2BBHA

X-ray structure of t.maritima cora soluble domain
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
232
structure length
223
Chain Sequence
b'PPGTLVYTGKYREDFEIEVMNYSIEEFREFKTTDVESVLPFRDSSTPTWINITGIHRTDVVQRVGEFFGTHPLVLEDILNVHQRPKVEFFENYVFIVLKMFTYDKHELESEQVSLILTKNCVLMFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDDYFVLLEKIDDEIDVLEEEVTVQRTHQLKRNLVELRKTIWPLREVLSSLYRDVPPLIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords divalent cation transport-related protein
publication title Crystal structure of the CorA Mg2+ transporter.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Metal transport/membrane protein
total genus 76
structure length 223
sequence length 232
ec nomenclature
pdb deposition date 2005-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 2bbhA02
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 2bbhA01
2HN2A 3NVOA 4EGWA 5JTGA 4EEDA 2BBHA 4EV6A 2IUBA 4I0UA 3CK6A 2HN1A 2BBJA 4EEBA 3NWIA 3JCFA 3RKGA
chains in the Genus database with same CATH superfamily
2AXDS 3UUMA 4KBMB 2ODVA 5LJMA 3UQ7A 2BG9A 3ABVA 3UPQA 5IUXA 3UUXB 3H3MA 1HUZA 4ZI2D 1KFYA 2K48A 3CMLA 2BPFA 5D63A 3ZN0B 1VRBA 3P50A 5A1LA 9ICTA 1MIYA 3PJAA 3SRZA 4PW8A 1YKHB 5ETWA 4DMVA 2CXFA 3CX8B 3UTKA 4CXWA 1ZQRA 1HG5A 3UQ0A 3LSVA 1SA0E 1M62A 2VQFT 4WYVA 5HRDA 3ONJA 5BPCA 1KNZA 2XQAA 4XBFB 2WB5A 4QXHB 4FHYA 5LBMA 5CHGA 3SWHA 4M1PA 5JQGE 3CIRA 4K4HA 4RPZA 9ICLA 4HFDA 3RYIE 3HI2A 8ICQA 3KV9A 5H6RB 1VCSA 1WYCA 2YINA 3AAIA 4PK4A 4IE0A 5BOMA 1XSPA 2DRBA 1US7B 2X67A 2P9BA 4IL9A 3HA4A 1F5AA 4IREA 4GIWA 3KBUA 4YSZA 3RJKA 5B3QA 1J5WA 3RX6A 5DABA 2ZLYA 5L3DB 3OJAA 1WRDA 3CX7B 3ZJ2A 4X1IE 4K4IA 2ZM0A 1JNRA 5FXVA 1ZQZA 4GKKT 3FZHB 2D0UA 2LM2A 4QX8B 2MTQA 1CUNA 4EZ4A 4MBQA 1TVAA 5HCJA 3J9X1 1ZQJA 2J47A 4H9SE 5DKWA 4S3NA 4IDQA 3ZC0A 3PUSA 1UURA 3N9PA 3JYYA 5FY1A 5LMUT 2I0MA 3N9NA 2ZH9A 2Q9QD 1YXRA 1I94T 1KK7A 4LF8T 4K0UA 4YTMA 4NXTA 4Q25A 4X1YE 9ICXA 3V7JA 2XQ6A 2UU9T 4KLFA 2FJDA 2DCFA 4AQYT 1ZQVA 5J2JA 3EDVA 5F3JA 4AKGA 2DNXA 3MGHA 4ZS2A 8ICMA 4O67A 4KM5A 1MMAA 2PFVA 3Q5WA 9ICUA 1HG2A 5FKYA 2YKSA 3TLWA 4WBNE 4E7XA 5HC9A 1FJGT 1YW0A 2A9UA 1KNYA 4GK5E 2ZH1A 4QZ9A 4UF0B 5J2GA 4KP3C 5DQWA 2BG9E 3V7KA 4U2YA 2H3RA 2DVIA 4LF6T 2W61A 3AE5A 9ICMA 3PUQA 2MPKA 4WBOA 4I2IA 7ICNA 4GYSA 4JI1T 4RQ6A 5HRKA 3KDSE 1KNRA 1YD8G 1BPEA 4HE8A 4P09A 5FNVE 5JDQA 5HEOA 3Q5XA 4K97A 2NW9A 1ZQKA 4KLDA 2JMKA 1N34T 1JAJA 3N9MA 2QYWA 3CQCB 4YD1A 4L0RA 4X4PA 2Q66A 4NKTA 5LG4A 5EZYE 5J2IA 3AQKA 4YD2A 2WSSV 4H9QC 2LKGA 4AIUA 4NY8A 3ONXA 5F5WA 4PK6A 3EDUA 3F57A 2KMFA 3AEGA 2GAFD 4NXUA 5D4BA 5BMVE 3AXJA 3OPCA 3N5LA 2N1GA 4GXKA 3SFEA 5CB4E 5LA6E 5LBQB 1UEUA 2V6YB 1ZEEA 2X9HA 4CXYA 4CZZB 5DBBA 2V7MA 5LGNB 9ICOA 4UEMA 4ATBB 2WZIA 4Z6EA 4JI4T 4NXXA 2P66A 4WBZA 1T72A 5JH7E 3LK3B 4AKLA 4M2YA 2XASB 3TLTA 2ZH6A 1BPZA 1ZQPA 1MNDA 3FXEB 3OYZA 1YLQA 5AQSB 3FB2A 4RWNA 2KSRA 7ICPA 2WMOA 4TN7B 3J7Yq 3PJAJ 1BPDA 4IDPA 2LHNA 1IBLT 3RGLA 2HH7A 4CN1A 1PX5A 4E7ZA 4EBKA 2V7LA 4UAZA 2LJLA 1BPBA 5DEDA 3OVSA 4WNKA 4XUSA 4RPYA 4M9JA 2CXLA 1SE7A 4I2FA 4RQ1A 1X79A 4JLEA 5C3JA 3RLFF 4JI0T 3VHLA 4I2JA 3UU5A 3UULA 3RH4A 4AKHA 2AE9A 4ZOLE 4JI6T 1ZQDA 5JR9B 1B7TA 2I6HA 1ZQSA 4X62T 4O2AE 7ICQA 2E9XA 3C64A 2DLRA 2BZBA 3PU8A 3EABA 4BAYB 4UELA 3LK9A 1D0YA 3EHZA 4PGQA 2BVMA 2V7IA 3HJ4A 2IDOB 2ODUA 2MAWA 2YU1A 3KV4A 3Q9DA 2BCSA 5LB7B 3MDCA 2IW5B 3RRCA 3MBYA 4YHJA 5J0SA 4DO0A 4FHXA 5HRGA 4F5NA 2JMHA 5HXRA 3ZSTA 2ZMAA 4QZIA 4HEAA 4O4LE 1HNZT 3Q5EA 3JPTA 5LHHB 2W4XA 1FEWA 2SPCA 5FYMA 2D9DA 2Y6XA 2W62A 4P0AA 2F4VT 3K3NA 4KLQA 4IHJE 1N32T 2N9DA 2XSBA 2G0UA 3OYXA 9ICGA 3KV5A 5J0UA 3DTOA 3P4SA 3PMNA 4IL4A 5M4YA 4KLJA 4DR2T 4DV6T 4OYJA 3VR9A 7ICEA 2PFQA 3TLUA 5CGMA 4M04A 4NLNA 4JUYA 2BCQA 2J1DG 5LOVE 4QZBA 4MHCA 4QZAA 4YMNA 3RKGA 3AE2A 1OU5A 5JDMA 2WAUA 4I2BA 4G63A 5D61A 3UU8A 1UK5A 5L47A 4AT9B 3MGIA 4HFCA 1IJ5A 4UB2A 2LOPA 3ANWA 3TFRA 4YMOA 4O4HE 1LVKA 3ISBA 4MLKA 4QZCA 5CFTA 1XDPA 4QXBB 5HEUA 5JR9C 3RYFE 9ICCA 1NOMA 1D0XA 4XA5A 4PFPA 1HR0T 4ISTA 