2BBHA

X-ray structure of t.maritima cora soluble domain
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
232
structure length
223
Chain Sequence
PPGTLVYTGKYREDFEIEVMNYSIEEFREFKTTDVESVLPFRDSSTPTWINITGIHRTDVVQRVGEFFGTHPLVLEDILNVHQRPKVEFFENYVFIVLKMFTYDKHELESEQVSLILTKNCVLMFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDDYFVLLEKIDDEIDVLEEEVTVQRTHQLKRNLVELRKTIWPLREVLSSLYRDVPPLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the CorA Mg2+ transporter.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Metal transport/membrane protein
molecule keywords divalent cation transport-related protein
total genus 76
structure length 223
sequence length 232
ec nomenclature
pdb deposition date 2005-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 2bbhA02
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 2bbhA01
3NWIA 4I0UA 5JTGA 4EGWA 2BBHA 4EV6A 4EEDA 3NVOA 2BBJA 3CK6A 3JCFA 3RKGA 4EEBA 2HN2A 2HN1A 2IUBA
chains in the Genus database with same CATH superfamily
5IINA 1HG5A 3HKEE 5ABFA 4HWIB 9ICMA 2AXDS 4P09A 4M2YA 3RKOA 3O1IA 3QK6A 4AXPA 4GXKA 4JI7T 4E7SA 8ICYA 1ZEEA 2V7LA 2BKOA 3T1HT 3UFGA 3RX6A 3ETUA 2NTXA 5HXHA 4ZS2A 5D63A 3S4UA 4PGYA 2A3DA 2LHNA 3KV4A 2Y48B 1VJ7A 1ZQMA 4AKIA 5HRDA 5J2BA 2WY2A 4CN6A 1R89A 2V1DB 3AEDA 3KINB 1OWAA 3AA0B 4KHPT 4P2HA 1Y01A 2BG9A 3IA3A 4EOZB 5LYJE 1US7B 3AA7B 2ZH2A 4XBFB 9ICXA 4KB6A 2KZ7B 3K3OA 2FJEA 3EI0A 2H89A 4O4HE 2A2FX 4PW8A 1ZQXA 3C18A 3O1HA 5EK2A 2E9XC 2RFFA 3OVAA 1MMGA 3CVRA 1ZQDA 5J2TE 5CHEA 5HCJA 7ICKA 3CPZA 7ICQA 1W0AA 2DR5A 2V6YA 5J1GA 4X4OA 5HYAA 3AE2A 2LKGA 3O1JA 4X4PA 3CWZB 5J2CA 5JR9A 3AEFA 3RGLA 2L8KA 2DNXA 4WC4A 4H9SE 9ICSA 7ICFA 3N2GE 2JQHA 1YQ3A 8ICOA 2XY8B 4AKRB 4A98A 3OJAA 7ICVA 4UAZA 3MGHA 3E22E 3JPSA 1FJGT 5AQTB 4I2DA 2G0UA 4PJMA 3UUBA 2CHOA 2IW5B 3I0QA 3PMNA 2LEHA 2LHRA 2CWYA 4DOAA 4LZGA 4K9AA 2FMQA 5M4YA 4FO6A 4HKAA 3K1SA 3VRAA 3HW8A 5DQWA 2EHOA 2WAUA 2DWGA 1ZQKA 4FHWA 4JI1T 3NRYA 4EXTA 2M6BA 4DOBA 3D0TA 1UEUA 3N2KE 4JI2T 5JDFA 1ZQEA 4ZS3A 4H9QC 3LJCA 5AQPB 4WNKA 3UFEA 1LRZA 3ZMTB 2Q66A 4HEAA 3VU7H 2VANA 1YD8G 3OWGA 4UB3A 3MA9A 4GOUA 5FKYA 4DV1T 3RJIA 2WCAA 2IUBA 4MFAA 3TLSA 4GKJT 4DMWA 4EIWA 5J0OA 3EHZA 3RIUC 4O6AA 2L3LA 2D2SA 1IBMT 2JQKA 4QHOA 3AE4A 1JN3A 3M3ZB 2JPFA 2QA7A 4F5OA 4UV8B 5L3CB 2XQ6A 4F5NA 4QH5A 3UXPA 3AAIA 4QH1A 2VVSA 4P1NA 5L3FB 5JTGA 4OYJA 5AQMB 1XDPA 3H37A 4TWDA 5D49A 5J0XA 4K0KT 9ICFA 2CEAA 5LGTB 3UQ2A 1ZQBA 4PAGA 2QYWA 4V1Av 3AE3A 4TV9E 3HKDE 3SFEA 4WBNE 4LFBT 4X4NA 4MHCA 3AU6A 4QWNB 4KLUA 4YHJA 3WFQE 4J2CA 5FXVA 4R65A 3UPSA 4YD2A 2K48A 5AQOB 4P0AA 4AQGA 2JJ9A 5EK3A 4I29A 2X9YA 4IQUA 5LG3A 5D62A 3R84B 5CFBA 3WAKA 2NWBA 3N9OA 1J1JA 2V7MA 3B0XA 5LGUB 1KNYA 1XSLA 3C2MA 4ZI2C 4K0UA 3RJKA 1NO5A 4FHPA 3K75D 2HH7A 2E2AA 3OVUA 4WC0A 5DBAA 4H9PC 2FMPA 3F31A 8ICKA 3V7LA 3ZT6A 3BQIA 5BPCA 4HWCA 8ICGA 4AT9A 4NKTA 2IHOA 2UUCT 5HXSA 3L3PA 1JQRA 2ACXA 1ZJMA 3J9X1 3RYIE 2R6GF 2XTLA 5J2GA 2WWUA 1LVFA 4X20E 3C66A 3ONLC 1L0VA 2PFOA 3HJ4A 2ZH1A 3ZLIA 2ACZA 3RIUA 4UR9A 4Z6EA 2WMOA 4EGWA 3FZKB 3DTOA 5LHHB 5LBMA 5CJ7A 4X4QA 2Y6XA 3IHRA 2LSIA 5DJQC 1ZQQA 4WC3A 3VHLA 4AKHA 2NP9A 4WC6A 1D1CA 2WB5A 4YFSA 1MMAA 3P4RA 3PE0A 3RH5A 1W0BA 3H3AA 4UV9B 4OX9T 1E7PA 4UVCB 5HREA 2VL8A 4O67A 3RLFF 2GK9A 4O4IE 2PBEA 3TLWA 2P9BA 2BCUA 1OEDA 1DU2A 3ZEFB 1D0ZA 3SFDA 2GA9D 5AQQB 3E0ZA 1Y64B 2AE9A 4UF0B 3EDVA 4MFRA 4IT4A 4TUYE 2CBIA 5LP6E 3V7JA 2F4VT 5J0SA 1MQ2A 2JIWA 4WYVA 3RRWA 2BPFA 5AQLB 2ZH7A 4FI5A 4PFPA 3BK9A 2KINB 1HNZT 4QZAA 8ICEA 2NTYA 1U4QA 5CWRA 4UF0A 4RWNA 4WC5A 2YK0A 3I9WA 1ZQFA 2ZM0A 2D9DA 4EZHA 2IC9A 2E9XD 5C2TA 2Q9QD 3L39A 3KFWX 4KLIA 4FJOA 4P4PA 1ZP0A 2K9AA 4LEVA 3ZMVB 3JZ0A 1IZNB 1UURA 4DUYT 4NLKA 3C50A 1BPBA 3FB2A 3U3IA 1ZQVA 5HEOA 4TWHA 2BKNA 1ZOYA 4TX5A 3AE7A 2HPLA 1XMOT 8ICLA 4A97A 1ZV4X 1Z0PA 2UXCT 5DDYA 5J0PA 3FXEB 3UXOA 1MQ3A 5JRCB 5AQGB 4IL9A 4HFHA 3OBVE 3EABA 5FXXA 1D0XA 3PJAA 4B3MT 1JAJA 1XMQT 3GWHA 3O9XA 3ZSTA 5KDMC 1HR0T 4PH5A 1ZKEA 4IDZA 4KI0F 4U72A 4O5CA 3AE9A 4ATBB 2BS3A 