2BBAA

Crystal structure and thermodynamic characterization of the ephb4 receptor in complex with an ephrin-b2 antagonist peptide reveals the determinants for receptor specificity.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
185
structure length
185
Chain Sequence
HHHHHEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and thermodynamic characterization of the EphB4/Ephrin-B2 antagonist peptide complex reveals the determinants for receptor specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ephrin type-B receptor 4
total genus 32
structure length 185
sequence length 185
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2005-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2bbaA00
2WN3A 3MV11 1W9TA 2C9KA 3CZUA 5G05L 2CDPA 2E31A 2J1VA 2WO1A 1J84A 4OUEA 2W9XA 2HLEA 2EIDA 1MPXA 3T08A 3THCA 4QDQA 5EIYB 1SDDB 2VCAA 2X05A 1WKYA 4ET7A 3LPGA 4D8MA 4P5YA 2EIBA 4P08A 3A23A 3THDA 2DDUA 1UYZA 1L7QA 3I3EA 2ORXA 4CU7A 1J83A 2BGOA 3I2HA 2YFUA 4XUNA 3C7OA 2XHNA 5B4XA 1JU4A 3WNNA 2VZPA 4P00B 2VZ1A 1US2A 1PMHX 2RV9A 1W99A 3I2KA 2QQJA 2W95A 1JYWA 3MBWA 3A7QA 2W1UA 4W8JA 1W0NA 3C7EA 3T2PA 4BK4A 1DP0A 2R7EB 1NAEA 3K4ZA 3C7GA 3W5NA 4UAPA 3FHQA 2VMDA 1UY3A 3CQOA 2XOMA 3CMGA 4A45A 3T2OA 3K4DA 3UETA 2J1UA 1JYVA 2DCJA 4IUGA 4GWIA 2PQSA 2VQUA 3ECQA 2Z4FA 4KI5M 2VQTA 3I2FA 4MOAA 2YFZA 2VMCA 4QX0A 3OG2A 2VC9A 2B4KA 4ARYA 3I2JA 2VOTA 3FN9A 1JZ2A 2RJ2A 5C71A 2Y64A 3C7HA 3P6BA 4CU6A 1EUUA 3FHAA 1GUIA 2XONA 4AAXA 1GNYA 4BJ0A 1GOHA 2V72A 1OD3A 1KEXA 2W1SA 1GMMA 5IJRA 4A41A 1GQPA 4ZZ5A 4M4RA 3WF4A 3SKJE 1W9WA 2J1EA 2WO3A 3OEBA 1UMHA 2JD9A 4PF1A 3PUIA 4CU8A 4XZUG 1KGYA 1O8PA 4CU9A 3WNOA 3J7HA 5DN2A 1EUTA 1TG7A 1W8NA 5IFPA 3C8XA 4QX2A 3ACGA 4UOJA 3VD5A 3OGRA 4DUVA 2CDOA 4DXRA 2Y6HA 2VZOA 2LW8A 3WQBA 3HJRA 3UNPA 5HPOA 1CZSA 1BHGA 2VZTA 3WF2A 2WN2A 3BN6A 4MGQA 4GZ9A 2HYXA 3WF1A 4CUAA 3DECA 4PQQA 3U37A 2VL4A 2YB7A 2W1QA 3BGAA 1LNSA 3JXSA 3T2QA 3OB8A 4M4PA 1XC6A 2BBAA 5CYYA 2WYSA 1W9SA 2VZUA 4LKSA 4QB2A 4QX3A 5LA0A 1UXZA 3NRUA 2W91A 2YG0A 1F4AA 1ULOA 3F2ZA 3VD3A 3T09A 1RYYA 1UYYA 1O8SA 1SG3A 5DQ0A 4E8DA 4LHSA 3FL7A 2VJXA 3WF0A 2Y6LA 3VD7A 1DLCA 3CDZB 3VDCA 2WABA 1JYXA 4QPWA 1JZ4A 1CZVA 2J1RA 4QX1A 1UZ0A 2QQOA 3EB7A 3NJXA 5B4NA 2J1TA 3W5MA 2OKXA 3EYPA 3LE0A 3K4AA 2VCCA 5LA2A 2ID4A 3CKHA 1H6XA 4DXSA 3MUZ1 1CZTA 3WSOA 3E1F1 2C26A 3ABZA 2W5FA 3ACFA 4W50A 4XVHA 5JMOA 2C4XA 5IFTA 1OH4A 3GGLA 2W3JA 2V5DA 3WNLA 4OMDA 5JR2A 1JU3A 4QDRA 1DYOA 1H6YA 3LEKA 1UY4A 4LQRA 2X09A 3OGVA 4HG6B 3UESA 2RVAA 2WAAA 1GOGA 2VCBA 1US3A 2VZ3A 4ZY9A 2WZEA 2VTFA 1K42A 3WF3A 4CUCA 4DUWA 1XNAA 4E8CA 2EIEA 3WNPA 3I3DA 3GDBA 1UWWA 3VDAA 1OT5A 3HNBM 3HPNA 1JI6A 5F7UA 4BK5A 4AG4A 4BDVB 4TTGA 3IB3A 4PT6A 4A42A 2YC2A 3A22A 1JZ3A 4RYDA 1PX4A 3K46A 3ACHA 1ULPA 3IAQA 2VZSA 2EICA 2WO2A 4JHZA 4MADA 4BXSV 4XURA 4D0QA 5C7GA 3WNMA 4A4AA 3VDBA 4MO3M 5I0DA 3PUHA 3I2IA 3HEIA 4XUQA 2QQNA 3LEGA 4P02B 5DPNA 5FUIA 4ZXEA 3LEIA 1K3IA 3VD9A 2DCKA 2QQLA 3D3AA 3IDAA 1WCQA 2BERA 3NJVA 1K45A 5HXMA 1O59A 4QB1A 5G04L 4JKLA 4XUOA 3ZM8A 2JE8A 2VZRA 1XNTA 3ETPA 4KMQA 3OBAA 1UY2A 2E26A 4JX0A 2KD7A 2E33A 2ZEZA 2BGPA 4QAWA 4DEVA 1CIYA 2QQIA 2VMFA 2YC4A 1R64A 1SHWB 3NNGA 3T0AA 5IYYA 2B9VA 3K75B 5JXJA 5LA1A 2WUHA 2J1AA 5A1AA 2VM9A 1OF4A 2J7MA 1F4HA 2L9LA 1YQ2A 1I5PA 2LS6A 3P1IA 4JKKA 3I2GA 2VZQA 2QBXA 1OF3A 2W1WA 3AC0A 4DEQA 2QQKA 3GXUA 4FI9A 3T0DA 3HN3A 4TXWA 1K12A 3HNYM 4XUTA 2J1SA 3CIHA 5JUVA 2Y6JA 2JDAA 3DYMA 2WQ8A 2ZEYA 1GOFA 1JZ7A 3DYPA 3I3BA 4RN5A 2XQXA 2VR4A 1CX1A 4DUXA 2VMEA 2WAOA 3HNMA 5J1XA 1W8OA 4W4ZA 2ORZA 1L7RA 5JXIA 1XPWA 3CZJA 2WBKA 4A6OA 3VD4A 2W47A 3T0BA 3WEZA 2Y6GA 3MUY1 1JYNA 3DYOA 1IQDC 4MGSA 1HN1A 4OZOA 5LCWL 4JKMA 2WZ8A 2Y8KA 2E32A 4ARXA 1D7PM 1T2XA 5JXGA 2W87A 5DMYA 3LPFA 3LQCA 1JZ6A 5JXHA 5EJZB 2Y6KA 4L0PA 4LPLA 2ZXQA 4A44A 5C70A 2X10A 5EJ1B 3SEEA 1UY0A 3IIIA 2ZEWA 2J22A 1UY1A 2BZDA 3OGSA 5IHRA 3IAPA 1UX7A 4KWUA 1JHJA 4OMCA 1PMJX 3A21A 4UI9L 1P8JA 1UMIA 3OEAA 2ZEXA 1NKGA 3I97A 4CUBA 2WDBA 2V4VA 1TVGA 1UYXA 4GWJA 4OYUA 4DXTA 2W94A 2JKXA 3K77A 5CZKA 3SEPA 4Z2AA 2QQMA 1JZ8A 3C7FA 4QDSA 2VO5A 3NQHA 3MV01 2VZVA 4QB6A 1NX9A 2W92A 4CVUA 4YPJA 3HOBA 3WNKA 1NUKA 1GU3A 3GM8A 3MO4A 4XUPA 3SKVA 4A3ZA 1JZ5A 1UXXX 4ZZ8A 2W46A 1PX3A 3ACIA
chains in the Genus database with same CATH superfamily
2RMU1 2JJ6A 3LSEA 3MV11 3ZDVA 5JOXA 2BPA2 1R092 1IPSA 1JMUB 1VAKA 3UKNA 2E31A 3PVEA 5KC6A 3PNAA 4I01A 3FC0A 5JSPA 2AC1A 4BZ4A 1LULA 2FCTA 1HDKA 2V73A 3H1MA 4V2VA 2DWRA 1AR62 1YFXA 2AREA 2ERFA 2JDUA 1XU2A 4CUGA 1OXCA 1VB4A 2QTWB 2K2SA 3UGFA 1RHI3 1VIWB 3OYWA 4L97A 4RS5B 3JD72 1RUD1 3OBRA 5KHKA 4HOOA 1WKYA 2IWGB 5CFDC 1QEXA 5JR7B 3SH5A 2CGNA 2IC1A 4GAZA 3VKOA 4NAOA 2JDMA 1VRH3 1J1TA 1H2LA 1LHVA 3KV5A 4Q4V2 5T5LA 1N1VA 3IDBB 2PHWA 5EV7A 4UT5A 4XZPA 3AKPA 4BPZA 5T5JA 5EWSA 3OYWB 4RS5A 2K46A 3ZSKA 2WFF1 4XFCA 5LBBA 3ZXGA 1QIQA 1S0JA 4Y1XA 2XJQA 2JIJA 3FUOA 4RHV1 3I54A 4BXFA 4NIGA 3IN9A 3M70A 4E4SA 1IOAA 5FP7A 3OUIA 5B4XA 4D6QA 1XNKA 3WDUA 5C5UA 4TSVA 3FWEA 1KDKA 2LROA 1W3VA 1U5YA 1WLCA 3O0VA 4XBNA 3ZXAC 2WS93 3E97A 3Q8EA 5FZFA 2OQ7A 1HIXA 1FPN1 4B29A 1X7NA 5DZFA 1HXS2 3W59A 4S2FA 4YW5A 1HB1A 2VD7A 3POEA 1LESA 2R30A 1QMJA 2GP5A 2OZ6A 2X29A 3SC7X 3PMEA 2WS92 3C7EA 4RHV2 4PQ9A 2ZMNA 3N3HA 4NRMA 2ENRA 2IVIB 1UQXA 2ZZJA 3LIHA 5FAXA 1NAEA 3EJKA 2GZWA 3K4ZA 4P9YA 5DUVA 4NHLA 2PHXA 4UAPA 1G6NA 4YM3A 5CFCA 2VMDA 1UY3A 5AC91 4GJYA 1R093 1WMDA 2XOMA 1Q8QA 1NCQB 4A45A 1C28A 1RC6A 3UETA 1YYNA 3M3IA 4YVWC 2RS13 1AXYA 1DCSA 3RI8A 5JI9A 4LO8A 2J1UA 2DCJA 2B7YA 1PZ9A 2BP6A 2CSGA 3WDTA 3FFZA 3VL8A 2OZJA 5EHDA 1QF3A 4NHMA 3OG2A 2UWCA 2VC9A 4GJZA 1MS8A 3BI3A 1HRI1 2OUHA 2YMZA 4JQTA 1JZ2A 1OA3A 2X5IB 1WW6A 4N43B 3SLIA 1RUJ3 1RINA 2JG8A 2Y64A 3C7HA 2VW2A 4FOWA 2O0OA 2PA7A 4HMZA 1AHSA 3VBRC 2FDFA 2I45A 1GNYA 4YM0A 4YVSA 4Y5Z0 4AEJA 1RMU2 2V72A 1RMU1 3W58A 4NPLA 4CXXA 3VZMA 5C8CB 2D40A 1WA6X 2W1SA 4QHZA 5LA1A 3H8XA 1ULFA 2X5IA 1GBGA 2AEYA 1F15A 2X5IC 1OLRA 1YRZA 3WF4A 4E4ZA 4MYEA 3KHBA 3U1XA 2WO3A 3OEBA 4YVSC 2VVFA 2ZX1A 3WX5A 5A70A 4XZUG 3HIFA 3HWJA 3RSJA 3B01A 2JG8C 1EUTA 1HB3A 4A2UA 5KC5A 4GXLA 3C8XA 1W28A 4MXWA 1JOJA 3O14A 2HWE3 3OBTA 3VD5A 3JBG1 1BEV1 3NKTA 1DF0A 4IETA 1HQNA 5BPXA 1AX0A 2CDOA 5BNPA 4FQ4A 4NAMA 1REFA 4HT1T 4Q4W2 4LNVA 1SFPA 4COYA 3HJRA 1W03A 1IZ3A 2VOXA 2OYZA 2B46X 3H50A 4IV3A 5DDJ1 4P9GA 5A7SA 3O1PA 1LENA 4MH0E 1HJFA 3WV6A 2GN7A 2Q4SA 2XKPA 1VRBA 4XYXA 4L99A 3SH3A 1UX6A 3UK9A 2ZX4A 5BNPB 1O91A 4KGQA 3EHKA 4CUAA 3DECA 4I30A 4FPLA 3U37A 4DPNA 3BGAA 5JZGB 4IE0A 4HN0A 4ZU5A 3KT1A 5K8SA 2XPJA 1OOPC 2GMEA 3LF7A 4K8FA 1YIPA 2VZUA 4QX3A 1XOYA 5LA0A 3NRUA 2W91A 4OCTA 1R082 4YFWA 2WZPP 3ZVXA 5GZGA 4HONA 1ULOA 3F2ZA 2D6KA 1FOD1 1Q8SA 4ASLA 1X33A 4WVZA 4YGEA 3T09A 3I2OA 1UYYA 1O8SA 4TYSA 4IEZA 1YQ6A 1S0IA 1SG3A 4XF4A 5GLTA 1DIWA 4ASMB 2Y6LA 5FLHA 3U78A 1N1SA 1DQ5A 3VD7A 3SH4A 1DFQA 2UWAA 5L36A 4L11A 1FAYA 1VMJA 1XSQA 2WNVA 3KQRA 3VGIA 4AI3A 2J1RA 2ZZQA 2ATFA 5KR7A 2BTVC 3AKQA 5GKAC 4CP9A 3ZYRA 4CDWC 3OBZA 1T6GC 4RS5C 3HQRA 1OQDA 2Y33A 3VBSB 5FMBA 5A7QA 4JGYA 1VBA1 4SLIA 3M8LA 3K4AA 2VCCA 2Y38A 4LOTA 5IVFA 4U2AA 4DXSA 5APAA 1SACA 1H9WA 4E2SA 1O3SA 4RR3A 1CZTA 3N9LA 2HWB3 3GJAA 3BIWE 2ZA9A 1GNHA 2C6SA 1OPOA 5DZGA 1LR5A 2YXSA 1H2NA 5JIAA 4Q4W3 1V9U2 5ANNA 1CD3G 5FY8A 1OD5A 1OH4A 3AK0A 2VBPA 3GGLA 4CCMA 5FXVA 2Q30A 2BGCA 1CAUA 5GLVA 3ZXEA 4D69A 5FY9A 4OMDA 4ZPIA 4OHXA 1DYOA 1KFUL 3AYCA 1UY4A 5FRAA 5CADA 4IV1B 2X09A 4NPRA 1WW4A 1IKQA 4IEXA 4TWTA 5CKQA 5J96B 3O1OA 1DYPA 4R52A 5LASA 5ABJC 4FOYA 5DAPA 3J9SA 2VZ3A 4P9JA 1YFWA 2RHPA 5LZ6A 2PLV1 2VTFA 2A70A 1Q5OA 2R16A 2VAUA 3AXDA 3VHPA 3ZXJA 1VJ2A 4BLIA 3WF3A 5BNOA 1XYNA 1RUC3 3ZSEA 4COWA 2AGSA 4CUCA 4DUWA 3N7JA 1XNAA 2PHLA 4LJHA 3ZMOA 2BU9A 1U5ZA 2NZ9A 3CU7A 2EIEA 2XG3A 3WNPA 5FYYA 4LBJA 3ZIWA 3LFMA 5FPUA 3VDAA 1EAH1 4IV3C 4OLLA 3ZFEB 3S7IA 1YJLA 4AI0A 4YFZA 4OVEA 4I0BA 4WZCA 2RDQA 4AG4A 5JVVA 4Q2FA 1RUG1 4XTMA 2P4EA 3O7OA 4I3PA 3L2HA 5FMOS 4TTGA 4FXGB 3GCWA 5EP9A 3FBMA 1SPPA 4QMAA 2JE7A 1Y9MA 5SV8A 3RS6A 4B8EA 1JZ3A 4CP0A 4NROA 3K46A 5T5OA 4QU1A 1KS4A 3S0MA 5FXXA 3ACHA 4XIOA 1X36A 3M3CA 4C91A 2YU1A 4YG0A 1ALYA 1ULGA 3ITQA 4X8PA 1SLAA 4HSJA 5C3QA 4UFIA 2WO2A 2PAKA 3NV2A 3T1MA 1HQLA 5FMDA 4YG6A 5E8AA 5ACA3 3WP5A 4NIAA 2W52A 1FPN3 2HWB2 2XJUA 3OPZA 5FBJA 3J8F3 5I0DA 1E5SA 3PUHA 3I2IA 1UCXA 1G9DA 4R9AA 1WMXA 3ZFGA 3KCYA 3B94A 3UKVA 1UOBA 4O9EA 3PHMA 1R1ZA 3GNEA 4JZRA 5D8AC 4CEYC 2GNMA 1NCRA 3EMRA 3LEIA 4ZU7A 1K3IA 2E7AA 3VD9A 4IGQA 1V9U1 2YROA 1RTVA 3AP7A 2BERA 4RA0A 2HWF2 2ZX0A 1H2KA 4EROA 3KT4A 3NJZA 1O59A 5J98B 4Q1RA 4QB1A 5G04L 4ASKA 1UU5A 3M3EA 4CCLA 2JE8A 1NCRB 2VZRA 2JKBA 2R49A 1S0EA 1ZVFA 4QU2A 1OFNA 1Z7S3 4LTAA 2MNGA 4GB32 4GMP3 4KMQA 5D1IA 2A3YA 1UOJA 2DYCA 1A78A 3MIDA 4QGLA 1HQWA 2V09A 2LRPA 4CZSA 4W6XA 4DOUA 2D6OX 1WD4A 4OI2A 4JV4A 2ZGPA 2WSUA 2BGPA 1ULCA 2XVKA 2D5HA 4URAA 1CIYA 2YC4A 1F35A 3ILFA 3RYPA 1SHWB 3T0AA 2G1MA 2VUAA 5IAVA 4AEMA 2B5HA 2WWJA 5CKMA 5H9QA 1W3XA 4Q27A 4IE6A 3VDDA 2MEV2 2VM9A 3TWIA 2A7AA 3N7LA 1G9FA 2A1XA 3VZJA 3S57A 3I4IA 4JKKA 2WSVA 5T50A 3P3PA 5FYHA 2VZQA 1QXPA 1TMF3 1XU1A 1H4HA 4N53A 5FQ0B 1IS3A 3TNPB 3WD5A 5JCTA 2W1WA 5AFBA 1JOBA 4Q4Y2 1VBD3 2QQKA 3GXUA 3QH7A 5FYZA 3DCQA 5I8SA 3WDWA 5BNQA 3U14A 1AL21 4NJ4A 5FK7A 1BEV3 5DUXA 1LOCA 1YHFA 3MIBA 3J8F2 1ODMA 4HKLA 3CIHA 2TNFA 1OQEA 2JDAA 4MZUA 3ZN6B 4L9BA 3ZO0B 2NPIA 4CPBA 3MEPA 1DU3D 1AYM2 3H3ZA 2A6VA 2TEPA 1AR93 1ZRRA 2A6WA 4DUXA 1SCRA 2A71A 4M0NA 1WGPA 2JG8B 3HNMA 5J1XA 1JODA 3ILRA 4W4ZA 1PO23 1QGLA 3LA7A 1L7RA 4PLMA 1C8M1 2ILMA 1C8M2 4ZHNA 3VBUB 2HJIA 1U0AA 2VU9A 1H4GA 2F4LA 2RM22 4PF5A 5L7OC 1V6LA 3WEZA 2Y6GA 1B09A 3UGGA 1LGBA 1V0AA 3MUY1 4CDUB 3DYOA 1YEWA 5FO8B 1FMD1 3ZR6A 2WR9A 4P5HA 3CHXA 2AEZA 4MGSA 5KHJA 2UU8A 2WZ8A 4B1MA 2Y8KA 4PDWC 3WUCA 4BE3A 2RM23 1MQTC 4FPHA 1WLTA 2XUMA 3PVNA 1A34A 1ST8A 1QJY1 1UOGA 1T2XA 3KLSA 1DLLA 3M7AA 2E53A 2QCSB 4RGGA 3IDCB 5FZ1A 1AXZA 4D7YA 3DF0A 5FKCA 3VHNA 2Y6KA 2XBO3 1QDOA 4XF9A 4Y1YA 1ND2B 4UBHA 3NO8A 4FTSA 5L73A 1RUF1 4IEVA 2OA2A 3AL5A 5CU1A 2DCTA 4QQPA 4CDXC 3RZGA 4XF3A 2J22A 1O3TA 3HT2A 3O0WA 1I9RA 1COV2 1PK6B 1VBA3 4M00A 5IHRA 4LBMA 4M3CF 4AI9A 4Y20A 5KXBA 3WDXA 1ZA4A 4QD2A 1JHJA 1QNWA 3QD6A 2RDRA 2H0BA 4XDOA 4IEPA 4NWWA 4Q8LA 1P8JA 2DUOA 3ZFFB 1MS1A 3AZVA 5F32A 2RJLA 2FDJA 1C4RA 4AGGA 3OEAA 4MGKE 2JEMA 2C24A 1VE0A 2VBDA 2GU9A 3H1YA 3O5SA 2G4IA 2V4VA 3AFGA 4AI2A 4AR2A 3MW3A 2Y26A 4U36A 5A33A 1BYHA 3H3LA 4GWJA 3NNJA 2WLQA 1FYUA 2BOIA 2GC2A 4JGZA 1LOFC 1GNZA 4MUVA 3GZUC 3OPWA 5A1LA 2BVVA 3UT0A 4LBKA 3HD8B 5CZKA 