3GA8A 2W67A 4PJMA 4RQ3A 9ICBA 8ICLA 4TX5A 1U5PA 4ANJA 1MMDA 1HNXT 2CPTA 3N2OA 9ICIA 3MZKB 2Z6EA 3A5XA 2LM9A 3ZCJA 2NW7A 8ICGA 5LG3A 3X1DA 3B13A 4O5EA 1ZQNA 2FMPA 2VL0A 3RH6A 5LXTE 3O1HA 4JI5T 1Z0PA 3HR0A 7ICSA 1FMWA 1OEDB 5J0OA 4I2GA 7ICMA 4Z6FA 4WQKA 3ZPOA 2XAGB 3MACA 5AQRB 2XAQB 4DO9A 2DHRA 4UBBA 5LGUB 2XAJB 3V7LA 1HNWT 2E9XD 2KINB 5BOLA 1BPXA 4O4IE 3T1HT 2M2UA 5CFBA 3ZEFB 2XTLA 5J2CA 2LHRA 3LQCB 4K9AA 2IHMA 5AQGB 1ZQGA 4UIGA 1BR4A 4QZEA 2W2UA 3AECA 4X4SA 1CHUA 3JC6D 4BJNA 2C5JA 1YQ3A 4QZDA 4PH5A 4LF5T 4FO1A 3JPNA 3W15B 2CXDA 4LVSA 1ZQQA 3RF1A 8ICUA 1Q78A 5DBCA 2BS3A 2ZM8A 4CI3B 1D1CA 4UAYA 2VKJA 5FXZA 4LF4T 1WCRA 3NVOA 2CBIA 4H9PC 4OFZA 1HF8A 4OAGA 5HXCA 2PBIA 2JRKA 1O3XA 3OUYB 4B6XA 4C91A 5HREA 3ETUA 8ICTA 3KVBA 2BKNA 5JDLA 2UXDT 2IC6A 1KEJA 8ICSA 7ICUA 4YJ2E 1N36T 4IG8A 4L5GA 5LMNT 4AT7B 2V5DA 3NRXA 3WAJA 1D1AA 2JPFA 1KDHA 5CJ7A 2E5LT 2X0HA 4LFAT 2XQ3A 4NXWA 3RQWA 1NO5A 3MDAA 3ISDA 3N9LA 2ZM2A 3QC9A 2UXXB 5HRHA 4AKRB 2C0SA 4TUSA 2NR4A 5ABFB 4FHVA 4DR6T 3TLVA 4OAHA 5HXSA 3K8PC 4JWMA 3IBPA 4PGXA 4WW0A 1OEDC 4K0KT 4GXJA 4AKIA 5CJ5A 3AVRA 2VQET 3UU3A 3RJFA 4RQ2A 1UX4A 2CWYA 3OVUA 5DDYA 3AU6A 4DR3T 4EYYR 3R6NA 3L9DA 4UD5A 4O8SA 3AA7B 1MQ2A 2BS4A 3ZT6A 2XJ7A 1N33T 4CN4A 4WOYA 2ZH8A 3UFEA 1GPJA 4O68A 2X9XA 4X64T 4AI6A 5IIJA 5HWYA 1ZQUA 3UU6A 3FZKB 2A2FX 4IDOA 1KF6A 4JI3T 3AEDA 7ICIA 3LBXB 2EHOB 7ICRA 3QOFA 4HFEA 4UF0A 4E8FA 1J1JA 3VU7H 4IIJE 2WMNA 3B57A 1ZQMA 2M67A 4DR1T 5FMNA 4DV0T 4O2BE 3PHZA 1JQRA 2E2AA 4G2AA 1IZNB 1ZQLA 4P4PA 8ICWA 4RQ4A 3QUJA 2OLTA 4O4JE 4DVDA 2IC9A 5AQPB 4LF9T 5EOZA 2DR9A 3EVYA 1L0VA 3P4WA 3UXPA 1Y01A 4MF2A 4I27A 5L2LA 5JDNA 1HUOA 2BVLA 4UV9B 1VJ7A 3Q2MA 4YJ3E 5IHYA 5J0WA 2BCVA 3OWGA 4I2CA 4H63V 2BCUA 3FZLB 3AQNA 3C18A 5CWRA 2PFNA 1DU2A 4K9BA 3R84B 4EBJA 3ER9B 5JDFA 2R6GF 5L3BB 3A7MA 5HCMA 3JAFA 2LLYA 5C8YE 2ES0A 8ICJA 3CQGB 2V6YA 3P4RA 4EYUA 4IQVA 1D0ZA 4GK0E 2KWHA 5J2FA 3NWIA 3P8CD 4K98A 2WU5A 2BPGA 1W09A 4FHWA 1I6ZA 5FXWA 2IIUA 2BE3A 4WQLA 8ICFA 3EUHA 1Z8UA 2YDQA 4LEWA 4EXTA 3C5GA 2LRLA 4LEZA 4EOZB 5F2VO 3N2GE 4Z6CA 2LSYA 5FL0A 2ZH3A 3CWZB 3I0OA 4I2EA 1WOTA 3SOLA 3ZYMA 4M9GA 3JADA 2WWUA 9ICQA 4KLUA 4PJLA 2EHOC 2H88A 2XQ8A 3FHNA 3UFGA 5IYZE 1LRZA 2C5IT 3CKDA 5L4HA 4BJMA 3PUXF 4AT8B 3AA1B 1Q79A 4ZI3C 2K9AA 5JR9A 3F31A 2HN2A 1LVFA 1MIVA 4ADZA 5DBAA 2ZH4A 2ZHBA 2NTXA 1XMOT 1NWMX 4QZFA 3L39A 3N9OA 4HWFA 5IWAT 3JCFA 3EAMA 1KNPA 4TUQA 4UB3A 4QWNB 3BQKA 3I9WA 5ABEA 5FY0A 4PGYA 4M9LA 4NUVA 3H37A 5D62A 2ZH2A 4HN9A 4F5RA 3ZKRA 3MXZA 2OV9A 4UB4A 2UXCT 5CP2A 3OGUA 3KBTA 1T98A 1ZQWA 4B3ST 3K3OA 3RYCE 4CXXA 4KLGA 2WQYA 1WLXA 5CFUA 4LFBT 3RIAA 5J0TA 2K3WA 4GOUA 3RQUA 2BKPA 5CFSA 3V5SA 3HW8A 2QVAA 2K5BB 5HXEA 2CEAA 3ZT5A 8ICPA 1U4QA 5ADXL 4F5OA 1AJ3A 5J0RA 4I29A 3RRWA 3AE9A 2YDSA 4TWHA 4XQ7A 2Y48B 2X68A 4F6RC 5J0ZA 5D49A 4H63H 2DRAA 3O4XE 4IDNA 3KINB 3P4PA 3PUWF 2M2WA 2JIWA 3G06A 3MKDA 3IF8B 5B3PA 3NKZA 2EWRA 2W00A 2L3LA 2B51A 5IIIA 2BBHA 5JRCB 4KLIA 3WFOA 7ICFA 3WFPA 4AT9A 8ICZA 2E8IA 4RWOA 7ICGA 3HL6A 2V5CA 5J2HA 4R65A 3VKGA 1XDOA 3PUYF 4RT2A 4UXNB 4FJOA 3RI5A 4UBCA 2ZM6T 5J0XA 2X51A 1TV9A 3PV0F 3PDYA 4XRHA 4UR9A 2X0LB 3ESLA 4ZI7E 5LHGB 2JQHA 3WFSC 3FXDB 2IAKA 4KHZF 2HHHT 4PPXA 4Z90A 2IHOA 4X0AA 4P4MA 2X0YA 3LK2B 2FJEA 2XAHB 5AQVB 3HWTA 3HIYA 3AEEA 3H39A 4TURA 2LOSA 5CA7A 3AA0B 3H3AA 5HAXA 7ICLA 1E7PA 1ZJNA 3DJBA 3UQ4A 2NRKA 3C2KA 3RHWA 2UUBT 2VVSA 1IAPA 4LT6A 4TUPA 1VFGA 5IINA 4I43B 4TV9E 2KT9A 2JQ9A 2M2VA 9ICJA 3CVRA 2PXIA 2UXNB 3V72A 8ICHA 3AE1A 1OEDA 2B76A 1QSDA 2LE8A 4WC0A 2YU2A 3AQMA 2MYSA 4A5XA 3S4UA 2WDRA 2ISOA 2PFPA 4U33A 1QLBA 3ZT7A 4YTNA 5LHIB 5EK2A 4DV5T 2V7JA 4U2ZA 2ZH5A 8ICBA 3AUOA 2HN1A 4PFOA 5HEJA 3VRAA 4M5DA 2LSGA 3AEAA 1ZQAA 4X4UA 1VOMA 3T1YT 4MF8A 2RPAA 1BR0A 3UUBA 7ICVA 3ONLC 4EV6A 2NP9A 4LEVA 3RIUA 5HEHA 3U3IA 2W63A 4JYAT 5FXXA 1YKEB 3PTRB 4EIWA 3OBVE 1HFAA 2QGSA 4KMCA 3EI0A 3FZMB 2RFFA 4AQGA 3K75D 1S94A 8ICXA 3B0XA 3RJEA 4WC7A 4X4NA 5HXHA 4DV3T 4CN6A 4NXMT 4C90A 4YSYA 5TZVA 2VKHA 3C4ZA 1ZJMA 2ACZA 3MJXA 2RP4A 4MFCA 2PG8A 