4TV8E 3ONJA 3RQWA 4EV6A 4EEDA 4CI1B 9ICBA 4H63H 1NWMX 7ICTA 4KLHA 4O8SA 2BS2A 2ZH6A 3HKBE 1FIOA 3KBUA 2BG9E 4Z8XA 2YU2A 4EEBA 2XQ7A 4LT6A 3PUZF 4CXYA 5HRHA 4KLJA 3UTKA 5H6QB 2VKDA 4KLQA 4DR4T 2A9UA 2HHHT 4HFIA 2UXBT 4I28A 3CX7B 4X4VA 2E8IA 2W2UA 3C5GA 4TUPA 2DVIA 2WWVA 3MKDA 3QUJA 1CUNA 5LCYA 4A5XA 2ES0A 3IBPA 4DBQA 4HFBA 4PK4A 2WU5A 2DR9A 4HE8A 7ICPA 3ABVA 2VK9A 3CMLA 4NY8A 3TLVA 1LKXA 1N33T 3VKGA 4HWDA 1JNZA 3RH6A 4UBBA 2PFNA 4RPXA 5HRGA 2IHMA 5HEUA 8ICMA 4X4RA 1LVKA 4UD4A 2FCLA 4ERRA 2OA5A 4O5EA 8ICXA 3Q5WA 1F5AA 3JAEA 3R6NA 3N9QA 3UU3A 5DECA 1ZQTA 1SA0E 3ZKRA 2DRAA 5J2KA 3JPOA 2DR7A 4GIWA 1KF6A 5FXZA 4GK0E 1SE7A 5FYMA 1MMDA 2XPKA 2BDEA 2PBIA 5J0WA 1B7TA 4YSYA 2CLYB 4X1KE 3ZN0B 4DBRA 3EF2A 3ZYLA 4I27A 1D1BA 3GMIA 4TN7B 4KUMB 4IDOA 4DVDA 5KMGP 4ILCA 4PHPA 2NOXA 3GN5A 5L4HA 4YMMA 5EK4A 4ZZCA 3P4WA 1RPLA 2ID1A 3NZQA 3LG7A 2IIUA 2XSAA 3ETVA 7ICSA 5AQJB 2LLYA 4LMLA 2KXPB 3EAMA 3PURA 4WBYA 4O4JE 5J2FA 4AT9B 5E0OA 4OK0A 4LFCT 3JC6C 2UXDT 3UQ0A 5L3GB 4KLGA 4LZDA 8ICAA 2BG9C 4JLXA 3K7DA 2CCQA 4ILBA 4Z91A 2XQ8A 1IJ6A 1SUMB 4TZ4C 3JPTA 1ZQLA 4E8FA 4M9JA 3C51A 2I9GA 3AU2A 2YINA 4QKNA 4WZXA 3RYHE 4AISA 5BR8T 4I43B 4WCWA 3CK6A 4WH5A 3RJFA 5LGNB 3AB3B 3F57A 2XQ4A 4EYUA 5J2EA 4UVAB 3EDUA 2EHOB 4DO9A 5HC9A 4O69A 5CA7A 2ODUA 5DBCA 3ZT5A 4NXVA 5IIKA 4B3TT 5HWYA 3V5UA 1KNZA 1XNQT 4I55E 3C64A 2GWSA 5LB7B 4NLNA 5F3JA 4AI6A 4M9LA 3NWIA 5HCMA 5JDMA 3AVRA 2DLRA 1KEJA 1R8CA 1PX5A 3Q5XA 2FJBA 9ICKA 9ICUA 2J62A 3RC8A 4IDQA 5IILA 1AJ3A 2W00A 3WFSC 4QX8B 1IAPA 4LEZA 4DR1T 3L09A 2MYSA 4QXBB 1HX1B 2KMFA 5HEGA 4TNWA 2OV9A 2KT9A 3PUAA 4YSXA 5KX5E 4QZFA 2BCVA 4YXDA 1BR1A 3RH4A 5JDHA 2V8SV 4QZDA 4C91A 2V5CA 4RQ5A 2VKOA 1FMVA 4BJMA 7ICGA 2YEVC 4ILAA 4U3CA 4DV0T 5HHIA 3OYZA 5IIJA 3BQKA 4FHYA 4NXNT 5FY1A 4EP7A 3RJHA 3HA4A 3NBXX 3PUSA 5FY0A 3NYBA 4PHAA 4I0UA 4DR6T 4NXZA 2DHRA 2YDQA 4GYSA 2CBJA 4XZCA 4U2YA 1ZQWA 5ADXL 2RPAA 2XHEB 3HX0A 1HNWT 4HX0A 1ZQNA 2KNDA 3HL6A 5H6RB 4IE7A 5C8YE 2V7JA 3QB5K 3CX6B 2KWHA 2XUEA 3ER9B 3KBTA 5J2HA 4O5KA 4COFA 5LMNT 3Q5DA 2WSSV 4IREA 2RA1A 4CXXA 2VKHA 5IIOA 3N9NA 5F5WA 1BPEA 4O4LE 2C5KT 3MK7C 2MOZA 4K4HA 2CXLA 3AA1B 1MMNA 4JLEA 2PFPA 5DDMA 1BPDA 4I2EA 3ZCIA 4NKUA 4M0AA 3ANWB 4LMKA 1T8BA 4RT2A 4JEHB 5HXEA 2CA5A 3UU5A 5HAXA 4RQ3A 4FHVA 4ZI3C 3UXNA 4NM2A 4AT7B 3ZJ2A 2XZEA 3M65A 1GPJA 3PNCA 2BKPA 3OTOT 8ICRA 4IL4A 4CN4A 4UB5A 4S3NA 4IE5A 8ICZA 2QGSA 3ZT7A 4CXWA 4X62T 2XQAA 4NXXA 2WS3A 3SS1A 3ER8C 2ZMAA 1T98A 3ZCJA 3NKZA 3X1DA 2LSGA 2KSRA 3VR8A 5J2JA 4YTNA 2CRBA 2EHOC 1J5WA 9ICRA 5DQVA 3OUYB 4NXUA 3TFSA 2HN1A 2ZHAA 2ODVA 3MBYA 5CP2A 2XSBA 4WC2A 5D46A 1KDHA 2E9XB 3QOFA 1UUSA 3UUXB 1EZ3A 1R8BA 4LEWA 4QX7B 3MJXA 5B3QA 5CR0A 4HFVA 4XJEA 1HCIA 2C0SA 2XAFB 4RT3A 1FEWA 2L9QA 3H38A 3OUYA 2WU2A 4GKKT 1NAFA 5ABHA 2CHNA 1KNRA 3AAAB 4QZHA 2M2WA 2XM2A 2XJ7A 2FUPA 3UU6A 4WW0A 1OU5A 1U5PA 4GK5E 3MDAA 4G63A 3AEAA 7ICJA 5LHGB 2VKJA 1HF8A 5ABFB 1YKHB 4H9RC 1BPYA 4I2CA 3C4WA 3JCFA 3PUVF 4O68A 5LA6E 2W66A 5HRBA 4HFCA 2XM1A 3KVAA 2WDRA 2BVLA 4UAWA 5L3BB 9ICJA 3P7IA 9ICCA 3C98B 3N9MA 2X51A 3TFRA 1WFDA 4L0RA 4DV5T 4CN1A 3QB5A 1Q78A 4M47A 8ICUA 4YLHA 1BPXA 4M5DA 4WC7A 4ZXLA 1YLQA 2IC6A 1ZQIA 2J1DG 8ICWA 4JLZA 1OEDB 3HJ1A 5AQKB 1FMWA 2UUBT 1I6ZA 3B0YA 5DBBA 3LK42 4UD5A 4KLMA 3K8PC 5KXJA 5CJ5A 5J29A 3RQUA 9ICOA 1YW0A 4RQ8A 2H7VC 3LK9A 3KVBA 4P0BA 3L8RA 3ZYKA 2ZM2A 1BR0A 2ZHBA 2PTFA 3OPCA 2VASA 2W62A 3ZPOA 1N32T 3RIFA 3OVSA 2NR4A 3GDXA 5FL1A 2NW8A 3PV0F 2WMNA 4KLTA 3AE1A 4HWHA 3AXJB 5LJNA 5CA1E 2E5VA 2GAFD 3KV5A 4NIQA 3ISCA 5FL0A 4YHHT 5J2IA 4AQFC 4DR7T 4DOCA 4YN4A 4B3RT 2B1EA 5FMNA 3LK3B 1CHUA 3FBLA 4EBKA 5F2VO 4JV5T 2BPGA 2H3RA 2YN6A 1T7SA 1YQ4A 4MALA 4HN9A 2ZM6T 1E1HB 3ISDA 1XNRT 3PU8A 2LKHA 3EUHA 4F6RC 5AQUB 4YTPA 8ICQA 3DJBA 1JMSA 5J0UA 2XAHB 3LK2B 9ICLA 3AQMA 8ICPA 1J5ET 3MXZA 4MFFA 3FZMB 2LOSA 4UELA 4ILUA 2MAWA 2BE3A 1VRBA 2CM0A 4KLEA 4LF4T 4GXJA 4X4TA 4K96A 8ICBA 2VURA 4JWNA 4F5PA 5DB9A 2UU9T 5B3PA 4DR2T 1MIYA 4FHXA 4GXIA 2VQET 3AXJA 1Q79A 4QZ8A 3LSVA 3NKUA 2LSJA 5BMVE 3B13A 