2BBHA

X-ray structure of t.maritima cora soluble domain
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
232
structure length
223
Chain Sequence
PPGTLVYTGKYREDFEIEVMNYSIEEFREFKTTDVESVLPFRDSSTPTWINITGIHRTDVVQRVGEFFGTHPLVLEDILNVHQRPKVEFFENYVFIVLKMFTYDKHELESEQVSLILTKNCVLMFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDDYFVLLEKIDDEIDVLEEEVTVQRTHQLKRNLVELRKTIWPLREVLSSLYRDVPPLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the CorA Mg2+ transporter.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Metal transport/membrane protein
molecule keywords divalent cation transport-related protein
total genus 76
structure length 223
sequence length 232
ec nomenclature
pdb deposition date 2005-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 2bbhA02
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 2bbhA01
4EV6A 2IUBA 4I0UA 4EEDA 3NWIA 2HN1A 3JCFA 4EEBA 5JTGA 2BBHA 3NVOA 2HN2A 2BBJA 3CK6A 3RKGA 4EGWA
chains in the Genus database with same CATH superfamily
2YKSA 2WDRA 3N2GE 4PHEA 3RH4A 5IUXA 4EZHA 3N9MA 4DV5T 4JI3T 2WQYA 2M2TA 3PUYF 4ZEYA 5L3GB 2E5LT 1WR0A 5HRLA 1NWMX 5HRKA 4YJ3E 4Z90A 4Z6EA 1HUZA 2W0GA 4O4LE 4YT0A 4JLZA 4QH1A 2X0LB 3P4QA 3AUOA 2Y8DA 5FVLA 4K8VA 1ZQQA 1UUSA 5J0WA 3SWHA 4JI4T 1R8BA 2VWAA 1UEUA 5AQKB 4ZHQE 8ICWA 8ICIA 4DV7T 3E22E 4PJMA 4C91A 2WZHA 2PFVA 4YTNA 3OVBA 5JDLA 2QRXA 3IA3A 8ICZA 4WC2A 3CK6A 3PV0F 3FB2A 5DJQC 2MYSA 2CHNA 3NBXX 3PNCA 1KNRA 5AQFB 3ZPOA 2DR8A 2LSJA 2W62A 4RQ2A 3N9NA 2ODVA 2LJLA 1UCUA 4QZHA 5L47A 2XQ4A 4X4TA 2Q9QB 4P09A 4RT3A 2HN1A 4MFAA 2PFNA 4B6XA 3EDUA 1KFYA 5JR9B 5FKYA 9ICQA 3Q5WA 4P1NA 7ICSA 3WFOA 4ZZBA 4EXTA 4JEUB 5JR9C 4KLLA 8ICHA 5FXWA 4DV4T 2VK9A 3WFSC 4I2BA 5LHGB 3UXPA 4M04A 1PX5A 3RYHE 5HYAA 3AA7B 1LRZA 5F5WA 5HCMA 1UETA 4X20E 2BKOA 4XRHA 1MMDA 4NXVA 3ZMZB 3P50A 5ABEA 4K0KT 2IHMA 5EZYE 2CMRA 2JQQA 3TLWA 1IZNB 4PAGA 4K4IA 7ICHA 1HCIA 4AI6A 1JNZA 2XZEA 4O4IE 1RPLA 3AB3B 4KLUA 9ICUA 2I6HA 4UBBA 2LHRA 4PGXA 3F31A 3N2OA 1MIWA 9ICRA 2BPFA 3VRAA 4NXZA 5JQGE 2ZMAA 2X68A 5LHIB 2QGSA 4HTEA 4YSXA 5H6QB 4TUQA 1MMGA 3C2LA 2BVMA 5HEOA 4X0AA 4YCXA 3ONLC 2VKHA 2FJBA 2YU1A 3UFGA 2FCLA 4FHXA 2X9YA 4ZS3A 3UFEA 5BMVE 2K24A 2C5JA 5JREA 4IQTA 4X1IE 3F2EA 3H37A 3PE0A 2XM1A 2CWYA 4I28A 4MFCA 2KT9A 4P4MA 2E9XB 8ICXA 3ZN0B 1E1HB 5JDQA 4P0BA 1KNPA 4FHYA 1SHZC 2YOEA 3N9PA 3ZMSB 3UT5E 4JI2T 3KV9A 3SFEA 3ABVA 3ONXA 5J2GA 1HG2A 3JPRA 4WQLA 2H89A 4NXXA 2LEHA 4TNWA 2JQ9A 5C2TA 4QH4A 3RHWA 3I9YA 3TFRA 2QVAA 3EUHA 4HN9A 4LZGA 1Y01A 2XQ7A 2DR5A 4DV0T 2YK0A 4I2HA 5CHGA 5IHYA 4DOBA 1ZQGA 4KUMB 4XUSA 2NW9A 4NY8A 2WSSV 4X4SA 4M47A 3KFWX 2PFOA 3UQ4A 3R84B 2UXDT 4UV9B 3AEEA 4NUUA 2P66A 3Q5EA 3VU7H 4QZFA 1BR0A 1V4AA 1BPEA 1ZV4X 2HPJA 3B5MA 4YHJA 2WWVA 2YEVC 4JBWF 3AEFA 2ZLYA 1W0AA 2ACXA 2FJDA 1CUNA 9ICEA 5CFUA 2BS4A 4QHOA 1I6ZA 1ZQSA 4M9HA 2B4VA 3AA1B 2IC6A 1ZQUA 4GK0E 5D62A 7ICEA 3UU4A 3LFMA 5ABFA 2ZM8A 4DBQA 4X4OA 1XSPA 2BCRA 5JR9A 2FMSA 4EAHA 5HHHA 4EIWA 4JI6T 1JQRA 2JIWA 2FMPA 2KLQA 4PHDA 2R6GF 5FXVA 4UIGA 9ICVA 2ISPA 4EEBA 5HXSA 5BOLA 3AE9A 4UB3A 4MFFA 5CJ5A 5J0PA 4FO6A 2WM9A 2XAFB 3TLUA 3ZN1B 3OKQA 4HEAA 1ZQHA 2Y48B 3FZHB 3TLVA 3O1HA 2GAFD 5IIKA 3GDXA 1D0XA 5L2LA 2IUBA 2LSYA 3IF8B 3RIAA 8ICVA 9ICNA 8ICLA 3UULA 1OEDB 5JRCB 3ZLIA 3K3QC 4KBMB 5HWYA 2BBJA 2XUEA 4XAXB 4TNVA 3PDYA 3EDVA 3CQXC 5FMNA 4MALA 5HXHA 1WYBA 2A2FX 3L3PA 1NAFA 3RIFA 5D61A 2BG9B 2UXNB 4WBOA 3VR9A 2L9QA 2UUBT 5J2DA 2I9GA 4JI5T 1T72A 3ETVA 3VKHA 2V6XA 3FZLB 4HFHA 1QLBA 1D1AA 3V7JA 4YSYA 3OWGA 5LB7B 2BCVA 1R8CA 1ZP0A 3AQMA 4LVSA 4ILCA 1IJ6A 3PU3A 3WFRE 3MZKB 3T1YT 3QB5A 4HX0A 5DB7A 1VOMA 4ISTA 2V1DB 4RWNA 4ILBA 2YDRA 4RQ3A 4KLHA 4PFPA 4UELA 5F2VO 5LGUB 5HXEA 1BR2A 8ICEA 4IL9A 5EK2A 3KVAA 4YMMA 3PUVF 1OU5A 2M2VA 4TWFA 4CI1B 4H9OC 5L3BB 3AQKA 4M1PA 4TN7B 2KSRA 1N33T 1MNDA 3LK42 4CXXA 2HHPA 2XASB 3RLFF 5L4HA 3PU8A 1ZQDA 4NKUA 1HR0T 1UX4A 4AKHA 3AE8A 5HEHA 4EZ4A 3L9DA 5FYMA 4KLEA 4NXNT 2JQHA 1WR6A 3H39A 3FZFB 7ICMA 2VB6A 2VQFT 3MA9A 3N2KE 3QUJA 3PJAJ 4DO9A 3AE6A 