1NAFA 5LYJE 2CM0A 5DB6A 5L4EA 3ZC1A 1XSLA 4X0BA 3O1JA 5L3FB 4N7RA 4MALA 4HWHA 3ZYLA 4MKPA 5FY7A 4RQ8A 4WC3A 1HS7A 2A72A 5LCYA 1ZQYA 2NW8A 1XNRT 5AQNB 2UUCT 4RQ0A 1ZOYA 2XAFB 3O1IA 4EZHA 2VURA 2DR5A 2DR8A 4QZ8A 5D46A 2XQ4A 4O9MA 4NXNT 5JDGA 2I9GA 4AT7A 5AQUB 3UT5E 3BQLA 4EAHA 4YN4A 1Y64B 3UQ2A 5IIOA 4IE6A 4NUUA 3KFWX 4ASKA 2FCLA 3OTOT 3CK6A 2NTYA 5C2TA 3IHRA 4PHEA 3NYBA 3RJJA 2N2NA 5H6QB 2FJAA 4NLKA 1UETA 3JPQA 5ABFA 2CLYB 2ID1A 2VWAA 4F5PA 4HFHA 3H38A 1VCTA 2KWIB 4DOBA 4WC5A 5EK3A 3C4XA 3C51A 3F2EA 2MBGA 4X4QA 4X1KE 3NBXX 4JI7T 4B3RT 1ZQFA 2XSAA 7ICHA 3AE7A 3AEBA 4HWCA 5AQKB 2XZEA 3C98B 4COFA 2YEVC 5ABHA 2GA9D 3D0TA 5LNKA 3K1SA 4PNIA 1IBMT 4X4RA 1RZTA 4PAGA 3NZQA 4JV5T 2HPLA 2HHPA 3LBXA 1YQ4A 2EHOA 4JLXA 5AFUL 5J2DA 2J4GA 3LDQB 2FMSA 1SHZC 4RWPA 1ZP0A 3VR8A 2W0GA 4NM1A 2XQ7A 5ABGA 4RQ5A 3GN5B 3UXOA 4AQFC 5J0YA 4DUZT 3EF2A 5AQTB 2V26A 4DMWA 4WH5A 2XM1A 5DJQC 4O5KA 9ICFA 4TUYE 3RPUA 3ERCC 5J1GA 4Z8XA 4CI2B 2BDEA 1XZYA 2C5KT 3LG7A 3HKBE 3LFMA 2BPCA 4U31A 4NXZA 4PHDA 4O5CA 9ICHA 3TLSA 3OKQA 5DDMA 4I50E 1ZQCA 4EEDA 1R8AA 8ICIA 3NRYA 2NOXA 3M3ZB 3RJIA 3IA3A 1EZ3A 1UCUA 4A56A 4P2HA 7ICJA 5KDMC 4YCXA 2FMQA 8ICNA 4O6AA 3C66A 4KLOA 9ICVA 4LEYA 4QHOA 4XJEA 8ICAA 2X9YA 4QH1A 2Y8DA 3UUNA 4TNVA 3PUAA 4U7IA 2CLYC 2OA5A 3ETVA 4B3MT 4K8VA 5J2EA 3PU3A 3AE8A 4M9HA 4PK5A 4GYRA 5LJNA 3RIUC 2VKOA 3CQXC 4ZHQE 2XPKA 5HRLA 3KV6A 5JTGA 3PURA 4LMLA 4RQ7A 4QH5A 2YN6A 2WCAA 5IILA 2Q9QB 1JNZA 1FA0A 4ZS3A 4HX0A 4QZHA 1WYBA 1NEKA 4YSXA 3HKDE 2CWOA 1UX5A 2LSKA 3AVSA 4X4OA 2PFOA 3PUGA 4JI2T 5CB1A 4XAXB 5HYAA 1KEYA 3I0QA 1ZQIA 4QKNA 4V1Av 4LMJA 1E2AA 2ACXA 4AT8A 4NLZA 5AQFB 3AE3A 4DIDB 4ZI2C 2YOEA 1D1BA 4GXIA 4EGWA 2LT3A 2DI4A 4DOAA 4UD4A 5GONE 4PHPA 4U74A 1MMGA 1RPLA 3P4QA 4YLHA 2XY8B 1R89A 4YY3T 4PHAA 4KX6A 5EK4A 5L3GB 5AQHB 4Z6DA 3RC8A 1MIWA 4KHPT 4RPXA 4MFAA 4ILBA 3U78A 2CMRA 2I59A 4HKAA 4UV8B 3JPOA 4DUYT 3RYHE 1R8CA 2BG9B 4ATBA 8ICEA 3C50A 2EHOD 3PNCA 4IE7A 5AQOB 2WZHA 4KLMA 2X9WA 2CE7A 4KUMB 4UVAB 2O5AA 5E0OA 3HKEE 4P1NA 5TAOA 2J62A 3HKCE 3NZPA 2M6BA 4ZI3D 1W0BA 4YTPA 2KZ7B 5J0QA 4I2AA 3SFDA 9ICRA 3O9XA 3JZ0A 3C2LA 3AE4A 3ISCA 2KXPB 1ZV4X 2BKOA 3I9YA 4J2CA 3GDXA 1X9BA 1R8BA 3ZMUB 4FHPA 1UGOA 3MCRA 4L9IA 5AQQB 3PUVF 4QZGA 1MMNA 4ILAA 5JVDE 1S35A 1ZKEA 1M7KA 4K96A 4R63A 2Q9QC 1XSNA 4HGAA 4LF7T 4U72A 4RWQA 1GQEA 4HFVA 1UUSA 4R66A 4KLLA 5JRCA 2D5UA 3C4WA 2IMLA 2XQ5A 3K3QC 4JEHB 4IDZA 4KLTA 2ZHAA 2L9QA 4M9NA 5L3CB 1FMVA 1QUUA 1T8BA 3VKHA 1WR0A 4KI0F 5J2KA 2H89A 9ICWA 1JMSA 3QB5A 3ZMTB 3RIFA 1ZQEA 4AXPA 8ICKA 4I28A 4UB1A 4K99A 3BQIA 2O1PA 3WI3A 3WFRE 4LZGA 1ZQXA 4ILUA 8ICCA 3FBLA 3BK9A 5J2UE 3LK42 4IT4A 4U3CA 2IHR1 4JBWF 2VKDA 5KMGP 3ZSSA 3C2MA 4F5QA 4P0BA 2H7VC 4WC4A 4YHHT 1ZHCA 4BA9A 5IIKA 4XZCA 5HRIA 2VVNA 2L8KA 1HTJF 2FUPA 4WC1A 1ZQTA 3VRBA 4OAIZ 4RT3A 4DV4T 3I1AA 2BG9C 3AAAB 4LMKA 1R8IA 4HWIB 4E80A 1IJ6A 5J2BA 4WBYA 4ERRA 2B56A 4FO6A 2A3DA 1MNEA 4LFCT 5DB8A 7ICOA 3QB5K 5HRBA 2QRXA 2WU2A 4AISA 2GWSA 1WR6A 4H9NC 3OV7A 2XHEB 5BR8T 4FH3A 4NIQA 4OHFA 1BR1A 3NKUA 5IIMA 3MK7C 2QA7A 2YK0A 4YT0A 2V1DB 2PTFA 4TWDA 5LP6E 4E7SA 2HPJA 4OK0A 4IGUA 4DV7T 3RH5A 4WZXA 4M47A 2D2SA 3ZN1B 5HRFA 5KXJA 4WC6A 3E22E 3FZFB 1UEVA 4AQFA 1HX8A 4YXDA 4MFFA 2BBJA 4N78D 4X4TA 3ZMZB 4WC2A 8ICRA 4JEUB 5JREA 1H7CA 2ISPA 2BCRA 5DQVA 1XWMA 4ZEYA 3UPSA 3PUZF 4I0UA 3RH3A 4A97A 4X20E 2ZH7A 1MQ3A 4CQIA 2V8SV 2FJBA 3RJHA 3OVAA 2YDRA 9ICKA 2VASA 2JQKA 3AXJB 3C5FA 2X66A 4U7YA 3PE0A 2DL1A 3ER8C 4B3TT 5DB7A 4O69A 9ICPA 4IE5A 2CHNA 2CA5A 4DR5T 4M0AA 3OVBA 4IQUA 5AQMB 5JDHA 3E0ZA 2VANA 2PJQA 4DBRA 2M2TA 4K4GA 5CA1E 2D0TA 2LRKA 2XQ9A 5CHEA 2WDQA 4JI8T 1W0AA 2MOZA 3CX6B 3HX0A 2WS3A 3HJ1A 2CRBA 2KNDA 3QK6A 3DP7A 2B1EA 5FP3A 3JPSA 3UXNA 3Q5DA 4ZZCA 4X5VA 3ZJ1A 1OWAA 4CI1B 1HX1B 2PBEA 1XNQT 4EB6E 2W66A 3A8YC 2K24A 4P4OA 1BPYA 2VL8A 2IUBA 8ICVA 5CR0A 4I2HA 3M65A 4DR4T 4ILCA 9ICEA 4F8HA 9ICAA 4NM2A 5HR9A 2W9MA 3RC3A 3L3PA 4UVBB 2XQYA 1E1HB 2NWBA 2WBLA 4JLZA 4IQWA 5HEGA 4X65T 4ZZBA 2UUAT 2VK9A 2JQQA 3L09A 4Z91A 3AE6A 5AQJB 4IQTA 