5DABA 1FA0A 5FP3A 4UAYA 2B4VA 9ICHA 2DL1A 7ICLA 5LNKA 2LJLA 1NEKA 4EBJA 2PJQA 2RP4A 3FBZA 2LSKA 4KX6A 3UU4A 2V6YB 3N5LA 3PJAJ 4ASKA 4EAHA 2X9HA 2X9WA 3P8CD 8ICSA 4WOYA 5J0YA 4WQKA 4GYRA 4RPYA 4DMVA 5CGMA 5JVDE 2MBGA 1E2AA 4RQ1A 2V7KA 4LVSA 3V72A 4NPPA 4DV4T 4N78D 4LF9T 4B6XA 2CXFA 2VL0A 5CA0E 1HUOA 2LE8A 8ICCA 3PU3A 4OAGA 4LF7T 4LEYA 2J4GA 3OGUA 1HNXT 2BCQA 2YDSA 4I2BA 2N2NA 4CQIA 1N34T 4QZCA 3NZPA 3G06A 3AEEA 4TURA 4KLFA 3ZMZB 3F2EA 2UUAT 4NXMT 2VWAA 5JDLA 1QLBA 4EZ4A 4K97A 3MDCA 4DNDA 4KHZF 4O2AE 3VKHA 7ICUA 4QH4A 4RQ2A 3PUGA 1Z8UA 4KLLA 1ZQGA 4XA5A 1ZQCA 3CQXC 2M2TA 4RQ4A 1M7KA 3FHNA 1G8XA 3MACA 2K5BB 3C2KA 3T8OA 4RQ0A 2JQQA 2FJAA 4RQ7A 2CWOA 3LFMA 4AT8B 5AFUL 4U7IA 1TFYA 3AUOA 4H63V 5FVLA 2UXXB 3OVBA 1ZQOA 2XQ3A 4X0BA 4B3ST 1WR0A 5JDQA 2V6XA 2BCSA 1ZQYA 2YKSA 5JREA 4XQ8A 1WRDA 1HTJF 2V7IA 2Q9QA 2BPCA 4KLOA 3N2OA 2M6IA 2I0MA 4NXTA 4E7ZA 4CI3B 3T1YT 2PFQA 4DUZT 4EB6E 4X5VA 2EHOD 1BR2A 1R8AA 4OAHA 3C4XA 3C2LA 3LDQB 2LSYA 2Q9QB 4M9NA 5HRFA 4IE4A 2D0UA 2XQ9A 4TUSA 2ISPA 4O2BE 4UEMA 2W63A 1WYCA 2ZLYA 5F8PA 1OXZA 5CFUA 9ICPA 4XQ7A 1D1AA 4NUUA 5L4EA 3VRBA 4FH5A 2PFVA 4U31A 1TV9A 3MCRA 5L47A 2NRKA 5EOZA 4QZEA 3VR9A 1WOTA 1KFYA 1WYBA 1UX4A 5J2AA 2K24A 1KEYA 1KNPA 4E80A 4NLZA 5L3EB 2Y8DA 4YJ2E 5EZYE 3EVYA 7ICIA 2HPJA 4IGUA 4R64A 1ZQSA 5CFSA 4KM5A 1NENA 1W9RA 5J0QA 1XWMA 4OHFA 3PHZA 4I50E 5C3JA 4JBWF 3RRCA 1BR4A 2HN2A 1XSNA 3A8YC 4PK6A 4PK5A 1ZQRA 2EWRA 1ZJNA 1HS7A 2N1GA 1XSPA 3RI5A 3RYFE 2BG9B 5AQFB 2X0YA 4IQTA 4JUYA 1GQEA 1HFAA 1QUUA 2KLQA 3OV7A 2ZM8A 4YT0A 4MF2A 4X64T 4JI8T 1BPZA 2C5IT 5ABEA 3AQLA 4LF5T 4I2JA 5TAOA 4HFDA 2PXIA 3AEBA 4MFCA 4AKLA 1YXRA 2WZIA 4QZBA 1NOMA 4F8HA 2X0HA 2DR8A 4UIGA 4I2AA 5JRCA 5JDGA 3UPQA 9ICNA 4X65T 4BJNA 2V26A 5LOVE 3AQKA 4I2HA 9ICTA 4ZOLE 1HUZA 2WDVA 4XRHA 1WR6A 9ICWA 3IF8B 4KMCA 5JR9B 3OKQA 2BBJA 3AE5A 4M04A 3HWTA 3K3NA 1D0YA 3I1AA 5JQGE 1JNRA 8ICIA 4NM1A 2CMRA 4L9IA 5IIIA 3P4SA 3O4XE 5DEDA 4DV2T 4IQWA 4UXNB 5JDNA 4HGAA 3HR0A 4TUQA 4XUSA 1UCUA 5LMUT 3CX8B 2ZH8A 3TLTA 4IQVA 9ICAA 5D4BA 3DP7A 2JMKA 4FO1A 3ZC0A 4IE6A 1H7CA 2B51A 5FY7A 3FZHB 3FXDB 9ICGA 2B76A 4AQYT 3RYCE 2DI4A 5L3DB 4ATBA 4X0AA 2ZH4A 2E5LT 3RKGA 5J0RA 4EYYR 4YD1A 2W4XA 8ICJA 3RJEA 4U7YA 3Q9DA 4U33A 2Q9QC 2LM9A 2CLYC 2VVNA 3A5XA 5LJMA 7ICOA 4UVBB 4YY3T 3U78A 3MGIA 4TWFA 2WM9A 2VB6A 8ICFA 2WZHA 3C4ZA 1MNDA 2XASB 1R8IA 2W9MA 5CB4E 3ZYMA 5J2DA 5IWAT 8ICVA 3WAJA 4MKPA 3PDYA 4PJJA 4O9MA 5HRLA 2E9XA 3WFPA 2X68A 2W0GA 2XQ5A 1SHZC 3AAEB 5LXTE 4ANJA 4ZI3D 4RQ6A 2M2VA 3I9YA 4QXHB 3H39A 2NW9A 1UK5A 1IBKT 8ICNA 4ZI2D 5GONE 5HR9A 5ABGA 1XDOA 5AQIB 2O5AA 3ISBA 3LBXA 3AE8A 5IUXA 4R66A 1ZQHA 3BQLA 4I4TE 1UGOA 2ZH5A 1OEDE 1X79A 5D61A 5FXWA 2YU1A 3AECA 4YSZA 4JYAT 3L9DA 3OYXA 4JEUB 1UETA 3HKCE 5A1LA 1V4AA 4PGQA 2DRBA 1M62A 5CHGA 4ADZA 5DKWA 4X1YE 4LF8T 2BCRA 4PHDA 2XQYA 4YMNA 2ZH3A 4UB4A 4UB1A 2LRKA 3E08A 4WBOA 1MIWA 2YDRA 4N7RA 2DCFA 5ETWA 2A72A 4PFOA 4JWMA 2I59A 4K4IA 5HWXA 3CQGB 4KP3C 2IDOB 3AEGA 1RZTA 2WBLA 5CB1A 1XZYA 3PTRB 2WP9A 4HWFA 7ICRA 5CFTA 3GN5B 2X67A 3V5SA 3LBXB 4Z90A 3JYYA 1N36T 4UBCA 4PPXA 2XAJB 2SPCA 2LRLA 2N9DA 3JPPA 4A56A 4K98A 4UB2A 4LFAT 5J0TA 3H3MA 4K4GA 1ZHCA 1ZQJA 3ESLA 9ICEA 2FJDA 3SRZA 4ZEYA 4CI2B 1KK7A 5HXCA 2J47A 1VOMA 3NRXA 3JPQA 2CXDA 3UUNA 4QZIA 4Q25A 4K9BA 3B5MA 2FBWA 5IHYA 5TZVA 4NXWA 3PUWF 3Q2MA 3ZMSB 1ZQPA 9ICQA 4ISSA 3B57A 3RJGA 2DWKA 2JMHA 4U2ZA 4I2GA 4WBZA 2W61A 1MIVA 2JQ9A 4JI6T 3ONXA 3QC9A 4H9NC 2JRKA 4YCXA 1UEVA 2V5DA 3A7MA 5HEJA 3JPNA 5HRKA 1I94T 4DV7T 1T72A 2X0LB 3AVSA 3W15B 3WFOA 4Z6CA 1TVAA 3K3QC 4PJLA 3KV6A 4CZZB 3CKDA 4RPZA 3I0OA 4PGXA 4JI0T 1VCSA 3FZLB 3RF1A 1S35A 4BA9A 1IBLT 4PHEA 3SOLA 3RIAA 1X9BA 3CIRA 7ICEA 3ZMUB 4DIDB 2ISOA 2HHPA 7ICHA 2IHR1 4DO0A 4Z6FA 5DB8A 2QVAA 5JR9C 4IIJE 4RWQA 3P50A 4DV6T 4H9OC 5FVKA 4KBMB 4MLKA 4KLSA 2IMLA 4DV3T 1TFWA 5L2LA 2PG8A 3PUXF 1WLXA 3ZC1A 2M67A 4DR3T 3AQNA 1HG2A 4K99A 1YKEB 4F5RA 1VCTA 4MBQA 5J0ZA 5IYZE 1VFGA 5HHHA 3RHWA 3IEEA 3KDSE 5JH7E 2Z6EA 2M2UA 3C5FA 3UT5E 4JI3T 3JPRA 2LOPA 3WI3A 1ZQUA 