5IIMA 3OVSA 5CFSA 5BOMA 4IREA 3KBUA 5AQJB 3I9WA 2DNXA 5M4YA 4OHFA 5DB8A 4X65T 3JYYA 5L3DB 4EBJA 4P2HA 1NO5A 4ZZCA 3P4RA 3MKDA 3PUAA 5J0XA 4KLGA 4HWIB 2BS2A 3ZC0A 4IQVA 4M2YA 1KEYA 4DOCA 3FHNA 5LMUT 3AECA 5J0QA 4JV5T 4KLMA 3NKZA 2WDQA 2KZ7B 5LOVE 2BE3A 5HC9A 1SE7A 4ZI3D 4K0UA 3CVRA 4G63A 4H9RC 4P4PA 1ZQLA 2DHRA 4AT9B 5LYJE 2LRLA 2XHEB 3SOLA 4ASKA 1ZQVA 3JC6C 4X5TA 5J2UE 5DQWA 4E8FA 1VFGA 4IDQA 2ZHBA 1GPJA 3J9X1 4WC5A 3RH6A 7ICKA 3C5GA 2ZH6A 8ICNA 2WDVA 2CLYB 1E2AA 3A8YC 2ZHAA 4LFAT 4WBYA 2CXFA 1S94A 3CIRA 7ICQA 4H9QC 4TURA 3IEEA 4IDPA 2Z6EA 3HL6A 4ZI2C 8ICSA 3GWHA 1BR1A 5JDMA 4K9BA 2X0YA 5AFUL 4O68A 4NXTA 1TV9A 4LF4T 4PPXA 1KF6A 5F3JA 1S35A 3AE4A 3IHRA 5J0SA 2UXBT 5FY0A 3AU6A 3OUYA 1BPXA 3AAIA 2ZH3A 4H9SE 1MIVA 4MBQA 3ONJA 4H63H 2WMNA 3NYBA 3JPOA 1H7CA 3PJAA 2AXDS 1VRBA 2JRKA 3KINB 2EHOC 4DUYT 4AT9A 4ZS2A 1ZEEA 3PUGA 4UB5A 3DP7A 4X4RA 3UUXB 2OLTA 3L8RA 3Q5XA 3FZKB 4GKKT 3QNUA 3RPUA 4KLJA 3UTKA 4EYYR 3AA0B 4LZDA 4R64A 4KHZF 3GN5B 2X66A 1D0YA 2VURA 2E8IA 3RYFE 2CXLA 4EB6E 4M9LA 4MHCA 4YHHT 3BK9A 5AQMB 2DWGA 4TV8E 3X1DA 2XQ3A 4U3CA 2XSAA 3RRWA 4U74A 4I0UA 4O8SA 3TKLB 4DMVA 5CFBA 4I2AA 2ID1A 4NUVA 4AKLA 5HRGA 3RH5A 2KXPB 3LK2B 4I2DA 2WY2A 5DDMA 5J2CA 4E7XA 4K9AA 2CE7A 4N7RA 4O6AA 4UF0B 3N5LA 4K99A 3ESLA 4ZI2D 4KLSA 4DMWA 3FBZA 5ETWA 2XSBA 9ICTA 1TVAA 4UXNB 1JNRA 1Z8UA 3SFDA 5J2KA 1N34T 5HEJA 2XAHB 1Q78A 4X4PA 4P4OA 4YD1A 3CMLA 1MMAA 4XA5A 4HFCA 3O1IA 1O3XA 4I2EA 3AE1A 5D49A 4LMKA 4ATBB 2IIUA 3HIYA 3N9QA 4QX8B 2IHR1 3MACA 5J2AA 1VCTA 2IMLA 1YD8G 2ES0A 4RPYA 1U5PA 4KLIA 2MOZA 4XZCA 3JPSA 2RPAA 5IYZE 3OBVE 4X64T 1ZQBA 3N9LA 1ZOYA 4TX5A 4IIJE 3JCFA 4LEVA 4NLKA 4IQWA 3RQWA 2LKGA 3OPCA 1T8BA 2ZM6T 4RWOA 2VL0A 5LGNB 4YTPA 4JI8T 3WFQE 5CFTA 2PTFA 7ICRA 7ICOA 5DBCA 8ICBA 5CA0E 3ERCC 4L9IA 3EAMA 3Q5DA 2WBLA 4R63A 2VKDA 3EI0A 4U7YA 4QXHB 3B0YA 2CLYC 4HFDA 4LEWA 2K3WA 3MDAA 2XQ9A 2DRBA 3OJAA 4M5DA 1KEJA 4NXWA 3C18A 3AE7A 7ICLA 2C5IT 2RP4A 2LM2A 1ZQIA 4MF8A 2WS3A 1ZQFA 1ZJMA 4AQFA 4QZAA 3RF1A 4H9NC 4PHPA 1MQ2A 5AQOB 4TZ4C 3NZPA 4O4JE 4O69A 4DVDA 2E9XD 2OV9A 3ANWB 4PK6A 4UVAB 3RI5A 2V5CA 5J0ZA 4UAZA 2PXIA 4MLKA 4WBNE 4IE5A 3HKBE 3OVUA 2KMFA 1ZQXA 4RQ5A 1HUOA 5IIOA 3HR0A 4I2FA 3WAJA 4O2BE 1HNXT 5EOZA 4CI3B 1U4QA 2VASA 4AT7A 1ZQZA 3MCRA 2YU2A 1J5WA 1XNQT 3RJKA 2QA7A 2I0MA 3AQNA 3I0QA 3JPQA 4ZI3C 2BG9C 5CA1E 2DI4A 4LF8T 4A97A 3EF2A 4WNKA 5HXCA 5C8YE 2Q9QA 1W09A 3NRXA 4HWCA 2H7VC 5J1GA 5L3CB 2CWOA 4ERRA 2CXDA 1ZQPA 2P9BA 1D1CA 5HAXA 1X79A 4DR6T 4FO1A 1Y64B 1ZQOA 2LHNA 4FHWA 3RIUA 5HEGA 3T8OA 1Q79A 3MGHA 3F57A 4L0RA 3ZSTA 3KV6A 4AQGA 8ICFA 4FH3A 8ICMA 3K3OA 1HG5A 4XBFB 3FBLA 3C4XA 4IE6A 2X9XA 5HXRA 3P4WA 2UUAT 9ICAA 2ZH5A 3B0XA 1NOMA 4TUYE 1BR4A 2XTLA 5LMNT 1ZQKA 1UX5A 5HR9A 2J1DG 4F8HA 4UEMA 4I2CA 1OEDE 2NTXA 5A1LA 2NWBA 4CN4A 3UXOA 2JPFA 5DBAA 2M67A 5J2IA 3RYIE 3E0ZA 3ZSSA 2BCUA 4QZBA 5CP2A 3OGUA 3AU2A 2LOSA 4CN6A 3VHLA 4H9PC 1MQ3A 2XAJB 4PGQA 2BZBA 3BQKA 3PUQA 1ZHCA 2EHOD 3HKCE 4BA9A 8ICUA 3B57A 3P7IA 4YMOA 5C3JA 3D0TA 2M6IA 3RC8A 3AEDA 2LSGA 2BKPA 3HKDE 3HA4A 5JTGA 1OXZA 3GMIA 4YFSA 4KM5A 9ICBA 2A72A 2OA5A 8ICAA 5J2FA 3HJ1A 4EEDA 1XSNA 3MXZA 4RQ6A 2H3RA 3C51A 3E08A 4KI0F 4NM1A 5CGMA 3RJIA 1ZQCA 8ICRA 4IE7A 3C4ZA 4J2CA 1V9DA 1EZ3A 3ZJ1A 4QZDA 5E0OA 4TUSA 3BQIA 3C98B 2XQYA 3RX6A 4ADZA 2W00A 4GK5E 2ZM0A 4YMNA 4KP3C 2BG9E 8ICPA 4GOUA 5JDFA 2DL1A 2D9DA 1M62A 2FUPA 4FHVA 3G06A 3ZYLA 9ICXA 2LSIA 3K3NA 4F6RC 7ICTA 1LKXA 1ZQMA 1ZQRA 2HHHT 1HX1B 2UU9T 1L0VA 4QX7B 3UPQA 1HTJF 3U3IA 3OUYB 3C5FA 5KMGP 3V5SA 2V7MA 3UPSA 3NRYA 2B56A 2LE8A 3U78A 1US7B 4HWFA 4QZ9A 2K5BB 1W9RA 5AQHB 2ZH4A 3UU5A 4PJJA 4UBCA 1IAPA 4WC7A 4I2IA 5DABA 4WW0A 3HW8A 7ICJA 4PHAA 2UXXB 2D5UA 5HRFA 2K48A 3AEBA 3GN5A 4GXJA 4QZEA 4DR7T 5J2JA 2V7LA 3HI2A 3NKUA 4X4QA 2H7OA 3QK6A 2X67A 2O1PA 3WFPA 2PBEA 4ZXLA 3C4WA 4QZ8A 4WYVA 3GA8A 2PFPA 1NEKA 2W66A 9ICMA 1HFAA 4A56A 7ICFA 2WB5A 4HFBA 3KBTA 2I59A 1M7KA 1WRDA 4EBKA 2WAUA 1BPBA 2LOPA 3OYXA 4JWNA 2RA1A 2B1EA 4NPPA 8ICOA 3UQ2A 3RC3A 2W61A 2E2AA 3SS1A 4KB6A 3RJJA 3W15B 