2BBKL

Crystal structure of the quinoprotein methylamine dehydrogenase from paracoccus denitrificans at 1.75 angstroms
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
Knots found
sequence length
125
structure length
124
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
publication title Refined crystal structure of methylamine dehydrogenase from Paracoccus denitrificans at 1.75 A resolution.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 31
structure length 124
sequence length 125
chains with identical sequence M
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2bbkL00
2HJ4D 3SXTC 2IUVD 3PXTC 1MAFL 2AH0D 3PXSC 2IURD 4FA5C 4L3GC 2HKMD 3SWSC 2AGXD 2IUQD 2GC7B 2IAAB 2AH1D 2Q7QD 2OK4D 3RLMC 3RN1C 2HXCD 2J57K 4FA4C 4FB1C 3L4MC 2H47B 2AGLD 2J56L 4L1QC 2H3XB 2IUPD 2AGYD 3C75L 2MTAL 4FAVC 2BBKL 1MG3B 2OJYD 3L4OC 3RMZC 2OK6D 4FA1C 3SLEC 2MADL 4K3IC 3ORVC 2AGZD 2HKRD 2AGWD 2HJBD 4Y5RC 4FANC 3SJLC 2I0TD 4FA9C 2J55L 2OIZD 3PXWC 3RN0C 3SVWC 2GC4B 4O1QC 1MAEL 1MDAL 4L3HC 2I0SD 2I0RD 1MG2B
chains in the Genus database with same CATH superfamily
2HJ4D 3SXTC 2IUVD 3PXTC 1MAFL 2AH0D 3PXSC 2IURD 4FA5C 4L3GC 2HKMD 3SWSC 2AGXD 2IUQD 2GC7B 2IAAB 2AH1D 2Q7QD 2OK4D 3RLMC 3RN1C 2HXCD 2J57K 4FA4C 4FB1C 3L4MC 2H47B 2AGLD 2J56L 4L1QC 2H3XB 2IUPD 2AGYD 3C75L 2MTAL 4FAVC 2BBKL 1MG3B 2OJYD 3L4OC 3RMZC 2OK6D 4FA1C 3SLEC 2MADL 4K3IC 3ORVC 2AGZD 2HKRD 2AGWD 2HJBD 4Y5RC 4FANC 3SJLC 2I0TD 4FA9C 2J55L 2OIZD 3PXWC 3RN0C 3SVWC 2GC4B 4O1QC 1MAEL 1MDAL 4L3HC 2I0SD 2I0RD 1MG2B
chains in the Genus database with same CATH topology
2HJ4D 3SXTC 2IUVD 3PXTC 1MAFL 2AH0D 3PXSC 2IURD 4FA5C 4L3GC 2HKMD 3SWSC 2AGXD 2IUQD 2GC7B 2IAAB 2AH1D 2Q7QD 2OK4D 3RLMC 3RN1C 2HXCD 2J57K 4FA4C 4FB1C 3L4MC 2H47B 2AGLD 2J56L 4L1QC 2H3XB 2IUPD 2AGYD 3C75L 2MTAL 4FAVC 2BBKL 1MG3B 2OJYD 3L4OC 3RMZC 2OK6D 4FA1C 3SLEC 2MADL 4K3IC 3ORVC 2AGZD 2HKRD 2AGWD 2HJBD 4Y5RC 4FANC 3SJLC 2I0TD 4FA9C 2J55L 2OIZD 3PXWC 3RN0C 3SVWC 2GC4B 4O1QC 1MAEL 1MDAL 4L3HC 2I0SD 2I0RD 1MG2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJ4 D;  3SXT C;  2IUV D;  3PXT C;  1MAF L;  2AH0 D;  3PXS C;  2IUR D;  4FA5 C;  4L3G C;  2HKM D;  3SWS C;  2AGX D;  2IUQ D;  2GC7 B;  2IAA B;  2AH1 D;  2Q7Q D;  2OK4 D;  3RLM C;  3RN1 C;  2HXC D;  2J57 K;  4FA4 C;  4FB1 C;  3L4M C;  2H47 B;  2AGL D;  2J56 L;  4L1Q C;  2H3X B;  2IUP D;  2AGY D;  3C75 L;  2MTA L;  4FAV C;  2BBK L;  1MG3 B;  2OJY D;  3L4O C;  3RMZ C;  2OK6 D;  4FA1 C;  3SLE C;  2MAD L;  4K3I C;  3ORV C;  2AGZ D;  2HKR D;  2AGW D;  2HJB D;  4Y5R C;  4FAN C;  3SJL C;  2I0T D;  4FA9 C;  2J55 L;  2OIZ D;  3PXW C;  3RN0 C;  3SVW C;  2GC4 B;  4O1Q C;  1MAE L;  1MDA L;  4L3H C;  2I0S D;  2I0R D;  1MG2 B; 
#chains in the Genus database with same CATH topology
 2HJ4 D;  3SXT C;  2IUV D;  3PXT C;  1MAF L;  2AH0 D;  3PXS C;  2IUR D;  4FA5 C;  4L3G C;  2HKM D;  3SWS C;  2AGX D;  2IUQ D;  2GC7 B;  2IAA B;  2AH1 D;  2Q7Q D;  2OK4 D;  3RLM C;  3RN1 C;  2HXC D;  2J57 K;  4FA4 C;  4FB1 C;  3L4M C;  2H47 B;  2AGL D;  2J56 L;  4L1Q C;  2H3X B;  2IUP D;  2AGY D;  3C75 L;  2MTA L;  4FAV C;  2BBK L;  1MG3 B;  2OJY D;  3L4O C;  3RMZ C;  2OK6 D;  4FA1 C;  3SLE C;  2MAD L;  4K3I C;  3ORV C;  2AGZ D;  2HKR D;  2AGW D;  2HJB D;  4Y5R C;  4FAN C;  3SJL C;  2I0T D;  4FA9 C;  2J55 L;  2OIZ D;  3PXW C;  3RN0 C;  3SVW C;  2GC4 B;  4O1Q C;  1MAE L;  1MDA L;  4L3H C;  2I0S D;  2I0R D;  1MG2 B; 
#chains in the Genus database with same CATH homology
 2HJ4 D;  3SXT C;  2IUV D;  3PXT C;  1MAF L;  2AH0 D;  3PXS C;  2IUR D;  4FA5 C;  4L3G C;  2HKM D;  3SWS C;  2AGX D;  2IUQ D;  2GC7 B;  2IAA B;  2AH1 D;  2Q7Q D;  2OK4 D;  3RLM C;  3RN1 C;  2HXC D;  2J57 K;  4FA4 C;  4FB1 C;  3L4M C;  2H47 B;  2AGL D;  2J56 L;  4L1Q C;  2H3X B;  2IUP D;  2AGY D;  3C75 L;  2MTA L;  4FAV C;  2BBK L;  1MG3 B;  2OJY D;  3L4O C;  3RMZ C;  2OK6 D;  4FA1 C;  3SLE C;  2MAD L;  4K3I C;  3ORV C;  2AGZ D;  2HKR D;  2AGW D;  2HJB D;  4Y5R C;  4FAN C;  3SJL C;  2I0T D;  4FA9 C;  2J55 L;  2OIZ D;  3PXW C;  3RN0 C;  3SVW C;  2GC4 B;  4O1Q C;  1MAE L;  1MDA L;  4L3H C;  2I0S D;  2I0R D;  1MG2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...