3P7IA 4EEBA 4A98A 2WY2A 1ZQOA 5J2TE 4WCWA 2E9XB 2V6XA 1IBKT 4TZ4C 1ZQHA 1T7SA 3E08A 2VB6A 4OAFA 3AA6B 4H9OC 4QH4A 3GN5A 4UVCB 1W9RA 5FL1A 3OUYA 3MA9A 1TFYA 4MFRA 3AU2A 2UXBT 3RJGA 3CPZA 5LGTB 4EP7A 4DOCA 2LKHA 4HFIA 7ICKA 1J5ET 2DWKA 4KLSA 3PMLA 1XMQT 3AB3B 3LJCA 3AAEB 7ICTA 2WDVA 3GMIA 3ZYKA 1WFDA 9ICNA 4DR7T 1OXZA 2CBJA 4KLHA 4R64A 2DWGA 4DNDA 4ISSA 1NENA 3ZMSB 4TV8E 4I4TE 3GWHA 3JAEA 4QX7B 2LSJA 3N9QA 2WWVA 4OYKA 3AQLA 5J29A 4ZXLA 4NKUA 2H7OA 2E5VA 4JWNA 2FBWA 4HWDA 4HTEA 3V5UA 3TFSA 2JJ9A 4OX9T 3IEEA 4DBQA 2LEHA 3ZCIA 3AEFA 4H9RC 1LKXA 5J2AA 3B5MA 1G73A 4IE4A 3N2KE 1TFWA 4KB6A 5L3EB 2LSIA 1OEDE 3WAKA 4FI5A 1V9DA 8ICOA 4UB5A 4TNWA 1G8XA 3ANWB 3TKLB 2Q9QA 4I2DA 5J0PA 3JPRA 5HHIA 3T8OA 4TWFA 1JN3A 5FVKA 4UAWA 5KX5E 5DECA 2B4VA 4X66T 5CA0E 5HWXA 3ZLIA 4DV2T 4NPPA 3FBZA 1HCIA 2DR7A 5HHHA 2RA1A 5DB9A 4X5TA 3QNUA 1BR2A 2E9XC 4PJNA 3RKOA 4LZDA 5AQLB 1V4AA 2CHOA 2WM9A 1SUMB 2XM2A 4QXCB 4HFBA 3B0YA 2CCQA 1FIOA 4NXVA 3UU4A 4KLEA 4XQ8A 3ZMVB 4FH5A 4YFSA 1ZQBA 2V7KA 2M6IA 9ICSA 2XUEA 3KVAA 2BS2A 4DV1T 3WFQE 4PJJA 4X4VA 5F8PA 5FVLA 2KLQA 4GKJT 3JPPA 2GK9A 3JC6C 3K7DA 4I55E 3SS1A 3L8RA 8ICYA 2WP9A 4YMMA 5AQIB
chains in the Genus database with same CATH topology
2HN2A 3NVOA 4EGWA 5JTGA 4EEDA 2BBHA 4EV6A 2IUBA 4I0UA 3CK6A 2HN1A 2BBJA 4EEBA 3NWIA 3JCFA 3RKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HN2 A;  3NVO A;  4EGW A;  5JTG A;  4EED A;  2BBH A;  4EV6 A;  2IUB A;  4I0U A;  3CK6 A;  2HN1 A;  2BBJ A;  4EEB A;  3NWI A;  3JCF A;  3RKG A; 
#chains in the Genus database with same CATH topology
 2AXD S;  3UUM A;  4KBM B;  2ODV A;  5LJM A;  3UQ7 A;  2BG9 A;  3ABV A;  3UPQ A;  5IUX A;  3UUX B;  3H3M A;  1HUZ A;  4ZI2 D;  1KFY A;  2K48 A;  3CML A;  2BPF A;  5D63 A;  3ZN0 B;  1VRB A;  3P50 A;  5A1L A;  9ICT A;  1MIY A;  3PJA A;  3SRZ A;  4PW8 A;  1YKH B;  5ETW A;  4DMV A;  2CXF A;  3CX8 B;  3UTK A;  4CXW A;  1ZQR A;  1HG5 A;  3UQ0 A;  3LSV A;  1SA0 E;  1M62 A;  2VQF T;  4WYV A;  5HRD A;  3ONJ A;  5BPC A;  1KNZ A;  2XQA A;  4XBF B;  2WB5 A;  4QXH B;  4FHY A;  5LBM A;  5CHG A;  3SWH A;  4M1P A;  5JQG E;  3CIR A;  4K4H A;  4RPZ A;  9ICL A;  4HFD A;  3RYI E;  3HI2 A;  8ICQ A;  3KV9 A;  5H6R B;  1VCS A;  1WYC A;  2YIN A;  3AAI A;  4PK4 A;  4IE0 A;  5BOM A;  1XSP A;  2DRB A;  1US7 B;  2X67 A;  2P9B A;  4IL9 A;  3HA4 A;  1F5A A;  4IRE A;  4GIW A;  3KBU A;  4YSZ A;  3RJK A;  5B3Q A;  1J5W A;  3RX6 A;  5DAB A;  2ZLY A;  5L3D B;  3OJA A;  1WRD A;  3CX7 B;  3ZJ2 A;  4X1I E;  4K4I A;  2ZM0 A;  1JNR A;  5FXV A;  1ZQZ A;  4GKK T;  3FZH B;  2D0U A;  2LM2 A;  4QX8 B;  2MTQ A;  1CUN A;  4EZ4 A;  4MBQ A;  1TVA A;  5HCJ A;  3J9X 1;  1ZQJ A;  2J47 A;  4H9S E;  5DKW A;  4S3N A;  4IDQ A;  3ZC0 A;  3PUS A;  1UUR A;  3N9P A;  3JYY A;  5FY1 A;  5LMU T;  2I0M A;  3N9N A;  2ZH9 A;  2Q9Q D;  1YXR A;  1I94 T;  1KK7 A;  4LF8 T;  4K0U A;  4YTM A;  4NXT A;  4Q25 A;  4X1Y E;  9ICX A;  3V7J A;  2XQ6 A;  2UU9 T;  4KLF A;  2FJD A;  2DCF A;  4AQY T;  1ZQV A;  5J2J A;  3EDV A;  5F3J A;  4AKG A;  2DNX A;  3MGH A;  4ZS2 A;  8ICM A;  4O67 A;  4KM5 A;  1MMA A;  2PFV A;  3Q5W A;  9ICU A;  1HG2 A;  5FKY A;  2YKS A;  3TLW A;  4WBN E;  4E7X A;  5HC9 A;  1FJG T;  1YW0 A;  2A9U A;  1KNY A;  4GK5 E;  2ZH1 A;  4QZ9 A;  4UF0 B;  5J2G A;  4KP3 C;  5DQW A;  2BG9 E;  3V7K A;  4U2Y A;  2H3R A;  2DVI A;  4LF6 T;  2W61 A;  3AE5 A;  9ICM A;  3PUQ A;  2MPK A;  4WBO A;  4I2I A;  7ICN A;  4GYS A;  4JI1 T;  4RQ6 A;  5HRK A;  3KDS E;  1KNR A;  1YD8 G;  1BPE A;  4HE8 A;  4P09 A;  5FNV E;  5JDQ A;  5HEO A;  3Q5X A;  4K97 A;  2NW9 A;  1ZQK A;  4KLD A;  2JMK A;  1N34 T;  1JAJ A;  3N9M A;  2QYW A;  3CQC B;  4YD1 A;  4L0R A;  4X4P A;  2Q66 A;  4NKT A;  5LG4 A;  5EZY E;  5J2I A;  3AQK A;  4YD2 A;  2WSS V;  4H9Q C;  2LKG A;  4AIU A;  4NY8 A;  3ONX A;  5F5W A;  4PK6 A;  3EDU A;  3F57 A;  2KMF A;  3AEG A;  2GAF D;  4NXU A;  5D4B A;  5BMV E;  3AXJ A;  3OPC A;  3N5L A;  2N1G A;  4GXK A;  3SFE A;  5CB4 E;  5LA6 E;  5LBQ B;  1UEU A;  2V6Y