3SEPA 3OUHA 4Q0UA 5BUVA 2AH2A 3CL1A 1VBE2 5EYXA 3OPTA 3FLPA 1ND3A 1PO22 2WFPA 1MS4A 2HKXA 3NQHA 4IE5A 5C8CC 5F6LB 4QB6A 1NX9A 2P2KA 4CVUA 3HOBA 1VB2A 4QT6A 1RUE3 3V56A 3GM8A 4GIQA 4XUPA 3WNKA 4RQPA 2LALA 5F5IA 3I8TA 4X6RB 1RUJ2 2KA3A 4R9BA 5IVBA 3H7YA 2W46A 3ACIA 2BNMA 3MF6A 4UW4A 4E4HA 1LAJA 2WT1A 3O1TA 1V00A 3O0XA 2WJSA 4PIXA 3NV3A 1YQ8A 3ZDSA 1W9TA 3JU9A 2CDPA 4ZS2A 3BPZA 3N9OA 3V0BB 3I49A 1EAH3 4IXLA 3WP6A 2WO1A 1J84A 4W65A 3N9NA 1X9TA 4L92A 2VPVA 4OUEA 3ZFGC 1CPMA 2ZMLA 4QPGC 1H2MA 1WUVA 2MPFA 2W9XA 3PIJA 3WCRA 5C4WC 5IATA 3MLKA 2XDVA 3WQ1A 1O4ZA 3DXTA 3WG3A 4XFIA 4LBQD 1EV12 2EIDA 1FATA 3VKFC 3V0BA 1QWRA 2IXLA 2EIGA 5EIYB 1SDDB 2FD8A 3J7NA 1MZ5A 2PHTA 2RS51 4MV2A 2NLRA 5A3WA 1J3QA 3MIFA 2Q1FA 2RDNA 4PBPA 3VV1A 1ZM1A 3B9CA 4P9WA 5K9YA 3MF9A 1EV13 1W8FA 4D8MA 4YNIA 2EIBA 3FJSA 2QZ2A 5FP3A 1APNA 3Q8CA 3KWVA 3POGA 2JG9A 1OUSA 1J3RA 2WIIB 4E2GA 2ORXA 1UD1A 2P3KA 2VUCA 3PJYA 1VMFA 4WM7C 3PUSA 2V5YA 4AGVA 1J83A 4COUA 2BGOA 3I2HA 2CAVA 2NM1A 4RGKA 2YFUA 3NVCA 4KU8A 1NZCA 1Y9GA 5HV0A 5ABJB 3KV4A 4FT8A 3IT8A 2W68A 4AK3A 2WQZC 2D6PA 2JG9B 2R6QA 4HANA 3Q9OA 4XCBA 3RPQA 1OVSA 1PMHX 1VBE3 2XKOA 1QOOA 5F6KA 3WG4A 1MEC1 2OXBA 1AYN2 1W99A 3T4VA 4EV0A 3AFKA 4LORA 5A3TA 4OHYA 5C3SA 3ME2A 4EWEA 5FZIA 5FREA 4EWDA 1E5IA 4W8JA 1W8TA 1D0GA 2E7TA 1W0NA 2VECA 5ABJA 4KBBA 2R0FA 3SNMA 4Y5SA 4Q8KA 2XLFA 4LIVA 3C7GA 1W6NB 2GMPA 3VBUC 5L9RA 2ES3A 2VG9A 4IL7A 4J1WA 2GNDA 5F5AA 4PI2A 1GFF2 3CQOA 4D6RA 5IVEA 1S0FA 1YUDA 3MHZA 3ZPOA 3INAA 3ZKUA 1AX1A 5C5TA 1LGNA 2VXRA 3R4UA 3WLUA 3AZZA 2QUOA 4BWOA 1URXA 1S2KA 4PIZA 1PM4A 4GWIA 2PQSA 2VQUA 4KI5M 2VQTA 5C8WA 3PJQA 4MOAA 5DG1A 2VMCA 4QX0A 2XJSA 4Y1VA 4ZS3A 5LY2A 1CVNA 2XH6A 1D4M1 3CJIA 1NQDA 3FHIB 3BTYA 5IK4A 3RWKX 1VBC2 3P6BA 1Q43A 1BBT3 4GALA 1SLBA 3D0JA 5A6ZA 1UF2C 4K8RB 4JGYC 5FJHA 1KEXA 3I59B 1TZOA 3D82A 4META 1GMMA 2DU0A 3KD4A 4MGIE 1XQNA 1G86A 4CDWA 2BFUS 4ZZ5A 1V70A 3POFA 5J09A 4LBNA 4ITCA 1DGLA 3SKJE 1PVC1 5FO9B 5JWPA 2YPDA 2VW1A 4CRQA 2R073 4PF1A 4AFBA 4AQ2A 1AVBA 2YPJA 4NR1A 1KGYA 2FCVA 4DB5A 1AR91 1LHOA 4M3CB 5IVJA 4BM8A 4AVAA 1PM7A 4QX2A 1M4WA 3ZFEC 2ZHNA 3ACGA 1PO21 1XRUA 2P6HA 2BNOA 3ZN5A 1JUIA 2RS33 2C9AA 1WMFA 2IXCA 2VMIA 2VZOA 2Y6FA 4LUKA 4QKDA 1QXRA 1VLNA 2AUYA 4RL7A 2UYBA 2ZHKA 4YGBA 4NHYA 1WCDJ 1GQGA 3AVRA 3S6PA 4AW7A 2W08A 2YBSA 5HPOA 4TLGA 2VZTA 1UNBA 4QKFA 4BYYA 4N53B 1PK6C 5FQ0A 2HYXA 4AVBA 1ZX5A 4N9HA 1NQJA 4Q4Y3 3EO6A 1LNSA 3PU3A 1FT9A 2VNGA 4MHUA 4UFHA 1S0GA 3ZYPA 1XC6A 1LODA 2P5BA 3KHCA 1UXZA 4BIOA 5FYIA 1X8EA 2RE9A 3KV6A 4XC9A 2WNUA 1ENRA 5H9PA 1KS5A 1YQCA 3VD3A 1RYYA 2WNEA 4H7MA 4KGGA 4NO4A 5DQ0A 1W06A 2XJTA 2AZ5A 2XL9A 3PUAA 1OLME 1S2EA 1AYM3 4HVOA 1DLCA 1AR92 1JBCA 1RVF2 3ST7A 4JGYB 1Q56A 1TNFA 4MHRA 3VDCA 4AFDA 3TN91 2TUNA 3I3MA 1CZVA 1PVC2 4FPCA 3H1WA 4QPIA 2UWBA 5HCAA 1WWYA 2WO7A 3LKJA 2VNOA 3PTYA 4I3GA 1ODNA 2QQOA 3LD8A 4OFGA 4Q4X3 2HYKA 3URFA 5CAZA 3EB7A 5DAQA 4BQXA 4GKXA 3RGBA 2ZABA 2OKXA 1JW6A 2X8KA 2D6LX 1RXFA 2Q8EA 4B4RA 3LE0A 4LO7A 4RGAA 2HWF3 3CKHA 5T3NA 2WZR3 1ND3C 4NRPA 2BNNA 2D7FA 3D8CA 1CN1A 1LOAA 3ZXLA 4AEDA 4IQPA 1MZEA 4TN7A 2DCZA 4JTNA 5AVAA 3E1F1 3NAPB 1JN2P 2WA4A 4JGZC 2W5FA 5DG2A 4XJ9A 4XVHA 1W2UA 3KSCA 4K6BA 3ELNA 5IFTA 5JDBA 1RUE1 4QQHA 3TYJA 2Z5WA 1OMIA 1BCXA 1AR61 2CGOA 4W6WA 2V5DA 4Q29A 3WNLA 1IPJA 3RYKA 1NXMA 5JR2A 1JU3A 4PBOA 1YFUA 4YG3A 4OI1A 4LQRA 5A32A 1VP6A 2VUDA 2ZGQA 5LBCA 3OGVA 4Z07A 2WWUA 5FUPA 2XUEA 4BQ1A 1RVF1 4O7XA 5CVRA 1HXS1 3SMHA 2VUJA 2MEV3 4AVTA 4I02A 4AEKA 2RVAA 1CAXB 3QH6A 3ZFFA 3RQ0A 5CEHA 1LU1A 2QQPA 1NLRA 2R32A 4LA3A 1AR81 3Q8AA 1V6NA 4DS0A 4HVQA 3B93A 3ZYHA 1K42A 1SFNA 1ZRDA 1L7LA 1DQ1A 4Y22B 1HB4A 5DZEA 4AL9A 2JE9A 2O1QA 2WFF2 4BB3A 1OLQA 4ZKTB 2RS53 4LA2A 2G19A 4CE8A 1BVP1 4EN7B 4KG0A 4YM1A 5A7OA 3RJRA 5F37A 3J26N 5L9VA 3MDPA 3I3DA 1DGRN 3PURA 1UWWA 4XQDA 3DPRB 1PO11 5F3GA 3ZSLA 5JOWA 1ND3B 2XJVA 1JI6A 4V1PA 3DV8A 2OPWA 3WUDA 4QPIC 5EPAA 2TBVA 5BNNC 1Z0HA 4XF0A 4Y22A 4QM8A 1PHMA 5FYMA 4IEWA 2ZX3A 1EPZA 1YI9A 3B69A 5C3OA 3AYAA 2YC2A 3A22A 3MFCA 3ES1A 1W0PA 3ILNA 2MHFA 4RYDA 1PX4A 3HR9A 3WW2A 1SMVA 2ZGRA 4D7SA 3WP4A 5C33A 1CJDA 5CFDA 1X82A 2DFCA 1IS6A 1TME2 1ZZCA 3IAQA 4S2DA 5F3EA 1DQ6A 4S2GA 4YSFA 1SBEA 1R081 1ZBA3 4MADA 1LOGA 4BXSV 2ZAHA 3DUIA 1SDWA 5C7GA 3TNQA 4Z82A 1VBE1 4LITA 1QJU2 4A4AA 3VDBA 5SV5A 4XBQA 1C1FA 2VTXA 5IW0A 3MW4A 3OD4A 4WVWA 1AXKA 3HEIA 2BDRA 3BYWA 2QQNA 4HBNA 2DUPA 5EXOA 2D98A 3VKLA 3LEGA 4FFIA 1W2NA 1C57A 4P02B 5HV4A 3HN1A 3G6JB 3O1UA 3TEXA 1OHFA 4E9KA 4WM7B 1FMD2 1JYTA 2QQLA 2RR12 4V2WA 4P9XA 3H7JA 2ET1A 4A7YA 4MGTA 5H9RA 2PXJA 3UKTA 2ZGLA 3KVAA 1VBB1 1D4VB 2QFEA 3T30A 1HN0A 1XE7A 1DDLA 1SBFA 4N53C 1EPWA 2W39A 1V6JA 2CHHA 1Z78A 4H55A 4EYUA 1A8MA 4XABA 2VOVA 3CF6E 4AQSA 3ETPA 2Q8CA 2ET7A 4FSJA 2IFRA 2YDEA 3BKZA 4XMIA 2IXHA 3T4HB 3WP3A 2E26A 2OS2A 2QDNA 5E89A 1Q8OA 2KD7A 3OUJA 1Y9QA 5BV6A 1NCQA 2CAUA 4YZ2A 5KXCA 1W6MB 2KR2A 4QAWA 3IDEA 2HWE2 5I0RA 4F3JA 4DRVA 3ENRA 3NNGA 3PVOA 1BXHA 4CCDA 2CYFA 3BCWA 2VW0A 4Y1ZA 3K75B 3RRDA 5BNNB 1PGSA 2GALA 4UXAA 2J1AA 1W9FA 5LRRA 5A1AA 1AYN3 1OC1A 5C3PA 5F9TA 4IEOA 3P1IA 1E5RA 3OSDA 4J6GA 5GJ6A 2ZHLA 1QQP2 2E7QA 3APBA 2R071 4L8QA 1MEC2 5LB6A 3RFRA 3ZN6A 4FI9A 4FPOB 3T0DA 5FXWA 2WL1A 3DKWA 4LMFA 3AKTA 2F4PA 2D43A 1TME3 1YO8A 3SHRA 3X29B 3AJYA 4CDQA 4YZ1A 2NN8A 4AHZA 4LBQB 3KQ4B 1DGWA 4BLJA 2EVXA 2ZOEB 1RUH1 4F8AA 1QJU3 3KGZA 2RG4A 1BZWA 4XUTA 1A3KA 1WLWA 1GZWB 1AZDA 3H3UA 1TNRA 4F7ZA 5FPBA 4LLOA 2EA7A 3DYPA 3UGHA 3NKGA 2IUWA 2VR4A 4DY5A 4KQ7A 4FTBA 4FOQA 1I3HA 4MXWB 1BKZA 3PIGA 2VCMA 1HKDA 2WAOA 3AP9A 2XGXA 4LKEA 4CDUA 2RR13 3VBSC 3RWNA 5EQUA 3BALA 1QJZA 1MS0A 2ORZA 1H30A 2PHRA 4LIUA 4UF0B 4XFGA 1LTEA 4DO0A 1I1EA 3CZJA 1CQ9A 1Y7BA 2RDSA 1RIRA 5A33B 4A6OA 3FMGA 4EZ4A 2HWC3 3PTRB 2GNTA 2QKDA 5FZOB 3AM2A 1YC61 1U5IA 4LXLA 1X50A 3E6BA 5FPXA 2E63A 5FYBA 1YNAA 1H1AA 3AMNA 1NXD1 3PUQA 1LKNA 4M3CE 1IQDC 2WT2A 3AMHA 4JKMA 3V0AA 1KJRA 4AI8A 1OURA 4ARXA 1D7PM 1OLMA 1GZ9A 1O4YA 1Y43B 3MLJA 2JG9C 1AR73 1J58A 4BH9A 5JXGA 4YW4A 4LKFA 4QXKA 2DVAA 4AFAA 1GANA 1JZ6A 3AP5A 4N7IA 1PIV3 3WINE 4FPEA 2X53S 2HWD2 4IW3A 1GWMA 4LPLA 5F1RA 1G7YA 2ZXQA 4KG8A 1C5IA 5EJ1B 4JVAA 2YHJA 3TRSB 2GH2A 3LDKA 1YXWA 2ZAAA 3IIIA 5FMOL 2PAEA 5D8AB 3TEYA 2BZDA 1AJKA 3KVBA 4HXCA 1CR7A 4IE7A 3NMBA 3RZKA 4N7UA 4DY3A 2HWD3 3KCCA 2KM2A 5JI7A 3LIGA 5A7WA 1NLQA 4FPJA 1W6PA 4CEWB 3FX3A 2WZR1 4CCEA 3Q8FA 3UL2A 1A6CA 4HKOA 3P5BA 4OMCA 1N3QA 1PMJX 1RUI1 2VGDA 3VZOA 3LZZA 4LOSA 5FZMA 5FOJB 5IK7A 4M0HA 2NMOA 5C3RA 3VBHB 5JMCA 1ZZBA 4LHLA 2ZEXA 3ON7A 1NKGA 2UY8A 3AMQA 4M01A 1ZRFA 5A7WB 4CEWA 5L19A 2QE3A 5FZLA 3GYDA 3RG0A 4AHWA 4CCJA 1UYXA 2QJVA 5CKNA 1ZBE1 1W8WA 3ATGA 1NE4A 4XFFA 3THTA 4EWAA 3LSDA 5FK8A 2R043 1IS4A 1OH3A 2JKXA 2PHDA 3SISA 1TMF2 4XXAA 2QQMA 5KHGA 2ZACA 4LLFA 4C0HA 3C7FA 4QDSA 1RVF3 1ASJ1 1HXS3 2VVDA 3FUQA 2NMNA 3P3NA 5FZ0A 1H0BA 2PYTA 3WY6A 5F2WA 2W92A 2ZGNA 3KB5A 3WW4A 1NUKA 1GU3A 1F2NA 1AR83 3BTAA 1OBNA 4C8DA 1JYIA 4Q4X2 3ZYJB 4FAHA 1UXXX 4QXHA 1LOFA 3R4SA 3RJ2X 3VL9A 4UW6A 4DZGA 2P3YA 2YC0A 3S5QA 1MVEA 4IEUA 1HLCA 4OI4A 2DBIA 2C9KA 2YGMA 2ZHMA 5G05L 1GICA 3CJXA 3PMSA 2RS12 5CNAA 3V64A 5K0UB 2AACA 1NE6A 1PO13 4OUSA 3BUCA 1YI7A 2J1VA 1S2BA 3EQEA 4JTOA 4EN6B 3AB0A 1RJ8A 3OGJA 1OPMA 1RUD3 4GH4B 1YCIA 1FOD2 5FYUA 1NG0A 5IVCA 2JDNA 1VRH2 3B3QE 3J4UH 3IBMA 1VRH1 1MPXA 3OJBA 1JHNA 1GZTA 5FJKA 2PN5A 5K0UA 5KWRA 4QDQA 2VCAA 3N7KA 1F31A 2X05A 1W6QA 3OY8B 5CISA 1OOPA 2ADEA 3H8UA 2OQ6A 2XXZA 5IK5A 5A80A 3WW1A 3O1RA 4NUBA 1TQ5A 4CCKA 4ET7A 4HK9A 1O3RA 3PLQA 1BJQA 3OCPA 3MIHA 4XJZA 5FDBA 2QQUA 5CIRA 1PNFA 4UYBA 2BYVE 4CCCA 4Q0VA 1QNYA 3A23A 3H0OA 4C1WA 5DAXA 4YYOA 4CDXB 5FYTA 3THDA 2DDUA 3B5LB 3OY8A 3I3EA 4ISRA 4P14A 1H8VA 4Q0SA 4HKWA 4OHVA 5FKBA 3KF3A 1O5UA 4JC1A 1MZFA 2WS91 1QOSA 4YVSB 2BFUL 2GMMA 2XJRA 4XJUA 3WNNA 3BTZA 4R8HA 4WM8C 2WLPA 2VZPA 2WFF3 3KMHA 2VZ1A 4CDWB 1HV1A 4RHV3 1VBB3 5J7MA 1TEIA 4CXWA 2P17A 3I2KA 1IPKA 5A1FA 2W95A 1BVVA 2WA3A 3A7QA 3I3QA 1PGW1 1XNBA 1M06G 2W1UA 5FY1A 2BUKA 4YW2A 3POSA 1R091 3UJQA 3ZYGA 1EP0A 1LOBA 4BK4A 4E4DX 1DP0A 3OF1A 1VBD2 2BW8A 1EY2A 4Y4YA 2R7EB 5T52A 3K2OA 4FOVA 4FXKB 3FHQA 4IGOA 1N1TA 1LHNA 3RZJA 3CMGA 2ARXA 2PAMA 1CAWA 2BEOA 1JXNA 1O5LA 2ZCWA 2VOKA 5GZEA 1VALA 4FPFA 3WHTA 2GDFA 5GZFA 3ECQA 1RUJ1 2Z4FA 4Z2WA 5IAXA 2YY1A 3KM5A 1LHWA 1HJGA 3ALQA 4DRRA 2B4KA 3EBRA 1QJEA 4QX7A 3I2JA 2OT7A 3N9PA 4P9LA 5K7PA 3FN9A 1NA1B 3VBOB 2RJ2A 1RHI2 3PU8A 2A6ZA 3JUUA 3L2YA 3GJBA 4YW7A 1LB2A 1WCKA 1QU0A 4YVWA 1GLHA 3GBGA 1GUIA 2XONA 4BHPA 3G7DA 1HRI3 4AAXA 2EXHA 2A73B 4BJ0A 1QJX3 1GOHA 2UY9A 1OD3A 5KXDA 2VULA 1QJY2 1QJU1 1NA1A 5IJRA 2XMLA 3VBOA 3AZXA 4IV1C 2FBEA 3ZX7A 1NA1C 3VBOC 2FCUA 5A3PA 2WC2A 1FXZA 5DXDA 3AYDA 1RMU3 2B9UA 1VPHA 2XLAA 2R061 1EYBA 4JQRA 1O8PA 3IPVB 1SCSA 3RZLA 3AMMA 1GP4A 3J7HA 2VH9A 4XE9A 1PGW2 5IFPA 5JXIA 3LWCA 1ASJ2 1AX2A 1MR5A 3JBG2 5DDJ3 1F8VA 3OGRA 3NAPC 3N7MA 1YQ5A 3BU7A 4XHXA 2Y6HA 4BIFA 2BWCA 2LW8A 3VBRB 3DGTA 5A3MA 1A8DA 3RMYA 3JB8A 1CWPA 3IPVA 4YZ4A 2RJKA 5EZWA 2PTMA 3BU0A 2HWE1 4RFT0 5F2SA 1OVPA 1CZSA 3JBG3 1BHGA 1N1YA 3WF2A 1WA4A 1UZWA 2GSYA 5D21A 3BN6A 2QNKA 4GZ9A 2VQ0A 4CEYA 1UU6A 2JDHA 5A7NA 4PQQA 3T3YA 2D5FA 2QDRA 2VL4A 3WNXA 5A3LA 3JXSA 3T2QA 1AR71 3O1VA 1IQAA 2BBAA 4M4PA 4AFCA 2IXJA 5F5CA 1PGL2 2WYSA 3D0SA 5FZ3A 3FBYA 4QB2A 4UFMA 5FP4A 3VBHC 4AYUA 1MVQA 2OIIA 2PMWB 1F4AA 3GZTB 2GC3A 2A6XA 2FQPA 3IKWA 4Y33A 5T5PA 4QGNA 1BMV2 1H8TB 2FZ2A 2O8OA 1UL9A 3B7MA 4LHSA 3FL7A 1DGWX 2VJXA 3F95A 3IZOA 1B35C 3PDQA 3QOPA 2HWD1 3WF0A 4WM8A 1PK6A 1SLLA 4BOWA 4QQOA 3NWKA 4XETA 5TSWA 4NIDA 2PHFA 2WABA 4Y20B 4QPWA 3RZMA 1KRIA 1W90A 1ND2A 4QX1A 4YRDA 1ZBE2 1UZ0A 1QJFA 2B42B 3EXUA 3WZ1A 1QXJA 2EXJA 3CBNA 1W9YA 1ZA7A 4JDNA 2HWC2 3ZYFA 1ULEA 4PI0A 5E16A 1CAVA 5FV3A 3ZR5A 2AYHA 3W5MA 4AVCA 4HN1A 3EYPA 5F8PA 4F83A 2D3PA 3ZFEA 2HWB1 1MQTB 2BRTA 1ZBE3 2P1BA 3AJZA 5FZHA 1QH6A 1XNCA 2ID4A 2R041 5LA2A 1NY71 4Q4W1 1H6XA 5A6YA 2Z42A 3DPRC 1LEDA 1N3OA 2CNAA 3MUZ1 4JGZB 1UMZA 4LO4B 1FPN2 1ASJ3 3ZXDA 4O61A 1AR72 3KS7A 1BBT2 3ACFA 5JMOA 1PGL1 4ISQA 3HMYA 2YGLA 4AWDA 2LUWA 5CBLA 3TB0A 3ASIA 2ZPXA 4COZA 4QPYA 2F6BA 4NVPA 2W3JA 4QX5A 5JLVA 3OTFA 4QQLA 5CG8A 1GP5A 2DU1A 4MGYE 4BMBA 2R0HA 1QOTA 3E6DA 3WQ7A 3LEKA 1Y4WA 4TZDA 2I07B 2A5ZA 2VQAA 2PLV3 3CJIC 4Y24A 3ZFGB 1H9PA 1LECA 4HG6B 4N9IA 5JZGC 5H9SA 1V6IA 3RYRA 3VZNA 4RQPB 1RUC1 2WAAA 1GOGA 2C1FA 2VCBA 4KU7A 4CCOA 3VBHA 3VB9A 3SXWA 1H1IA 5EJ3A 2IXIA 1FNYA 1Z7S2 4ZY9A 3AMPA 4HK8A 4CXYA 4FP3A 4IESA 1FV2A 2RS32 1WZXA 3LGRA 2HBUA 2B39A 1H8TC 4EZHA 4TLFA 3JQXA 1WMEA 1GWKA 2BJSA 4GMP0 4E8CA 4IEYA 