2W67A 4JI5T 5FNVE 4LF6T 4QZGA 4OAIZ 4QZ9A 5DB6A 3PUQA 3P4PA 4AT7A 2KWIB 3Q5EA 4IDPA 4M1PA 5LG4A 3HIYA 5HEHA 2BZBA 4X5TA 2XAGB 5AQSB 1OEDC 2WDQA 4ZZBA 4R63A 4OYKA 2I6HA 2K3WA 2X9XA 1HX8A 1S94A 4MF8A 3ERCC 2C5JA 3UULA 4QXCB 3WFRE 1WCRA 3ANWA 2WQYA 4IG8A 4I2FA 3N9LA 3NVOA 4X1IE 7ICMA 4K8VA 3QNUA 4OAFA 4PNIA 3PMLA 5AQHB 3TLUA 4L5GA 1V9DA 4F5QA 3KV9A 4X66T 2MPKA 2D0TA 4Z6DA 4ISTA 5AQNB 2X66A 4YJ3E 3JC6D 2H7OA 4AIUA 4AQFA 2IAKA 5LBQB 3CQCB 5LHIB 5BOLA 5AQVB 2ZH9A 2FMSA 2YOEA 4IE0A 2BVMA 1UX5A 5BOMA 4NUVA 2LT3A 2UXNB 4LMJA 4XAXB 4E7XA 3ZN1B 3N9PA 3LQCB 3J7Yq 8ICHA 4RWOA 2BBHA 3PUYF 2QRXA 2XAQB 8ICTA 4AT8A 4I2IA 4TNVA 4YMOA 9ICVA 4HTEA 2NW7A 2O1PA 4RWPA 4IDNA 3MZKB 3AA6B 2LM2A 3RH3A 3JAFA 3P4QA 3TKLB 5HRIA 3ZJ1A 3RJJA 2B56A 4KLDA 2BS4A 1IJ5A 5DB7A 4IHJE 3V7KA 1QSDA 3UQ7A 3HI2A 1MNEA 3AE6A 3SWHA 2VQFT 5AQRB 2H88A 4YTMA 4WQLA 4P4MA 7ICNA 4PJNA 1ZQZA 3UUMA 4ZI7E 5J2UE 4BAYB 5HXRA 4G2AA 4M9HA 3UQ4A 9ICIA 4AKGA 4X4UA 4HFEA 4ZHQE 4C90A 4X4SA 4FH3A 3RC3A 2MTQA 2D5UA 2CPTA 4P4OA 5IIMA 2CE7A 3JADA 4JI4T 4DR5T 3RPUA 1O3XA 4OFZA 3GA8A 1G73A 2P66A 3ZSSA 2OLTA 4U74A 1ZQAA 4WC1A 1W09A 4M9GA 3FZFB 3UU8A
chains in the Genus database with same CATH topology
3NWIA 4I0UA 5JTGA 4EGWA 2BBHA 4EV6A 4EEDA 3NVOA 2BBJA 3CK6A 3JCFA 3RKGA 4EEBA 2HN2A 2HN1A 2IUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NWI A;  4I0U A;  5JTG A;  4EGW A;  2BBH A;  4EV6 A;  4EED A;  3NVO A;  2BBJ A;  3CK6 A;  3JCF A;  3RKG A;  4EEB A;  2HN2 A;  2HN1 A;  2IUB A; 
#chains in the Genus database with same CATH topology
 5IIN A;  1HG5 A;  3HKE E;  5ABF A;  4HWI B;  9ICM A;  2AXD S;  4P09 A;  4M2Y A;  3RKO A;  3O1I A;  3QK6 A;  4AXP A;  4GXK A;  4JI7 T;  4E7S A;  8ICY A;  1ZEE A;  2V7L A;  2BKO A;  3T1H T;  3UFG A;  3RX6 A;  3ETU A;  2NTX A;  5HXH A;  4ZS2 A;  5D63 A;  3S4U A;  4PGY A;  2A3D A;  2LHN A;  3KV4 A;  2Y48 B;  1VJ7 A;  1ZQM A;  4AKI A;  5HRD A;  5J2B A;  2WY2 A;  4CN6 A;  1R89 A;  2V1D B;  3AED A;  3KIN B;  1OWA A;  3AA0 B;  4KHP T;  4P2H A;  1Y01 A;  2BG9 A;  3IA3 A;  4EOZ B;  5LYJ E;  1US7 B;  3AA7 B;  2ZH2 A;  4XBF B;  9ICX A;  4KB6 A;  2KZ7 B;  3K3O A;  2FJE A;  3EI0 A;  2H89 A;  4O4H E;  2A2F X;  4PW8 A;  1ZQX A;  3C18 A;  3O1H A;  5EK2 A;  2E9X C;  2RFF A;  3OVA A;  1MMG A;  3CVR A;  1ZQD A;  5J2T E;  5CHE A;  5HCJ A;  7ICK A;  3CPZ A;  7ICQ A;  1W0A A;  2DR5 A;  2V6Y A;  5J1G A;  4X4O A;  5HYA A;  3AE2 A;  2LKG A;  3O1J A;  4X4P A;  3CWZ B;  5J2C A;  5JR9 A;  3AEF A;  3RGL A;  2L8K A;  2DNX A;  4WC4 A;  4H9S E;  9ICS A;  7ICF A;  3N2G E;  2JQH A;  1YQ3 A;  8ICO A;  2XY8 B;  4AKR B;  4A98 A;  3OJA A;  7ICV A;  4UAZ A;  3MGH A;  3E22 E;  3JPS A;  1FJG T;  5AQT B;  4I2D A;  2G0U A;  4PJM A;  3UUB A;  2CHO A;  2IW5 B;  3I0Q A;  3PMN A;  2LEH A;  2LHR A;  2CWY A;  4DOA A;  4LZG A;  4K9A A;  2FMQ A;  5M4Y A;  4FO6 A;  4HKA A;  3K1S A;  3VRA A;  3HW8 A;  5DQW A;  2EHO A;  2WAU A;  2DWG A;  1ZQK A;  4FHW A;  4JI1 T;  3NRY A;  4EXT A;  2M6B A;  4DOB A;  3D0T A;  1UEU A;  3N2K E;  4JI2 T;  5JDF A;  1ZQE A;  4ZS3 A;  4H9Q C;  3LJC A;  5AQP B;  4WNK A;  3UFE A;  1LRZ A;  3ZMT B;  2Q66 A;  4HEA A;  3VU7 H;  2VAN A;  1YD8 G;  3OWG A;  4UB3 A;  3MA9 A;  4GOU A;  5FKY A;  4DV1 T;  3RJI A;  2WCA A;  2IUB A;  4MFA A;  3TLS A;  4GKJ T;  4DMW A;  4EIW A;  5J0O A;  3EHZ A;  3RIU C;  4O6A A;  2L3L A;  2D2S A;  1IBM T;  2JQK A;  4QHO A;  3AE4 A;  1JN3 A;  3M3Z B;  2JPF A;  2QA7 A;  4F5O A;  4UV8 B;  5L3C B;  2XQ6 A;  4F5N A;  4QH5 A;  3UXP A;  3AAI A;  4QH1 A;  2VVS A;  4P1N A;  5L3F B;  5JTG A;  4OYJ A;  5AQM B;  1XDP A;  3H37 A;  4TWD A;  5D49 A;  5J0X A;  4K0K T;  9ICF A;  2CEA A;  5LGT B;  3UQ2 A;  1ZQB A;  4PAG A;  2QYW A;  4V1A v;  3AE3 A;  4TV9 E;  3HKD E;  3SFE A;  4WBN E;  4LFB T;  4X4N A;  4MHC A;  3AU6 A;  4QWN B;  4KLU A;  4YHJ A;  3WFQ E;  4J2C A;  5FXV A;  4R65 A;  3UPS A;  4YD2 A;  2K48 A;  5AQO B;  4P0A A;  4AQG A;  2JJ9 A;  5EK3 A;  4I29 A;  2X9Y A;  4IQU A;  5LG3 A;  5D62 A;  3R84 B;  