B;  1ZEE A;  2X9H A;  4CXY A;  4CZZ B;  5DBB A;  2V7M A;  5LGN B;  9ICO A;  4UEM A;  4ATB B;  2WZI A;  4Z6E A;  4JI4 T;  4NXX A;  2P66 A;  4WBZ A;  1T72 A;  5JH7 E;  3LK3 B;  4AKL A;  4M2Y A;  2XAS B;  3TLT A;  2ZH6 A;  1BPZ A;  1ZQP A;  1MND A;  3FXE B;  3OYZ A;  1YLQ A;  5AQS B;  3FB2 A;  4RWN A;  2KSR A;  7ICP A;  2WMO A;  4TN7 B;  3J7Y q;  3PJA J;  1BPD A;  4IDP A;  2LHN A;  1IBL T;  3RGL A;  2HH7 A;  4CN1 A;  1PX5 A;  4E7Z A;  4EBK A;  2V7L A;  4UAZ A;  2LJL A;  1BPB A;  5DED A;  3OVS A;  4WNK A;  4XUS A;  4RPY A;  4M9J A;  2CXL A;  1SE7 A;  4I2F A;  4RQ1 A;  1X79 A;  4JLE A;  5C3J A;  3RLF F;  4JI0 T;  3VHL A;  4I2J A;  3UU5 A;  3UUL A;  3RH4 A;  4AKH A;  2AE9 A;  4ZOL E;  4JI6 T;  1ZQD A;  5JR9 B;  1B7T A;  2I6H A;  1ZQS A;  4X62 T;  4O2A E;  7ICQ A;  2E9X A;  3C64 A;  2DLR A;  2BZB A;  3PU8 A;  3EAB A;  4BAY B;  4UEL A;  3LK9 A;  1D0Y A;  3EHZ A;  4PGQ A;  2BVM A;  2V7I A;  3HJ4 A;  2IDO B;  2ODU A;  2MAW A;  2YU1 A;  3KV4 A;  3Q9D A;  2BCS A;  5LB7 B;  3MDC A;  2IW5 B;  3RRC A;  3MBY A;  4YHJ A;  5J0S A;  4DO0 A;  4FHX A;  5HRG A;  4F5N A;  2JMH A;  5HXR A;  3ZST A;  2ZMA A;  4QZI A;  4HEA A;  4O4L E;  1HNZ T;  3Q5E A;  3JPT A;  5LHH B;  2W4X A;  1FEW A;  2SPC A;  5FYM A;  2D9D A;  2Y6X A;  2W62 A;  4P0A A;  2F4V T;  3K3N A;  4KLQ A;  4IHJ E;  1N32 T;  2N9D A;  2XSB A;  2G0U A;  3OYX A;  9ICG A;  3KV5 A;  5J0U A;  3DTO A;  3P4S A;  3PMN A;  4IL4 A;  5M4Y A;  4KLJ A;  4DR2 T;  4DV6 T;  4OYJ A;  3VR9 A;  7ICE A;  2PFQ A;  3TLU A;  5CGM A;  4M04 A;  4NLN A;  4JUY A;  2BCQ A;  2J1D G;  5LOV E;  4QZB A;  4MHC A;  4QZA A;  4YMN A;  3RKG A;  3AE2 A;  1OU5 A;  5JDM A;  2WAU A;  4I2B A;  4G63 A;  5D61 A;  3UU8 A;  1UK5 A;  5L47 A;  4AT9 B;  3MGI A;  4HFC A;  1IJ5 A;  4UB2 A;  2LOP A;  3ANW A;  3TFR A;  4YMO A;  4O4H E;  1LVK A;  3ISB A;  4MLK A;  4QZC A;  5CFT A;  1XDP A;  4QXB B;  5HEU A;  5JR9 C;  3RYF E;  9ICC A;  1NOM A;  1D0X A;  4XA5 A;  4PFP A;  1HR0 T;  4IST A;  3GA8 A;  2W67 A;  4PJM A;  4RQ3 A;  9ICB A;  8ICL A;  4TX5 A;  1U5P A;  4ANJ A;  1MMD A;  1HNX T;  2CPT A;  3N2O A;  9ICI A;  3MZK B;  2Z6E A;  3A5X A;  2LM9 A;  3ZCJ A;  2NW7 A;  8ICG A;  5LG3 A;  3X1D A;  3B13 A;  4O5E A;  1ZQN A;  2FMP A;  2VL0 A;  3RH6 A;  5LXT E;  3O1H A;  4JI5 T;  1Z0P A;  3HR0 A;  7ICS A;  1FMW A;  1OED B;  5J0O A;  4I2G A;  7ICM A;  4Z6F A;  4WQK A;  3ZPO A;  2XAG B;  3MAC A;  5AQR B;  2XAQ B;  4DO9 A;  2DHR A;  4UBB A;  5LGU B;  2XAJ B;  3V7L A;  1HNW T;  2E9X D;  2KIN B;  5BOL A;  1BPX A;  4O4I E;  3T1H T;  2M2U A;  5CFB A;  3ZEF B;  2XTL A;  5J2C A;  2LHR A;  3LQC B;  4K9A A;  2IHM A;  5AQG B;  1ZQG A;  4UIG A;  1BR4 A;  4QZE A;  2W2U A;  3AEC A;  4X4S A;  1CHU A;  3JC6 D;  4BJN A;  2C5J A;  1YQ3 A;  4QZD A;  4PH5 A;  4LF5 T;  4FO1 A;  3JPN A;  3W15 B;  2CXD A;  4LVS A;  1ZQQ A;  3RF1 A;  8ICU A;  1Q78 A;  5DBC A;  2BS3 A;  2ZM8 A;  4CI3 B;  1D1C A;  4UAY A;  2VKJ A;  5FXZ A;  4LF4 T;  1WCR A;  3NVO A;  2CBI A;  4H9P C;  4OFZ A;  1HF8 A;  4OAG A;  5HXC A;  2PBI A;  2JRK A;  1O3X A;  3OUY B;  4B6X A;  4C91 A;  5HRE A;  3ETU A;  8ICT A;  3KVB A;  2BKN A;  5JDL A;  2UXD T;  2IC6 A;  1KEJ A;  8ICS A;  7ICU A;  4YJ2 E;  1N36 T;  4IG8 A;  4L5G A;  5LMN T;  4AT7 B;  2V5D A;  3NRX A;  3WAJ A;  1D1A A;  2JPF A;  1KDH A;  5CJ7 A;  2E5L T;  2X0H A;  4LFA T;  2XQ3 A;  4NXW A;  3RQW A;  1NO5 A;  3MDA A;  3ISD A;  3N9L A;  2ZM2 A;  3QC9 A;  2UXX B;  5HRH A;  4AKR B;  2C0S A;  4TUS A;  2NR4 A;  5ABF B;  4FHV A;  4DR6 T;  3TLV A;  4OAH A;  5HXS A;  3K8P C;  4JWM A;  3IBP A;  4PGX A;  4WW0 A;  1OED C;  4K0K T;  4GXJ A;  4AKI A;  5CJ5 A;  3AVR A;  2VQE T;  3UU3 A;  3RJF A;  4RQ2 A;  1UX4 A;  2CWY A;  3OVU A;  5DDY A;  3AU6 A;  4DR3 T;  4EYY R;  3R6N A;  3L9D A;  4UD5 A;  4O8S A;  3AA7 B;  1MQ2 A;  2BS4 A;  3ZT6 A;  2XJ7 A;  1N33 T;  4CN4 A;  4WOY A;  2ZH8 A;  3UFE A;  1GPJ A;  4O68 A;  2X9X A;  4X64 T;  4AI6 A;  5IIJ A;  5HWY A;  1ZQU A;  3UU6 A;  3FZK B;  2A2F X;  4IDO A;  