1X8MA 3B00A 2DV9A 2EXIA 5LW9A 3TBDA 4QX8A 4MGZE 4YARA 2Q5TA 2WWSA 1SLTA 1GWLA 1Q8VA 3HNBM 4GULA 4L2NA 1ZYBA 5T55A 3BVCA 2ETEA 3ZPYA 3SCFA 5CFDB 1ACCA 1DQ0A 2VNVA 5HI0A 3BOPA 4Z8BA 1STMA 2W0XA 1UKRA 4Y26A 4BDVB 4CEWC 4CP1A 3IB3A 1WD3A 1HW5A 2BOJA 1W6MA 4HETA 1CJPA 3WHUA 3BPSA 2ZBJA 3QACA 4QQ2A 4PIYA 1K5MB 1SEFA 5FFOC 5KHIA 2Q1MA 5ACA1 3LCPA 1CONA 1COV1 3KZ4C 5I8TA 3HT1A 1RUG3 1XYOA 1XB9A 2VZSA 3OOXA 4HZFA 1GZCA 3E5UA 3HQUA 4Y5TA 5K4LA 1GKBA 1HX6A 4NN0A 4WM7A 4NE9A 4QKBA 1K5MA 3WNMA 4AAPA 5LK7B 1G9CA 2VTXJ 4UW3A 5FZAA 3U75A 4XUQA 1R1A1 3DKQA 5ERLA 4BQWA 1V9U3 1AUYA 5FIXA 5DPNA 3IMNA 1RITA 4MLOA 5AVPA 5JPNB 2FMDA 4JDOA 4CDQB 4S2HA 4ZXEA 3J8F1 3O1MA 5C9AB 3AX4A 4XF1A 3W21A 1OOPB 1K5MC 2D97A 1D4M2 3LB9A 5EYYA 5FZCA 1UU4A 4OQ9A 5F3CA 1RB8G 4XCAA 1Z7S1 3NJVA 1K45A 5HXMA 5JOZA 1LJ7A 1C3HA 1OA4A 2G9ZA 5FY0A 4JKLA 5BNPC 3IWZA 3ZM8A 4PJYA 5C4WA 3AXEA 1W0OA 1XNTA 5FYCA 5C9AA 4AFMA 4SBVA 5LK5A 3E6CC 1QH7A 1W6NA 2R072 3OBAA 4Q1PA 5FZKA 3BIEA 3LA2A 4B7KA 5LBEA 4NWVA 1FI2A 2P3IA 3ES4A 2E33A 1LU2A 4I09A 3TOJA 4ONUA 4WVMA 4GMP1 2VMFA 2QQIA 5C4WB 2WT0A 2D3RA 3N36A 5J3UA 3IM0A 2E6VA 2JB4A 4BQ2A 1QJX1 5FZGA 3NW4A 2B9VA 1RUI2 2CGPA 5JXJA 2ADDA 2WUHA 3ACLA 3H9AA 1VBD1 1KJLA 1OF4A 4LHNA 4K7JA 2L9LA 5C8CA 1D2QA 5JPMB 3VHOA 1AL23 1LOEA 2BQPA 2QBXA 3U4SA 1AL0G 1BEV2 5KBFA 4UFLA 3C2UA 2R063 5DUUA 1GZWA 3BODA 3NJYA 1MS5A 2DVBA 2Z69A 4TXWA 5JZGA 5DABA 1UIJA 1FNZA 2JWPA 1TMF1 2JDZA 2XWJB 5FZ4A 4JHTA 5LEJA 1ZREA 1WLDA 3WR0A 4NPMA 1F5JA 1PZ7A 3HNYM 4JDMA 2OUJA 2WQ4A 2J1SA 4D6SA 3GBWA 3DYMA 2WQ8A 2ZEYA 2IZWA 1JZ7A 4M3CA 3I3BA 1C8M3 1YWKA 2P34A 1FX5A 1ZZ6A 2ZGSA 4QHOA 3VHRA 1DZQA 4HVRA 3THPA 2VMEA 3LEMA 2GAUA 1W04A 2JDKA 2GH8A 5IK8A 1W2AX 1W8OA 1BK0A 1XPWA 3D4KA 5E1RA 3N9QA 4XACA 3CNAA 3QBQA 1HRI2 1OI6A 2Z79A 4NIIA 1S55A 2W47A 4X6QB 3T0BA 1BLZA 2RM21 3E5QA 1XNDA 5FPAA 2CWSA 2XQRA 3NV1A 4E27A 4QM9A 1QJY3 4XOGA 3Q8BA 4XPVA 1JYNA 1RUOA 4YLZA 1RUF2 5A3NA 3PVBB 3I7DA 4OZOA 5LCWL 1DQ2A 3M3OA 3PL0A 5T54A 1ND2C 4Q4V3 4PDWA 4R9CA 4FP2A 4CPBD 2XBO1 4YGDA 4UW5A 4EN0A 1ZRIA 5FZDA 1EAH2 4RR3B 2FDGA 1FMD3 1RUF3 2W87A 4ATEA 5DMYA 4RSUA 3LQCA 4AHYA 5ISLA 1E57A 5JXHA 1B35A 2HEVF 5EJZB 5L7OA 3POJA 3SITA 1GR3A 5C70A 2FDHA 2X10A 3SEEA 1UPSA 5FPZA 4PDWB 2CV6A 3L9JT 4WVVA 3TEZA 1AL22 2HEWF 2HH9A 4ES9A 1J1LA 3R0RA 2H6BA 2YUEA 1VBB2 4K20A 2WNVB 1UX7A 4C90A 4DXZA 2VMHA 5J48A 4YGCA 1HV0A 4ZONA 1WCUA 1UMIA 2KXLA 2YZ4A 4YZ3A 1NOVA 4AQTA 4XW3A 1W6OB 3ROUA 2I2SA 3ZKYA 4CUBA 5I0SA 1K5JA 4JCKA 3WDYA 2WDBA 1TVGA 1DZRA 2RMU2 1ZNPA 3HVDA 3UJOA 5FTTC 2RS52 2R1BA 4OYUA 1V6KA 5EFUA 5I93A 1S0DA 4XXPA 2Y0IA 3K77A 4NRQA 3V65A 1RUE2 1W8HA 3NAPA 4Z2AA 5GZDA 2N7GA 1JZ8A 2JDYA 4HL0A 4QGMA 2Q0AA 1OKQA 1RL3A 1WW5A 2VZVA 5I0TA 3MIEA 5C9AC 5ANQA 4YPJA 4HPKB 3VDDC 1DG6A 4MSVA 3DN7A 3MO4A 4H3WA 4OUMA 4LBLA 4MX3A 2JX9A 3AVSA 4A3ZA 5A6XA 2WRAA 2XR4A 2LM3A 1UO9A 4IEQA 1JOPA 2G9FA 4FO9A 4IV1A 5IT6A 4LUMA 1W8UA 4XJ8A 4FTEA 1DHKB 2WN3A 4UWDA 3HBZA 1KFXL 4BISA 1QJX2 1XXNA 3CZUA 2QQWA 3N9MA 4LO5B 1RUH2 4Z92B 4AOCA 4PLOA 2V4AA 1OFSA 3RMXA 1UPIA 4A7ZA 3DEMA 1XBFA 1DGRA 1F9KA 2XJPA 4B4QA 2CTVA 5GZCA 5FY7A 4CCNA 3A0KA 3M4FA 3S30A 2HLEA 5A3UA 1CGPA 2UYAA 1G9BA 4R4ZA 1ZZ9A 3T08A 1EV11 2W2IA 4C0BA 4CDUC 3THCA 3FLTA 4I0AA 4K1YA 5B2GB 3N35A 2FDKA 1COV3 1VBA2 4N43C 4P9IA 2JIGA 5A32B 5LBFA 3SQOA 4QPGA 1KDMA 3QLQA 5GLUA 2BV4A 5F5QA 3LPGA 4P5YA 4P08A 1WW7A 2DTWA 4AXOA 1YIFA 3POWA 5FXZA 4Q0PA 1R1A3 3MI8A 2JDPA 1UYZA 1L7QA 4D3WA 4G9SB 4AZZA 1SBDA 4I0WB 4CU7A 2DBNA 5A7PA 5GLWA 2Z2SB 4A6SA 4QPGB 2VNRA 4XUNA 3C7OA 4IGPA 3VZLA 2XHNA 1F5FA 1IG3A 1XJAA 1JU4A 2Q1ZB 4RQPC 1V6OA 4P00B 5FPVA 1POV0 1VAMA 5GM0A 1US2A 4DMIA 3R05A 3ZYIB 3U11A 2RV9A 3B02A 4BMEA 5HXVA 1ULDA 1RGSA 1JUHA 4BA6A 1NZIA 2QQJA 2Y34A 2VOWA 4YZ5A 1JYWA 3MBWA 3VDDB 1UIKA 1UAIA 1S1AA 2UURA 4KBZA 5E6HA 5FP8A 2HBTA 4KWKA 2BWAA 3T2PA 1MEC3 1JYCA 3HBKA 3N4MA 3J7MA 4UFKA 3K48A 1YFYA 4OULA 2H0VA 3JCIA 4EE2A 3W5NA 4ATFA 3O12A 3W20A 1D2SA 2D6MA 3WCSA 4IERA 3JZVA 1REEA 3T2OA 3K4DA 3KV9A 4G4FA 3SCGA 1CIWA 5E88A 1JYVA 5I0UA 1NT0A 2SLIA 4FPYA 4IUGA 2P37A 1LCLA 3VBFA 1TE1B 3ZMNA 3I2FA 1GQHA 2YFZA 1POV3 4ARYA 4FAGA 3FFQA 1AR82 4AQ6A 2VOTA 3MICA 5C71A 2K0GA 3K3NA 4CU6A 3NV4A 1VAVA 1EUUA 3FHAA 4CA9A 4CYDA 3GHMA 1PVXA 4QXBA 3VBFB 5BXXA 2WNUB 1D4M3 2BVBA 1PVC3 3AKSA 5FY5A 5JSRA 5LRSA 2NP0A 4AE2A 3WVJA 1UOFA 1IGOA 1Q8PA 4PHZA 2QZ3A 3WQ0A 2ZGMA 1UW8A 1PO12 2YU2A 4A41A 1GQPA 1BBT1 3U0ZA 5FP9A 4J1XA 4M4RA 3ZSJA 2LTNA 3RI9A 5J37A 5F3IA 1W9WA 2J1EA 1N47A 1UMHA 1W8ZA 2JD9A 2PQQA 3PUIA 5FMCA 4CU8A 5FCCA 1ENSA 2RS31 3AP4A 3ZYBA 4CU9A 3RNSA 3MPPG 3LOBA 3WNOA 1UZVA 4XTPA 5DN2A 1TG7A 1W8NA 3WG2A 4A7KA 3WT3A 3WDVA 1WCSA 4UOJA 3AL6A 1CAVB 5FO7B 4DUVA 4DXRA 3E5XA 3D6EA 5BNNA 5CFCB 4D7TA 2E9QA 3WQBA 3ZN4A 3ETQA 4R4XA 3UNPA 3VN4A 1NYWA 2PELA 2ZGKA 1D0HA 1DQ4A 2XLGA 3I2DA 3U10A 3B9IA 4DNYA 4LO6B 2A3WA 3AYEA 1IKPA 1MS9A 2WN2A 4MGQA 3LOIA 5F39A 5HBAA 2GC1A 3POBA 3WF1A 4IDZA 4Q4V1 2A3XA 4CSWA 2YB7A 2W1QA 3VBUA 4GH4C 1VBC1 5DUWA 3CJIB 3OB8A 2C0ZA 4LEJA 1SZBA 3LA3A 5DAVA 4N43A 5CYYA 2ARBA 4XDQA 1W9SA 2GP3A 2EAAA 4LBQA 4LKSA 5FUNA 1DZTA 2DURA 4OHZA 4G3YC 2DVFA 3J7LA 2YG0A 4Y4RA 3ZFFC 3ZOIA 1UZZA 2A75A 5I8YA 4OZXA 4Q4Y1 1ZRCA 4OI0A 4GWNA 2R042 1WBLA 2FZ1A 3TN93 5KXEA 4E8DA 2FMYA 5FY4A 3U07A 3CDZB 4ES8A 2WKKA 1S0CA 1OA2A 3BOWA 5LWBA 2CWMA 4KWJA 1XSRA 4DQAA 1JYXA 1JZ4A 2F17A 1G8WA 3FE5A 3TN92 4XJAA 4KL1A 1AYM1 2CU5A 3U4XA 4XBLA 3H8RA 1NLSA 5FBZA 2ZMKA 5FZ9A 2EAKA 3DL3A 5FZOA 4K1ZA 2DUQA 1ZZ8A 2ZGTA 2J1TA 3NJXA 4FBFA 1IHMA 4AGRA 5B4NA 2ARAA 1W6PB 3JD71 2Q8DA 2XHKA 1QQP1 4GB31 4K3UA 4YM2A 4BQ3A 3V0AB 3GBFA 4Q4X1 3ZIXA 1BMV1 1Y3TA 4IV3B 4BCUA 5IWFA 3WSOA 4KH9A 2XWBB 1AR63 2EXKA 2FDIA 2C26A 3VBSA 2K9ZA 2ZGUA 3ABZA 2HWF1 5CG9A 3GZEA 4W50A 2YBPA 1SFYA 2C4XA 4K40A 3K51A 1RUNA 2QQVA 3AZWA 1REDA 4YW6A 1VMHA 4EQVA 2XBO2 2D3SA 1NCRC 1XYPA 2MEV1 1CX4A 5D8AA 1UYPA 2P3JA 3LDRA 3CO2A 4NOTA 1H6YA 4QDRA 5FZEA 4OHWA 5FOBB 4WV8A 4H2AA 2EF6A 3KF5A 3UV9A 3BTXA 3M1HA 4KNCA 3UESA 5M0TA 2WINB 4UBGA 1OSGA 3NNFA 2A6YA 5BY5A 1RXGA 2ZKLA 5FZ6A 1HRV3 4HFSA 3TAYA 1OKOA 4BU2A 1US3A 2WZEA 2DVDA 4FFGA 4Y1UA 2R062 1ONAA 4C1XA 4Y3OA 4QPIB 4RFRB 1DYKA 2OX0A 1KD7A 3RVHA 3RZZA 4EN8B 5LY1A 2RMU3 1AF9A 4LK6A 4CP9B 5CFCC 3MZHA 3R4DB 4NHXA 3JQWA 1I5ZA 3OGGA 3M2MA 3GDBA 2J42A 1OT5A 3MIGA 3HPNA 1X9PA 3HAGA 4BK5A 5F7UA 3LAGA 3NSTA 2SBAA 3NNLA 1O6UA 5C6CA 1NCQC 2IFWA 5D2AA 5FWJA 2DVGA 4HPKA 4PT6A 1DBNA 2AENA 4WVMB 1W2TA 4A42A 1LGCA 1ZBA2 1XE0A 1LEMA 1R083 4LR4A 4BQYA 4I2OA 1RHI1 1O4TA 5BNOC 4GWMA 4K21A 1ULPA 4FCAA 5FLJA 4AVSA 4H7LA 2B45X 2WZR2 4XQ4A 2EICA 4JHZA 1J3PA 5K0UC 4R9DA 3IMMA 4XURA 4D0QA 1SPPB 2IXKA 2Y0OA 4XAAA 1O7FA 4MO3M 3GZAA 2XL7A 5FZ7A 1XE8A 4LKDA 4GH4A 2PFWA 4GD4A 4XJWA 3WW3A 1ZBA1 4GQ7A 5HCHA 4B1LA 5CB7A 2GN3A 3KT7A 5FUIA 3MGUA 5FYSA 5L7OB 4XEZA 4EJRA 4QKNA 1QKQA 5J36A 2DTYA 2O14A 2DCKA 1W6QB 3AKRA 3D3AA 1ENQA 3GF6A 1GV9A 3IDAA 3MLLA 3MPBA 2JXAA 3DXUA 1WCQA 2VE1A 4WZFA 5HCBA 1MS3A 4JRLA 4FFHA 3POYA 4FPGA 5BNOB 5JSOA 1KXGA 4Z1VA 4LK7A 4XILA 4E2QA 2PHUA 4QHBA 4XHBA 4Q26A 2ARCA 2E51A 2YBKA 1FV3A 3I59A 4XUOA 1CAWB 4RR3C 1VR3A 4QWNA 4XMAA 1HRV2 3HQXA 2CY6A 4NIHA 3BB6A 2P6CA 3K3OA 4INDA 2G9GA 2D44A 1UN1A 2GNBA 1POV1 1UY2A 1POQA 1S4CA 4LULA 4UF0A 4JX0A 1CESA 4DIQA 4LT5A 4N90A 3LFIA 5IVVA 1O3QA 2ZEZA 3W9AA 1UZYA 4QXCA 4XFHA 5AC93 1HB2A 2ZKNA 4MVTA 5DDJ2 1YJKA 4ZU4A 4DEVA 1JS9A 1LRHA 4K9SA 1R64A 2RS11 3AZYA 4NHKA 4D94A 3CEWA 4YVWB 5IYYA 1PIV2 3MYXA 2WNVC 1I6XA 4ZXKA 2ZX2A 3NL1A 4B7EA 3POIA 2J7MA 1F4HA 4GKYA 2XB6C 1YLLA 1YQ2A 1I5PA 2LS6A 3FZ3A 4FVVA 1KITA 3H8OA 1QDCA 1TME1 3WXPA 3O1SA 1W39A 3I2GA 4A3XA 1E5HA 1U5XA 1OF3A 3LDBA 3D5OA 2ZGOA 3AC0A 4DEQA 1AYN1 1ENXA 2VBBA 2NYYA 4N8MA 4B4PA 1RUC2 3HN3A 3GHNA 1K12A 3VBFC 3S5AA 1IG0A 2ZS6B 3ZXKA 2WNOA 3GCXA 4HLTA 4YWAA 4CP2A 5GLZA 4LBOA 2C5DA 2B8MA 2BBVA 2H6CA 1CPNA 4FPKA 1LHUA 5AFEA 5FR3A 3RDIA 3TEWA 5JUVA 2YYOA 2Y6JA 5LATA 1OQ1A 4KWLA 3MW2A 3USUA 2EALA 2RR11 2O8QA 2ZJCA 2QVSB 1GOFA 4J25A 3VKMA 2DCYA 4X8NA 1C5HA 4RN5A 1GYKA 2XQXA 3C3VA 1RUH3 2CL2A 5IVYA 2WYFA 1CX1A 3H42B 1ZZ7A 2YV8A 4FFFA 2Y60A 4CTEA 1W6OA 1GSLA 3T1LA 1JTZX 3USUB 3ZXFA 4AEDC 1C8NA 1PNGA 1PZ8A 1VBC3 4W6YA 4AVVA 2XVLA 3OD0A 5KHHA 4B3NA 2WBKA 3IIAA 3MFAA 5JOYA 4YW1A 3VD4A 1NY72 3T2TA 1G9AA 3QCWA 5ACA2 5FLIA 4GA9A 4PCRA 4UFJA 4Q0QA 4Q5OA 4CEYB 5FZ8A 1B35B 3JB4C 1Q3EA 4XIKA 4LHKA 5I91A 4H14A 2HWC1 1HN1A 2XVGA 5LEKA 4JAAA 4OQ8A 1PIV1 2E32A 2OVUA 4NMIA 4O65A 5FYVA 4MXVA 4COVA 4AF9A 3VUOA 5AC92 2VXJA 1N3PA 4ORFA 1L3JA 1V6MA 3LPFA 2R1DA 1AJOA 1R1A2 4FQZA 5A3OA 2VVEA 3CLPA 2VMGA 1MACA 5BYNA 5FWEA 5JAXA 1RUD2 5CA6A 2I74A 5GALA 3S7EA 3VBRA 3AP6A 1H8TA 4L0PA 5L9BA 3M3QA 4A44A 1KQRA 1FOD3 5JIUA 2JD4A 1RJ7A 2JECA 1UY0A 1T6BX 1CAUB 2WNUC 5IUQA 3SCHA 3GALA 2ZEWA 1OUXA 3ZSMA 3RZHA 1UY1A 4CDQC 3OGSA 3JD73 4JRAA 5HCFA 5FPLA 3IAPA 3ORJA 1QQP3 3KCXA 4GB33 4BQ5A 2PLV2 3A0NA 1PMIA 4HSLA 3WOGA 4EN9B 2HEYF 4XDPA 4KWUA 2JENA 3FLRA 3USSA 3ZLIA 2DFBA 3A21A 4UI9L 2D93A 3UYJA 1IS5A 4MG2A 1H1MA 4AEDB 2IVJA 5A6QA 1U12A 1W2OA 3I97A 2Q8OA 4BQ4A 2NQYA 4LE4A 1GP6A 1QY4A 1UKGA 2VY0A 1QHDA 3A4UA 1RUI3 5FZBA 4IE4A 4URTA 4DINB 4PLNA 5DAWA 3NNMA 4DXTA 3VZKA 1SLCA 3KGLA 1WBFA 2W94A 1MZ6A 1J59A 4YW3A 4XAEA 4WBBA 4WM8B 5LA9A 4CDXA 3VKNA 1SLIA 4XFAA 4XFBA 3DPRA 4XQWA 2OW4A 1SQ4A 2ZTNA 1W05A 2VO5A 1C1LA 2FHRA 3VLBB 3MV01 2JICA 2GC0A 3R6SA 2OPKA 1BQPA 4O9GA 4RD7A 1HRV1 3SKVA 3WG1A 4AHXA 1CAXA 2JB8A 1JH5A 1BK1A 1JZ5A 4DFSA 4AI1A 2AR6A 4ZZ8A 1RUG2 2DF7A 1PX3A 4LE3A 2D6NA 1MQTA 1S0BA
chains in the Genus database with same CATH topology