4X0BA 4JI7T 4F5QA 2NRKA 4ILAA 5LXTE 3MGIA 4PJLA 2N1GA 4WQKA 4E7SA 3KV5A 1XMOT 5AQGB 4QZIA 2YDQA 5KXJA 2PJQA 4OAIZ 2DR9A 3FXDB 4IGUA 3LBXA 3ZEFB 4AQYT 5LBMA 4I4TE 3AEGA 2C5KT 3MDCA 5IIJA 4KLQA 2IW5B 1NENA 3OTOT 4PH5A 2ACZA 2V26A 4O5KA 2ZH7A 3C2KA 2ZH8A 2NR4A 5CB4E 3ZT5A 3HWTA 3JC6D 4O5CA 4IDOA 4DR5T 2GWSA 1QSDA 3FXEB 5TAOA 3SRZA 4UB2A 1IBKT 4PK4A 1BPYA 3AE5A 4JLXA 4DR3T 4X4NA 3B13A 2J4GA 3JPPA 2JJ9A 3RIUC 5LP6E 3ZMUB 1R8AA 4CQIA 1ZQYA 1BPZA 3PHZA 2ZH2A 3KDSE 4NXUA 4UAWA 4LF6T 2QYWA 4FI5A 1XNRT 4OYKA 5J0UA 4I27A 3CWZB 2XAQB 3RQUA 2KNDA 5FP3A 4DV1T 4V1Av 2XPKA 1HS7A 2XQ5A 3PUZF 3LQCB 4IDZA 4B3ST 3K75D 3LK9A 5DB6A 4QXBB 4X62T 1JN3A 5HWXA 4JI0T 4E80A 2Q9QD 4UD5A 2F4VT 3LG7A 3AEAA 7ICUA 1UK5A 4BJNA 7ICGA 2NW7A 3UU6A 2ODUA 2LRKA 1OEDA 5JRCA 3HJ4A 1CHUA 3K8PC 4NLZA 3ANWA 5IWAT 1WCRA 4UF0A 9ICIA 4I29A 5HHIA 5J2EA 4O9MA 1IJ5A 4IG8A 2CEAA 2CM0A 5AQTB 2K9AA 2DWKA 9ICGA 2MBGA 3KV4A 4UR9A 2NW8A 5HRIA 1VJ7A 4CI2B 1WOTA 5LA6E 5IINA 4DV6T 4RQ7A 4QZGA 3HKEE 4K4HA 5EK3A 1B7TA 5FXZA 5AQIB 3AE3A 2FJEA 3I0OA 5D63A 4COFA 4AT7B 2XM2A 4ZOLE 1JMSA 1FA0A 2L3LA 4EV6A 2BCSA 4WC6A 4X1KE 1BPDA 2JMKA 5LG3A 4TWDA 5AQQB 4GKJT 5ABFB 4UB1A 3O1JA 2PBIA 9ICCA 9ICJA 4GXIA 2MPKA 3R6NA 4OAGA 5DBBA 2CBIA 5KDMC 2W4XA 4PK5A 3QC9A 5AQRB 5HRDA 3AXJB 4L5GA 4PNIA 1OEDC 5AQVB 5L3EB 1ZQAA 2EHOA 2V8SV 2VKJA 3OYZA 1N32T 3RJGA 3LJCA 4EOZB 4KLTA 5HREA 4RQ0A 2FMQA 2WU2A 3OV7A 1ZQJA 3M3ZB 3KVBA 4DNDA 3LSVA 5AQSB 4K98A 2DCFA 2D0UA 3AVRA 1R8IA 5AQLB 1WFDA 4GIWA 2DR7A 2H88A 4Q25A 5TZVA 4QKNA 5FVKA 1G8XA 2CHOA 5L3FB 4TWHA 3L39A 3EHZA 4RWPA 1KDHA 2JMHA 4CXYA 3RJEA 2C0SA 1XDOA 3ZMTB 4A98A 2LM9A 1LVFA 2BBHA 4DV2T 4AKIA 1UEVA 9ICHA 2GA9D 2XQAA 4DO0A 3AAAB 3CPZA 3I1AA 2Y6XA 1YW0A 3VRBA 4AXPA 4ZI7E 1T7SA 4NM2A 1WLXA 4S3NA 5JDGA 4HWDA 2W9MA 3O9XA 5CA7A 5J0YA 8ICQA 3MBYA 3ISDA 3TLSA 5J0TA 4Z6FA 4G2AA 2IHOA 5DQVA 7ICNA 4Z6DA 5JVDE 2FJAA 4M0AA 1WYCA 4XQ7A 2AE9A 3LBXB 1D0ZA 3PURA 5D46A 5AQNB 4PJNA 2KWIB 1FMVA 5EK4A 2M6BA 4GYRA 4WZXA 3S4UA 4B3TT 3AAEB 2M2WA 1FMWA 2N9DA 1KNYA 4AQFC 5FL0A 4P0AA 2B51A 2V6YA 4RPZA 5DKWA 2ZH9A 4U7IA 5J0OA 4YLHA 7ICPA 1FJGT 2LSKA 1J5ET 4WC0A 4LF9T 4WH5A 2WWUA 4LF5T 5CHEA 7ICIA 2VVSA 4X66T 3PUWF 1QUUA 1Z0PA 4YXDA 3A7MA 2V7JA 3RJHA 5LBQB 3J7Yq 2WCAA 4OAFA 4BJMA 3JAFA 4B3RT 3EVYA 1ZJNA 5B3PA 3IBPA 4I55E 4YTMA 4M9GA 4IE0A 4RQ1A 4KLDA 1MIYA 4X1YE 4UAYA 2XY8B 2V7KA 4O4HE 2BPGA 3AQLA 3LK3B 2BKNA 4DBRA 2BS3A 5KX5E 2NTYA 3ISBA 3AVSA 3Q9DA 4OYJA 3RKOA 2W2UA 3UUMA 2X9HA 4Z6CA 4X5VA 4AKGA 5DDYA 3AE2A 4HE8A 2CRBA 4KHPT 4KX6A 3JADA 3ETUA 2XQ8A 4Z8XA 3C2MA 1I94T 1UGOA 3RJFA 2EWRA 4FJOA 3UQ7A 2WU5A 3VR8A 4OAHA 3UXNA 4NLNA 4HKAA 3UU3A 4A5XA 1HF8A 2XJ7A 1D1BA 4CXWA 3V5UA 2EHOB 4CN1A 3CKDA 5HRHA 1G73A 4LEZA 4XJEA 3RH3A 4KMCA 4HFVA 3K7DA 3T1HT 4DUZT 3ISCA 3BQLA 1YKHB 2HN2A 4LEYA 4IL4A 4GYSA 2O5AA 4AISA 2D0TA 5HRBA 2BPCA 2DRAA 3ZYMA 5LNKA 4K97A 9ICLA 4AKRB 4I2JA 3HX0A 4MF2A 2B76A 2PG8A 2LKHA 3P4PA 3RYCE 2LT3A 3WI3A 4UD4A 3ZKRA 3ZCJA 3L09A 2CCQA 2IDOB 8ICGA 2N2NA 3C66A 3PMNA 1VCSA 4HFIA 2DLRA 2X9WA 2X0HA 3LDQB 5ABGA 4RT2A 1GQEA 5IILA 9ICWA 2CA5A 3CX8B 5H6RB 5CR0A 4ANJA 4HGAA 4TV9E 5FXXA 5LJNA 1DU2A 3JZ0A 4FH5A 5DB9A 1LVKA 2L8KA 5LCYA 4RPXA 4JEHB 4CZZB 3RKGA 3AXJA 2KINB 2D2SA 4QZCA 5L4EA 3QOFA 2HPLA 2E9XC 3JPNA 3NZQA 1X9BA 5AQPB 5DEDA 4WCWA 4U2YA 3UUNA 4AT8B 4GXKA 4F5NA 4RQ4A 3ZYKA 2ZH1A 2GK9A 1OWAA 5J2HA 1AJ3A 4E7ZA 2W67A 1YXRA 4C90A 4JUYA 5JDNA 4YY3T 1UURA 3CX7B 1ZQNA 4BAYB 3DTOA 4EP7A 2ZM2A 3V7LA 2BVLA 2E9XA 3V7KA 3O4XE 3ZC1A 4IQUA 2UUCT 4NXMT 4UV8B 5BR8T 4OK0A 3P4SA 4HWHA 4MKPA 4H63V 2HH7A 3ER8C 2RFFA 5HEUA 5FY7A 5J2BA 8ICYA 1SA0E 1HNWT 4AT8A 2BCQA 2Q9QC 4QWNB 3ZCIA 9ICPA 3MJXA 4ISSA 4JI1T 4F5RA 2DVIA 3ZJ2A 3ZT7A 4UVBB 4RQ8A 4DR4T 5LJMA 5GONE 4TUPA 4U33A 4UB4A 3UUBA 1TFWA 4WC1A 2XAGB 5J29A 1R89A 2A9UA 4ILUA 3WAKA 1T98A 3M65A 4O5EA 3H3MA 2IAKA 4I50E 4LF7T 2M2UA 2PFQA 1IBMT 2XQ6A 4N78D 4FHPA 4YSZA 4EGWA 8ICTA 1XWMA 4NIQA 4R66A 5D4BA 2V5DA 3C50A 1FEWA 4B3MT 2WMOA 2VQET 2J47A 2WZIA 4LMJA 1MMNA 3ZT6A 1W0BA 4LMLA 