2BBKL

Crystal structure of the quinoprotein methylamine dehydrogenase from paracoccus denitrificans at 1.75 angstroms
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
publication title Refined crystal structure of methylamine dehydrogenase from Paracoccus denitrificans at 1.75 A resolution.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 31
structure length 124
sequence length 125
chains with identical sequence M
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2bbkL00
2OJYD 2HJ4D 2HKMD 2AGLD 2H3XB 4K3IC 3SJLC 2Q7QD 2J57K 2MADL 2HKRD 3PXWC 2IURD 3SWSC 1MAFL 4Y5RC 3RN0C 2GC4B 2I0RD 2I0SD 2AGWD 4FA9C 1MG3B 2OK6D 4FB1C 2IAAB 2GC7B 3RN1C 4FA4C 3L4MC 2OIZD 2MTAL 2IUVD 2J56L 4FAVC 3RMZC 3L4OC 3C75L 4L3GC 3SXTC 4FANC 4FA1C 4L1QC 4L3HC 2AH0D 2AH1D 2IUQD 3SLEC 1MAEL 3ORVC 3PXSC 2AGXD 2J55L 4O1QC 2I0TD 3RLMC 3SVWC 2OK4D 2AGYD 4FA5C 3PXTC 1MDAL 2HXCD 1MG2B 2H47B 2IUPD 2HJBD 2BBKL 2AGZD
chains in the Genus database with same CATH superfamily
2OJYD 2HJ4D 2HKMD 2AGLD 2H3XB 4K3IC 3SJLC 2Q7QD 2J57K 2MADL 2HKRD 3PXWC 2IURD 3SWSC 1MAFL 4Y5RC 3RN0C 2GC4B 2I0RD 2I0SD 2AGWD 4FA9C 1MG3B 2OK6D 4FB1C 2IAAB 2GC7B 3RN1C 4FA4C 3L4MC 2OIZD 2MTAL 2IUVD 2J56L 4FAVC 3RMZC 3L4OC 3C75L 4L3GC 3SXTC 4FANC 4FA1C 4L1QC 4L3HC 2AH0D 2AH1D 2IUQD 3SLEC 1MAEL 3ORVC 3PXSC 2AGXD 2J55L 4O1QC 2I0TD 3RLMC 3SVWC 2OK4D 2AGYD 4FA5C 3PXTC 1MDAL 2HXCD 1MG2B 2H47B 2IUPD 2HJBD 2BBKL 2AGZD
chains in the Genus database with same CATH topology
2OJYD 2HJ4D 2HKMD 2AGLD 2H3XB 4K3IC 3SJLC 2Q7QD 2J57K 2MADL 2HKRD 3PXWC 2IURD 3SWSC 1MAFL 4Y5RC 3RN0C 2GC4B 2I0RD 2I0SD 2AGWD 4FA9C 1MG3B 2OK6D 4FB1C 2IAAB 2GC7B 3RN1C 4FA4C 3L4MC 2OIZD 2MTAL 2IUVD 2J56L 4FAVC 3RMZC 3L4OC 3C75L 4L3GC 3SXTC 4FANC 4FA1C 4L1QC 4L3HC 2AH0D 2AH1D 2IUQD 3SLEC 1MAEL 3ORVC 3PXSC 2AGXD 2J55L 4O1QC 2I0TD 3RLMC 3SVWC 2OK4D 2AGYD 4FA5C 3PXTC 1MDAL 2HXCD 1MG2B 2H47B 2IUPD 2HJBD 2BBKL 2AGZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJY D;  2HJ4 D;  2HKM D;  2AGL D;  2H3X B;  4K3I C;  3SJL C;  2Q7Q D;  2J57 K;  2MAD L;  2HKR D;  3PXW C;  2IUR D;  3SWS C;  1MAF L;  4Y5R C;  3RN0 C;  2GC4 B;  2I0R D;  2I0S D;  2AGW D;  4FA9 C;  1MG3 B;  2OK6 D;  4FB1 C;  2IAA B;  2GC7 B;  3RN1 C;  4FA4 C;  3L4M C;  2OIZ D;  2MTA L;  2IUV D;  2J56 L;  4FAV C;  3RMZ C;  3L4O C;  3C75 L;  4L3G C;  3SXT C;  4FAN C;  4FA1 C;  4L1Q C;  4L3H C;  2AH0 D;  2AH1 D;  2IUQ D;  3SLE C;  1MAE L;  3ORV C;  3PXS C;  2AGX D;  2J55 L;  4O1Q C;  2I0T D;  3RLM C;  3SVW C;  2OK4 D;  2AGY D;  4FA5 C;  3PXT C;  1MDA L;  2HXC D;  1MG2 B;  2H47 B;  2IUP D;  2HJB D;  2BBK L;  2AGZ D; 
#chains in the Genus database with same CATH topology
 2OJY D;  2HJ4 D;  2HKM D;  2AGL D;  2H3X B;  4K3I C;  3SJL C;  2Q7Q D;  2J57 K;  2MAD L;  2HKR D;  3PXW C;  2IUR D;  3SWS C;  1MAF L;  4Y5R C;  3RN0 C;  2GC4 B;  2I0R D;  2I0S D;  2AGW D;  4FA9 C;  1MG3 B;  2OK6 D;  4FB1 C;  2IAA B;  2GC7 B;  3RN1 C;  4FA4 C;  3L4M C;  2OIZ D;  2MTA L;  2IUV D;  2J56 L;  4FAV C;  3RMZ C;  3L4O C;  3C75 L;  4L3G C;  3SXT C;  4FAN C;  4FA1 C;  4L1Q C;  4L3H C;  2AH0 D;  2AH1 D;  2IUQ D;  3SLE C;  1MAE L;  3ORV C;  3PXS C;  2AGX D;  2J55 L;  4O1Q C;  2I0T D;  3RLM C;  3SVW C;  2OK4 D;  2AGY D;  4FA5 C;  3PXT C;  1MDA L;  2HXC D;  1MG2 B;  2H47 B;  2IUP D;  2HJB D;  2BBK L;  2AGZ D; 
#chains in the Genus database with same CATH homology
 2OJY D;  2HJ4 D;  2HKM D;  2AGL D;  2H3X B;  4K3I C;  3SJL C;  2Q7Q D;  2J57 K;  2MAD L;  2HKR D;  3PXW C;  2IUR D;  3SWS C;  1MAF L;  4Y5R C;  3RN0 C;  2GC4 B;  2I0R D;  2I0S D;  2AGW D;  4FA9 C;  1MG3 B;  2OK6 D;  4FB1 C;  2IAA B;  2GC7 B;  3RN1 C;  4FA4 C;  3L4M C;  2OIZ D;  2MTA L;  2IUV D;  2J56 L;  4FAV C;  3RMZ C;  3L4O C;  3C75 L;  4L3G C;  3SXT C;  4FAN C;  4FA1 C;  4L1Q C;  4L3H C;  2AH0 D;  2AH1 D;  2IUQ D;  3SLE C;  1MAE L;  3ORV C;  3PXS C;  2AGX D;  2J55 L;  4O1Q C;  2I0T D;  3RLM C;  3SVW C;  2OK4 D;  2AGY D;  4FA5 C;  3PXT C;  1MDA L;  2HXC D;  1MG2 B;  2H47 B;  2IUP D;  2HJB D;  2BBK L;  2AGZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...