2WN3A 3MV11 1W9TA 2C9KA 3CZUA 5G05L 2CDPA 2E31A 2J1VA 2WO1A 1J84A 4OUEA 2W9XA 2HLEA 2EIDA 1MPXA 3T08A 3THCA 4QDQA 5EIYB 1SDDB 2VCAA 2X05A 1WKYA 4ET7A 3LPGA 4D8MA 4P5YA 2EIBA 4P08A 3A23A 3THDA 2DDUA 1UYZA 1L7QA 3I3EA 2ORXA 4CU7A 1J83A 2BGOA 3I2HA 2YFUA 4XUNA 3C7OA 2XHNA 5B4XA 1JU4A 3WNNA 2VZPA 4P00B 2VZ1A 1US2A 1PMHX 2RV9A 1W99A 3I2KA 2QQJA 2W95A 1JYWA 3MBWA 3A7QA 2W1UA 4W8JA 1W0NA 3C7EA 3T2PA 4BK4A 1DP0A 2R7EB 1NAEA 3K4ZA 3C7GA 3W5NA 4UAPA 3FHQA 2VMDA 1UY3A 3CQOA 2XOMA 3CMGA 4A45A 3T2OA 3K4DA 3UETA 2J1UA 1JYVA 2DCJA 4IUGA 4GWIA 2PQSA 2VQUA 3ECQA 2Z4FA 4KI5M 2VQTA 3I2FA 4MOAA 2YFZA 2VMCA 4QX0A 3OG2A 2VC9A 2B4KA 4ARYA 3I2JA 2VOTA 3FN9A 1JZ2A 2RJ2A 5C71A 2Y64A 3C7HA 3P6BA 4CU6A 1EUUA 3FHAA 1GUIA 2XONA 4AAXA 1GNYA 4BJ0A 1GOHA 2V72A 1OD3A 1KEXA 2W1SA 1GMMA 5IJRA 4A41A 1GQPA 4ZZ5A 4M4RA 3WF4A 3SKJE 1W9WA 2J1EA 2WO3A 3OEBA 1UMHA 2JD9A 4PF1A 3PUIA 4CU8A 4XZUG 1KGYA 1O8PA 4CU9A 3WNOA 3J7HA 5DN2A 1EUTA 1TG7A 1W8NA 5IFPA 3C8XA 4QX2A 3ACGA 4UOJA 3VD5A 3OGRA 4DUVA 2CDOA 4DXRA 2Y6HA 2VZOA 2LW8A 3WQBA 3HJRA 3UNPA 5HPOA 1CZSA 1BHGA 2VZTA 3WF2A 2WN2A 3BN6A 4MGQA 4GZ9A 2HYXA 3WF1A 4CUAA 3DECA 4PQQA 3U37A 2VL4A 2YB7A 2W1QA 3BGAA 1LNSA 3JXSA 3T2QA 3OB8A 4M4PA 1XC6A 2BBAA 5CYYA 2WYSA 1W9SA 2VZUA 4LKSA 4QB2A 4QX3A 5LA0A 1UXZA 3NRUA 2W91A 2YG0A 1F4AA 1ULOA 3F2ZA 3VD3A 3T09A 1RYYA 1UYYA 1O8SA 1SG3A 5DQ0A 4E8DA 4LHSA 3FL7A 2VJXA 3WF0A 2Y6LA 3VD7A 1DLCA 3CDZB 3VDCA 2WABA 1JYXA 4QPWA 1JZ4A 1CZVA 2J1RA 4QX1A 1UZ0A 2QQOA 3EB7A 3NJXA 5B4NA 2J1TA 3W5MA 2OKXA 3EYPA 3LE0A 3K4AA 2VCCA 5LA2A 2ID4A 3CKHA 1H6XA 4DXSA 3MUZ1 1CZTA 3WSOA 3E1F1 2C26A 3ABZA 2W5FA 3ACFA 4W50A 4XVHA 5JMOA 2C4XA 5IFTA 1OH4A 3GGLA 2W3JA 2V5DA 3WNLA 4OMDA 5JR2A 1JU3A 4QDRA 1DYOA 1H6YA 3LEKA 1UY4A 4LQRA 2X09A 3OGVA 4HG6B 3UESA 2RVAA 2WAAA 1GOGA 2VCBA 1US3A 2VZ3A 4ZY9A 2WZEA 2VTFA 1K42A 3WF3A 4CUCA 4DUWA 1XNAA 4E8CA 2EIEA 3WNPA 3I3DA 3GDBA 1UWWA 3VDAA 1OT5A 3HNBM 3HPNA 1JI6A 5F7UA 4BK5A 4AG4A 4BDVB 4TTGA 3IB3A 4PT6A 4A42A 2YC2A 3A22A 1JZ3A 4RYDA 1PX4A 3K46A 3ACHA 1ULPA 3IAQA 2VZSA 2EICA 2WO2A 4JHZA 4MADA 4BXSV 4XURA 4D0QA 5C7GA 3WNMA 4A4AA 3VDBA 4MO3M 5I0DA 3PUHA 3I2IA 3HEIA 4XUQA 2QQNA 3LEGA 4P02B 5DPNA 5FUIA 4ZXEA 3LEIA 1K3IA 3VD9A 2DCKA 2QQLA 3D3AA 3IDAA 1WCQA 2BERA 3NJVA 1K45A 5HXMA 1O59A 4QB1A 5G04L 4JKLA 4XUOA 3ZM8A 2JE8A 2VZRA 1XNTA 3ETPA 4KMQA 3OBAA 1UY2A 2E26A 4JX0A 2KD7A 2E33A 2ZEZA 2BGPA 4QAWA 4DEVA 1CIYA 2QQIA 2VMFA 2YC4A 1R64A 1SHWB 3NNGA 3T0AA 5IYYA 2B9VA 3K75B 5JXJA 5LA1A 2WUHA 2J1AA 5A1AA 2VM9A 1OF4A 2J7MA 1F4HA 2L9LA 1YQ2A 1I5PA 2LS6A 3P1IA 4JKKA 3I2GA 2VZQA 2QBXA 1OF3A 2W1WA 3AC0A 4DEQA 2QQKA 3GXUA 4FI9A 3T0DA 3HN3A 4TXWA 1K12A 3HNYM 4XUTA 2J1SA 3CIHA 5JUVA 2Y6JA 2JDAA 3DYMA 2WQ8A 2ZEYA 1GOFA 1JZ7A 3DYPA 3I3BA 4RN5A 2XQXA 2VR4A 1CX1A 4DUXA 2VMEA 2WAOA 3HNMA 5J1XA 1W8OA 4W4ZA 2ORZA 1L7RA 5JXIA 1XPWA 3CZJA 2WBKA 4A6OA 3VD4A 2W47A 3T0BA 3WEZA 2Y6GA 3MUY1 1JYNA 3DYOA 1IQDC 4MGSA 1HN1A 4OZOA 5LCWL 4JKMA 2WZ8A 2Y8KA 2E32A 4ARXA 1D7PM 1T2XA 5JXGA 2W87A 5DMYA 3LPFA 3LQCA 1JZ6A 5JXHA 5EJZB 2Y6KA 4L0PA 4LPLA 2ZXQA 4A44A 5C70A 2X10A 5EJ1B 3SEEA 1UY0A 3IIIA 2ZEWA 2J22A 1UY1A 2BZDA 3OGSA 5IHRA 3IAPA 1UX7A 4KWUA 1JHJA 4OMCA 1PMJX 3A21A 4UI9L 1P8JA 1UMIA 3OEAA 2ZEXA 1NKGA 3I97A 4CUBA 2WDBA 2V4VA 1TVGA 1UYXA 4GWJA 4OYUA 4DXTA 2W94A 2JKXA 3K77A 5CZKA 3SEPA 4Z2AA 2QQMA 1JZ8A 3C7FA 4QDSA 2VO5A 3NQHA 3MV01 2VZVA 4QB6A 1NX9A 2W92A 4CVUA 4YPJA 3HOBA 3WNKA 1NUKA 1GU3A 3GM8A 3MO4A 4XUPA 3SKVA 4A3ZA 1JZ5A 1UXXX 4ZZ8A 2W46A 1PX3A 3ACIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WN3 A;  3MV1 1;  1W9T A;  2C9K A;  3CZU A;  5G05 L;  2CDP A;  2E31 A;  2J1V A;  2WO1 A;  1J84 A;  4OUE A;  2W9X A;  2HLE A;  2EID A;  1MPX A;  3T08 A;  3THC A;  4QDQ A;  5EIY B;  1SDD B;  2VCA A;  2X05 A;  1WKY A;  4ET7 A;  3LPG A;  4D8M A;  4P5Y A;  2EIB A;  4P08 A;  3A23 A;  3THD A;  2DDU A;  1UYZ A;  1L7Q A;  3I3E A;  2ORX A;  4CU7 A;  1J83 A;  2BGO A;  3I2H A;  2YFU A;  4XUN A;  3C7O A;  2XHN A;  5B4X A;  1JU4 A;  3WNN A;  2VZP A;  4P00 B;  2VZ1 A;  1US2 A;  1PMH X;  2RV9 A;  1W99 A;  3I2K A;  2QQJ A;  2W95 A;  1JYW A;  3MBW A;  3A7Q A;  2W1U A;  4W8J A;  1W0N A;  3C7E A;  3T2P A;  4BK4 A;  1DP0 A;  2R7E B;  1NAE A;  3K4Z A;  3C7G A;  3W5N A;  4UAP A;  3FHQ A;  2VMD A;  1UY3 A;  3CQO A;  2XOM A;  3CMG A;  4A45 A;  3T2O A;  3K4D A;  3UET A;  2J1U A;  1JYV A;  2DCJ A;  4IUG A;  4GWI A;  2PQS A;  2VQU A;  3ECQ A;  2Z4F A;  4KI5 M;  2VQT A;  3I2F A;  4MOA A;  2YFZ A;  2VMC A;  4QX0 A;  3OG2 A;  2VC9 A;  2B4K A;  4ARY A;  3I2J A;  2VOT A;  3FN9 A;  1JZ2 A;  2RJ2 A;  5C71 A;  2Y64 A;  3C7H A;  3P6B A;  4CU6 A;  1EUU A;  3FHA A;  1GUI A;  2XON A;  4AAX A;  1GNY A;  4BJ0 A;  1GOH A;  2V72 A;  1OD3 A;  1KEX A;  2W1S A;  1GMM A;  5IJR A;  4A41 A;  1GQP A;  4ZZ5 A;  4M4R A;  3WF4 A;  3SKJ E;  1W9W A;  2J1E A;  2WO3 A;  3OEB A;  1UMH A;  2JD9 A;  4PF1 A;  3PUI A;  4CU8 A;  4XZU G;  1KGY A;  1O8P A;  4CU9 A;  3WNO A;  3J7H A;  5DN2 A;  1EUT A;  1TG7 A;  1W8N A;  5IFP A;  3C8X A;  4QX2 A;  3ACG A;  4UOJ A;  3VD5 A;  3OGR A;  4DUV A;  2CDO A;  4DXR A;  2Y6H A;  2VZO A;  2LW8 A;  3WQB A;  3HJR A;  3UNP A;  5HPO A;  1CZS A;  1BHG A;  2VZT A;  3WF2 A;  2WN2 A;  3BN6 A;  4MGQ A;  4GZ9 A;  2HYX A;  3WF1 A;  4CUA A;  3DEC A;  4PQQ A;  3U37 A;  2VL4 A;  2YB7 A;  2W1Q A;  3BGA A;  1LNS A;  3JXS A;  3T2Q A;  3OB8 A;  4M4P A;  1XC6 A;  2BBA A;  5CYY A;  2WYS A;  1W9S A;  2VZU A;  4LKS A;  4QB2 A;  4QX3 A;  5LA0 A;  1UXZ A;  3NRU A;  2W91 A;  2YG0 A;  1F4A A;  1ULO A;  3F2Z A;  3VD3 A;  3T09 A;  1RYY A;  1UYY A;  1O8S A;  1SG3 A;  5DQ0 A;  4E8D A;  4LHS A;  3FL7 A;  2VJX A;  3WF0 A;  2Y6L A;  3VD7 A;  1DLC A;  3CDZ B;  3VDC A;  2WAB A;  1JYX A;  4QPW A;  1JZ4 A;  1CZV A;  2J1R A;  4QX1 A;  1UZ0 A;  2QQO A;  3EB7 A;  3NJX A;  5B4N A;  2J1T A;  3W5M A;  2OKX A;  3EYP A;  3LE0 A;  3K4A A;  2VCC A;  5LA2 A;  2ID4 A;  3CKH A;  1H6X A;  4DXS A;  3MUZ 1;  1CZT A;  3WSO A;  3E1F 1;  2C26 A;  3ABZ A;  2W5F A;  3ACF A;  4W50 A;  4XVH A;  5JMO A;  2C4X A;  5IFT A;  1OH4 A;  3GGL A;  2W3J A;  2V5D A;  3WNL A;  4OMD A;  5JR2 A;  1JU3 A;  4QDR A;  1DYO A;  1H6Y A;  3LEK A;  1UY4 A;  4LQR A;  2X09 A;  3OGV A;  4HG6 B;  3UES A;  2RVA A;  2WAA A;  1GOG A;  2VCB A;  1US3 A;  2VZ3 A;  4ZY9 A;  2WZE A;  2VTF A;  1K42 A;  3WF3 A;  4CUC A;  4DUW A;  1XNA A;  4E8C A;  2EIE A;  3WNP A;  3I3D A;  3GDB A;  1UWW A;  3VDA A;  1OT5 A;  3HNB M;  3HPN A;  1JI6 A;  5F7U A;  4BK5 A;  4AG4 A;  4BDV B;  4TTG A;  3IB3 A;  4PT6 A;  4A42 A;  2YC2 A;  3A22 A;  1JZ3 A;  4RYD A;  1PX4 A;  3K46 A;  3ACH A;  1ULP A;  3IAQ A;  2VZS A;  2EIC A;  2WO2 A;  4JHZ A;  4MAD A;  4BXS V;  4XUR A;  4D0Q A;  5C7G A;  3WNM A;  4A4A A;  3VDB A;  4MO3 M;  5I0D A;  3PUH A;  3I2I A;  3HEI A;  4XUQ A;  2QQN A;  3LEG A;  4P02 B;  5DPN A;  5FUI A;  4ZXE A;  3LEI A;  1K3I A;  3VD9 A;  2DCK A;  2QQL A;  3D3A A;  3IDA A;  1WCQ A;  2BER A;  3NJV A;  1K45 A;  5HXM A;  1O59 A;  4QB1 A;  5G04 L;  4JKL A;  4XUO A;  3ZM8 A;  2JE8 A;  2VZR A;  1XNT A;  3ETP A;  4KMQ A;  3OBA A;  1UY2 A;  2E26 A;  4JX0 A;  2KD7 A;  2E33 A;  2ZEZ A;  2BGP A;  4QAW A;  4DEV A;  1CIY A;  2QQI A;  2VMF A;  2YC4 A;  1R64 A;  1SHW B;  3NNG A;  3T0A A;  5IYY A;  2B9V A;  3K75 B;  5JXJ A;  5LA1 A;  2WUH A;  2J1A A;  5A1A A;  2VM9 A;  1OF4 A;  2J7M A;  1F4H A;  2L9L A;  1YQ2 A;  1I5P A;  2LS6 A;  3P1I A;  4JKK A;  3I2G A;  2VZQ A;  2QBX A;  1OF3 A;  2W1W A;  3AC0 A;  4DEQ A;  2QQK A;  3GXU A;  4FI9 A;  3T0D A;  3HN3 A;  4TXW A;  1K12 A;  3HNY M;  4XUT A;  2J1S A;  3CIH A;  5JUV A;  2Y6J A;  2JDA A;  3DYM A;  2WQ8 A;  2ZEY A;  1GOF A;  1JZ7 A;  3DYP A;  3I3B A;  4RN5 A;  2XQX A;  2VR4 A;  1CX1 A;  4DUX A;  2VME A;  2WAO A;  3HNM A;  5J1X A;  1W8O A;  4W4Z A;  2ORZ A;  1L7R A;  5JXI A;  1XPW A;  3CZJ A;  2WBK A;  4A6O A;  3VD4 A;  2W47 A;  3T0B A;  3WEZ A;  2Y6G A;  3MUY 1;  1JYN A;  3DYO A;  1IQD C;  4MGS A;  1HN1 A;  4OZO A;  5LCW L;  4JKM A;  2WZ8 A;  2Y8K A;  2E32 A;  4ARX A;  1D7P M;  1T2X A;  5JXG A;  2W87 A;  5DMY A;  3LPF A;  3LQC A;  1JZ6 A;  5JXH A;  5EJZ B;  2Y6K A;  4L0P A;  4LPL A;  2ZXQ A;  4A44 A;  5C70 A;  2X10 A;  5EJ1 B;  3SEE A;  1UY0 A;  3III A;  2ZEW A;  2J22 A;  1UY1 A;  2BZD A;  3OGS A;  5IHR A;  3IAP A;  1UX7 A;  4KWU A;  1JHJ A;  4OMC A;  1PMJ X;  3A21 A;  4UI9 L;  1P8J A;  1UMI A;  3OEA A;  2ZEX A;  1NKG A;  3I97 A;  4CUB A;  2WDB A;  2V4V A;  1TVG A;  1UYX A;  4GWJ A;  4OYU A;  4DXT A;  2W94 A;  2JKX A;  3K77 A;  5CZK A;  3SEP A;  4Z2A A;  2QQM A;  1JZ8 A;  3C7F A;  4QDS A;  2VO5 A;  3NQH A;  3MV0 1;  2VZV A;  4QB6 A;  1NX9 A;  2W92 A;  4CVU A;  4YPJ A;  3HOB A;  3WNK A;  1NUK A;  1GU3 A;  3GM8 A;  3MO4 A;  4XUP A;  3SKV A;  4A3Z A;  1JZ5 A;  1UXX X;  4ZZ8 A;  2W46 A;  1PX3 A;  3ACI A; 
#chains in the Genus database with same CATH topology
 2RMU 1;  2JJ6 A;  3LSE A;  3MV1 1;  3ZDV A;  5JOX A;  2BPA 2;  1R09 2;  1IPS A;  1JMU B;  1VAK A;  3UKN A;  2E31 A;  3PVE A;  5KC6 A;  3PNA A;  4I01 A;  3FC0 A;  5JSP A;  2AC1 A;  4BZ4 A;  1LUL A;  2FCT A;  1HDK A;  2V73 A;  3H1M A;  4V2V A;  2DWR A;  1AR6 2;  1YFX A;  2ARE A;  2ERF A;  2JDU A;  1XU2 A;  4CUG A;  1OXC A;  1VB4 A;  2QTW B;  2K2S A;  3UGF A;  1RHI 3;  1VIW B;  3OYW A;  4L97 A;  4RS5 B;  3JD7 2;  1RUD 1;  3OBR A;  5KHK A;  4HOO A;  1WKY A;  2IWG B;  5CFD C;  1QEX A;  5JR7 B;  3SH5 A;  2CGN A;  2IC1 A;  4GAZ A;  3VKO A;  4NAO A;  2JDM A;  1VRH 3;  1J1T A;  1H2L A;  1LHV A;  3KV5 A;  4Q4V 2;  5T5L A;  1N1V A;  3IDB B;  2PHW A;  5EV7 A;  4UT5 A;  4XZP A;  3AKP A;  4BPZ A;  5T5J A;  5EWS A;  3OYW B;  4RS5 A;  2K46 A;  3ZSK A;  2WFF 1;  4XFC A;  5LBB A;  3ZXG A;  1QIQ A;  1S0J A;  4Y1X A;  2XJQ A;  2JIJ A;  3FUO A;  4RHV 1;  3I54 A;  4BXF A;  4NIG A;  3IN9 A;  3M70 A;  4E4S A;  1IOA A;  5FP7 A;  3OUI A;  5B4X A;  4D6Q A;  1XNK A;  3WDU A;  5C5U A;  4TSV A;  3FWE A;  1KDK A;  2LRO A;  1W3V A;  1U5Y A;  1WLC A;  3O0V A;  4XBN A;  3ZXA C;  2WS9 3;  3E97 A;  3Q8E A;  5FZF A;  2OQ7 A;  1HIX A;  1FPN 1;  4B29 A;  1X7N A;  5DZF A;  1HXS 2;  3W59 A;  4S2F A;  4YW5 A;  1HB1 A;  2VD7 A;  3POE A;  1LES A;  2R30 A;  1QMJ A;  2GP5 A;  2OZ6 A;  2X29 A;  3SC7 X;  3PME A;  2WS9 2;  3C7E A;  4RHV 2;  4PQ9 A;  2ZMN A;  3N3H A;  4NRM A;  2ENR A;  2IVI B;  1UQX A;  2ZZJ A;  3LIH A;  5FAX A;  1NAE A;  3EJK A;  2GZW A;  3K4Z A;  4P9Y A;  5DUV A;  4NHL A;  2PHX A;  4UAP A;  1G6N A;  4YM3 A;  5CFC A;  2VMD A;  1UY3 A;  5AC9 1;  4GJY A;  1R09 3;  1WMD A;  2XOM A;  1Q8Q A;  1NCQ B;  4A45 A;  1C28 A;  1RC6 A;  3UET A;  1YYN A;  3M3I A;  4YVW C;  2RS1 3;  1AXY A;  1DCS A;  3RI8 A;  5JI9 A;  4LO8 A;  2J1U A;  2DCJ A;  2B7Y A;  1PZ9 A;  2BP6 A;  2CSG A;  3WDT A;  3FFZ A;  3VL8 A;  2OZJ A;  5EHD A;  1QF3 A;  4NHM A;  3OG2 A;  2UWC A;  2VC9 A;  4GJZ A;  1MS8 A;  3BI3 A;  1HRI 1;  2OUH A;  2YMZ A;  4JQT A;  1JZ2 A;  1OA3 A;  2X5I B;  1WW6 A;  4N43 B;  3SLI A;  1RUJ 3;  1RIN A;  2JG8 A;  2Y64 A;  3C7H A;  2VW2 A;  4FOW A;  2O0O A;  2PA7 A;  4HMZ A;  1AHS A;  3VBR C;  2FDF A;  2I45 A;  1GNY A;  4YM0 A;  4YVS A;  4Y5Z 0;  4AEJ A;  1RMU 2;  2V72 A;  1RMU 1;  3W58 A;  4NPL A;  4CXX A;  3VZM A;  5C8C B;  2D40 A;  1WA6 X;  2W1S A;  4QHZ A;  5LA1 A;  3H8X A;  1ULF A;  2X5I A;  1GBG A;  2AEY A;  1F15 A;  2X5I C;  1OLR A;  1YRZ A;  3WF4 A;  4E4Z A;  4MYE A;  3KHB A;  3U1X A;  2WO3 A;  3OEB A;  4YVS C;  2VVF A;  2ZX1 A;  3WX5 A;  5A70 A;  4XZU G;  3HIF A;  