4LT6A 2NP9A 2J62A 2V6YB 3H38A 2IC9A 3PUXF 1HNZT 1YQ3A 4WBZA 2YDSA 4JYAT 3PUSA 5F8PA 4XQ8A 4QH5A 4JLEA 2CBJA 5AQUB 4F5PA 3DJBA 2YN6A 3H3AA 3NWIA 5CWRA 3ER9B 4U31A 9ICSA 2VKOA 2NOXA 3VKGA 1FIOA 4M9NA 3UQ0A 2ISOA 5B3QA 4Z91A 3AA6B 2YINA 4M9JA 4F5OA 5FL1A 5J2TE 4PFOA 2LLYA 4KLFA 9ICFA 4AIUA 3RRCA 2MTQA 3CQCB 4RWQA 1MNEA 3P8CD 3A5XA 4ATBA 2VANA 5FNVE 2FBWA 5FY1A 1TFYA 8ICJA 1SUMB 1ZQEA 4HFEA 4IE4A 5LGTB 3N9OA 2X51A 3QB5K 4DR2T 1YQ4A 1E7PA 5LHHB 3CQGB 4NKTA 4IT4A 4X4VA 3ZMVB 3TLTA 5LG4A 9ICKA 5IIIA 3PMLA 2Q66A 4K4GA 1ZKEA 1IBLT 2G0UA 9ICOA 4O2AE 2E5VA 1XDPA 2VVNA 5DECA 4K96A 1ZQWA 4U2ZA 4OX9T 2MAWA 1KNZA 4KLOA 4PGYA 3EABA 4YJ2E 3MK7C 4IHJE 1XZYA 1XMQT 3K1SA 2WP9A 4PW8A 2CPTA 2BG9A 2W63A 1HX8A 5CJ7A 8ICKA 7ICVA 2A3DA 4R65A 3RGLA 2BDEA 3TFSA 4EYUA 3C64A 2JQKA 5JDHA 5HCJA 4DV3T 3OVAA 5BPCA 4YD2A 3CX6B 3PTRB 1N36T 1F5AA 3Q2MA 2UXCT 2VL8A 1YKEB 1YLQA 1ZQTA 4DR1T 1XSLA 5ABHA 4IDNA 5JH7E 4DIDB 4WC4A 5ADXL 5J0RA 4X4UA 3JAEA 4LFBT 4O67A 4I2GA 3UU8A 2SPCA 2V7IA 1KK7A 4QXCB 4UVCB 4OFZA 3JPTA 4WC3A 1JAJA 5CB1A 3V72A 4WOYA 4YN4A 3NVOA 4DOAA 4U72A 4MFRA 2KWHA 8ICCA 3FZMB 1RZTA 4I43B 1J1JA 4LFCT 4JWMA
chains in the Genus database with same CATH topology
4EV6A 2IUBA 4I0UA 4EEDA 3NWIA 2HN1A 3JCFA 4EEBA 5JTGA 2BBHA 3NVOA 2HN2A 2BBJA 3CK6A 3RKGA 4EGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EV6 A;  2IUB A;  4I0U A;  4EED A;  3NWI A;  2HN1 A;  3JCF A;  4EEB A;  5JTG A;  2BBH A;  3NVO A;  2HN2 A;  2BBJ A;  3CK6 A;  3RKG A;  4EGW A; 
#chains in the Genus database with same CATH topology
 2YKS A;  2WDR A;  3N2G E;  4PHE A;  3RH4 A;  5IUX A;  4EZH A;  3N9M A;  4DV5 T;  4JI3 T;  2WQY A;  2M2T A;  3PUY F;  4ZEY A;  5L3G B;  2E5L T;  1WR0 A;  5HRL A;  1NWM X;  5HRK A;  4YJ3 E;  4Z90 A;  4Z6E A;  1HUZ A;  2W0G A;  4O4L E;  4YT0 A;  4JLZ A;  4QH1 A;  2X0L B;  3P4Q A;  3AUO A;  2Y8D A;  5FVL A;  4K8V A;  1ZQQ A;  1UUS A;  5J0W A;  3SWH A;  4JI4 T;  1R8B A;  2VWA A;  1UEU A;  5AQK B;  4ZHQ E;  8ICW A;  8ICI A;  4DV7 T;  3E22 E;  4PJM A;  4C91 A;  2WZH A;  2PFV A;  4YTN A;  3OVB A;  5JDL A;  2QRX A;  3IA3 A;  8ICZ A;  4WC2 A;  3CK6 A;  3PV0 F;  3FB2 A;  5DJQ C;  2MYS A;  2CHN A;  3NBX X;  3PNC A;  1KNR A;  5AQF B;  3ZPO A;  2DR8 A;  2LSJ A;  2W62 A;  4RQ2 A;  3N9N A;  2ODV A;  2LJL A;  1UCU A;  4QZH A;  5L47 A;  2XQ4 A;  4X4T A;  2Q9Q B;  4P09 A;  4RT3 A;  2HN1 A;  4MFA A;  2PFN A;  4B6X A;  3EDU A;  1KFY A;  5JR9 B;  5FKY A;  9ICQ A;  3Q5W A;  4P1N A;  7ICS A;  3WFO A;  4ZZB A;  4EXT A;  4JEU B;  5JR9 C;  4KLL A;  8ICH A;  5FXW A;  4DV4 T;  2VK9 A;  3WFS C;  4I2B A;  5LHG B;  3UXP A;  4M04 A;  1PX5 A;  3RYH E;  5HYA A;  3AA7 B;  1LRZ A;  5F5W A;  5HCM A;  1UET A;  4X20 E;  2BKO A;  4XRH A;  1MMD A;  4NXV A;  3ZMZ B;  3P50 A;  5ABE A;  4K0K T;  2IHM A;  5EZY E;  2CMR A;  2JQQ A;  3TLW A;  1IZN B;  4PAG A;  4K4I A;  7ICH A;  1HCI A;  4AI6 A;  1JNZ A;  2XZE A;  4O4I E;  1RPL A;  3AB3 B;  4KLU A;  9ICU A;  2I6H A;  4UBB A;  2LHR A;  4PGX A;  3F31 A;  3N2O A;  1MIW A;  9ICR A;  2BPF A;  3VRA A;  4NXZ A;  5JQG E;  2ZMA A;  2X68 A;  5LHI B;  2QGS A;  4HTE A;  4YSX A;  5H6Q B;  4TUQ A;  1MMG A;  3C2L A;  2BVM A;  5HEO A;  4X0A A;  4YCX A;  3ONL C;  2VKH A;  2FJB A;  2YU1 A;  3UFG A;  2FCL A;  4FHX A;  2X9Y A;  4ZS3 A;  3UFE A;  5BMV E;  2K24 A;  2C5J A;  5JRE A;  4IQT A;  4X1I E;  3F2E A;  3H37 A;  3PE0 A;  2XM1 A;  2CWY A;  4I28 A;  4MFC A;  2KT9 A;  4P4M A;  2E9X B;  8ICX A;  3ZN0 B;  1E1H B;  5JDQ A;  4P0B A;  1KNP A;  4FHY A;  1SHZ C;  2YOE A;  3N9P A;  3ZMS B;  3UT5 E;  4JI2 T;  3KV9 A;  3SFE A;  3ABV A;  3ONX A;  5J2G A;  1HG2 A;  3JPR A;  4WQL A;  2H89 A;  4NXX A;  2LEH A;  4TNW A;  2JQ9 A;  5C2T A;  4QH4 A;  3RHW A;  3I9Y A;  3TFR A;  2QVA A;  3EUH A;  4HN9 A;  4LZG A;  1Y01 A;  2XQ7 A;  2DR5 A;  4DV0 T;  2YK0 A;  4I2H A;  5CHG A;  5IHY A;  4DOB A;  1ZQG A;  4KUM B;  4XUS A;  2NW9 A;  4NY8 A;  2WSS V;  4X4S A;  4M47 A;  3KFW X;  2PFO A;  3UQ4 A;  3R84 B;  2UXD T;  4UV9 B;  