5CFB A;  3WAK A;  2NWB A;  3N9O A;  1J1J A;  2V7M A;  3B0X A;  5LGU B;  1KNY A;  1XSL A;  3C2M A;  4ZI2 C;  4K0U A;  3RJK A;  1NO5 A;  4FHP A;  3K75 D;  2HH7 A;  2E2A A;  3OVU A;  4WC0 A;  5DBA A;  4H9P C;  2FMP A;  3F31 A;  8ICK A;  3V7L A;  3ZT6 A;  3BQI A;  5BPC A;  4HWC A;  8ICG A;  4AT9 A;  4NKT A;  2IHO A;  2UUC T;  5HXS A;  3L3P A;  1JQR A;  2ACX A;  1ZJM A;  3J9X 1;  3RYI E;  2R6G F;  2XTL A;  5J2G A;  2WWU A;  1LVF A;  4X20 E;  3C66 A;  3ONL C;  1L0V A;  2PFO A;  3HJ4 A;  2ZH1 A;  3ZLI A;  2ACZ A;  3RIU A;  4UR9 A;  4Z6E A;  2WMO A;  4EGW A;  3FZK B;  3DTO A;  5LHH B;  5LBM A;  5CJ7 A;  4X4Q A;  2Y6X A;  3IHR A;  2LSI A;  5DJQ C;  1ZQQ A;  4WC3 A;  3VHL A;  4AKH A;  2NP9 A;  4WC6 A;  1D1C A;  2WB5 A;  4YFS A;  1MMA A;  3P4R A;  3PE0 A;  3RH5 A;  1W0B A;  3H3A A;  4UV9 B;  4OX9 T;  1E7P A;  4UVC B;  5HRE A;  2VL8 A;  4O67 A;  3RLF F;  2GK9 A;  4O4I E;  2PBE A;  3TLW A;  2P9B A;  2BCU A;  1OED A;  1DU2 A;  3ZEF B;  1D0Z A;  3SFD A;  2GA9 D;  5AQQ B;  3E0Z A;  1Y64 B;  2AE9 A;  4UF0 B;  3EDV A;  4MFR A;  4IT4 A;  4TUY E;  2CBI A;  5LP6 E;  3V7J A;  2F4V T;  5J0S A;  1MQ2 A;  2JIW A;  4WYV A;  3RRW A;  2BPF A;  5AQL B;  2ZH7 A;  4FI5 A;  4PFP A;  3BK9 A;  2KIN B;  1HNZ T;  4QZA A;  8ICE A;  2NTY A;  1U4Q A;  5CWR A;  4UF0 A;  4RWN A;  4WC5 A;  2YK0 A;  3I9W A;  1ZQF A;  2ZM0 A;  2D9D A;  4EZH A;  2IC9 A;  2E9X D;  5C2T A;  2Q9Q D;  3L39 A;  3KFW X;  4KLI A;  4FJO A;  4P4P A;  1ZP0 A;  2K9A A;  4LEV A;  3ZMV B;  3JZ0 A;  1IZN B;  1UUR A;  4DUY T;  4NLK A;  3C50 A;  1BPB A;  3FB2 A;  3U3I A;  1ZQV A;  5HEO A;  4TWH A;  2BKN A;  1ZOY A;  4TX5 A;  3AE7 A;  2HPL A;  1XMO T;  8ICL A;  4A97 A;  1ZV4 X;  1Z0P A;  2UXC T;  5DDY A;  5J0P A;  3FXE B;  3UXO A;  1MQ3 A;  5JRC B;  5AQG B;  4IL9 A;  4HFH A;  3OBV E;  3EAB A;  5FXX A;  1D0X A;  3PJA A;  4B3M T;  1JAJ A;  1XMQ T;  3GWH A;  3O9X A;  3ZST A;  5KDM C;  1HR0 T;  4PH5 A;  1ZKE A;  4IDZ A;  4KI0 F;  4U72 A;  4O5C A;  3AE9 A;  4ATB B;  2BS3 A;  4TV8 E;  3ONJ A;  3RQW A;  4EV6 A;  4EED A;  4CI1 B;  9ICB A;  4H63 H;  1NWM X;  7ICT A;  4KLH A;  4O8S A;  2BS2 A;  2ZH6 A;  3HKB E;  1FIO A;  3KBU A;  2BG9 E;  4Z8X A;  2YU2 A;  4EEB A;  2XQ7 A;  4LT6 A;  3PUZ F;  4CXY A;  5HRH A;  4KLJ A;  3UTK A;  5H6Q B;  2VKD A;  4KLQ A;  4DR4 T;  2A9U A;  2HHH T;  4HFI A;  2UXB T;  4I28 A;  3CX7 B;  4X4V A;  2E8I A;  2W2U A;  3C5G A;  4TUP A;  2DVI A;  2WWV A;  3MKD A;  3QUJ A;  1CUN A;  5LCY A;  4A5X A;  2ES0 A;  3IBP A;  4DBQ A;  4HFB A;  4PK4 A;  2WU5 A;  2DR9 A;  4HE8 A;  7ICP A;  3ABV A;  2VK9 A;  3CML A;  4NY8 A;  3TLV A;  1LKX A;  1N33 T;  3VKG A;  4HWD A;  1JNZ A;  3RH6 A;  4UBB A;  2PFN A;  4RPX A;  5HRG A;  2IHM A;  5HEU A;  8ICM A;  4X4R A;  1LVK A;  4UD4 A;  2FCL A;  4ERR A;  2OA5 A;  4O5E A;  8ICX A;  3Q5W A;  1F5A A;  3JAE A;  3R6N A;  3N9Q A;  3UU3 A;  5DEC A;  1ZQT A;  1SA0 E;  3ZKR A;  2DRA A;  5J2K A;  3JPO A;  2DR7 A;  4GIW A;  1KF6 A;  5FXZ A;  4GK0 E;  1SE7 A;  5FYM A;  1MMD A;  2XPK A;  2BDE A;  2PBI A;  5J0W A;  1B7T A;  4YSY A;  2CLY B;  4X1K E;  3ZN0 B;  4DBR A;  3EF2 A;  3ZYL A;  4I27 A;  1D1B A;  3GMI A;  4TN7 B;  4KUM B;  4IDO A;  4DVD A;  5KMG P;  4ILC A;  4PHP A;  2NOX A;  3GN5 A;  5L4H A;  4YMM A;  5EK4 A;  4ZZC A;  3P4W A;  1RPL A;  2ID1 A;  3NZQ A;  3LG7 A;  2IIU A;  2XSA A;  3ETV A;  7ICS A;  5AQJ B;  2LLY A;  4LML A;  2KXP B;  3EAM A;  3PUR A;  4WBY A;  4O4J E;  5J2F A;  4AT9 B;  5E0O A;  4OK0 A;  4LFC T;  3JC6 C;  2UXD T;  3UQ0 A;  5L3G B;  4KLG A;  4LZD A;  8ICA A;  2BG9 C;  4JLX A;  3K7D A;  2CCQ A;  4ILB A;  4Z91 A;  2XQ8 A;  1IJ6 A;  1SUM B;  4TZ4 C;  3JPT A;  1ZQL A;  4E8F A;  4M9J A;  3C51 A;  2I9G A;  3AU2 A;  2YIN A;  4QKN A;  4WZX A;  3RYH E;  4AIS A;  5BR8 T;  4I43 B;  4WCW A;  3CK6 A;  4WH5 A;  3RJF A;  5LGN B;  3AB3 B;  3F57 A;  2XQ4 A;  4EYU A;  5J2E A;  4UVA B;  3EDU A;  2EHO B;  4DO9 A;  5HC9 A;  4O69 A;  5CA7 A;  2ODU A;  5DBC A;  3ZT5 A;  4NXV A;  5IIK A;  4B3T T;  5HWY