3HWJ A;  3RSJ A;  3B01 A;  2JG8 C;  1EUT A;  1HB3 A;  4A2U A;  5KC5 A;  4GXL A;  3C8X A;  1W28 A;  4MXW A;  1JOJ A;  3O14 A;  2HWE 3;  3OBT A;  3VD5 A;  3JBG 1;  1BEV 1;  3NKT A;  1DF0 A;  4IET A;  1HQN A;  5BPX A;  1AX0 A;  2CDO A;  5BNP A;  4FQ4 A;  4NAM A;  1REF A;  4HT1 T;  4Q4W 2;  4LNV A;  1SFP A;  4COY A;  3HJR A;  1W03 A;  1IZ3 A;  2VOX A;  2OYZ A;  2B46 X;  3H50 A;  4IV3 A;  5DDJ 1;  4P9G A;  5A7S A;  3O1P A;  1LEN A;  4MH0 E;  1HJF A;  3WV6 A;  2GN7 A;  2Q4S A;  2XKP A;  1VRB A;  4XYX A;  4L99 A;  3SH3 A;  1UX6 A;  3UK9 A;  2ZX4 A;  5BNP B;  1O91 A;  4KGQ A;  3EHK A;  4CUA A;  3DEC A;  4I30 A;  4FPL A;  3U37 A;  4DPN A;  3BGA A;  5JZG B;  4IE0 A;  4HN0 A;  4ZU5 A;  3KT1 A;  5K8S A;  2XPJ A;  1OOP C;  2GME A;  3LF7 A;  4K8F A;  1YIP A;  2VZU A;  4QX3 A;  1XOY A;  5LA0 A;  3NRU A;  2W91 A;  4OCT A;  1R08 2;  4YFW A;  2WZP P;  3ZVX A;  5GZG A;  4HON A;  1ULO A;  3F2Z A;  2D6K A;  1FOD 1;  1Q8S A;  4ASL A;  1X33 A;  4WVZ A;  4YGE A;  3T09 A;  3I2O A;  1UYY A;  1O8S A;  4TYS A;  4IEZ A;  1YQ6 A;  1S0I A;  1SG3 A;  4XF4 A;  5GLT A;  1DIW A;  4ASM B;  2Y6L A;  5FLH A;  3U78 A;  1N1S A;  1DQ5 A;  3VD7 A;  3SH4 A;  1DFQ A;  2UWA A;  5L36 A;  4L11 A;  1FAY A;  1VMJ A;  1XSQ A;  2WNV A;  3KQR A;  3VGI A;  4AI3 A;  2J1R A;  2ZZQ A;  2ATF A;  5KR7 A;  2BTV C;  3AKQ A;  5GKA C;  4CP9 A;  3ZYR A;  4CDW C;  3OBZ A;  1T6G C;  4RS5 C;  3HQR A;  1OQD A;  2Y33 A;  3VBS B;  5FMB A;  5A7Q A;  4JGY A;  1VBA 1;  4SLI A;  3M8L A;  3K4A A;  2VCC A;  2Y38 A;  4LOT A;  5IVF A;  4U2A A;  4DXS A;  5APA A;  1SAC A;  1H9W A;  4E2S A;  1O3S A;  4RR3 A;  1CZT A;  3N9L A;  2HWB 3;  3GJA A;  3BIW E;  2ZA9 A;  1GNH A;  2C6S A;  1OPO A;  5DZG A;  1LR5 A;  2YXS A;  1H2N A;  5JIA A;  4Q4W 3;  1V9U 2;  5ANN A;  1CD3 G;  5FY8 A;  1OD5 A;  1OH4 A;  3AK0 A;  2VBP A;  3GGL A;  4CCM A;  5FXV A;  2Q30 A;  2BGC A;  1CAU A;  5GLV A;  3ZXE A;  4D69 A;  5FY9 A;  4OMD A;  4ZPI A;  4OHX A;  1DYO A;  1KFU L;  3AYC A;  1UY4 A;  5FRA A;  5CAD A;  4IV1 B;  2X09 A;  4NPR A;  1WW4 A;  1IKQ A;  4IEX A;  4TWT A;  5CKQ A;  5J96 B;  3O1O A;  1DYP A;  4R52 A;  5LAS A;  5ABJ C;  4FOY A;  5DAP A;  3J9S A;  2VZ3 A;  4P9J A;  1YFW A;  2RHP A;  5LZ6 A;  2PLV 1;  2VTF A;  2A70 A;  1Q5O A;  2R16 A;  2VAU A;  3AXD A;  3VHP A;  3ZXJ A;  1VJ2 A;  4BLI A;  3WF3 A;  5BNO A;  1XYN A;  1RUC 3;  3ZSE A;  4COW A;  2AGS A;  4CUC A;  4DUW A;  3N7J A;  1XNA A;  2PHL A;  4LJH A;  3ZMO A;  2BU9 A;  1U5Z A;  2NZ9 A;  3CU7 A;  2EIE A;  2XG3 A;  3WNP A;  5FYY A;  4LBJ A;  3ZIW A;  3LFM A;  5FPU A;  3VDA A;  1EAH 1;  4IV3 C;  4OLL A;  3ZFE B;  3S7I A;  1YJL A;  4AI0 A;  4YFZ A;  4OVE A;  4I0B A;  4WZC A;  2RDQ A;  4AG4 A;  5JVV A;  4Q2F A;  1RUG 1;  4XTM A;  2P4E A;  3O7O A;  4I3P A;  3L2H A;  5FMO S;  4TTG A;  4FXG B;  3GCW A;  5EP9 A;  3FBM A;  1SPP A;  4QMA A;  2JE7 A;  1Y9M A;  5SV8 A;  3RS6 A;  4B8E A;  1JZ3 A;  4CP0 A;  4NRO A;  3K46 A;  5T5O A;  4QU1 A;  1KS4 A;  3S0M A;  5FXX A;  3ACH A;  4XIO A;  1X36 A;  3M3C A;  4C91 A;  2YU1 A;  4YG0 A;  1ALY A;  1ULG A;  3ITQ A;  4X8P A;  1SLA A;  4HSJ A;  5C3Q A;  4UFI A;  2WO2 A;  2PAK A;  3NV2 A;  3T1M A;  1HQL A;  5FMD A;  4YG6 A;  5E8A A;  5ACA 3;  3WP5 A;  4NIA A;  2W52 A;  1FPN 3;  2HWB 2;  2XJU A;  3OPZ A;  5FBJ A;  3J8F 3;  5I0D A;  1E5S A;  3PUH A;  3I2I A;  1UCX A;  1G9D A;  4R9A A;  1WMX A;  3ZFG A;  3KCY A;  3B94 A;  3UKV A;  1UOB A;  4O9E A;  3PHM A;  1R1Z A;  3GNE A;  4JZR A;  5D8A C;  4CEY C;  2GNM A;  1NCR A;  3EMR A;  3LEI A;  4ZU7 A;  1K3I A;  2E7A A;  3VD9 A;  4IGQ A;  1V9U 1;  2YRO A;  1RTV A;  3AP7 A;  2BER A;  4RA0 A;  2HWF 2;  2ZX0 A;  1H2K A;  4ERO A;  3KT4 A;  3NJZ A;  1O59 A;  5J98 B;  4Q1R A;  4QB1 A;  5G04 L;  4ASK A;  1UU5 A;  3M3E A;  4CCL A;  2JE8 A;  1NCR B;  2VZR A;  2JKB A;  2R49 A;  1S0E A;  1ZVF A;  4QU2 A;  1OFN A;  1Z7S 3;  4LTA A;  2MNG A;  4GB3 2;  4GMP 3;  4KMQ A;  5D1I A;  2A3Y A;  1UOJ A;  2DYC A;  1A78 A;  3MID A;  4QGL A;  1HQW A;  2V09 A;  2LRP A;  4CZS A;  4W6X A;  4DOU A;  2D6O X;  1WD4 A;  4OI2 A;  4JV4 A;  2ZGP A;  2WSU A;  2BGP A;  1ULC A;  2XVK A;  2D5H A;  4URA A;  1CIY A;  2YC4 A;  1F35 A;  3ILF A;  3RYP A;  1SHW B;  3T0A A;  2G1M A;  2VUA A;  5IAV A;  4AEM A;  2B5H A;  2WWJ A;  5CKM A;  5H9Q A;  1W3X A;  4Q27 A;  4IE6 A;  3VDD A;  2MEV 2;  2VM9 A;  3TWI A;  2A7A A;  3N7L A;  1G9F A;  2A1X A;  3VZJ A;  3S57 A;  3I4I A;  4JKK A;  2WSV A;  5T50 A;  3P3P A;  5FYH A;  2VZQ A;  1QXP A;  1TMF 3;  1XU1 A;  1H4H A;  4N53 A;  5FQ0 B;  1IS3 A;  3TNP B;  3WD5 A;  5JCT A;  2W1W A;  5AFB A;  1JOB A;  4Q4Y 2;  1VBD 3;  2QQK A;  3GXU A;  3QH7 A;  5FYZ A;  3DCQ A;  5I8S A;  3WDW A;  5BNQ A;  3U14 A;  1AL2 1;  4NJ4 A;  5FK7 A;  1BEV 3;  5DUX A;  1LOC A;  1YHF A;  3MIB A;  3J8F 2;  1ODM A;  4HKL A;  3CIH A;  2TNF A;  1OQE A;  2JDA A;  4MZU A;  3ZN6 B;  4L9B A;  3ZO0 B;  2NPI A;  4CPB A;  3MEP A;  1DU3 D;  1AYM 2;  3H3Z A;  2A6V A;  2TEP A;  1AR9 3;  1ZRR A;  2A6W A;  4DUX A;  1SCR A;  2A71 A;  4M0N A;  1WGP A;  2JG8 B;  3HNM A;  5J1X A;  1JOD A;  3ILR A;  4W4Z A;  1PO2 3;  1QGL A;  3LA7 A;  1L7R A;  4PLM A;  1C8M 1;  2ILM A;  1C8M 2;  4ZHN A;  3VBU B;  2HJI A;  1U0A A;  2VU9 A;  1H4G A;  2F4L A;  2RM2 2;  4PF5 A;  5L7O C;  1V6L A;  3WEZ A;  2Y6G A;  1B09 A;  3UGG A;  1LGB A;  1V0A A;  3MUY 1;  4CDU B;  3DYO A;  1YEW A;  5FO8 B;  1FMD 1;  3ZR6 A;  2WR9 A;  4P5H A;  3CHX A;  2AEZ A;  4MGS A;  5KHJ A;  2UU8 A;  2WZ8 A;  4B1M A;  2Y8K A;  4PDW C;  3WUC A;  4BE3 A;  2RM2 3;  1MQT C;  4FPH A;  1WLT A;  2XUM A;  3PVN A;  1A34 A;  1ST8 A;  1QJY 1;  1UOG A;  1T2X A;  3KLS A;  1DLL A;  3M7A A;  2E53 A;  2QCS B;  4RGG A;  3IDC B;  5FZ1 A;  1AXZ A;  4D7Y A;  3DF0 A;  5FKC A;  3VHN A;  2Y6K A;  2XBO 3;  1QDO A;  4XF9 A;  4Y1Y A;  1ND2 B;  4UBH A;  3NO8 A;  4FTS A;  5L73 A;  1RUF 1;  4IEV A;  2OA2 A;  3AL5 A;  5CU1 A;  2DCT A;  4QQP A;  4CDX C;  3RZG A;  4XF3 A;  2J22 A;  1O3T A;  3HT2 A;  3O0W A;  1I9R A;  1COV 2;  1PK6 B;  1VBA 3;  4M00 A;  5IHR A;  4LBM A;  4M3C F;  4AI9 A;  4Y20 A;  5KXB A;  3WDX A;  1ZA4 A;  4QD2 A;  1JHJ A;  1QNW A;  3QD6 A;  2RDR A;  2H0B A;  4XDO A;  4IEP A;  4NWW A;  4Q8L A;  1P8J A;  2DUO A;  3ZFF B;  1MS1 A;  3AZV A;  5F32 A;  2RJL A;  2FDJ A;  1C4R A;  4AGG A;  3OEA A;  4MGK E;  2JEM A;  2C24 A;  1VE0 A;  2VBD A;  2GU9 A;  3H1Y A;  3O5S A;  2G4I A;  2V4V A;  3AFG A;  4AI2 A;  4AR2 A;  3MW3 A;  2Y26 A;  4U36 A;  5A33 A;  1BYH A;  3H3L A;  4GWJ A;  3NNJ A;  2WLQ A;  1FYU A;  2BOI A;  2GC2 A;  4JGZ A;  1LOF C;  1GNZ A;  4MUV A;  3GZU C;  3OPW A;  5A1L A;  2BVV A;  3UT0 A;  4LBK A;  3HD8 B;  5CZK A;  3SEP A;  3OUH A;  4Q0U A;  5BUV A;  2AH2 A;  3CL1 A;  1VBE 2;  5EYX A;  3OPT A;  3FLP A;  1ND3 A;  1PO2 2;  2WFP A;  1MS4 A;  2HKX A;  3NQH A;  4IE5 A;  5C8C C;  5F6L B;  4QB6 A;  1NX9 A;  2P2K A;  4CVU A;  3HOB A;  1VB2 A;  4QT6 A;  1RUE 3;  3V56 A;  3GM8 A;  4GIQ A;  4XUP A;  3WNK A;  4RQP A;  2LAL A;  5F5I A;  3I8T A;  4X6R B;  1RUJ 2;  2KA3 A;  4R9B A;  5IVB A;  3H7Y A;  2W46 A;  3ACI A;  2BNM A;  3MF6 A;  4UW4 A;  4E4H A;  1LAJ A;  2WT1 A;  3O1T A;  1V00 A;  3O0X A;  2WJS A;  4PIX A;  3NV3 A;  1YQ8 A;  3ZDS A;  1W9T A;  3JU9 A;  2CDP A;  4ZS2 A;  3BPZ A;  3N9O A;  3V0B B;  3I49 A;  1EAH 3;  4IXL A;  3WP6 A;  2WO1 A;  1J84 A;  4W65 A;  3N9N A;  1X9T A;  4L92 A;  2VPV A;  4OUE A;  3ZFG C;  1CPM A;  2ZML A;  4QPG C;  1H2M A;  1WUV A;  2MPF A;  2W9X A;  3PIJ A;  3WCR A;  5C4W C;  5IAT A;  3MLK A;  2XDV A;  3WQ1 A;  1O4Z A;  3DXT A;  3WG3 A;  4XFI A;  4LBQ D;  1EV1 2;  2EID A;  1FAT A;  3VKF C;  3V0B A;  1QWR A;  2IXL A;  2EIG A;  5EIY B;  1SDD B;  2FD8 A;  3J7N A;  1MZ5 A;  2PHT A;  2RS5 1;  4MV2 A;  2NLR A;  5A3W A;  1J3Q A;  3MIF A;  2Q1F A;  2RDN A;  4PBP A;  3VV1 A;  1ZM1 A;  3B9C A;  4P9W A;  5K9Y A;  3MF9 A;  1EV1 3;  1W8F A;  4D8M A;  4YNI A;  2EIB A;  3FJS A;  2QZ2 A;  5FP3 A;  1APN A;  3Q8C A;  3KWV A;  3POG A;  2JG9 A;  1OUS A;  1J3R A;  2WII B;  4E2G A;  2ORX A;  1UD1 A;  2P3K A;  2VUC A;  3PJY A;  1VMF A;  4WM7 C;  3PUS A;  2V5Y A;  4AGV A;  1J83 A;  4COU A;  2BGO A;  3I2H A;  2CAV A;  2NM1 A;  4RGK A;  2YFU A;  3NVC A;  4KU8 A;  1NZC A;  1Y9G A;  5HV0 A;  5ABJ B;  3KV4 A;  4FT8 A;  3IT8 A;  2W68 A;  4AK3 A;  2WQZ C;  2D6P A;  2JG9 B;  2R6Q A;  4HAN A;  3Q9O A;  4XCB A;  3RPQ A;  1OVS A;  1PMH X;  1VBE 3;  2XKO A;  1QOO A;  5F6K A;  3WG4 A;  1MEC 1;  2OXB A;  1AYN 2;  1W99 A;  3T4V A;  4EV0 A;  3AFK A;  4LOR A;  5A3T A;  4OHY A;  5C3S A;  3ME2 A;  4EWE A;  5FZI A;  5FRE A;  4EWD A;  1E5I A;  4W8J A;  1W8T A;  1D0G A;  2E7T A;  1W0N A;  2VEC A;  5ABJ A;  4KBB A;  2R0F A;  3SNM A;  4Y5S A;  4Q8K A;  2XLF A;  4LIV A;  3C7G A;  1W6N B;  2GMP A;  3VBU C;  5L9R A;  2ES3 A;  2VG9 A;  4IL7 A;  4J1W A;  2GND A;  5F5A A;  4PI2 A;  1GFF 2;  3CQO A;  4D6R A;  5IVE A;  1S0F A;  1YUD A;  3MHZ A;  3ZPO A;  3INA A;  3ZKU A;  1AX1 A;  5C5T A;  1LGN A;  2VXR A;  3R4U A;  3WLU A;  3AZZ A;  2QUO A;  4BWO A;  1URX A;  1S2K A;  4PIZ A;  1PM4 A;  4GWI A;  2PQS A;  2VQU A;  4KI5 M;  2VQT A;  5C8W A;  3PJQ A;  4MOA A;  5DG1 A;  2VMC A;  4QX0 A;  2XJS A;  4Y1V A;  4ZS3 A;  5LY2 A;  1CVN A;  2XH6 A;  1D4M 1;  3CJI A;  1NQD A;  3FHI B;  3BTY A;  5IK4 A;  3RWK X;  1VBC 2;  3P6B A;  1Q43 A;  1BBT 3;  4GAL A;  1SLB A;  3D0J A;  5A6Z A;  1UF2 C;  4K8R B;  4JGY C;  5FJH A;  1KEX A;  3I59 B;  1TZO A;  3D82 A;  4MET A;  1GMM A;  2DU0 A;  3KD4 A;  4MGI E;  1XQN A;  1G86 A;  4CDW A;  2BFU S;  4ZZ5 A;  1V70 A;  3POF A;  5J09 A;  4LBN A;  4ITC A;  1DGL A;  3SKJ E;  1PVC 1;  5FO9 B;  5JWP A;  2YPD A;  2VW1 A;  4CRQ A;  2R07 3;  4PF1 A;  4AFB A;  4AQ2 A;  1AVB A;  2YPJ A;  4NR1 A;  1KGY A;  2FCV A;  4DB5 A;  1AR9 1;  1LHO A;  4M3C B;  5IVJ A;  4BM8 A;  4AVA A;  1PM7 A;  4QX2 A;  1M4W A;  3ZFE C;  2ZHN A;  3ACG A;  1PO2 1;  1XRU A;  2P6H A;  2BNO A;  3ZN5 A;  1JUI A;  2RS3 3;  2C9A A;  1WMF A;  2IXC A;  2VMI A;  2VZO A;  2Y6F A;  4LUK A;  4QKD A;  1QXR A;  1VLN A;  2AUY A;  4RL7 A;  2UYB A;  2ZHK A;  4YGB A;  4NHY A;  1WCD J;  1GQG A;  3AVR A;  3S6P A;  4AW7 A;  2W08 A;  2YBS A;  5HPO A;  4TLG A;  2VZT A;  1UNB A;  4QKF A;  4BYY A;  4N53 B;  1PK6 C;  5FQ0 A;  2HYX A;  4AVB A;  1ZX5 A;  4N9H A;  1NQJ A;  4Q4Y 3;  3EO6 A;  1LNS A;  3PU3 A;  1FT9 A;  2VNG A;  4MHU A;  4UFH A;  1S0G A;  3ZYP A;  1XC6 A;  1LOD A;  2P5B A;  3KHC A;  1UXZ A;  4BIO A;  5FYI A;  1X8E A;  2RE9 A;  3KV6 A;  4XC9 A;  2WNU A;  1ENR A;  5H9P A;  1KS5 A;  1YQC A;  3VD3 A;  1RYY A;  2WNE A;  4H7M A;  4KGG A;  4NO4 A;  5DQ0 A;  1W06 A;  2XJT A;  2AZ5 A;  2XL9 A;  3PUA A;  1OLM E;  1S2E A;  1AYM 3;  4HVO A;  1DLC A;  1AR9 2;  1JBC A;  1RVF 2;  3ST7 A;  4JGY B;  1Q56 A;  1TNF A;  4MHR A;  3VDC A;  4AFD A;  3TN9 1;  2TUN A;  3I3M A;  1CZV A;  1PVC 2;  4FPC A;  3H1W A;  4QPI A;  2UWB A;  5HCA A;  1WWY A;  2WO7 A;  3LKJ A;  2VNO A;  3PTY A;  4I3G A;  1ODN A;  2QQO A;  3LD8 A;  4OFG A;  4Q4X 3;  2HYK A;  3URF A;  5CAZ A;  3EB7 A;  5DAQ A;  4BQX A;  4GKX A;  3RGB A;  2ZAB A;  2OKX A;  1JW6 A;  2X8K A;  2D6L X;  1RXF A;  2Q8E A;  4B4R A;  3LE0 A;  4LO7 A;  4RGA A;  2HWF 3;  3CKH A;  5T3N A;  2WZR 3;  1ND3 C;  4NRP A;  2BNN A;  2D7F A;  3D8C A;  1CN1 A;  1LOA A;  3ZXL A;  4AED A;  4IQP A;  1MZE A;  4TN7 A;  2DCZ A;  4JTN A;  5AVA A;  3E1F 1;  3NAP B;  1JN2 P;  2WA4 A;  4JGZ C;  2W5F A;  5DG2 A;  4XJ9 A;  4XVH A;  1W2U A;  3KSC A;  4K6B A;  3ELN A;  5IFT A;  5JDB A;  1RUE 1;  4QQH A;  3TYJ A;  2Z5W A;  1OMI A;  1BCX A;  1AR6 1;  2CGO A;  4W6W A;  2V5D A;  4Q29 A;  3WNL A;  1IPJ A;  3RYK A;  1NXM A;  5JR2 A;  1JU3 A;  4PBO A;  1YFU A;  4YG3 A;  4OI1 A;  4LQR A;  5A32 A;  1VP6 A;  2VUD A;  2ZGQ A;  5LBC A;  3OGV A;  4Z07 A;  2WWU A;  5FUP A;  2XUE A;  4BQ1 A;  1RVF 1;  4O7X A;  5CVR A;  1HXS 1;  3SMH A;  2VUJ A;  2MEV 3;  4AVT A;  4I02 A;  4AEK A;  2RVA A;  1CAX B;  3QH6 A;  3ZFF A;  3RQ0 A;  5CEH A;  1LU1 A;  2QQP A;  1NLR A;  2R32 A;  4LA3 A;  1AR8 1;  3Q8A A;  1V6N A;  4DS0 A;  4HVQ A;  3B93 A;  3ZYH A;  1K42 A;  1SFN A;  1ZRD A;  1L7L A;  1DQ1 A;  4Y22 B;  1HB4 A;  5DZE A;  4AL9 A;  2JE9 A;  2O1Q A;  2WFF 2;  4BB3 A;  1OLQ A;  4ZKT B;  2RS5 3;  4LA2 A;  2G19 A;  4CE8 A;  1BVP 1;  4EN7 B;  4KG0 A;  4YM1 A;  5A7O A;  3RJR A;  5F37 A;  3J26 N;  5L9V A;  3MDP A;  3I3D A;  1DGR N;  3PUR A;  1UWW A;  4XQD A;  3DPR B;  1PO1 1;  5F3G A;  3ZSL A;  5JOW A;  1ND3 B;  2XJV A;  1JI6 A;  4V1P A;  3DV8 A;  2OPW A;  3WUD A;  4QPI C;  5EPA A;  2TBV A;  5BNN C;  1Z0H A;  4XF0 A;  4Y22 A;  4QM8 A;  1PHM A;  5FYM A;  4IEW A;  2ZX3 A;  1EPZ A;  1YI9 A;  3B69 A;  5C3O A;  3AYA A;  2YC2 A;  3A22 A;  3MFC A;  3ES1 A;  1W0P A;  3ILN A;  2MHF A;  4RYD A;  1PX4 A;  3HR9 A;  3WW2 A;  1SMV A;  2ZGR A;  4D7S A;  3WP4 A;  5C33 A;  1CJD A;  5CFD A;  1X82 A;  2DFC A;  1IS6 A;  1TME 2;  1ZZC A;  3IAQ A;  4S2D A;  5F3E A;  1DQ6 A;  4S2G A;  4YSF A;  1SBE A;  1R08 1;  1ZBA 3;  4MAD A;  1LOG A;  4BXS V;  2ZAH A;  3DUI A;  1SDW A;  5C7G A;  3TNQ A;  4Z82 A;  1VBE 1;  4LIT A;  1QJU 2;  4A4A A;  3VDB A;  5SV5 A;  4XBQ A;  1C1F A;  2VTX A;  5IW0 A;  3MW4 A;  3OD4 A;  4WVW A;  1AXK A;  3HEI A;  2BDR A;  3BYW A;  2QQN A;  4HBN A;  2DUP A;  5EXO A;  2D98 A;  3VKL A;  3LEG A;  4FFI A;  1W2N A;  1C57 A;  4P02 B;  5HV4 A;  3HN1 A;  3G6J B;  3O1U A;  3TEX A;  1OHF A;  4E9K A;  4WM7 B;  1FMD 2;  1JYT A;  2QQL A;  2RR1 2;  4V2W A;  4P9X A;  3H7J A;  2ET1 A;  4A7Y A;  4MGT A;  5H9R A;  2PXJ A;  3UKT A;  2ZGL A;  3KVA A;  1VBB 1;  1D4V B;  2QFE A;  3T30 A;  1HN0 A;  1XE7 A;  1DDL A;  1SBF A;  4N53 C;  1EPW A;  2W39 A;  1V6J A;  2CHH A;  1Z78 A;  4H55 A;  4EYU A;  1A8M A;  4XAB A;  2VOV A;  3CF6 E;  4AQS A;  3ETP A;  2Q8C A;  2ET7 A;  4FSJ A;  2IFR A;  2YDE A;  3BKZ A;  4XMI A;  2IXH A;  3T4H B;  3WP3 A;  2E26 A;  2OS2 A;  2QDN A;  5E89 A;  1Q8O A;  2KD7 A;  3OUJ A;  1Y9Q A;  5BV6 A;  1NCQ A;  2CAU A;  4YZ2 A;  5KXC A;  1W6M B;  2KR2 A;  4QAW A;  3IDE A;  2HWE 2;  5I0R A;  4F3J A;  4DRV A;  3ENR A;  3NNG A;  3PVO A;  1BXH A;  4CCD A;  2CYF A;  3BCW A;  2VW0 A;  4Y1Z A;  3K75 B;  3RRD A;  5BNN B;  1PGS A;  2GAL A;  4UXA A;  2J1A A;  1W9F A;  5LRR A;  5A1A A;  1AYN 3;  1OC1 A;  5C3P A;  5F9T A;  4IEO A;  3P1I A;  1E5R A;  3OSD A;  4J6G A;  5GJ6 A;  2ZHL A;  1QQP 2;  2E7Q A;  3APB A;  2R07 1;  4L8Q A;  1MEC 2;  5LB6 A;  3RFR A;  3ZN6 A;  4FI9 A;  4FPO B;  3T0D A;  5FXW A;  2WL1 A;  3DKW A;  4LMF A;  3AKT A;  2F4P A;  2D43 A;  1TME 3;  1YO8 A;  3SHR A;  3X29 B;  3AJY A;  4CDQ A;  4YZ1 A;  2NN8 A;  4AHZ A;  4LBQ B;  3KQ4 B;  1DGW A;  4BLJ A;  2EVX A;  2ZOE B;  1RUH 1;  4F8A A;  1QJU 3;  3KGZ A;  2RG4 A;  1BZW A;  4XUT A;  1A3K A;  1WLW A;  1GZW B;  1AZD A;  3H3U A;  1TNR A;  4F7Z A;  5FPB A;  4LLO A;  2EA7 A;  3DYP A;  3UGH A;  3NKG A;  2IUW A;  2VR4 A;  4DY5 A;  4KQ7 A;  4FTB A;  4FOQ A;  1I3H A;  4MXW B;  1BKZ A;  3PIG A;  2VCM A;  1HKD A;  2WAO A;  3AP9 A;  2XGX A;  4LKE A;  4CDU A;  2RR1 3;  3VBS C;  3RWN A;  5EQU A;  3BAL A;  1QJZ A;  1MS0 A;  2ORZ A;  1H30 A;  2PHR A;  4LIU A;  4UF0 B;  4XFG A;  1LTE A;  4DO0 A;  1I1E A;  3CZJ A;  1CQ9 A;  1Y7B A;  2RDS A;  1RIR A;  5A33 B;  4A6O A;  3FMG A;  4EZ4 A;  2HWC 3;  3PTR B;  2GNT A;  2QKD A;  5FZO B;  3AM2 A;  1YC6 1;  1U5I A;  4LXL A;  1X50 A;  3E6B A;  5FPX A;  2E63 A;  5FYB A;  1YNA A;  1H1A A;  3AMN A;  1NXD 1;  3PUQ A;  1LKN A;  4M3C E;  1IQD C;  2WT2 A;  3AMH A;  4JKM A;  3V0A A;  1KJR A;  4AI8 A;  1OUR A;  4ARX A;  1D7P M;  1OLM A;  1GZ9 A;  1O4Y A;  1Y43 B;  3MLJ A;  2JG9 C;  1AR7 3;  1J58 A;  4BH9 A;  5JXG A;  4YW4 A;  4LKF A;  4QXK A;  2DVA A;  4AFA A;  1GAN A;  1JZ6 A;  3AP5 A;  4N7I A;  1PIV 3;  3WIN E;  4FPE A;  2X53 S;  2HWD 2;  4IW3 A;  1GWM A;  4LPL A;  5F1R A;  1G7Y A;  2ZXQ A;  4KG8 A;  1C5I A;  5EJ1 B;  4JVA A;  2YHJ A;  3TRS B;  2GH2 A;  3LDK A;  1YXW A;  2ZAA A;  3III A;  5FMO L;  2PAE A;  5D8A B;  3TEY A;  2BZD A;  1AJK A;  3KVB A;  4HXC A;  1CR7 A;  4IE7 A;  3NMB A;  3RZK A;  4N7U A;  4DY3 A;  2HWD 3;  3KCC A;  2KM2 A;  5JI7 A;  3LIG A;  5A7W A;  1NLQ A;  4FPJ A;  1W6P A;  4CEW B;  3FX3 A;  2WZR 1;  4CCE A;  3Q8F A;  3UL2 A;  1A6C A;  4HKO A;  3P5B A;  4OMC A;  1N3Q A;  1PMJ X;  1RUI 1;  2VGD A;  3VZO A;  3LZZ A;  4LOS A;  5FZM A;  5FOJ B;  5IK7 A;  4M0H A;  2NMO A;  5C3R A;  3VBH B;  5JMC A;  1ZZB A;  4LHL A;  2ZEX A;  3ON7 A;  1NKG A;  2UY8 A;  3AMQ A;  4M01 A;  1ZRF A;  5A7W B;  4CEW A;  5L19 A;  2QE3 A;  5FZL A;  3GYD A;  3RG0 A;  4AHW A;  4CCJ A;  1UYX A;  2QJV A;  5CKN A;  1ZBE 1;  1W8W A;  3ATG A;  1NE4 A;  4XFF A;  3THT A;  4EWA A;  3LSD A;  5FK8 A;  2R04 3;  1IS4 A;  1OH3 A;  2JKX A;  2PHD A;  3SIS A;  1TMF 2;  4XXA A;  2QQM A;  5KHG A;  2ZAC A;  4LLF A;  4C0H A;  3C7F A;  4QDS A;  1RVF 3;  1ASJ 1;  1HXS 3;  2VVD A;  3FUQ A;  2NMN A;  3P3N A;  5FZ0 A;  1H0B A;  2PYT A;  3WY6 A;  5F2W A;  2W92 A;  2ZGN A;  3KB5 A;  3WW4 A;  1NUK A;  1GU3 A;  1F2N A;  1AR8 3;  3BTA A;  1OBN A;  4C8D A;  1JYI A;  4Q4X 2;  3ZYJ B;  4FAH A;  1UXX X;  4QXH A;  1LOF A;  3R4S A;  3RJ2 X;  3VL9 A;  4UW6 A;  4DZG A;  2P3Y A;  2YC0 A;  3S5Q A;  1MVE A;  4IEU A;  1HLC A;  4OI4 A;  2DBI A;  2C9K A;  2YGM A;  2ZHM A;  5G05 L;  1GIC A;  3CJX A;  3PMS A;  2RS1 2;  5CNA A;  3V64 A;  5K0U B;  2AAC A;  1NE6 A;  1PO1 3;  4OUS A;  3BUC A;  1YI7 A;  2J1V A;  1S2B A;  3EQE A;  4JTO A;  4EN6 B;  3AB0 A;  1RJ8 A;  3OGJ A;  1OPM A;  1RUD 3;  4GH4 B;  1YCI A;  1FOD 2;  5FYU A;  1NG0 A;  5IVC A;  2JDN A;  1VRH 2;  3B3Q E;  3J4U H;  3IBM A;  1VRH 1;  1MPX A;  3OJB A;  1JHN A;  1GZT A;  5FJK A;  2PN5 A;  5K0U A;  5KWR A;  4QDQ A;  2VCA A;  3N7K A;  1F31 A;  2X05 A;  1W6Q A;  3OY8 B;  5CIS A;  1OOP A;  2ADE A;  3H8U A;  2OQ6 A;  2XXZ A;  5IK5 A;  5A80 A;  3WW1 A;  3O1R A;  4NUB A;  1TQ5 A;  4CCK A;  4ET7 A;  4HK9 A;  1O3R A;  3PLQ A;  1BJQ A;  3OCP A;  3MIH A;  4XJZ A;  5FDB A;  2QQU A;  5CIR A;  1PNF A;  4UYB A;  2BYV E;  4CCC A;  4Q0V A;  1QNY A;  3A23 A;  3H0O A;  4C1W A;  5DAX A;  4YYO A;  4CDX B;  5FYT A;  3THD A;  2DDU A;  3B5L B;  3OY8 A;  3I3E A;  4ISR A;  4P14 A;  1H8V A;  4Q0S A;  4HKW A;  4OHV A;  5FKB A;  3KF3 A;  1O5U A;  4JC1 A;  1MZF A;  2WS9 1;  1QOS A;  4YVS B;  2BFU L;  2GMM A;  2XJR A;  4XJU A;  3WNN A;  3BTZ A;  4R8H A;  4WM8 C;  2WLP A;  2VZP A;  2WFF 3;  3KMH A;  2VZ1 A;  4CDW B;  1HV1 A;  4RHV 3;  1VBB 3;  5J7M A;  1TEI A;  4CXW A;  2P17 A;  3I2K A;  1IPK A;  5A1F A;  2W95 A;  1BVV A;  2WA3 A;  3A7Q A;  3I3Q A;  1PGW 1;  1XNB A;  1M06 G;  2W1U A;  5FY1 A;  2BUK A;  4YW2 A;  3POS A;  1R09 1;  3UJQ A;  3ZYG A;  1EP0 A;  1LOB A;  4BK4 A;  4E4D X;  1DP0 A;  3OF1 A;  1VBD 2;  2BW8 A;  1EY2 A;  4Y4Y A;  2R7E B;  5T52 A;  3K2O A;  4FOV A;  4FXK B;  3FHQ A;  4IGO A;  1N1T A;  1LHN A;  3RZJ A;  3CMG A;  2ARX A;  2PAM A;  1CAW A;  2BEO A;  1JXN A;  1O5L A;  2ZCW A;  2VOK A;  5GZE A;  1VAL A;  4FPF A;  3WHT A;  2GDF A;  5GZF A;  3ECQ A;  1RUJ 1;  2Z4F A;  4Z2W A;  5IAX A;  2YY1 A;  3KM5 A;  1LHW A;  1HJG A;  3ALQ A;  4DRR A;  2B4K A;  3EBR A;  1QJE A;  4QX7 A;  3I2J A;  2OT7 A;  3N9P A;  4P9L A;  5K7P A;  3FN9 A;  1NA1 B;  3VBO B;  2RJ2 A;  1RHI 2;  3PU8 A;  2A6Z A;  3JUU A;  3L2Y A;  3GJB A;  4YW7 A;  1LB2 A;  1WCK A;  1QU0 A;  4YVW A;  1GLH A;  3GBG A;  1GUI A;  2XON A;  4BHP A;  3G7D A;  1HRI 3;  4AAX A;  2EXH A;  2A73 B;  4BJ0 A;  1QJX 3;  1GOH A;  2UY9 A;  1OD3 A;  5KXD A;  2VUL A;  1QJY 2;  1QJU 1;  1NA1 A;  5IJR A;  2XML A;  3VBO A;  3AZX A;  4IV1 C;  2FBE A;  3ZX7 A;  1NA1 C;  3VBO C;  2FCU A;  5A3P A;  2WC2 A;  1FXZ A;  5DXD A;  3AYD A;  1RMU 3;  2B9U A;  1VPH A;  2XLA A;  2R06 1;  1EYB A;  4JQR A;  1O8P A;  3IPV B;  1SCS A;  3RZL A;  3AMM A;  1GP4 A;  3J7H A;  2VH9 A;  4XE9 A;  1PGW 2;  5IFP A;  5JXI A;  3LWC A;  1ASJ 2;  1AX2 A;  1MR5 A;  3JBG 2;  5DDJ 3;  1F8V A;  3OGR A;  3NAP C;  3N7M A;  1YQ5 A;  3BU7 A;  4XHX A;  2Y6H A;  4BIF A;  2BWC A;  2LW8 A;  3VBR B;  3DGT A;  5A3M A;  1A8D A;  3RMY A;  3JB8 A;  1CWP A;  3IPV A;  4YZ4 A;  2RJK A;  5EZW A;  2PTM A;  3BU0 A;  2HWE 1;  4RFT 0;  5F2S A;  1OVP A;  1CZS A;  3JBG 3;  1BHG A;  1N1Y A;  3WF2 A;  1WA4 A;  1UZW A;  2GSY A;  5D21 A;  3BN6 A;  2QNK A;  4GZ9 A;  2VQ0 A;  4CEY A;  1UU6 A;  2JDH A;  5A7N A;  4PQQ A;  3T3Y A;  2D5F A;  2QDR A;  2VL4 A;  3WNX A;  5A3L A;  3JXS A;  3T2Q A;  1AR7 1;  3O1V A;  1IQA A;  2BBA A;  4M4P A;  4AFC A;  2IXJ A;  5F5C A;  1PGL 2;  2WYS A;  3D0S A;  5FZ3 A;  3FBY A;  4QB2 A;  4UFM A;  5FP4 A;  3VBH C;  4AYU A;  1MVQ A;  2OII A;  2PMW B;  1F4A A;  3GZT B;  2GC3 A;  2A6X A;  2FQP A;  3IKW A;  4Y33 A;  5T5P A;  4QGN A;  1BMV 2;  1H8T B;  2FZ2 A;  2O8O A;  1UL9 A;  3B7M A;  4LHS A;  3FL7 A;  1DGW X;  2VJX A;  3F95 A;  3IZO A;  1B35 C;  3PDQ A;  3QOP A;  2HWD 1;  3WF0 A;  4WM8 A;  1PK6 A;  1SLL A;  4BOW A;  4QQO A;  3NWK A;  4XET A;  5TSW A;  4NID A;  2PHF A;  2WAB A;  4Y20 B;  4QPW A;  3RZM A;  1KRI A;  1W90 A;  1ND2 