3AEE A;  4NUU A;  2P66 A;  3Q5E A;  3VU7 H;  4QZF A;  1BR0 A;  1V4A A;  1BPE A;  1ZV4 X;  2HPJ A;  3B5M A;  4YHJ A;  2WWV A;  2YEV C;  4JBW F;  3AEF A;  2ZLY A;  1W0A A;  2ACX A;  2FJD A;  1CUN A;  9ICE A;  5CFU A;  2BS4 A;  4QHO A;  1I6Z A;  1ZQS A;  4M9H A;  2B4V A;  3AA1 B;  2IC6 A;  1ZQU A;  4GK0 E;  5D62 A;  7ICE A;  3UU4 A;  3LFM A;  5ABF A;  2ZM8 A;  4DBQ A;  4X4O A;  1XSP A;  2BCR A;  5JR9 A;  2FMS A;  4EAH A;  5HHH A;  4EIW A;  4JI6 T;  1JQR A;  2JIW A;  2FMP A;  2KLQ A;  4PHD A;  2R6G F;  5FXV A;  4UIG A;  9ICV A;  2ISP A;  4EEB A;  5HXS A;  5BOL A;  3AE9 A;  4UB3 A;  4MFF A;  5CJ5 A;  5J0P A;  4FO6 A;  2WM9 A;  2XAF B;  3TLU A;  3ZN1 B;  3OKQ A;  4HEA A;  1ZQH A;  2Y48 B;  3FZH B;  3TLV A;  3O1H A;  2GAF D;  5IIK A;  3GDX A;  1D0X A;  5L2L A;  2IUB A;  2LSY A;  3IF8 B;  3RIA A;  8ICV A;  9ICN A;  8ICL A;  3UUL A;  1OED B;  5JRC B;  3ZLI A;  3K3Q C;  4KBM B;  5HWY A;  2BBJ A;  2XUE A;  4XAX B;  4TNV A;  3PDY A;  3EDV A;  3CQX C;  5FMN A;  4MAL A;  5HXH A;  1WYB A;  2A2F X;  3L3P A;  1NAF A;  3RIF A;  5D61 A;  2BG9 B;  2UXN B;  4WBO A;  3VR9 A;  2L9Q A;  2UUB T;  5J2D A;  2I9G A;  4JI5 T;  1T72 A;  3ETV A;  3VKH A;  2V6X A;  3FZL B;  4HFH A;  1QLB A;  1D1A A;  3V7J A;  4YSY A;  3OWG A;  5LB7 B;  2BCV A;  1R8C A;  1ZP0 A;  3AQM A;  4LVS A;  4ILC A;  1IJ6 A;  3PU3 A;  3WFR E;  3MZK B;  3T1Y T;  3QB5 A;  4HX0 A;  5DB7 A;  1VOM A;  4IST A;  2V1D B;  4RWN A;  4ILB A;  2YDR A;  4RQ3 A;  4KLH A;  4PFP A;  4UEL A;  5F2V O;  5LGU B;  5HXE A;  1BR2 A;  8ICE A;  4IL9 A;  5EK2 A;  3KVA A;  4YMM A;  3PUV F;  1OU5 A;  2M2V A;  4TWF A;  4CI1 B;  4H9O C;  5L3B B;  3AQK A;  4M1P A;  4TN7 B;  2KSR A;  1N33 T;  1MND A;  3LK4 2;  4CXX A;  2HHP A;  2XAS B;  3RLF F;  5L4H A;  3PU8 A;  1ZQD A;  4NKU A;  1HR0 T;  1UX4 A;  4AKH A;  3AE8 A;  5HEH A;  4EZ4 A;  3L9D A;  5FYM A;  4KLE A;  4NXN T;  2JQH A;  1WR6 A;  3H39 A;  3FZF B;  7ICM A;  2VB6 A;  2VQF T;  3MA9 A;  3N2K E;  3QUJ A;  3PJA J;  4DO9 A;  3AE6 A;  5IIM A;  3OVS A;  5CFS A;  5BOM A;  4IRE A;  3KBU A;  5AQJ B;  3I9W A;  2DNX A;  5M4Y A;  4OHF A;  5DB8 A;  4X65 T;  3JYY A;  5L3D B;  4EBJ A;  4P2H A;  1NO5 A;  4ZZC A;  3P4R A;  3MKD A;  3PUA A;  5J0X A;  4KLG A;  4HWI B;  2BS2 A;  3ZC0 A;  4IQV A;  4M2Y A;  1KEY A;  4DOC A;  3FHN A;  5LMU T;  3AEC A;  5J0Q A;  4JV5 T;  4KLM A;  3NKZ A;  2WDQ A;  2KZ7 B;  5LOV E;  2BE3 A;  5HC9 A;  1SE7 A;  4ZI3 D;  4K0U A;  3CVR A;  4G63 A;  4H9R C;  4P4P A;  1ZQL A;  2DHR A;  4AT9 B;  5LYJ E;  2LRL A;  2XHE B;  3SOL A;  4ASK A;  1ZQV A;  3JC6 C;  4X5T A;  5J2U E;  5DQW A;  4E8F A;  1VFG A;  4IDQ A;  2ZHB A;  1GPJ A;  3J9X 1;  4WC5 A;  3RH6 A;  7ICK A;  3C5G A;  2ZH6 A;  8ICN A;  2WDV A;  2CLY B;  1E2A A;  3A8Y C;  2ZHA A;  4LFA T;  4WBY A;  2CXF A;  1S94 A;  3CIR A;  7ICQ A;  4H9Q C;  4TUR A;  3IEE A;  4IDP A;  2Z6E A;  3HL6 A;  4ZI2 C;  8ICS A;  3GWH A;  1BR1 A;  5JDM A;  4K9B A;  2X0Y A;  5AFU L;  4O68 A;  4NXT A;  1TV9 A;  4LF4 T;  4PPX A;  1KF6 A;  5F3J A;  1S35 A;  3AE4 A;  3IHR A;  5J0S A;  2UXB T;  5FY0 A;  3AU6 A;  3OUY A;  1BPX A;  3AAI A;  2ZH3 A;  4H9S E;  1MIV A;  4MBQ A;  3ONJ A;  4H63 H;  2WMN A;  3NYB A;  3JPO A;  1H7C A;  3PJA A;  2AXD S;  1VRB A;  2JRK A;  3KIN B;  2EHO C;  4DUY T;  4AT9 A;  4ZS2 A;  1ZEE A;  3PUG A;  4UB5 A;  3DP7 A;  4X4R A;  3UUX B;  2OLT A;  3L8R A;  3Q5X A;  3FZK B;  4GKK T;  3QNU A;  3RPU A;  4KLJ A;  3UTK A;  4EYY R;  3AA0 B;  4LZD A;  4R64 A;  4KHZ F;  3GN5 B;  2X66 A;  1D0Y A;  2VUR A;  2E8I A;  3RYF E;  2CXL A;  4EB6 E;  4M9L A;  4MHC A;  4YHH T;  3BK9 A;  5AQM B;  2DWG A;  4TV8 E;  3X1D A;  2XQ3 A;  4U3C A;  2XSA A;  3RRW A;  4U74 A;  4I0U A;  4O8S A;  3TKL B;  4DMV A;  5CFB A;  4I2A A;  2ID1 A;  4NUV A;  4AKL A;  5HRG A;  3RH5 A;  2KXP B;  3LK2 B;  4I2D A;  2WY2 A;  5DDM A;  5J2C A;  4E7X A;  4K9A A;  2CE7 A;  4N7R A;  4O6A A;  4UF0 B;  3N5L A;  4K99 A;  3ESL A;  4ZI2 D;  4KLS A;  4DMW A;  3FBZ A;  5ETW A;  2XSB A;  9ICT A;  1TVA