A;  3V5U A;  1KNZ A;  1XNQ T;  4I55 E;  3C64 A;  2GWS A;  5LB7 B;  4NLN A;  5F3J A;  4AI6 A;  4M9L A;  3NWI A;  5HCM A;  5JDM A;  3AVR A;  2DLR A;  1KEJ A;  1R8C A;  1PX5 A;  3Q5X A;  2FJB A;  9ICK A;  9ICU A;  2J62 A;  3RC8 A;  4IDQ A;  5IIL A;  1AJ3 A;  2W00 A;  3WFS C;  4QX8 B;  1IAP A;  4LEZ A;  4DR1 T;  3L09 A;  2MYS A;  4QXB B;  1HX1 B;  2KMF A;  5HEG A;  4TNW A;  2OV9 A;  2KT9 A;  3PUA A;  4YSX A;  5KX5 E;  4QZF A;  2BCV A;  4YXD A;  1BR1 A;  3RH4 A;  5JDH A;  2V8S V;  4QZD A;  4C91 A;  2V5C A;  4RQ5 A;  2VKO A;  1FMV A;  4BJM A;  7ICG A;  2YEV C;  4ILA A;  4U3C A;  4DV0 T;  5HHI A;  3OYZ A;  5IIJ A;  3BQK A;  4FHY A;  4NXN T;  5FY1 A;  4EP7 A;  3RJH A;  3HA4 A;  3NBX X;  3PUS A;  5FY0 A;  3NYB A;  4PHA A;  4I0U A;  4DR6 T;  4NXZ A;  2DHR A;  2YDQ A;  4GYS A;  2CBJ A;  4XZC A;  4U2Y A;  1ZQW A;  5ADX L;  2RPA A;  2XHE B;  3HX0 A;  1HNW T;  4HX0 A;  1ZQN A;  2KND A;  3HL6 A;  5H6R B;  4IE7 A;  5C8Y E;  2V7J A;  3QB5 K;  3CX6 B;  2KWH A;  2XUE A;  3ER9 B;  3KBT A;  5J2H A;  4O5K A;  4COF A;  5LMN T;  3Q5D A;  2WSS V;  4IRE A;  2RA1 A;  4CXX A;  2VKH A;  5IIO A;  3N9N A;  5F5W A;  1BPE A;  4O4L E;  2C5K T;  3MK7 C;  2MOZ A;  4K4H A;  2CXL A;  3AA1 B;  1MMN A;  4JLE A;  2PFP A;  5DDM A;  1BPD A;  4I2E A;  3ZCI A;  4NKU A;  4M0A A;  3ANW B;  4LMK A;  1T8B A;  4RT2 A;  4JEH B;  5HXE A;  2CA5 A;  3UU5 A;  5HAX A;  4RQ3 A;  4FHV A;  4ZI3 C;  3UXN A;  4NM2 A;  4AT7 B;  3ZJ2 A;  2XZE A;  3M65 A;  1GPJ A;  3PNC A;  2BKP A;  3OTO T;  8ICR A;  4IL4 A;  4CN4 A;  4UB5 A;  4S3N A;  4IE5 A;  8ICZ A;  2QGS A;  3ZT7 A;  4CXW A;  4X62 T;  2XQA A;  4NXX A;  2WS3 A;  3SS1 A;  3ER8 C;  2ZMA A;  1T98 A;  3ZCJ A;  3NKZ A;  3X1D A;  2LSG A;  2KSR A;  3VR8 A;  5J2J A;  4YTN A;  2CRB A;  2EHO C;  1J5W A;  9ICR A;  5DQV A;  3OUY B;  4NXU A;  3TFS A;  2HN1 A;  2ZHA A;  2ODV A;  3MBY A;  5CP2 A;  2XSB A;  4WC2 A;  5D46 A;  1KDH A;  2E9X B;  3QOF A;  1UUS A;  3UUX B;  1EZ3 A;  1R8B A;  4LEW A;  4QX7 B;  3MJX A;  5B3Q A;  5CR0 A;  4HFV A;  4XJE A;  1HCI A;  2C0S A;  2XAF B;  4RT3 A;  1FEW A;  2L9Q A;  3H38 A;  3OUY A;  2WU2 A;  4GKK T;  1NAF A;  5ABH A;  2CHN A;  1KNR A;  3AAA B;  4QZH A;  2M2W A;  2XM2 A;  2XJ7 A;  2FUP A;  3UU6 A;  4WW0 A;  1OU5 A;  1U5P A;  4GK5 E;  3MDA A;  4G63 A;  3AEA A;  7ICJ A;  5LHG B;  2VKJ A;  1HF8 A;  5ABF B;  1YKH B;  4H9R C;  1BPY A;  4I2C A;  3C4W A;  3JCF A;  3PUV F;  4O68 A;  5LA6 E;  2W66 A;  5HRB A;  4HFC A;  2XM1 A;  3KVA A;  2WDR A;  2BVL A;  4UAW A;  5L3B B;  9ICJ A;  3P7I A;  9ICC A;  3C98 B;  3N9M A;  2X51 A;  3TFR A;  1WFD A;  4L0R A;  4DV5 T;  4CN1 A;  3QB5 A;  1Q78 A;  4M47 A;  8ICU A;  4YLH A;  1BPX A;  4M5D A;  4WC7 A;  4ZXL A;  1YLQ A;  2IC6 A;  1ZQI A;  2J1D G;  8ICW A;  4JLZ A;  1OED B;  3HJ1 A;  5AQK B;  1FMW A;  2UUB T;  1I6Z A;  3B0Y A;  5DBB A;  3LK4 2;  4UD5 A;  4KLM A;  3K8P C;  5KXJ A;  5CJ5 A;  5J29 A;  3RQU A;  9ICO A;  1YW0 A;  4RQ8 A;  2H7V C;  3LK9 A;  3KVB A;  4P0B A;  3L8R A;  3ZYK A;  2ZM2 A;  1BR0 A;  2ZHB A;  2PTF A;  3OPC A;  2VAS A;  2W62 A;  3ZPO A;  1N32 T;  3RIF A;  3OVS A;  2NR4 A;  3GDX A;  5FL1 A;  2NW8 A;  3PV0 F;  2WMN A;  4KLT A;  3AE1 A;  4HWH A;  3AXJ B;  5LJN A;  5CA1 E;  2E5V A;  2GAF D;  3KV5 A;  4NIQ A;  3ISC A;  5FL0 A;  4YHH T;  5J2I A;  4AQF C;  4DR7 T;  4DOC A;  4YN4 A;  4B3R T;  2B1E A;  5FMN A;  3LK3 B;  1CHU A;  3FBL A;  4EBK A;  5F2V O;  4JV5 T;  2BPG A;  2H3R A;  2YN6 A;  1T7S A;  1YQ4 A;  4MAL A;  4HN9 A;  2ZM6 T;  1E1H B;  3ISD A;  1XNR T;  3PU8 A;  2LKH A;  3EUH A;  4F6R C;  5AQU B;  4YTP A;  8ICQ A;  3DJB A;  1JMS A;  5J0U A;  2XAH B;  3LK2 B;  9ICL A;  3AQM A;  8ICP A;  1J5E T;  3MXZ A;  4MFF A;  3FZM B;  2LOS A;  4UEL A;  4ILU A;  2MAW A;  2BE3 A;  1VRB A;  2CM0 A;  4KLE A;  4LF4 T;  4GXJ A;  4X4T A;  4K96 A;  8ICB A;  2VUR A;  4JWN A;  4F5P A;  5DB9 A;  2UU9 T;  5B3P A;  4DR2 T;  1MIY A;  4FHX A;  4GXI A;  2VQE T;  3AXJ A;  1Q79 A;  4QZ8 A;  3LSV A;  3NKU A;  2LSJ A;  5BMV