A;  4QX1 A;  4YRD A;  1ZBE 2;  1UZ0 A;  1QJF A;  2B42 B;  3EXU A;  3WZ1 A;  1QXJ A;  2EXJ A;  3CBN A;  1W9Y A;  1ZA7 A;  4JDN A;  2HWC 2;  3ZYF A;  1ULE A;  4PI0 A;  5E16 A;  1CAV A;  5FV3 A;  3ZR5 A;  2AYH A;  3W5M A;  4AVC A;  4HN1 A;  3EYP A;  5F8P A;  4F83 A;  2D3P A;  3ZFE A;  2HWB 1;  1MQT B;  2BRT A;  1ZBE 3;  2P1B A;  3AJZ A;  5FZH A;  1QH6 A;  1XNC A;  2ID4 A;  2R04 1;  5LA2 A;  1NY7 1;  4Q4W 1;  1H6X A;  5A6Y A;  2Z42 A;  3DPR C;  1LED A;  1N3O A;  2CNA A;  3MUZ 1;  4JGZ B;  1UMZ A;  4LO4 B;  1FPN 2;  1ASJ 3;  3ZXD A;  4O61 A;  1AR7 2;  3KS7 A;  1BBT 2;  3ACF A;  5JMO A;  1PGL 1;  4ISQ A;  3HMY A;  2YGL A;  4AWD A;  2LUW A;  5CBL A;  3TB0 A;  3ASI A;  2ZPX A;  4COZ A;  4QPY A;  2F6B A;  4NVP A;  2W3J A;  4QX5 A;  5JLV A;  3OTF A;  4QQL A;  5CG8 A;  1GP5 A;  2DU1 A;  4MGY E;  4BMB A;  2R0H A;  1QOT A;  3E6D A;  3WQ7 A;  3LEK A;  1Y4W A;  4TZD A;  2I07 B;  2A5Z A;  2VQA A;  2PLV 3;  3CJI C;  4Y24 A;  3ZFG B;  1H9P A;  1LEC A;  4HG6 B;  4N9I A;  5JZG C;  5H9S A;  1V6I A;  3RYR A;  3VZN A;  4RQP B;  1RUC 1;  2WAA A;  1GOG A;  2C1F A;  2VCB A;  4KU7 A;  4CCO A;  3VBH A;  3VB9 A;  3SXW A;  1H1I A;  5EJ3 A;  2IXI A;  1FNY A;  1Z7S 2;  4ZY9 A;  3AMP A;  4HK8 A;  4CXY A;  4FP3 A;  4IES A;  1FV2 A;  2RS3 2;  1WZX A;  3LGR A;  2HBU A;  2B39 A;  1H8T C;  4EZH A;  4TLF A;  3JQX A;  1WME A;  1GWK A;  2BJS A;  4GMP 0;  4E8C A;  4IEY A;  1X8M A;  3B00 A;  2DV9 A;  2EXI A;  5LW9 A;  3TBD A;  4QX8 A;  4MGZ E;  4YAR A;  2Q5T A;  2WWS A;  1SLT A;  1GWL A;  1Q8V A;  3HNB M;  4GUL A;  4L2N A;  1ZYB A;  5T55 A;  3BVC A;  2ETE A;  3ZPY A;  3SCF A;  5CFD B;  1ACC A;  1DQ0 A;  2VNV A;  5HI0 A;  3BOP A;  4Z8B A;  1STM A;  2W0X A;  1UKR A;  4Y26 A;  4BDV B;  4CEW C;  4CP1 A;  3IB3 A;  1WD3 A;  1HW5 A;  2BOJ A;  1W6M A;  4HET A;  1CJP A;  3WHU A;  3BPS A;  2ZBJ A;  3QAC A;  4QQ2 A;  4PIY A;  1K5M B;  1SEF A;  5FFO C;  5KHI A;  2Q1M A;  5ACA 1;  3LCP A;  1CON A;  1COV 1;  3KZ4 C;  5I8T A;  3HT1 A;  1RUG 3;  1XYO A;  1XB9 A;  2VZS A;  3OOX A;  4HZF A;  1GZC A;  3E5U A;  3HQU A;  4Y5T A;  5K4L A;  1GKB A;  1HX6 A;  4NN0 A;  4WM7 A;  4NE9 A;  4QKB A;  1K5M A;  3WNM A;  4AAP A;  5LK7 B;  1G9C A;  2VTX J;  4UW3 A;  5FZA A;  3U75 A;  4XUQ A;  1R1A 1;  3DKQ A;  5ERL A;  4BQW A;  1V9U 3;  1AUY A;  5FIX A;  5DPN A;  3IMN A;  1RIT A;  4MLO A;  5AVP A;  5JPN B;  2FMD A;  4JDO A;  4CDQ B;  4S2H A;  4ZXE A;  3J8F 1;  3O1M A;  5C9A B;  3AX4 A;  4XF1 A;  3W21 A;  1OOP B;  1K5M C;  2D97 A;  1D4M 2;  3LB9 A;  5EYY A;  5FZC A;  1UU4 A;  4OQ9 A;  5F3C A;  1RB8 G;  4XCA A;  1Z7S 1;  3NJV A;  1K45 A;  5HXM A;  5JOZ A;  1LJ7 A;  1C3H A;  1OA4 A;  2G9Z A;  5FY0 A;  4JKL A;  5BNP C;  3IWZ A;  3ZM8 A;  4PJY A;  5C4W A;  3AXE A;  1W0O A;  1XNT A;  5FYC A;  5C9A A;  4AFM A;  4SBV A;  5LK5 A;  3E6C C;  1QH7 A;  1W6N A;  2R07 2;  3OBA A;  4Q1P A;  5FZK A;  3BIE A;  3LA2 A;  4B7K A;  5LBE A;  4NWV A;  1FI2 A;  2P3I A;  3ES4 A;  2E33 A;  1LU2 A;  4I09 A;  3TOJ A;  4ONU A;  4WVM A;  4GMP 1;  2VMF A;  2QQI A;  5C4W B;  2WT0 A;  2D3R A;  3N36 A;  5J3U A;  3IM0 A;  2E6V A;  2JB4 A;  4BQ2 A;  1QJX 1;  5FZG A;  3NW4 A;  2B9V A;  1RUI 2;  2CGP A;  5JXJ A;  2ADD A;  2WUH A;  3ACL A;  3H9A A;  1VBD 1;  1KJL A;  1OF4 A;  4LHN A;  4K7J A;  2L9L A;  5C8C A;  1D2Q A;  5JPM B;  3VHO A;  1AL2 3;  1LOE A;  2BQP A;  2QBX A;  3U4S A;  1AL0 G;  1BEV 2;  5KBF A;  4UFL A;  3C2U A;  2R06 3;  5DUU A;  1GZW A;  3BOD A;  3NJY A;  1MS5 A;  2DVB A;  2Z69 A;  4TXW A;  5JZG A;  5DAB A;  1UIJ A;  1FNZ A;  2JWP A;  1TMF 1;  2JDZ A;  2XWJ B;  5FZ4 A;  4JHT A;  5LEJ A;  1ZRE A;  1WLD A;  3WR0 A;  4NPM A;  1F5J A;  1PZ7 A;  3HNY M;  4JDM A;  2OUJ A;  2WQ4 A;  2J1S A;  4D6S A;  3GBW A;  3DYM A;  2WQ8 A;  2ZEY A;  2IZW A;  1JZ7 A;  4M3C A;  3I3B A;  1C8M 3;  1YWK A;  2P34 A;  1FX5 A;  1ZZ6 A;  2ZGS A;  4QHO A;  3VHR A;  1DZQ A;  4HVR A;  3THP A;  2VME A;  3LEM A;  2GAU A;  1W04 A;  2JDK A;  2GH8 A;  5IK8 A;  1W2A X;  1W8O A;  1BK0 A;  1XPW A;  3D4K A;  5E1R A;  3N9Q A;  4XAC A;  3CNA A;  3QBQ A;  1HRI 2;  1OI6 A;  2Z79 A;  4NII A;  1S55 A;  2W47 A;  4X6Q B;  3T0B A;  1BLZ A;  2RM2 1;  3E5Q A;  1XND A;  5FPA A;  2CWS A;  2XQR A;  3NV1 A;  4E27 A;  4QM9 A;  1QJY 3;  4XOG A;  3Q8B A;  4XPV A;  1JYN A;  1RUO A;  4YLZ A;  1RUF 2;  5A3N A;  3PVB B;  3I7D A;  4OZO A;  5LCW L;  1DQ2 A;  3M3O A;  3PL0 A;  5T54 A;  1ND2 C;  4Q4V 3;  4PDW A;  4R9C A;  4FP2 A;  4CPB D;  2XBO 1;  4YGD A;  4UW5 A;  4EN0 A;  1ZRI A;  5FZD A;  1EAH 2;  4RR3 B;  2FDG A;  1FMD 3;  1RUF 3;  2W87 A;  4ATE A;  5DMY A;  4RSU A;  3LQC A;  4AHY A;  5ISL A;  1E57 A;  5JXH A;  1B35 A;  2HEV F;  5EJZ B;  5L7O A;  3POJ A;  3SIT A;  1GR3 A;  5C70 A;  2FDH A;  2X10 A;  3SEE A;  1UPS A;  5FPZ A;  4PDW B;  2CV6 A;  3L9J T;  4WVV A;  3TEZ A;  1AL2 2;  2HEW F;  2HH9 A;  4ES9 A;  1J1L A;  3R0R A;  2H6B A;  2YUE A;  1VBB 2;  4K20 A;  2WNV B;  1UX7 A;  4C90 A;  4DXZ A;  2VMH A;  5J48 A;  4YGC A;  1HV0 A;  4ZON A;  1WCU A;  1UMI A;  2KXL A;  2YZ4 A;  4YZ3 A;  1NOV A;  4AQT A;  4XW3 A;  1W6O B;  3ROU A;  2I2S A;  3ZKY A;  4CUB A;  5I0S A;  1K5J A;  4JCK A;  3WDY A;  2WDB A;  1TVG A;  1DZR A;  2RMU 2;  1ZNP A;  3HVD A;  3UJO A;  5FTT C;  2RS5 2;  2R1B A;  4OYU A;  1V6K A;  5EFU A;  5I93 A;  1S0D A;  4XXP A;  2Y0I A;  3K77 A;  4NRQ A;  3V65 A;  1RUE 2;  1W8H A;  3NAP A;  4Z2A A;  5GZD A;  2N7G A;  1JZ8 A;  2JDY A;  4HL0 A;  4QGM A;  2Q0A A;  1OKQ A;  1RL3 A;  1WW5 A;  2VZV A;  5I0T A;  3MIE A;  5C9A C;  5ANQ A;  4YPJ A;  4HPK B;  3VDD C;  1DG6 A;  4MSV A;  3DN7 A;  3MO4 A;  4H3W A;  4OUM A;  4LBL A;  4MX3 A;  2JX9 A;  3AVS A;  4A3Z A;  5A6X A;  2WRA A;  2XR4 A;  2LM3 A;  1UO9 A;  4IEQ A;  1JOP A;  2G9F A;  4FO9 A;  4IV1 A;  5IT6 A;  4LUM A;  1W8U A;  4XJ8 A;  4FTE A;  1DHK B;  2WN3 A;  4UWD A;  3HBZ A;  1KFX L;  4BIS A;  1QJX 2;  1XXN A;  3CZU A;  2QQW A;  3N9M A;  4LO5 B;  1RUH 2;  4Z92 B;  4AOC A;  4PLO A;  2V4A A;  1OFS A;  3RMX A;  1UPI A;  4A7Z A;  3DEM A;  1XBF A;  1DGR A;  1F9K A;  2XJP A;  4B4Q A;  2CTV A;  5GZC A;  5FY7 A;  4CCN A;  3A0K A;  3M4F A;  3S30 A;  2HLE A;  5A3U A;  1CGP A;  2UYA A;  1G9B A;  4R4Z A;  1ZZ9 A;  3T08 A;  1EV1 1;  2W2I A;  4C0B A;  4CDU C;  3THC A;  3FLT A;  4I0A A;  4K1Y A;  5B2G B;  3N35 A;  2FDK A;  1COV 3;  1VBA 2;  4N43 C;  4P9I A;  2JIG A;  5A32 B;  5LBF A;  3SQO A;  4QPG A;  1KDM A;  3QLQ A;  5GLU A;  2BV4 A;  5F5Q A;  3LPG A;  4P5Y A;  4P08 A;  1WW7 A;  2DTW A;  4AXO A;  1YIF A;  3POW A;  5FXZ A;  4Q0P A;  1R1A 3;  3MI8 A;  2JDP A;  1UYZ A;  1L7Q A;  4D3W A;  4G9S B;  4AZZ A;  1SBD A;  4I0W B;  4CU7 A;  2DBN A;  5A7P A;  5GLW A;  2Z2S B;  4A6S A;  4QPG B;  2VNR A;  4XUN A;  3C7O A;  4IGP A;  3VZL A;  2XHN A;  1F5F A;  1IG3 A;  1XJA A;  1JU4 A;  2Q1Z B;  4RQP C;  1V6O A;  4P00 B;  5FPV A;  1POV 0;  1VAM A;  5GM0 A;  1US2 A;  4DMI A;  3R05 A;  3ZYI B;  3U11 A;  2RV9 A;  3B02 A;  4BME A;  5HXV A;  1ULD A;  1RGS A;  1JUH A;  4BA6 A;  1NZI A;  2QQJ A;  2Y34 A;  2VOW A;  4YZ5 A;  1JYW A;  3MBW A;  3VDD B;  1UIK A;  1UAI A;  1S1A A;  2UUR A;  4KBZ A;  5E6H A;  5FP8 A;  2HBT A;  4KWK A;  2BWA A;  3T2P A;  1MEC 3;  1JYC A;  3HBK A;  3N4M A;  3J7M A;  4UFK A;  3K48 A;  1YFY A;  4OUL A;  2H0V A;  3JCI A;  4EE2 A;  3W5N A;  4ATF A;  3O12 A;  3W20 A;  1D2S A;  2D6M A;  3WCS A;  4IER A;  3JZV A;  1REE A;  3T2O A;  3K4D A;  3KV9 A;  4G4F A;  3SCG A;  1CIW A;  5E88 A;  1JYV A;  5I0U A;  1NT0 A;  2SLI A;  4FPY A;  4IUG A;  2P37 A;  1LCL A;  3VBF A;  1TE1 B;  3ZMN A;  3I2F A;  1GQH A;  2YFZ A;  1POV 3;  4ARY A;  4FAG A;  3FFQ A;  1AR8 2;  4AQ6 A;  2VOT A;  3MIC A;  5C71 A;  2K0G A;  3K3N A;  4CU6 A;  3NV4 A;  1VAV A;  1EUU A;  3FHA A;  4CA9 A;  4CYD A;  3GHM A;  1PVX A;  4QXB A;  3VBF B;  5BXX A;  2WNU B;  1D4M 3;  2BVB A;  1PVC 3;  3AKS A;  5FY5 A;  5JSR A;  5LRS A;  2NP0 A;  4AE2 A;  3WVJ A;  1UOF A;  1IGO A;  1Q8P A;  4PHZ A;  2QZ3 A;  3WQ0 A;  2ZGM A;  1UW8 A;  1PO1 2;  2YU2 A;  4A41 A;  1GQP A;  1BBT 1;  3U0Z A;  5FP9 A;  4J1X A;  4M4R A;  3ZSJ A;  2LTN A;  3RI9 A;  5J37 A;  5F3I A;  1W9W A;  2J1E A;  1N47 A;  1UMH A;  1W8Z A;  2JD9 A;  2PQQ A;  3PUI A;  5FMC A;  4CU8 A;  5FCC A;  1ENS A;  2RS3 1;  3AP4 A;  3ZYB A;  4CU9 A;  3RNS A;  3MPP G;  3LOB A;  3WNO A;  1UZV A;  4XTP A;  5DN2 A;  1TG7 A;  1W8N A;  3WG2 A;  4A7K A;  3WT3 A;  3WDV A;  1WCS A;  4UOJ A;  3AL6 A;  1CAV B;  5FO7 B;  4DUV A;  4DXR A;  3E5X A;  3D6E A;  5BNN A;  5CFC B;  4D7T A;  2E9Q A;  3WQB A;  3ZN4 A;  3ETQ A;  4R4X A;  3UNP A;  3VN4 A;  1NYW A;  2PEL A;  2ZGK A;  1D0H A;  1DQ4 A;  2XLG A;  3I2D A;  3U10 A;  3B9I A;  4DNY A;  4LO6 B;  2A3W A;  3AYE A;  1IKP A;  1MS9 A;  2WN2 A;  4MGQ A;  3LOI A;  5F39 A;  5HBA A;  2GC1 A;  3POB A;  3WF1 A;  4IDZ A;  4Q4V 1;  2A3X A;  4CSW A;  2YB7 A;  2W1Q A;  3VBU A;  4GH4 C;  1VBC 1;  5DUW A;  3CJI B;  3OB8 A;  2C0Z A;  4LEJ A;  1SZB A;  3LA3 A;  5DAV A;  4N43 A;  5CYY A;  2ARB A;  4XDQ A;  1W9S A;  2GP3 A;  2EAA A;  4LBQ A;  4LKS A;  5FUN A;  1DZT A;  2DUR A;  4OHZ A;  4G3Y C;  2DVF A;  3J7L A;  2YG0 A;  4Y4R A;  3ZFF C;  3ZOI A;  1UZZ A;  2A75 A;  5I8Y A;  4OZX A;  4Q4Y 1;  1ZRC A;  4OI0 A;  4GWN A;  2R04 2;  1WBL A;  2FZ1 A;  3TN9 3;  5KXE A;  4E8D A;  2FMY A;  5FY4 A;  3U07 A;  3CDZ B;  4ES8 A;  2WKK A;  1S0C A;  1OA2 A;  3BOW A;  5LWB A;  2CWM A;  4KWJ A;  1XSR A;  4DQA A;  1JYX A;  1JZ4 A;  2F17 A;  1G8W A;  3FE5 A;  3TN9 2;  4XJA A;  4KL1 A;  1AYM 1;  2CU5 A;  3U4X A;  4XBL A;  3H8R A;  1NLS A;  5FBZ A;  2ZMK A;  5FZ9 A;  2EAK A;  3DL3 A;  5FZO A;  4K1Z A;  2DUQ A;  1ZZ8 A;  2ZGT A;  2J1T A;  3NJX A;  4FBF A;  1IHM A;  4AGR A;  5B4N A;  2ARA A;  1W6P B;  3JD7 1;  2Q8D A;  2XHK A;  1QQP 1;  4GB3 1;  4K3U A;  4YM2 A;  4BQ3 A;  3V0A B;  3GBF A;  4Q4X 1;  3ZIX A;  1BMV 1;  1Y3T A;  4IV3 B;  4BCU A;  5IWF A;  3WSO A;  4KH9 A;  2XWB B;  1AR6 3;  2EXK A;  2FDI A;  2C26 A;  3VBS A;  2K9Z A;  2ZGU A;  3ABZ A;  2HWF 1;  5CG9 A;  3GZE A;  4W50 A;  2YBP A;  1SFY A;  2C4X A;  4K40 A;  3K51 A;  1RUN A;  2QQV A;  3AZW A;  1RED A;  4YW6 A;  1VMH A;  4EQV A;  2XBO 2;  2D3S A;  1NCR C;  1XYP A;  2MEV 1;  1CX4 A;  5D8A A;  1UYP A;  2P3J A;  3LDR A;  3CO2 A;  4NOT A;  1H6Y A;  4QDR A;  5FZE A;  4OHW A;  5FOB B;  4WV8 A;  4H2A A;  2EF6 A;  3KF5 A;  3UV9 A;  3BTX A;  3M1H A;  4KNC A;  3UES A;  5M0T A;  2WIN B;  4UBG A;  1OSG A;  3NNF A;  2A6Y A;  5BY5 A;  1RXG A;  2ZKL A;  5FZ6 A;  1HRV 3;  