A;  4UXN B;  1JNR A;  1Z8U A;  3SFD A;  5J2K A;  1N34 T;  5HEJ A;  2XAH B;  1Q78 A;  4X4P A;  4P4O A;  4YD1 A;  3CML A;  1MMA A;  4XA5 A;  4HFC A;  3O1I A;  1O3X A;  4I2E A;  3AE1 A;  5D49 A;  4LMK A;  4ATB B;  2IIU A;  3HIY A;  3N9Q A;  4QX8 B;  2IHR 1;  3MAC A;  5J2A A;  1VCT A;  2IML A;  1YD8 G;  2ES0 A;  4RPY A;  1U5P A;  4KLI A;  2MOZ A;  4XZC A;  3JPS A;  2RPA A;  5IYZ E;  3OBV E;  4X64 T;  1ZQB A;  3N9L A;  1ZOY A;  4TX5 A;  4IIJ E;  3JCF A;  4LEV A;  4NLK A;  4IQW A;  3RQW A;  2LKG A;  3OPC A;  1T8B A;  2ZM6 T;  4RWO A;  2VL0 A;  5LGN B;  4YTP A;  4JI8 T;  3WFQ E;  5CFT A;  2PTF A;  7ICR A;  7ICO A;  5DBC A;  8ICB A;  5CA0 E;  3ERC C;  4L9I A;  3EAM A;  3Q5D A;  2WBL A;  4R63 A;  2VKD A;  3EI0 A;  4U7Y A;  4QXH B;  3B0Y A;  2CLY C;  4HFD A;  4LEW A;  2K3W A;  3MDA A;  2XQ9 A;  2DRB A;  3OJA A;  4M5D A;  1KEJ A;  4NXW A;  3C18 A;  3AE7 A;  7ICL A;  2C5I T;  2RP4 A;  2LM2 A;  1ZQI A;  4MF8 A;  2WS3 A;  1ZQF A;  1ZJM A;  4AQF A;  4QZA A;  3RF1 A;  4H9N C;  4PHP A;  1MQ2 A;  5AQO B;  4TZ4 C;  3NZP A;  4O4J E;  4O69 A;  4DVD A;  2E9X D;  2OV9 A;  3ANW B;  4PK6 A;  4UVA B;  3RI5 A;  2V5C A;  5J0Z A;  4UAZ A;  2PXI A;  4MLK A;  4WBN E;  4IE5 A;  3HKB E;  3OVU A;  2KMF A;  1ZQX A;  4RQ5 A;  1HUO A;  5IIO A;  3HR0 A;  4I2F A;  3WAJ A;  4O2B E;  1HNX T;  5EOZ A;  4CI3 B;  1U4Q A;  2VAS A;  4AT7 A;  1ZQZ A;  3MCR A;  2YU2 A;  1J5W A;  1XNQ T;  3RJK A;  2QA7 A;  2I0M A;  3AQN A;  3I0Q A;  3JPQ A;  4ZI3 C;  2BG9 C;  5CA1 E;  2DI4 A;  4LF8 T;  4A97 A;  3EF2 A;  4WNK A;  5HXC A;  5C8Y E;  2Q9Q A;  1W09 A;  3NRX A;  4HWC A;  2H7V C;  5J1G A;  5L3C B;  2CWO A;  4ERR A;  2CXD A;  1ZQP A;  2P9B A;  1D1C A;  5HAX A;  1X79 A;  4DR6 T;  4FO1 A;  1Y64 B;  1ZQO A;  2LHN A;  4FHW A;  3RIU A;  5HEG A;  3T8O A;  1Q79 A;  3MGH A;  3F57 A;  4L0R A;  3ZST A;  3KV6 A;  4AQG A;  8ICF A;  4FH3 A;  8ICM A;  3K3O A;  1HG5 A;  4XBF B;  3FBL A;  3C4X A;  4IE6 A;  2X9X A;  5HXR A;  3P4W A;  2UUA T;  9ICA A;  2ZH5 A;  3B0X A;  1NOM A;  4TUY E;  1BR4 A;  2XTL A;  5LMN T;  1ZQK A;  1UX5 A;  5HR9 A;  2J1D G;  4F8H A;  4UEM A;  4I2C A;  1OED E;  2NTX A;  5A1L A;  2NWB A;  4CN4 A;  3UXO A;  2JPF A;  5DBA A;  2M67 A;  5J2I A;  3RYI E;  3E0Z A;  3ZSS A;  2BCU A;  4QZB A;  5CP2 A;  3OGU A;  3AU2 A;  2LOS A;  4CN6 A;  3VHL A;  4H9P C;  1MQ3 A;  2XAJ B;  4PGQ A;  2BZB A;  3BQK A;  3PUQ A;  1ZHC A;  2EHO D;  3HKC E;  4BA9 A;  8ICU A;  3B57 A;  3P7I A;  4YMO A;  5C3J A;  3D0T A;  2M6I A;  3RC8 A;  3AED A;  2LSG A;  2BKP A;  3HKD E;  3HA4 A;  5JTG A;  1OXZ A;  3GMI A;  4YFS A;  4KM5 A;  9ICB A;  2A72 A;  2OA5 A;  8ICA A;  5J2F A;  3HJ1 A;  4EED A;  1XSN A;  3MXZ A;  4RQ6 A;  2H3R A;  3C51 A;  3E08 A;  4KI0 F;  4NM1 A;  5CGM A;  3RJI A;  1ZQC A;  8ICR A;  4IE7 A;  3C4Z A;  4J2C A;  1V9D A;  1EZ3 A;  3ZJ1 A;  4QZD A;  5E0O A;  4TUS A;  3BQI A;  3C98 B;  2XQY A;  3RX6 A;  4ADZ A;  2W00 A;  4GK5 E;  2ZM0 A;  4YMN A;  4KP3 C;  2BG9 E;  8ICP A;  4GOU A;  5JDF A;  2DL1 A;  2D9D A;  1M62 A;  2FUP A;  4FHV A;  3G06 A;  3ZYL A;  9ICX A;  2LSI A;  3K3N A;  4F6R C;  7ICT A;  1LKX A;  1ZQM A;  1ZQR A;  2HHH T;  1HX1 B;  2UU9 T;  1L0V A;  4QX7 B;  3UPQ A;  1HTJ F;  3U3I A;  3OUY B;  3C5F A;  5KMG P;  3V5S A;  2V7M A;  3UPS A;  3NRY A;  2B56 A;  2LE8 A;  3U78 A;  1US7 B;  4HWF A;  4QZ9 A;  2K5B B;  1W9R A;  5AQH B;  2ZH4 A;  3UU5 A;  4PJJ A;  4UBC A;  1IAP A;  4WC7 A;  4I2I A;  5DAB A;  4WW0 A;  3HW8 A;  7ICJ A;  4PHA A;  2UXX B;  2D5U A;  5HRF A;  2K48 A;  3AEB A;  3GN5 A;  4GXJ A;  4QZE A;  4DR7 T;  5J2J A;  2V7L A;  3HI2 A;  3NKU A;  4X4Q A;  2H7O A;  3QK6 A;  2X67 A;  2O1P A;  3WFP A;  2PBE A;  4ZXL A;  3C4W A;  4QZ8 A;  4WYV A;  3GA8 A;  2PFP A;  1NEK A;  2W66 A;  9ICM A;  1HFA A;  4A56 A;  7ICF A;  2WB5 A;  4HFB A;  3KBT A;  2I59 A;  1M7K A;  1WRD A;  4EBK A;  2WAU A;  1BPB A;  2LOP A;  3OYX A;  4JWN A;  2RA1 A;  2B1E A;  4NPP A;  8ICO A;  3UQ2 A;  3RC3 A;  2W61 A;  2E2A A;  3SS1 A;  4KB6 A;  3RJJ A;  3W15 B;  4X0B A;  4JI7 T;  4F5Q A;  2NRK A;  4ILA A;  5LXT E;  3MGI A;  4PJL A;  2N1G A;  4WQK A;  4E7S A;  3KV5 A;  1XMO T;  5AQG B;  4QZI A;  2YDQ A;  5KXJ A;  2PJQ A;  4OAI Z;  2DR9 A;  3FXD B;  4IGU A;  3LBX A;  3ZEF B;  4AQY T;  5LBM A;  4I4T E;  3AEG A;  2C5K T;  3MDC A;  5IIJ A;  4KLQ A;  2IW5 B;  1NEN A;  3OTO T;  4PH5 A;  2ACZ A;  2V26 A;  4O5K A;  2ZH7 A;  3C2K A;  2ZH8 A;  2NR4 A;  5CB4 E;  3ZT5 A;  3HWT A;  3JC6 D;  4O5C A;  4IDO A;  4DR5 T;  2GWS A;  1QSD A;  3FXE B;  5TAO A;  3SRZ A;  4UB2 A;  1IBK T;  4PK4 A;  1BPY A;  3AE5 A;  4JLX A;  4DR3 T;  4X4N A;  3B13 A;  2J4G A;  3JPP A;  2JJ9 A;  3RIU C;  5LP6 E;  3ZMU B;  1R8A A;  4CQI A;  1ZQY A;  1BPZ A;  3PHZ A;  2ZH2 A;  3KDS E;  4NXU A;  4UAW A;  4LF6 T;  2QYW A;  4FI5 A;  1XNR T;  4OYK A;  5J0U A;  4I27 A;  3CWZ B;  2XAQ B;  3RQU A;  2KND A;  5FP3 A;  4DV1 T;  4V1A v;  2XPK A;  1HS7 A;  2XQ5 A;  3PUZ F;  3LQC B;  4IDZ A;  4B3S T;  3K75 D;  3LK9 A;  5DB6 A;  4QXB B;  4X62 T;  1JN3 A;  5HWX A;  4JI0 T;  4E80 A;  2Q9Q D;  4UD5 A;  2F4V T;  3LG7 A;  3AEA A;  7ICU A;  1UK5 A;  4BJN A;  7ICG A;  2NW7 A;  3UU6 A;  2ODU A;  2LRK A;  1OED A;  5JRC A;  3HJ4 A;  1CHU A;  3K8P C;  4NLZ A;  3ANW A;  5IWA T;  1WCR A;  4UF0 A;  9ICI A;  4I29 A;  5HHI A;  5J2E A;  4O9M A;  1IJ5 A;  4IG8 A;  2CEA A;  2CM0 A;  5AQT B;  2K9A A;  2DWK A;  9ICG A;  2MBG A;  3KV4 A;  4UR9 A;  2NW8 A;  5HRI A;  1VJ7 A;  4CI2 B;  1WOT A;  5LA6 E;  5IIN A;  4DV6 T;  4RQ7 A;  4QZG A;  3HKE E;  4K4H A;  5EK3 A;  1B7T A;  5FXZ A;  5AQI B;  3AE3 A;  2FJE A;  3I0O A;  5D63 A;  4COF A;  4AT7 B;  2XM2 A;  4ZOL E;  1JMS A;  1FA0 A;  2L3L A;  4EV6 A;  2BCS A;  4WC6 A;  4X1K E;  1BPD A;  2JMK A;  5LG3 A;  4TWD A;  5AQQ B;  4GKJ T;  5ABF B;  4UB1 A;  3O1J A;  2PBI A;  9ICC A;  9ICJ A;  4GXI A;  2MPK A;  3R6N A;  4OAG A;  5DBB A;  2CBI A;  5KDM C;  2W4X A;  4PK5 A;  3QC9 A;  5AQR B;  5HRD A;  3AXJ B;  4L5G A;  4PNI A;  1OED C;  5AQV B;  5L3E B;  1ZQA A;  2EHO A;  2V8S V;  2VKJ A;  3OYZ A;  1N32 T;  3RJG A;  3LJC A;  4EOZ B;  4KLT A;  5HRE A;  4RQ0 A;  2FMQ A;  2WU2 A;  3OV7 A;  1ZQJ A;  3M3Z B;  3KVB A;  4DND A;  3LSV A;  5AQS B;  4K98 A;  2DCF A;  2D0U A;  3AVR A;  1R8I A;  5AQL B;  1WFD A;  4GIW A;  2DR7 A;  2H88 A;  4Q25 A;  5TZV A;  4QKN A;  5FVK A;  1G8X A;  2CHO A;  5L3F B;  4TWH A;  3L39 A;  3EHZ A;  4RWP A;  1KDH A;  2JMH A;  4CXY A;  3RJE A;  2C0S A;  1XDO A;  3ZMT B;  4A98 A;  2LM9 A;  1LVF A;  2BBH A;  4DV2 T;  4AKI A;  1UEV A;  9ICH A;  2GA9 D;  2XQA A;  4DO0 A;  3AAA B;  3CPZ A;  3I1A A;  2Y6X A;  1YW0 A;  3VRB A;  4AXP A;  4ZI7 E;  1T7S A;  4NM2 A;  1WLX A;  4S3N A;  5JDG A;  4HWD A;  2W9M A;  3O9X A;  5CA7 A;  5J0Y A;  8ICQ A;  3MBY A;  3ISD A;  3TLS A;  5J0T A;  4Z6F A;  4G2A A;  2IHO A;  5DQV A;  7ICN A;  4Z6D A;  5JVD E;  2FJA A;  4M0A A;  1WYC A;  4XQ7 A;  2AE9 A;  3LBX B;  1D0Z A;  3PUR A;  5D46 A;  5AQN B;  4PJN A;  2KWI B;  1FMV A;  5EK4 A;  2M6B A;  4GYR A;  4WZX A;  3S4U A;  4B3T T;  3AAE B;  2M2W A;  1FMW A;  2N9D A;  1KNY A;  4AQF C;  5FL0 A;  4P0A A;  2B51 A;  2V6Y A;  4RPZ A;  5DKW A;  2ZH9 A;  4U7I A;  5J0O A;  4YLH A;  7ICP A;  1FJG T;  2LSK A;  1J5E T;  4WC0 A;  4LF9 T;  4WH5 A;  2WWU A;  4LF5 T;  5CHE A;  7ICI A;  2VVS A;  4X66 T;  3PUW F;  1QUU A;  1Z0P A;  4YXD A;  3A7M A;  2V7J A;  3RJH A;  5LBQ B;  3J7Y q;  2WCA A;  4OAF A;  4BJM A;  3JAF A;  4B3R T;  3EVY A;  1ZJN A;  5B3P A;  3IBP A;  4I55 E;  4YTM A;  4M9G A;  4IE0 A;  4RQ1 A;  4KLD A;  1MIY A;  4X1Y E;  4UAY A;  2XY8 B;  2V7K A;  4O4H E;  2BPG A;  3AQL A;  3LK3 B;  2BKN A;  4DBR A;  2BS3 A;  5KX5 E;  2NTY A;  3ISB A;  3AVS A;  3Q9D A;  4OYJ A;  3RKO A;  2W2U A;  3UUM A;  2X9H A;  4Z6C A;  4X5V A;  4AKG A;  5DDY A;  3AE2 A;  4HE8 A;  2CRB A;  4KHP T;  4KX6 A;  3JAD A;  3ETU A;  2XQ8 A;  4Z8X A;  3C2M A;  1I94 T;  1UGO A;  3RJF A;  2EWR A;  4FJO A;  3UQ7 A;  2WU5 A;  3VR8 A;  4OAH A;  3UXN A;  4NLN A;  4HKA A;  3UU3 A;  4A5X A;  1HF8 A;  2XJ7 