1KF6 A;  4JI3 T;  3AED A;  7ICI A;  3LBX B;  2EHO B;  7ICR A;  3QOF A;  4HFE A;  4UF0 A;  4E8F A;  1J1J A;  3VU7 H;  4IIJ E;  2WMN A;  3B57 A;  1ZQM A;  2M67 A;  4DR1 T;  5FMN A;  4DV0 T;  4O2B E;  3PHZ A;  1JQR A;  2E2A A;  4G2A A;  1IZN B;  1ZQL A;  4P4P A;  8ICW A;  4RQ4 A;  3QUJ A;  2OLT A;  4O4J E;  4DVD A;  2IC9 A;  5AQP B;  4LF9 T;  5EOZ A;  2DR9 A;  3EVY A;  1L0V A;  3P4W A;  3UXP A;  1Y01 A;  4MF2 A;  4I27 A;  5L2L A;  5JDN A;  1HUO A;  2BVL A;  4UV9 B;  1VJ7 A;  3Q2M A;  4YJ3 E;  5IHY A;  5J0W A;  2BCV A;  3OWG A;  4I2C A;  4H63 V;  2BCU A;  3FZL B;  3AQN A;  3C18 A;  5CWR A;  2PFN A;  1DU2 A;  4K9B A;  3R84 B;  4EBJ A;  3ER9 B;  5JDF A;  2R6G F;  5L3B B;  3A7M A;  5HCM A;  3JAF A;  2LLY A;  5C8Y E;  2ES0 A;  8ICJ A;  3CQG B;  2V6Y A;  3P4R A;  4EYU A;  4IQV A;  1D0Z A;  4GK0 E;  2KWH A;  5J2F A;  3NWI A;  3P8C D;  4K98 A;  2WU5 A;  2BPG A;  1W09 A;  4FHW A;  1I6Z A;  5FXW A;  2IIU A;  2BE3 A;  4WQL A;  8ICF A;  3EUH A;  1Z8U A;  2YDQ A;  4LEW A;  4EXT A;  3C5G A;  2LRL A;  4LEZ A;  4EOZ B;  5F2V O;  3N2G E;  4Z6C A;  2LSY A;  5FL0 A;  2ZH3 A;  3CWZ B;  3I0O A;  4I2E A;  1WOT A;  3SOL A;  3ZYM A;  4M9G A;  3JAD A;  2WWU A;  9ICQ A;  4KLU A;  4PJL A;  2EHO C;  2H88 A;  2XQ8 A;  3FHN A;  3UFG A;  5IYZ E;  1LRZ A;  2C5I T;  3CKD A;  5L4H A;  4BJM A;  3PUX F;  4AT8 B;  3AA1 B;  1Q79 A;  4ZI3 C;  2K9A A;  5JR9 A;  3F31 A;  2HN2 A;  1LVF A;  1MIV A;  4ADZ A;  5DBA A;  2ZH4 A;  2ZHB A;  2NTX A;  1XMO T;  1NWM X;  4QZF A;  3L39 A;  3N9O A;  4HWF A;  5IWA T;  3JCF A;  3EAM A;  1KNP A;  4TUQ A;  4UB3 A;  4QWN B;  3BQK A;  3I9W A;  5ABE A;  5FY0 A;  4PGY A;  4M9L A;  4NUV A;  3H37 A;  5D62 A;  2ZH2 A;  4HN9 A;  4F5R A;  3ZKR A;  3MXZ A;  2OV9 A;  4UB4 A;  2UXC T;  5CP2 A;  3OGU A;  3KBT A;  1T98 A;  1ZQW A;  4B3S T;  3K3O A;  3RYC E;  4CXX A;  4KLG A;  2WQY A;  1WLX A;  5CFU A;  4LFB T;  3RIA A;  5J0T A;  2K3W A;  4GOU A;  3RQU A;  2BKP A;  5CFS A;  3V5S A;  3HW8 A;  2QVA A;  2K5B B;  5HXE A;  2CEA A;  3ZT5 A;  8ICP A;  1U4Q A;  5ADX L;  4F5O A;  1AJ3 A;  5J0R A;  4I29 A;  3RRW A;  3AE9 A;  2YDS A;  4TWH A;  4XQ7 A;  2Y48 B;  2X68 A;  4F6R C;  5J0Z A;  5D49 A;  4H63 H;  2DRA A;  3O4X E;  4IDN A;  3KIN B;  3P4P A;  3PUW F;  2M2W A;  2JIW A;  3G06 A;  3MKD A;  3IF8 B;  5B3P A;  3NKZ A;  2EWR A;  2W00 A;  2L3L A;  2B51 A;  5III A;  2BBH A;  5JRC B;  4KLI A;  3WFO A;  7ICF A;  3WFP A;  4AT9 A;  8ICZ A;  2E8I A;  4RWO A;  7ICG A;  3HL6 A;  2V5C A;  5J2H A;  4R65 A;  3VKG A;  1XDO A;  3PUY F;  4RT2 A;  4UXN B;  4FJO A;  3RI5 A;  4UBC A;  2ZM6 T;  5J0X A;  2X51 A;  1TV9 A;  3PV0 F;  3PDY A;  4XRH A;  4UR9 A;  2X0L B;  3ESL A;  4ZI7 E;  5LHG B;  2JQH A;  3WFS C;  3FXD B;  2IAK A;  4KHZ F;  2HHH T;  4PPX A;  4Z90 A;  2IHO A;  4X0A A;  4P4M A;  2X0Y A;  3LK2 B;  2FJE A;  2XAH B;  5AQV B;  3HWT A;  3HIY A;  3AEE A;  3H39 A;  4TUR A;  2LOS A;  5CA7 A;  3AA0 B;  3H3A A;  5HAX A;  7ICL A;  1E7P A;  1ZJN A;  3DJB A;  3UQ4 A;  2NRK A;  3C2K A;  3RHW A;  2UUB T;  2VVS A;  1IAP A;  4LT6 A;  4TUP A;  1VFG A;  5IIN A;  4I43 B;  4TV9 E;  2KT9 A;  2JQ9 A;  2M2V A;  9ICJ A;  3CVR A;  2PXI A;  2UXN B;  3V72 A;  8ICH A;  3AE1 A;  1OED A;  2B76 A;  1QSD A;  2LE8 A;  4WC0 A;  2YU2 A;  3AQM A;  2MYS A;  4A5X A;  3S4U A;  2WDR A;  2ISO A;  2PFP A;  4U33 A;  1QLB A;  3ZT7 A;  4YTN A;  5LHI B;  5EK2 A;  4DV5 T;  2V7J A;  4U2Z A;  2ZH5 A;  8ICB A;  3AUO A;  2HN1 A;  4PFO A;  5HEJ A;  3VRA A;  4M5D A;  2LSG A;  3AEA A;  1ZQA A;  4X4U A;  1VOM A;  3T1Y T;  4MF8 A;  2RPA A;  1BR0 A;  3UUB A;  7ICV A;  3ONL C;  4EV6 A;  2NP9 A;  4LEV A;  3RIU A;  5HEH A;  3U3I A;  2W63 A;  4JYA T;  5FXX A;  1YKE B;  3PTR B;  4EIW A;  3OBV E;  1HFA A;  2QGS A;  4KMC A;  3EI0 A;  3FZM B;  2RFF A;  4AQG A;  3K75 D;  1S94 A;  8ICX A;  3B0X A;  3RJE A;  4WC7 A;  4X4N A;  5HXH A;  4DV3 T;  4CN6 A;  4NXM T;  4C90 A;  4YSY A;  5TZV A;  2VKH A;  3C4Z A;  1ZJM A;  2ACZ A;  3MJX A;  2RP4 A;  4MFC A;  2PG8 A;  1NAF