4HFS A;  3TAY A;  1OKO A;  4BU2 A;  1US3 A;  2WZE A;  2DVD A;  4FFG A;  4Y1U A;  2R06 2;  1ONA A;  4C1X A;  4Y3O A;  4QPI B;  4RFR B;  1DYK A;  2OX0 A;  1KD7 A;  3RVH A;  3RZZ A;  4EN8 B;  5LY1 A;  2RMU 3;  1AF9 A;  4LK6 A;  4CP9 B;  5CFC C;  3MZH A;  3R4D B;  4NHX A;  3JQW A;  1I5Z A;  3OGG A;  3M2M A;  3GDB A;  2J42 A;  1OT5 A;  3MIG A;  3HPN A;  1X9P A;  3HAG A;  4BK5 A;  5F7U A;  3LAG A;  3NST A;  2SBA A;  3NNL A;  1O6U A;  5C6C A;  1NCQ C;  2IFW A;  5D2A A;  5FWJ A;  2DVG A;  4HPK A;  4PT6 A;  1DBN A;  2AEN A;  4WVM B;  1W2T A;  4A42 A;  1LGC A;  1ZBA 2;  1XE0 A;  1LEM A;  1R08 3;  4LR4 A;  4BQY A;  4I2O A;  1RHI 1;  1O4T A;  5BNO C;  4GWM A;  4K21 A;  1ULP A;  4FCA A;  5FLJ A;  4AVS A;  4H7L A;  2B45 X;  2WZR 2;  4XQ4 A;  2EIC A;  4JHZ A;  1J3P A;  5K0U C;  4R9D A;  3IMM A;  4XUR A;  4D0Q A;  1SPP B;  2IXK A;  2Y0O A;  4XAA A;  1O7F A;  4MO3 M;  3GZA A;  2XL7 A;  5FZ7 A;  1XE8 A;  4LKD A;  4GH4 A;  2PFW A;  4GD4 A;  4XJW A;  3WW3 A;  1ZBA 1;  4GQ7 A;  5HCH A;  4B1L A;  5CB7 A;  2GN3 A;  3KT7 A;  5FUI A;  3MGU A;  5FYS A;  5L7O B;  4XEZ A;  4EJR A;  4QKN A;  1QKQ A;  5J36 A;  2DTY A;  2O14 A;  2DCK A;  1W6Q B;  3AKR A;  3D3A A;  1ENQ A;  3GF6 A;  1GV9 A;  3IDA A;  3MLL A;  3MPB A;  2JXA A;  3DXU A;  1WCQ A;  2VE1 A;  4WZF A;  5HCB A;  1MS3 A;  4JRL A;  4FFH A;  3POY A;  4FPG A;  5BNO B;  5JSO A;  1KXG A;  4Z1V A;  4LK7 A;  4XIL A;  4E2Q A;  2PHU A;  4QHB A;  4XHB A;  4Q26 A;  2ARC A;  2E51 A;  2YBK A;  1FV3 A;  3I59 A;  4XUO A;  1CAW B;  4RR3 C;  1VR3 A;  4QWN A;  4XMA A;  1HRV 2;  3HQX A;  2CY6 A;  4NIH A;  3BB6 A;  2P6C A;  3K3O A;  4IND A;  2G9G A;  2D44 A;  1UN1 A;  2GNB A;  1POV 1;  1UY2 A;  1POQ A;  1S4C A;  4LUL A;  4UF0 A;  4JX0 A;  1CES A;  4DIQ A;  4LT5 A;  4N90 A;  3LFI A;  5IVV A;  1O3Q A;  2ZEZ A;  3W9A A;  1UZY A;  4QXC A;  4XFH A;  5AC9 3;  1HB2 A;  2ZKN A;  4MVT A;  5DDJ 2;  1YJK A;  4ZU4 A;  4DEV A;  1JS9 A;  1LRH A;  4K9S A;  1R64 A;  2RS1 1;  3AZY A;  4NHK A;  4D94 A;  3CEW A;  4YVW B;  5IYY A;  1PIV 2;  3MYX A;  2WNV C;  1I6X A;  4ZXK A;  2ZX2 A;  3NL1 A;  4B7E A;  3POI A;  2J7M A;  1F4H A;  4GKY A;  2XB6 C;  1YLL A;  1YQ2 A;  1I5P A;  2LS6 A;  3FZ3 A;  4FVV A;  1KIT A;  3H8O A;  1QDC A;  1TME 1;  3WXP A;  3O1S A;  1W39 A;  3I2G A;  4A3X A;  1E5H A;  1U5X A;  1OF3 A;  3LDB A;  3D5O A;  2ZGO A;  3AC0 A;  4DEQ A;  1AYN 1;  1ENX A;  2VBB A;  2NYY A;  4N8M A;  4B4P A;  1RUC 2;  3HN3 A;  3GHN A;  1K12 A;  3VBF C;  3S5A A;  1IG0 A;  2ZS6 B;  3ZXK A;  2WNO A;  3GCX A;  4HLT A;  4YWA A;  4CP2 A;  5GLZ A;  4LBO A;  2C5D A;  2B8M A;  2BBV A;  2H6C A;  1CPN A;  4FPK A;  1LHU A;  5AFE A;  5FR3 A;  3RDI A;  3TEW A;  5JUV A;  2YYO A;  2Y6J A;  5LAT A;  1OQ1 A;  4KWL A;  3MW2 A;  3USU A;  2EAL A;  2RR1 1;  2O8Q A;  2ZJC A;  2QVS B;  1GOF A;  4J25 A;  3VKM A;  2DCY A;  4X8N A;  1C5H A;  4RN5 A;  1GYK A;  2XQX A;  3C3V A;  1RUH 3;  2CL2 A;  5IVY A;  2WYF A;  1CX1 A;  3H42 B;  1ZZ7 A;  2YV8 A;  4FFF A;  2Y60 A;  4CTE A;  1W6O A;  1GSL A;  3T1L A;  1JTZ X;  3USU B;  3ZXF A;  4AED C;  1C8N A;  1PNG A;  1PZ8 A;  1VBC 3;  4W6Y A;  4AVV A;  2XVL A;  3OD0 A;  5KHH A;  4B3N A;  2WBK A;  3IIA A;  3MFA A;  5JOY A;  4YW1 A;  3VD4 A;  1NY7 2;  3T2T A;  1G9A A;  3QCW A;  5ACA 2;  5FLI A;  4GA9 A;  4PCR A;  4UFJ A;  4Q0Q A;  4Q5O A;  4CEY B;  5FZ8 A;  1B35 B;  3JB4 C;  1Q3E A;  4XIK A;  4LHK A;  5I91 A;  4H14 A;  2HWC 1;  1HN1 A;  2XVG A;  5LEK A;  4JAA A;  4OQ8 A;  1PIV 1;  2E32 A;  2OVU A;  4NMI A;  4O65 A;  5FYV A;  4MXV A;  4COV A;  4AF9 A;  3VUO A;  5AC9 2;  2VXJ A;  1N3P A;  4ORF A;  1L3J A;  1V6M A;  3LPF A;  2R1D A;  1AJO A;  1R1A 2;  4FQZ A;  5A3O A;  2VVE A;  3CLP A;  2VMG A;  1MAC A;  5BYN A;  5FWE A;  5JAX A;  1RUD 2;  5CA6 A;  2I74 A;  5GAL A;  3S7E A;  3VBR A;  3AP6 A;  1H8T A;  4L0P A;  5L9B A;  3M3Q A;  4A44 A;  1KQR A;  1FOD 3;  5JIU A;  2JD4 A;  1RJ7 A;  2JEC A;  1UY0 A;  1T6B X;  1CAU B;  2WNU C;  5IUQ A;  3SCH A;  3GAL A;  2ZEW A;  1OUX A;  3ZSM A;  3RZH A;  1UY1 A;  4CDQ C;  3OGS A;  3JD7 3;  4JRA A;  5HCF A;  5FPL A;  3IAP A;  3ORJ A;  1QQP 3;  3KCX A;  4GB3 3;  4BQ5 A;  2PLV 2;  3A0N A;  1PMI A;  4HSL A;  3WOG A;  4EN9 B;  2HEY F;  4XDP A;  4KWU A;  2JEN A;  3FLR A;  3USS A;  3ZLI A;  2DFB A;  3A21 A;  4UI9 L;  2D93 A;  3UYJ A;  1IS5 A;  4MG2 A;  1H1M A;  4AED B;  2IVJ A;  5A6Q A;  1U12 A;  1W2O A;  3I97 A;  2Q8O A;  4BQ4 A;  2NQY A;  4LE4 A;  1GP6 A;  1QY4 A;  1UKG A;  2VY0 A;  1QHD A;  3A4U A;  1RUI 3;  5FZB A;  4IE4 A;  4URT A;  4DIN B;  4PLN A;  5DAW A;  3NNM A;  4DXT A;  3VZK A;  1SLC A;  3KGL A;  1WBF A;  2W94 A;  1MZ6 A;  1J59 A;  4YW3 A;  4XAE A;  4WBB A;  4WM8 B;  5LA9 A;  4CDX A;  3VKN A;  1SLI A;  4XFA A;  4XFB A;  3DPR A;  4XQW A;  2OW4 A;  1SQ4 A;  2ZTN A;  1W05 A;  2VO5 A;  1C1L A;  2FHR A;  3VLB B;  3MV0 1;  2JIC A;  2GC0 A;  3R6S A;  2OPK A;  1BQP A;  4O9G A;  4RD7 A;  1HRV 1;  3SKV A;  3WG1 A;  4AHX A;  1CAX A;  2JB8 A;  1JH5 A;  1BK1 A;  1JZ5 A;  4DFS A;  4AI1 A;  2AR6 A;  4ZZ8 A;  1RUG 2;  2DF7 A;  1PX3 A;  4LE3 A;  2D6N A;  1MQT A;  1S0B A; 
#chains in the Genus database with same CATH homology
 2WN3 A;  3MV1 1;  1W9T A;  2C9K A;  3CZU A;  5G05 L;  2CDP A;  2E31 A;  2J1V A;  2WO1 A;  1J84 A;  4OUE A;  2W9X A;  2HLE A;  2EID A;  1MPX A;  3T08 A;  3THC A;  4QDQ A;  5EIY B;  1SDD B;  2VCA A;  2X05 A;  1WKY A;  4ET7 A;  3LPG A;  4D8M A;  4P5Y A;  2EIB A;  4P08 A;  3A23 A;  3THD A;  2DDU A;  1UYZ A;  1L7Q A;  3I3E A;  2ORX A;  4CU7 A;  1J83 A;  2BGO A;  3I2H A;  2YFU A;  4XUN A;  3C7O A;  2XHN A;  5B4X A;  1JU4 A;  3WNN A;  2VZP A;  4P00 B;  2VZ1 A;  1US2 A;  1PMH X;  2RV9 A;  1W99 A;  3I2K A;  2QQJ A;  2W95 A;  1JYW A;  3MBW A;  3A7Q A;  2W1U A;  4W8J A;  1W0N A;  3C7E A;  3T2P A;  4BK4 A;  1DP0 A;  2R7E B;  1NAE A;  3K4Z A;  3C7G A;  3W5N A;  4UAP A;  3FHQ A;  2VMD A;  1UY3 A;  3CQO A;  2XOM A;  3CMG A;  4A45 A;  3T2O A;  3K4D A;  3UET A;  2J1U A;  1JYV A;  2DCJ A;  4IUG A;  4GWI A;  2PQS A;  2VQU A;  3ECQ A;  2Z4F A;  4KI5 M;  2VQT A;  3I2F A;  4MOA A;  2YFZ A;  2VMC A;  4QX0 A;  3OG2 A;  2VC9 A;  2B4K A;  4ARY A;  3I2J A;  2VOT A;  3FN9 A;  1JZ2 A;  2RJ2 A;  5C71 A;  2Y64 A;  3C7H A;  3P6B A;  4CU6 A;  1EUU A;  3FHA A;  1GUI A;  2XON A;  4AAX A;  1GNY A;  4BJ0 A;  1GOH A;  2V72 A;  1OD3 A;  1KEX A;  2W1S A;  1GMM A;  5IJR A;  4A41 A;  1GQP A;  4ZZ5 A;  4M4R A;  3WF4 A;  3SKJ E;  1W9W A;  2J1E A;  2WO3 A;  3OEB A;  1UMH A;  2JD9 A;  4PF1 A;  3PUI A;  4CU8 A;  4XZU G;  1KGY A;  1O8P A;  4CU9 A;  3WNO A;  3J7H A;  5DN2 A;  1EUT A;  1TG7 A;  1W8N A;  5IFP A;  3C8X A;  4QX2 A;  3ACG A;  4UOJ A;  3VD5 A;  3OGR A;  4DUV A;  2CDO A;  4DXR A;  2Y6H A;  2VZO A;  2LW8 A;  3WQB A;  3HJR A;  3UNP A;  5HPO A;  1CZS A;  1BHG A;  2VZT A;  3WF2 A;  2WN2 A;  3BN6 A;  4MGQ A;  4GZ9 A;  2HYX A;  3WF1 A;  4CUA A;  3DEC A;  4PQQ A;  3U37 A;  2VL4 A;  2YB7 A;  2W1Q A;  3BGA A;  1LNS A;  3JXS A;  3T2Q A;  3OB8 A;  4M4P A;  1XC6 A;  2BBA A;  5CYY A;  2WYS A;  1W9S A;  2VZU A;  4LKS A;  4QB2 A;  4QX3 A;  5LA0 A;  1UXZ A;  3NRU A;  2W91 A;  2YG0 A;  1F4A A;  1ULO A;  3F2Z A;  3VD3 A;  3T09 A;  1RYY A;  1UYY A;  1O8S A;  1SG3 A;  5DQ0 A;  4E8D A;  4LHS A;  3FL7 A;  2VJX A;  3WF0 A;  2Y6L A;  3VD7 A;  1DLC A;  3CDZ B;  3VDC A;  2WAB A;  1JYX A;  4QPW A;  1JZ4 A;  1CZV A;  2J1R A;  4QX1 A;  1UZ0 A;  2QQO A;  3EB7 A;  3NJX A;  5B4N A;  2J1T A;  3W5M A;  2OKX A;  3EYP A;  3LE0 A;  3K4A A;  2VCC A;  5LA2 A;  2ID4 A;  3CKH A;  1H6X A;  4DXS A;  3MUZ 1;  1CZT A;  3WSO A;  3E1F 1;  2C26 A;  3ABZ A;  2W5F A;  3ACF A;  4W50 A;  4XVH A;  5JMO A;  2C4X A;  5IFT A;  1OH4 A;  3GGL A;  2W3J A;  2V5D A;  3WNL A;  4OMD A;  5JR2 A;  1JU3 A;  4QDR A;  1DYO A;  1H6Y A;  3LEK A;  1UY4 A;  4LQR A;  2X09 A;  3OGV A;  4HG6 B;  3UES A;  2RVA A;  2WAA A;  1GOG A;  2VCB A;  1US3 A;  2VZ3 A;  4ZY9 A;  2WZE A;  2VTF A;  1K42 A;  3WF3 A;  4CUC A;  4DUW A;  1XNA A;  4E8C A;  2EIE A;  3WNP A;  3I3D A;  3GDB A;  1UWW A;  3VDA A;  1OT5 A;  3HNB M;  3HPN A;  1JI6 A;  5F7U A;  4BK5 A;  4AG4 A;  4BDV B;  4TTG A;  3IB3 A;  4PT6 A;  4A42 A;  2YC2 A;  3A22 A;  1JZ3 A;  4RYD A;  1PX4 A;  3K46 A;  3ACH A;  1ULP A;  3IAQ A;  2VZS A;  2EIC A;  2WO2 A;  4JHZ A;  4MAD A;  4BXS V;  4XUR A;  4D0Q A;  5C7G A;  3WNM A;  4A4A A;  3VDB A;  4MO3 M;  5I0D A;  3PUH A;  3I2I A;  3HEI A;  4XUQ A;  2QQN A;  3LEG A;  4P02 B;  5DPN A;  5FUI A;  4ZXE A;  3LEI A;  1K3I A;  3VD9 A;  2DCK A;  2QQL A;  3D3A A;  3IDA A;  1WCQ A;  2BER A;  3NJV A;  1K45 A;  5HXM A;  1O59 A;  4QB1 A;  5G04 L;  4JKL A;  4XUO A;  3ZM8 A;  2JE8 A;  2VZR A;  1XNT A;  3ETP A;  4KMQ A;  3OBA A;  1UY2 A;  2E26 A;  4JX0 A;  2KD7 A;  2E33 A;  2ZEZ A;  2BGP A;  4QAW A;  4DEV A;  1CIY A;  2QQI A;  2VMF A;  2YC4 A;  1R64 A;  1SHW B;  3NNG A;  3T0A A;  5IYY A;  2B9V A;  3K75 B;  5JXJ A;  5LA1 A;  2WUH A;  2J1A A;  5A1A A;  2VM9 A;  1OF4 A;  2J7M A;  1F4H A;  2L9L A;  1YQ2 A;  1I5P A;  2LS6 A;  3P1I A;  4JKK A;  3I2G A;  2VZQ A;  2QBX A;  1OF3 A;  2W1W A;  3AC0 A;  4DEQ A;  2QQK A;  3GXU A;  4FI9 A;  3T0D A;  3HN3 A;  4TXW A;  1K12 A;  3HNY M;  4XUT A;  2J1S A;  3CIH A;  5JUV A;  2Y6J A;  2JDA A;  3DYM A;  2WQ8 A;  2ZEY A;  1GOF A;  1JZ7 A;  3DYP A;  3I3B A;  4RN5 A;  2XQX A;  2VR4 A;  1CX1 A;  4DUX A;  2VME A;  2WAO A;  3HNM A;  5J1X A;  1W8O A;  4W4Z A;  2ORZ A;  1L7R A;  5JXI A;  1XPW A;  3CZJ A;  2WBK A;  4A6O A;  3VD4 A;  2W47 A;  3T0B A;  3WEZ A;  2Y6G A;  3MUY 1;  1JYN A;  3DYO A;  1IQD C;  4MGS A;  1HN1 A;  4OZO A;  5LCW L;  4JKM A;  2WZ8 A;  2Y8K A;  2E32 A;  4ARX A;  1D7P M;  1T2X A;  5JXG A;  2W87 A;  5DMY A;  3LPF A;  3LQC A;  1JZ6 A;  5JXH A;  5EJZ B;  2Y6K A;  4L0P A;  4LPL A;  2ZXQ A;  4A44 A;  5C70 A;  2X10 A;  5EJ1 B;  3SEE A;  1UY0 A;  3III A;  2ZEW A;  2J22 A;  1UY1 A;  2BZD A;  3OGS A;  5IHR A;  3IAP A;  1UX7 A;  4KWU A;  1JHJ A;  4OMC A;  1PMJ X;  3A21 A;  4UI9 L;  1P8J A;  1UMI A;  3OEA A;  2ZEX A;  1NKG A;  3I97 A;  4CUB A;  2WDB A;  2V4V A;  1TVG A;  1UYX A;  4GWJ A;  4OYU A;  4DXT A;  2W94 A;  2JKX A;  3K77 A;  5CZK A;  3SEP A;  4Z2A A;  2QQM A;  1JZ8 A;  3C7F A;  4QDS A;  2VO5 A;  3NQH A;  3MV0 1;  2VZV A;  4QB6 A;  1NX9 A;  2W92 A;  4CVU A;  4YPJ A;  3HOB A;  3WNK A;  1NUK A;  1GU3 A;  3GM8 A;  3MO4 A;  4XUP A;  3SKV A;  4A3Z A;  1JZ5 A;  1UXX X;  4ZZ8 A;  2W46 A;  1PX3 A;  3ACI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...