A;  1D1B A;  4CXW A;  3V5U A;  2EHO B;  4CN1 A;  3CKD A;  5HRH A;  1G73 A;  4LEZ A;  4XJE A;  3RH3 A;  4KMC A;  4HFV A;  3K7D A;  3T1H T;  4DUZ T;  3ISC A;  3BQL A;  1YKH B;  2HN2 A;  4LEY A;  4IL4 A;  4GYS A;  2O5A A;  4AIS A;  2D0T A;  5HRB A;  2BPC A;  2DRA A;  3ZYM A;  5LNK A;  4K97 A;  9ICL A;  4AKR B;  4I2J A;  3HX0 A;  4MF2 A;  2B76 A;  2PG8 A;  2LKH A;  3P4P A;  3RYC E;  2LT3 A;  3WI3 A;  4UD4 A;  3ZKR A;  3ZCJ A;  3L09 A;  2CCQ A;  2IDO B;  8ICG A;  2N2N A;  3C66 A;  3PMN A;  1VCS A;  4HFI A;  2DLR A;  2X9W A;  2X0H A;  3LDQ B;  5ABG A;  4RT2 A;  1GQE A;  5IIL A;  9ICW A;  2CA5 A;  3CX8 B;  5H6R B;  5CR0 A;  4ANJ A;  4HGA A;  4TV9 E;  5FXX A;  5LJN A;  1DU2 A;  3JZ0 A;  4FH5 A;  5DB9 A;  1LVK A;  2L8K A;  5LCY A;  4RPX A;  4JEH B;  4CZZ B;  3RKG A;  3AXJ A;  2KIN B;  2D2S A;  4QZC A;  5L4E A;  3QOF A;  2HPL A;  2E9X C;  3JPN A;  3NZQ A;  1X9B A;  5AQP B;  5DED A;  4WCW A;  4U2Y A;  3UUN A;  4AT8 B;  4GXK A;  4F5N A;  4RQ4 A;  3ZYK A;  2ZH1 A;  2GK9 A;  1OWA A;  5J2H A;  1AJ3 A;  4E7Z A;  2W67 A;  1YXR A;  4C90 A;  4JUY A;  5JDN A;  4YY3 T;  1UUR A;  3CX7 B;  1ZQN A;  4BAY B;  3DTO A;  4EP7 A;  2ZM2 A;  3V7L A;  2BVL A;  2E9X A;  3V7K A;  3O4X E;  3ZC1 A;  4IQU A;  2UUC T;  4NXM T;  4UV8 B;  5BR8 T;  4OK0 A;  3P4S A;  4HWH A;  4MKP A;  4H63 V;  2HH7 A;  3ER8 C;  2RFF A;  5HEU A;  5FY7 A;  5J2B A;  8ICY A;  1SA0 E;  1HNW T;  4AT8 A;  2BCQ A;  2Q9Q C;  4QWN B;  3ZCI A;  9ICP A;  3MJX A;  4ISS A;  4JI1 T;  4F5R A;  2DVI A;  3ZJ2 A;  3ZT7 A;  4UVB B;  4RQ8 A;  4DR4 T;  5LJM A;  5GON E;  4TUP A;  4U33 A;  4UB4 A;  3UUB A;  1TFW A;  4WC1 A;  2XAG B;  5J29 A;  1R89 A;  2A9U A;  4ILU A;  3WAK A;  1T98 A;  3M65 A;  4O5E A;  3H3M A;  2IAK A;  4I50 E;  4LF7 T;  2M2U A;  2PFQ A;  1IBM T;  2XQ6 A;  4N78 D;  4FHP A;  4YSZ A;  4EGW A;  8ICT A;  1XWM A;  4NIQ A;  4R66 A;  5D4B A;  2V5D A;  3C50 A;  1FEW A;  4B3M T;  2WMO A;  2VQE T;  2J47 A;  2WZI A;  4LMJ A;  1MMN A;  3ZT6 A;  1W0B A;  4LML A;  4LT6 A;  2NP9 A;  2J62 A;  2V6Y B;  3H38 A;  2IC9 A;  3PUX F;  1HNZ T;  1YQ3 A;  4WBZ A;  2YDS A;  4JYA T;  3PUS A;  5F8P A;  4XQ8 A;  4QH5 A;  4JLE A;  2CBJ A;  5AQU B;  4F5P A;  3DJB A;  2YN6 A;  3H3A A;  3NWI A;  5CWR A;  3ER9 B;  4U31 A;  9ICS A;  2VKO A;  2NOX A;  3VKG A;  1FIO A;  4M9N A;  3UQ0 A;  2ISO A;  5B3Q A;  4Z91 A;  3AA6 B;  2YIN A;  4M9J A;  4F5O A;  5FL1 A;  5J2T E;  4PFO A;  2LLY A;  4KLF A;  9ICF A;  4AIU A;  3RRC A;  2MTQ A;  3CQC B;  4RWQ A;  1MNE A;  3P8C D;  3A5X A;  4ATB A;  2VAN A;  5FNV E;  2FBW A;  5FY1 A;  1TFY A;  8ICJ A;  1SUM B;  1ZQE A;  4HFE A;  4IE4 A;  5LGT B;  3N9O A;  2X51 A;  3QB5 K;  4DR2 T;  1YQ4 A;  1E7P A;  5LHH B;  3CQG B;  4NKT A;  4IT4 A;  4X4V A;  3ZMV B;  3TLT A;  5LG4 A;  9ICK A;  5III A;  3PML A;  2Q66 A;  4K4G A;  1ZKE A;  1IBL T;  2G0U A;  9ICO A;  4O2A E;  2E5V A;  1XDP A;  2VVN A;  5DEC A;  4K96 A;  1ZQW A;  4U2Z A;  4OX9 T;  2MAW A;  1KNZ A;  4KLO A;  4PGY A;  3EAB A;  4YJ2 E;  3MK7 C;  4IHJ E;  1XZY A;  1XMQ T;  3K1S A;  2WP9 A;  4PW8 A;  2CPT A;  2BG9 A;  2W63 A;  1HX8 A;  5CJ7 A;  8ICK A;  7ICV A;  2A3D A;  4R65 A;  3RGL A;  2BDE A;  3TFS A;  4EYU A;  3C64 A;  2JQK A;  5JDH A;  5HCJ A;  4DV3 T;  3OVA A;  5BPC A;  4YD2 A;  3CX6 B;  3PTR B;  1N36 T;  1F5A A;  3Q2M A;  2UXC T;  2VL8 A;  1YKE B;  1YLQ A;  1ZQT A;  4DR1 T;  1XSL A;  5ABH A;  4IDN A;  5JH7 E;  4DID B;  4WC4 A;  5ADX L;  5J0R A;  4X4U A;  3JAE A;  4LFB T;  4O67 A;  4I2G A;  3UU8 A;  2SPC A;  2V7I A;  1KK7 A;  4QXC B;  4UVC B;  4OFZ A;  3JPT A;  4WC3 A;  1JAJ A;  5CB1 A;  3V72 A;  4WOY A;  4YN4 A;  3NVO A;  4DOA A;  4U72 A;  4MFR A;  2KWH A;  8ICC A;  3FZM B;  1RZT A;  4I43 B;  1J1J A;  4LFC T;  4JWM A; 
#chains in the Genus database with same CATH homology
 4EV6 A;  2IUB A;  4I0U A;  4EED A;  3NWI A;  2HN1 A;  3JCF A;  4EEB A;  5JTG A;  2BBH A;  3NVO A;  2HN2 A;  2BBJ A;  3CK6 A;  3RKG A;  4EGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...