E;  3B13 A;  5DAB A;  1FA0 A;  5FP3 A;  4UAY A;  2B4V A;  9ICH A;  2DL1 A;  7ICL A;  5LNK A;  2LJL A;  1NEK A;  4EBJ A;  2PJQ A;  2RP4 A;  3FBZ A;  2LSK A;  4KX6 A;  3UU4 A;  2V6Y B;  3N5L A;  3PJA J;  4ASK A;  4EAH A;  2X9H A;  2X9W A;  3P8C D;  8ICS A;  4WOY A;  5J0Y A;  4WQK A;  4GYR A;  4RPY A;  4DMV A;  5CGM A;  5JVD E;  2MBG A;  1E2A A;  4RQ1 A;  2V7K A;  4LVS A;  3V72 A;  4NPP A;  4DV4 T;  4N78 D;  4LF9 T;  4B6X A;  2CXF A;  2VL0 A;  5CA0 E;  1HUO A;  2LE8 A;  8ICC A;  3PU3 A;  4OAG A;  4LF7 T;  4LEY A;  2J4G A;  3OGU A;  1HNX T;  2BCQ A;  2YDS A;  4I2B A;  2N2N A;  4CQI A;  1N34 T;  4QZC A;  3NZP A;  3G06 A;  3AEE A;  4TUR A;  4KLF A;  3ZMZ B;  3F2E A;  2UUA T;  4NXM T;  2VWA A;  5JDL A;  1QLB A;  4EZ4 A;  4K97 A;  3MDC A;  4DND A;  4KHZ F;  4O2A E;  3VKH A;  7ICU A;  4QH4 A;  4RQ2 A;  3PUG A;  1Z8U A;  4KLL A;  1ZQG A;  4XA5 A;  1ZQC A;  3CQX C;  2M2T A;  4RQ4 A;  1M7K A;  3FHN A;  1G8X A;  3MAC A;  2K5B B;  3C2K A;  3T8O A;  4RQ0 A;  2JQQ A;  2FJA A;  4RQ7 A;  2CWO A;  3LFM A;  4AT8 B;  5AFU L;  4U7I A;  1TFY A;  3AUO A;  4H63 V;  5FVL A;  2UXX B;  3OVB A;  1ZQO A;  2XQ3 A;  4X0B A;  4B3S T;  1WR0 A;  5JDQ A;  2V6X A;  2BCS A;  1ZQY A;  2YKS A;  5JRE A;  4XQ8 A;  1WRD A;  1HTJ F;  2V7I A;  2Q9Q A;  2BPC A;  4KLO A;  3N2O A;  2M6I A;  2I0M A;  4NXT A;  4E7Z A;  4CI3 B;  3T1Y T;  2PFQ A;  4DUZ T;  4EB6 E;  4X5V A;  2EHO D;  1BR2 A;  1R8A A;  4OAH A;  3C4X A;  3C2L A;  3LDQ B;  2LSY A;  2Q9Q B;  4M9N A;  5HRF A;  4IE4 A;  2D0U A;  2XQ9 A;  4TUS A;  2ISP A;  4O2B E;  4UEM A;  2W63 A;  1WYC A;  2ZLY A;  5F8P A;  1OXZ A;  5CFU A;  9ICP A;  4XQ7 A;  1D1A A;  4NUU A;  5L4E A;  3VRB A;  4FH5 A;  2PFV A;  4U31 A;  1TV9 A;  3MCR A;  5L47 A;  2NRK A;  5EOZ A;  4QZE A;  3VR9 A;  1WOT A;  1KFY A;  1WYB A;  1UX4 A;  5J2A A;  2K24 A;  1KEY A;  1KNP A;  4E80 A;  4NLZ A;  5L3E B;  2Y8D A;  4YJ2 E;  5EZY E;  3EVY A;  7ICI A;  2HPJ A;  4IGU A;  4R64 A;  1ZQS A;  5CFS A;  4KM5 A;  1NEN A;  1W9R A;  5J0Q A;  1XWM A;  4OHF A;  3PHZ A;  4I50 E;  5C3J A;  4JBW F;  3RRC A;  1BR4 A;  2HN2 A;  1XSN A;  3A8Y C;  4PK6 A;  4PK5 A;  1ZQR A;  2EWR A;  1ZJN A;  1HS7 A;  2N1G A;  1XSP A;  3RI5 A;  3RYF E;  2BG9 B;  5AQF B;  2X0Y A;  4IQT A;  4JUY A;  1GQE A;  1HFA A;  1QUU A;  2KLQ A;  3OV7 A;  2ZM8 A;  4YT0 A;  4MF2 A;  4X64 T;  4JI8 T;  1BPZ A;  2C5I T;  5ABE A;  3AQL A;  4LF5 T;  4I2J A;  5TAO A;  4HFD A;  2PXI A;  3AEB A;  4MFC A;  4AKL A;  1YXR A;  2WZI A;  4QZB A;  1NOM A;  4F8H A;  2X0H A;  2DR8 A;  4UIG A;  4I2A A;  5JRC A;  5JDG A;  3UPQ A;  9ICN A;  4X65 T;  4BJN A;  2V26 A;  5LOV E;  3AQK A;  4I2H A;  9ICT A;  4ZOL E;  1HUZ A;  2WDV A;  4XRH A;  1WR6 A;  9ICW A;  3IF8 B;  4KMC A;  5JR9 B;  3OKQ A;  2BBJ A;  3AE5 A;  4M04 A;  3HWT A;  3K3N A;  1D0Y A;  3I1A A;  5JQG E;  1JNR A;  8ICI A;  4NM1 A;  2CMR A;  4L9I A;  5III A;  3P4S A;  3O4X E;  5DED A;  4DV2 T;  4IQW A;  4UXN B;  5JDN A;  4HGA A;  3HR0 A;  4TUQ A;  4XUS A;  1UCU A;  5LMU T;  3CX8 B;  2ZH8 A;  3TLT A;  4IQV A;  9ICA A;  5D4B A;  3DP7 A;  2JMK A;  4FO1 A;  3ZC0 A;  4IE6 A;  1H7C A;  2B51 A;  5FY7 A;  3FZH B;  3FXD B;  9ICG A;  2B76 A;  4AQY T;  3RYC E;  2DI4 A;  5L3D B;  4ATB A;  4X0A A;  2ZH4 A;  2E5L T;  3RKG A;  5J0R A;  4EYY R;  4YD1 A;  2W4X A;  8ICJ A;  3RJE A;  4U7Y A;  3Q9D A;  4U33 A;  2Q9Q C;  2LM9 A;  2CLY C;  2VVN A;  3A5X A;  5LJM A;  7ICO A;  4UVB B;  4YY3 T;  3U78 A;  3MGI A;  4TWF A;  2WM9 A;  2VB6 A;  8ICF A;  2WZH A;  3C4Z A;  1MND A;  2XAS B;  1R8I A;  2W9M A;  5CB4 E;  3ZYM A;  5J2D A;  5IWA T;  8ICV A;  3WAJ A;  4MKP A;  3PDY A;  4PJJ A;  4O9M A;  5HRL A;  2E9X A;  3WFP A;  2X68 A;  2W0G A;  2XQ5 A;  1SHZ C;  3AAE B;  5LXT E;  4ANJ A;  4ZI3 D;  4RQ6 A;  2M2V A;  3I9Y A;  4QXH B;  3H39 A;  2NW9 A;  1UK5 A;  1IBK T;  8ICN A;  4ZI2 D;  5GON E;  5HR9 A;  5ABG A;  1XDO A;  5AQI B;  2O5A A;  3ISB A;  3LBX A;  3AE8 A;  5IUX A;  4R66 A;  1ZQH A;  3BQL A;  4I4T E;  1UGO A;  2ZH5 A;  1OED