A;  5LYJ E;  2CM0 A;  5DB6 A;  5L4E A;  3ZC1 A;  1XSL A;  4X0B A;  3O1J A;  5L3F B;  4N7R A;  4MAL A;  4HWH A;  3ZYL A;  4MKP A;  5FY7 A;  4RQ8 A;  4WC3 A;  1HS7 A;  2A72 A;  5LCY A;  1ZQY A;  2NW8 A;  1XNR T;  5AQN B;  2UUC T;  4RQ0 A;  1ZOY A;  2XAF B;  3O1I A;  4EZH A;  2VUR A;  2DR5 A;  2DR8 A;  4QZ8 A;  5D46 A;  2XQ4 A;  4O9M A;  4NXN T;  5JDG A;  2I9G A;  4AT7 A;  5AQU B;  3UT5 E;  3BQL A;  4EAH A;  4YN4 A;  1Y64 B;  3UQ2 A;  5IIO A;  4IE6 A;  4NUU A;  3KFW X;  4ASK A;  2FCL A;  3OTO T;  3CK6 A;  2NTY A;  5C2T A;  3IHR A;  4PHE A;  3NYB A;  3RJJ A;  2N2N A;  5H6Q B;  2FJA A;  4NLK A;  1UET A;  3JPQ A;  5ABF A;  2CLY B;  2ID1 A;  2VWA A;  4F5P A;  4HFH A;  3H38 A;  1VCT A;  2KWI B;  4DOB A;  4WC5 A;  5EK3 A;  3C4X A;  3C51 A;  3F2E A;  2MBG A;  4X4Q A;  4X1K E;  3NBX X;  4JI7 T;  4B3R T;  1ZQF A;  2XSA A;  7ICH A;  3AE7 A;  3AEB A;  4HWC A;  5AQK B;  2XZE A;  3C98 B;  4COF A;  2YEV C;  5ABH A;  2GA9 D;  3D0T A;  5LNK A;  3K1S A;  4PNI A;  1IBM T;  4X4R A;  1RZT A;  4PAG A;  3NZQ A;  4JV5 T;  2HPL A;  2HHP A;  3LBX A;  1YQ4 A;  2EHO A;  4JLX A;  5AFU L;  5J2D A;  2J4G A;  3LDQ B;  2FMS A;  1SHZ C;  4RWP A;  1ZP0 A;  3VR8 A;  2W0G A;  4NM1 A;  2XQ7 A;  5ABG A;  4RQ5 A;  3GN5 B;  3UXO A;  4AQF C;  5J0Y A;  4DUZ T;  3EF2 A;  5AQT B;  2V26 A;  4DMW A;  4WH5 A;  2XM1 A;  5DJQ C;  4O5K A;  9ICF A;  4TUY E;  3RPU A;  3ERC C;  5J1G A;  4Z8X A;  4CI2 B;  2BDE A;  1XZY A;  2C5K T;  3LG7 A;  3HKB E;  3LFM A;  2BPC A;  4U31 A;  4NXZ A;  4PHD A;  4O5C A;  9ICH A;  3TLS A;  3OKQ A;  5DDM A;  4I50 E;  1ZQC A;  4EED A;  1R8A A;  8ICI A;  3NRY A;  2NOX A;  3M3Z B;  3RJI A;  3IA3 A;  1EZ3 A;  1UCU A;  4A56 A;  4P2H A;  7ICJ A;  5KDM C;  4YCX A;  2FMQ A;  8ICN A;  4O6A A;  3C66 A;  4KLO A;  9ICV A;  4LEY A;  4QHO A;  4XJE A;  8ICA A;  2X9Y A;  4QH1 A;  2Y8D A;  3UUN A;  4TNV A;  3PUA A;  4U7I A;  2CLY C;  2OA5 A;  3ETV A;  4B3M T;  4K8V A;  5J2E A;  3PU3 A;  3AE8 A;  4M9H A;  4PK5 A;  4GYR A;  5LJN A;  3RIU C;  2VKO A;  3CQX C;  4ZHQ E;  2XPK A;  5HRL A;  3KV6 A;  5JTG A;  3PUR A;  4LML A;  4RQ7 A;  4QH5 A;  2YN6 A;  2WCA A;  5IIL A;  2Q9Q B;  1JNZ A;  1FA0 A;  4ZS3 A;  4HX0 A;  4QZH A;  1WYB A;  1NEK A;  4YSX A;  3HKD E;  2CWO A;  1UX5 A;  2LSK A;  3AVS A;  4X4O A;  2PFO A;  3PUG A;  4JI2 T;  5CB1 A;  4XAX B;  5HYA A;  1KEY A;  3I0Q A;  1ZQI A;  4QKN A;  4V1A v;  4LMJ A;  1E2A A;  2ACX A;  4AT8 A;  4NLZ A;  5AQF B;  3AE3 A;  4DID B;  4ZI2 C;  2YOE A;  1D1B A;  4GXI A;  4EGW A;  2LT3 A;  2DI4 A;  4DOA A;  4UD4 A;  5GON E;  4PHP A;  4U74 A;  1MMG A;  1RPL A;  3P4Q A;  4YLH A;  2XY8 B;  1R89 A;  4YY3 T;  4PHA A;  4KX6 A;  5EK4 A;  5L3G B;  5AQH B;  4Z6D A;  3RC8 A;  1MIW A;  4KHP T;  4RPX A;  4MFA A;  4ILB A;  3U78 A;  2CMR A;  2I59 A;  4HKA A;  4UV8 B;  3JPO A;  4DUY T;  3RYH E;  1R8C A;  2BG9 B;  4ATB A;  8ICE A;  3C50 A;  2EHO D;  3PNC A;  4IE7 A;  5AQO B;  2WZH A;  4KLM A;  2X9W A;  2CE7 A;  4KUM B;  4UVA B;  2O5A A;  5E0O A;  3HKE E;  4P1N A;  5TAO A;  2J62 A;  3HKC E;  3NZP A;  2M6B A;  4ZI3 D;  1W0B A;  4YTP A;  2KZ7 B;  5J0Q A;  4I2A A;  3SFD A;  9ICR A;  3O9X A;  3JZ0 A;  3C2L A;  3AE4 A;  3ISC A;  2KXP B;  1ZV4 X;  2BKO A;  3I9Y A;  4J2C A;  3GDX A;  1X9B A;  1R8B A;  3ZMU B;  4FHP A;  1UGO A;  3MCR A;  4L9I A;  5AQQ B;  3PUV F;  4QZG A;  1MMN A;  4ILA A;  5JVD E;  1S35 A;  1ZKE A;  1M7K A;  4K96 A;  4R63 A;  2Q9Q C;  1XSN A;  4HGA A;  4LF7 T;  4U72 A;  4RWQ A;  1GQE A;  4HFV A;  1UUS A;  4R66 A;  4KLL A;  5JRC A;  2D5U A;  3C4W A;  2IML A;  2XQ5 A;  3K3Q C;  4JEH B;  4IDZ A;  4KLT A;  2ZHA A;  2L9Q A;  4M9N A;  5L3C B;  1FMV A;  1QUU A;  1T8B A;  3VKH A;  1WR0 A;  4KI0 F;  5J2K A;  2H89 A;  9ICW A;  1JMS A;  3QB5 A;  3ZMT B;  3RIF A;  1ZQE A;  4AXP A;  8ICK A;  4I28 A;  4UB1 A;  4K99 A;  3BQI A;  2O1P A;  3WI3 A;  3WFR E;  4LZG A;  1ZQX A;  4ILU A;  8ICC A;  3FBL A;  3BK9 A;  5J2U E;  3LK4 2;  4IT4 A;  4U3C A;  2IHR 1;  4JBW F;  2VKD A;  5KMG P;  3ZSS A;  3C2M A;  4F5Q A;  4P0B A;  2H7V C;  4WC4 A;  4YHH T;  1ZHC A;  4BA9 A;  5IIK A;  4XZC A;  5HRI A;  2VVN A;  2L8K A;  1HTJ F;  2FUP A;  4WC1 A;  1ZQT A;  3VRB A;  4OAI Z;  4RT3 A;  4DV4 T;  3I1A A;  2BG9 C;  3AAA B;  4LMK A;  1R8I A;  4HWI B;  4E80 A;  1IJ6 A;  5J2B A;  4WBY A;  4ERR A;  2B56 A;  4FO6 A;  2A3D A;  1MNE A;  4LFC T;  5DB8 A;  7ICO A;  3QB5 K;  5HRB A;  2QRX A;  2WU2 A;  4AIS A;  2GWS A;  1WR6 A;  4H9N C;  3OV7 A;  2XHE B;  5BR8 T;  4FH3 A;  4NIQ A;  4OHF A;  1BR1 A;  3NKU A;  5IIM A;  3MK7 C;  2QA7 A;  2YK0 A;  4YT0 A;  2V1D B;  2PTF A;  4TWD A;  5LP6 E;  4E7S A;  2HPJ A;  4OK0 A;  4IGU A;  4DV7 T;  3RH5 A;  4WZX A;  4M47 A;  2D2S A;  3ZN1 B;  5HRF A;  5KXJ A;  4WC6 A;  3E22 E;  3FZF B;  1UEV A;  4AQF A;  1HX8 A;  4YXD A;  4MFF A;  2BBJ A;  4N78 D;  4X4T A;  3ZMZ B;  4WC2 A;  8ICR A;  4JEU B;  5JRE A;  1H7C A;  2ISP A;  2BCR A;  5DQV A;  1XWM A;  4ZEY A;  3UPS A;  3PUZ F;  4I0U A;  3RH3 A;  4A97 A;  4X20 E;  2ZH7 A;  1MQ3 A;  4CQI A;  2V8S V;  2FJB A;  3RJH A;  3OVA A;  2YDR A;  9ICK A;  2VAS A;  2JQK A;  3AXJ B;  3C5F A;  2X66 A;  4U7Y A;  3PE0 A;  2DL1 A;  3ER8 C;  4B3T T;  5DB7 A;  4O69 A;  9ICP A;  4IE5 A;  2CHN A;  2CA5 A;  4DR5 T;  4M0A A;  3OVB A;  4IQU A;  5AQM B;  5JDH A;  3E0Z A;  2VAN A;  2PJQ A;  4DBR A;  2M2T A;  4K4G A;  5CA1 E;  2D0T A;  2LRK A;  2XQ9 A;  5CHE A;  2WDQ A;  4JI8 T;  1W0A A;  2MOZ A;  3CX6 B;  3HX0 A;  2WS3 A;  3HJ1 A;  2CRB A;  2KND A;  3QK6 A;  3DP7 A;  2B1E A;  5FP3 A;  3JPS A;  3UXN A;  3Q5D A;  4ZZC A;  4X5V A;  3ZJ1 A;  1OWA A;  4CI1 B;  1HX1 B;  2PBE A;  1XNQ T;  4EB6 E;  2W66 A;  3A8Y C;  2K24 A;  4P4O A;  1BPY A;  2VL8 A;  2IUB A;  8ICV A;  5CR0 A;  4I2H A;  3M65 A;  4DR4 T;  4ILC A;  9ICE A;  4F8H A;  9ICA A;  4NM2 A;  5HR9 A;  2W9M A;  3RC3 A;  3L3P A;  4UVB B;  2XQY A;  1E1H B;  2NWB A;  2WBL A;  4JLZ A;  4IQW A;  5HEG A;  4X65 T;  4ZZB A;  2UUA T;  2VK9 A;  2JQQ A;  3L09 A;  4Z91 A;  3AE6 A;  5AQJ B;  4IQT A;  3P7I A;  4EEB A;  4A98 A;  2WY2 A;  1ZQO A;  5J2T E;  4WCW A;  2E9X B;  2V6X A;  1IBK T;  4TZ4 C;  1ZQH A;  1T7S A;  3E08 A;  2VB6 A;  4OAF A;  3AA6 B;  4H9O C;  4QH4 A;  3GN5 A;  4UVC B;  1W9R A;  5FL1 A;  3OUY A;  3MA9 A;  1TFY A;  4MFR A;  3AU2 A;  2UXB T;  3RJG A;  3CPZ A;  5LGT B;  4EP7 A;  4DOC A;  2LKH A;  4HFI A;  7ICK A;  1J5E T;  2DWK A;  4KLS A;  3PML A;  1XMQ T;  3AB3 B;  3LJC A;  3AAE B;  7ICT A;  2WDV A;  3GMI A;  3ZYK A;  1WFD A;  9ICN A;  4DR7 T;  1OXZ A;  2CBJ A;  4KLH A;  4R64 A;  2DWG A;  4DND A;  4ISS A;  1NEN A;  3ZMS B;  4TV8 E;  4I4T E;  3GWH A;  3JAE A;  4QX7 B;  2LSJ A;  3N9Q A;  2WWV A;  4OYK A;  3AQL A;  5J29 A;  4ZXL A;  4NKU A;  2H7O A;  2E5V A;  4JWN A;  2FBW A;  4HWD A;  4HTE A;  3V5U A;  3TFS A;  2JJ9 A;  4OX9 T;  3IEE A;  4DBQ A;  2LEH A;  3ZCI A;  3AEF A;  4H9R C;  1LKX A;  5J2A A;  3B5M A;  1G73 A;  4IE4 A;  3N2K E;  1TFW A;  4KB6 A;  5L3E B;  2LSI A;  1OED E;  3WAK A;  4FI5 A;  1V9D A;  8ICO A;  4UB5 A;  4TNW A;  1G8X A;  3ANW B;  3TKL B;  2Q9Q A;  4I2D A;  5J0P A;  3JPR A;  5HHI A;  3T8O A;  4TWF A;  1JN3 A;  5FVK A;  4UAW A;  5KX5 E;  5DEC A;  2B4V A;  4X66 T;  5CA0 E;  5HWX A;  3ZLI A;  4DV2 T;  4NPP A;  3FBZ A;  1HCI A;  2DR7 A;  5HHH A;  2RA1 A;  5DB9 A;  4X5T A;  3QNU A;  1BR2 A;  2E9X C;  4PJN A;  3RKO A;  4LZD A;  5AQL B;  1V4A A;  2CHO A;  2WM9 A;  1SUM B;  2XM2 A;  4QXC B;  4HFB A;  3B0Y A;  2CCQ A;  1FIO A;  4NXV A;  3UU4 A;  4KLE A;  4XQ8 A;  3ZMV B;  4FH5 A;  4YFS A;  1ZQB A;  2V7K A;  2M6I A;  9ICS A;  2XUE A;  3KVA A;  2BS2 A;  4DV1 T;  3WFQ E;  4PJJ A;  4X4V A;  5F8P A;  5FVL A;  2KLQ A;  4GKJ T;  3JPP A;  2GK9 A;  3JC6 C;  3K7D A;  4I55 E;  3SS1 A;  3L8R A;  8ICY A;  2WP9 A;  4YMM A;  5AQI B; 
#chains in the Genus database with same CATH homology
 2HN2 A;  3NVO A;  4EGW A;  5JTG A;  4EED A;  2BBH A;  4EV6 A;  2IUB A;  4I0U A;  3CK6 A;  2HN1 A;  2BBJ A;  4EEB A;  3NWI A;  3JCF A;  3RKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...