E;  1X79 A;  5D61 A;  5FXW A;  2YU1 A;  3AEC A;  4YSZ A;  4JYA T;  3L9D A;  3OYX A;  4JEU B;  1UET A;  3HKC E;  5A1L A;  1V4A A;  4PGQ A;  2DRB A;  1M62 A;  5CHG A;  4ADZ A;  5DKW A;  4X1Y E;  4LF8 T;  2BCR A;  4PHD A;  2XQY A;  4YMN A;  2ZH3 A;  4UB4 A;  4UB1 A;  2LRK A;  3E08 A;  4WBO A;  1MIW A;  2YDR A;  4N7R A;  2DCF A;  5ETW A;  2A72 A;  4PFO A;  4JWM A;  2I59 A;  4K4I A;  5HWX A;  3CQG B;  4KP3 C;  2IDO B;  3AEG A;  1RZT A;  2WBL A;  5CB1 A;  1XZY A;  3PTR B;  2WP9 A;  4HWF A;  7ICR A;  5CFT A;  3GN5 B;  2X67 A;  3V5S A;  3LBX B;  4Z90 A;  3JYY A;  1N36 T;  4UBC A;  4PPX A;  2XAJ B;  2SPC A;  2LRL A;  2N9D A;  3JPP A;  4A56 A;  4K98 A;  4UB2 A;  4LFA T;  5J0T A;  3H3M A;  4K4G A;  1ZHC A;  1ZQJ A;  3ESL A;  9ICE A;  2FJD A;  3SRZ A;  4ZEY A;  4CI2 B;  1KK7 A;  5HXC A;  2J47 A;  1VOM A;  3NRX A;  3JPQ A;  2CXD A;  3UUN A;  4QZI A;  4Q25 A;  4K9B A;  3B5M A;  2FBW A;  5IHY A;  5TZV A;  4NXW A;  3PUW F;  3Q2M A;  3ZMS B;  1ZQP A;  9ICQ A;  4ISS A;  3B57 A;  3RJG A;  2DWK A;  2JMH A;  4U2Z A;  4I2G A;  4WBZ A;  2W61 A;  1MIV A;  2JQ9 A;  4JI6 T;  3ONX A;  3QC9 A;  4H9N C;  2JRK A;  4YCX A;  1UEV A;  2V5D A;  3A7M A;  5HEJ A;  3JPN A;  5HRK A;  1I94 T;  4DV7 T;  1T72 A;  2X0L B;  3AVS A;  3W15 B;  3WFO A;  4Z6C A;  1TVA A;  3K3Q C;  4PJL A;  3KV6 A;  4CZZ B;  3CKD A;  4RPZ A;  3I0O A;  4PGX A;  4JI0 T;  1VCS A;  3FZL B;  3RF1 A;  1S35 A;  4BA9 A;  1IBL T;  4PHE A;  3SOL A;  3RIA A;  1X9B A;  3CIR A;  7ICE A;  3ZMU B;  4DID B;  2ISO A;  2HHP A;  7ICH A;  2IHR 1;  4DO0 A;  4Z6F A;  5DB8 A;  2QVA A;  5JR9 C;  4IIJ E;  4RWQ A;  3P50 A;  4DV6 T;  4H9O C;  5FVK A;  4KBM B;  4MLK A;  4KLS A;  2IML A;  4DV3 T;  1TFW A;  5L2L A;  2PG8 A;  3PUX F;  1WLX A;  3ZC1 A;  2M67 A;  4DR3 T;  3AQN A;  1HG2 A;  4K99 A;  1YKE B;  4F5R A;  1VCT A;  4MBQ A;  5J0Z A;  5IYZ E;  1VFG A;  5HHH A;  3RHW A;  3IEE A;  3KDS E;  5JH7 E;  2Z6E A;  2M2U A;  3C5F A;  3UT5 E;  4JI3 T;  3JPR A;  2LOP A;  3WI3 A;  1ZQU A;  2W67 A;  4JI5 T;  5FNV E;  4LF6 T;  4QZG A;  4OAI Z;  4QZ9 A;  5DB6 A;  3PUQ A;  3P4P A;  4AT7 A;  2KWI B;  3Q5E A;  4IDP A;  4M1P A;  5LG4 A;  3HIY A;  5HEH A;  2BZB A;  4X5T A;  2XAG B;  5AQS B;  1OED C;  2WDQ A;  4ZZB A;  4R63 A;  4OYK A;  2I6H A;  2K3W A;  2X9X A;  1HX8 A;  1S94 A;  4MF8 A;  3ERC C;  2C5J A;  3UUL A;  4QXC B;  3WFR E;  1WCR A;  3ANW A;  2WQY A;  4IG8 A;  4I2F A;  3N9L A;  3NVO A;  4X1I E;  7ICM A;  4K8V A;  3QNU A;  4OAF A;  4PNI A;  3PML A;  5AQH B;  3TLU A;  4L5G A;  1V9D A;  4F5Q A;  3KV9 A;  4X66 T;  2MPK A;  2D0T A;  4Z6D A;  4IST A;  5AQN B;  2X66 A;  4YJ3 E;  3JC6 D;  2H7O A;  4AIU A;  4AQF A;  2IAK A;  5LBQ B;  3CQC B;  5LHI B;  5BOL A;  5AQV B;  2ZH9 A;  2FMS A;  2YOE A;  4IE0 A;  2BVM A;  1UX5 A;  5BOM A;  4NUV A;  2LT3 A;  2UXN B;  4LMJ A;  4XAX B;  4E7X A;  3ZN1 B;  3N9P A;  3LQC B;  3J7Y q;  8ICH A;  4RWO A;  2BBH A;  3PUY F;  2QRX A;  2XAQ B;  8ICT A;  4AT8 A;  4I2I A;  4TNV A;  4YMO A;  9ICV A;  4HTE A;  2NW7 A;  2O1P A;  4RWP A;  4IDN A;  3MZK B;  3AA6 B;  2LM2 A;  3RH3 A;  3JAF A;  3P4Q A;  3TKL B;  5HRI A;  3ZJ1 A;  3RJJ A;  2B56 A;  4KLD A;  2BS4 A;  1IJ5 A;  5DB7 A;  4IHJ E;  3V7K A;  1QSD A;  3UQ7 A;  3HI2 A;  1MNE A;  3AE6 A;  3SWH A;  2VQF T;  5AQR B;  2H88 A;  4YTM A;  4WQL A;  4P4M A;  7ICN A;  4PJN A;  1ZQZ A;  3UUM A;  4ZI7 E;  5J2U E;  4BAY B;  5HXR A;  4G2A A;  4M9H A;  3UQ4 A;  9ICI A;  4AKG A;  4X4U A;  4HFE A;  4ZHQ E;  4C90 A;  4X4S A;  4FH3 A;  3RC3 A;  2MTQ A;  2D5U A;  2CPT A;  4P4O A;  5IIM A;  2CE7 A;  3JAD A;  4JI4 T;  4DR5 T;  3RPU A;  1O3X A;  4OFZ A;  3GA8 A;  1G73 A;  2P66 A;  3ZSS A;  2OLT A;  4U74 A;  1ZQA A;  4WC1 A;  1W09 A;  4M9G A;  3FZF B;  3UU8 A; 
#chains in the Genus database with same CATH homology
 3NWI A;  4I0U A;  5JTG A;  4EGW A;  2BBH A;  4EV6 A;  4EED A;  3NVO A;  2BBJ A;  3CK6 A;  3JCF A;  3RKG A;  4EEB A;  2HN2 A;  2HN1 A;  2IUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...