2BBKL

Crystal structure of the quinoprotein methylamine dehydrogenase from paracoccus denitrificans at 1.75 angstroms
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
publication title Refined crystal structure of methylamine dehydrogenase from Paracoccus denitrificans at 1.75 A resolution.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 31
structure length 124
sequence length 125
chains with identical sequence M
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2bbkL00
1MAFL 4O1QC 3RLMC 2OK4D 2I0TD 2Q7QD 3PXWC 4FANC 2MTAL 4FA1C 4FA5C 4FAVC 2AGZD 3PXTC 1MG3B 4L3GC 2HJBD 3SJLC 2J56L 3RMZC 4L3HC 3C75L 2HKMD 2AGWD 3PXSC 4Y5RC 4FA4C 3SVWC 2AGLD 2AH1D 3L4OC 4FB1C 2HJ4D 2OJYD 2AGXD 1MG2B 2I0SD 3L4MC 3RN1C 1MDAL 2IURD 2J55L 2IUVD 3SXTC 3ORVC 2GC7B 2HXCD 2J57K 3SLEC 2MADL 4K3IC 3RN0C 2OK6D 2I0RD 2IUQD 2AGYD 2BBKL 2HKRD 2IUPD 4L1QC 4FA9C 2OIZD 2IAAB 2H47B 3SWSC 2GC4B 1MAEL 2AH0D 2H3XB
chains in the Genus database with same CATH superfamily
1MAFL 4O1QC 3RLMC 2OK4D 2I0TD 2Q7QD 3PXWC 4FANC 2MTAL 4FA1C 4FA5C 4FAVC 2AGZD 3PXTC 1MG3B 4L3GC 2HJBD 3SJLC 2J56L 3RMZC 4L3HC 3C75L 2HKMD 2AGWD 3PXSC 4Y5RC 4FA4C 3SVWC 2AGLD 2AH1D 3L4OC 4FB1C 2HJ4D 2OJYD 2AGXD 1MG2B 2I0SD 3L4MC 3RN1C 1MDAL 2IURD 2J55L 2IUVD 3SXTC 3ORVC 2GC7B 2HXCD 2J57K 3SLEC 2MADL 4K3IC 3RN0C 2OK6D 2I0RD 2IUQD 2AGYD 2BBKL 2HKRD 2IUPD 4L1QC 4FA9C 2OIZD 2IAAB 2H47B 3SWSC 2GC4B 1MAEL 2AH0D 2H3XB
chains in the Genus database with same CATH topology
1MAFL 4O1QC 3RLMC 2OK4D 2I0TD 2Q7QD 3PXWC 4FANC 2MTAL 4FA1C 4FA5C 4FAVC 2AGZD 3PXTC 1MG3B 4L3GC 2HJBD 3SJLC 2J56L 3RMZC 4L3HC 3C75L 2HKMD 2AGWD 3PXSC 4Y5RC 4FA4C 3SVWC 2AGLD 2AH1D 3L4OC 4FB1C 2HJ4D 2OJYD 2AGXD 1MG2B 2I0SD 3L4MC 3RN1C 1MDAL 2IURD 2J55L 2IUVD 3SXTC 3ORVC 2GC7B 2HXCD 2J57K 3SLEC 2MADL 4K3IC 3RN0C 2OK6D 2I0RD 2IUQD 2AGYD 2BBKL 2HKRD 2IUPD 4L1QC 4FA9C 2OIZD 2IAAB 2H47B 3SWSC 2GC4B 1MAEL 2AH0D 2H3XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MAF L;  4O1Q C;  3RLM C;  2OK4 D;  2I0T D;  2Q7Q D;  3PXW C;  4FAN C;  2MTA L;  4FA1 C;  4FA5 C;  4FAV C;  2AGZ D;  3PXT C;  1MG3 B;  4L3G C;  2HJB D;  3SJL C;  2J56 L;  3RMZ C;  4L3H C;  3C75 L;  2HKM D;  2AGW D;  3PXS C;  4Y5R C;  4FA4 C;  3SVW C;  2AGL D;  2AH1 D;  3L4O C;  4FB1 C;  2HJ4 D;  2OJY D;  2AGX D;  1MG2 B;  2I0S D;  3L4M C;  3RN1 C;  1MDA L;  2IUR D;  2J55 L;  2IUV D;  3SXT C;  3ORV C;  2GC7 B;  2HXC D;  2J57 K;  3SLE C;  2MAD L;  4K3I C;  3RN0 C;  2OK6 D;  2I0R D;  2IUQ D;  2AGY D;  2BBK L;  2HKR D;  2IUP D;  4L1Q C;  4FA9 C;  2OIZ D;  2IAA B;  2H47 B;  3SWS C;  2GC4 B;  1MAE L;  2AH0 D;  2H3X B; 
#chains in the Genus database with same CATH topology
 1MAF L;  4O1Q C;  3RLM C;  2OK4 D;  2I0T D;  2Q7Q D;  3PXW C;  4FAN C;  2MTA L;  4FA1 C;  4FA5 C;  4FAV C;  2AGZ D;  3PXT C;  1MG3 B;  4L3G C;  2HJB D;  3SJL C;  2J56 L;  3RMZ C;  4L3H C;  3C75 L;  2HKM D;  2AGW D;  3PXS C;  4Y5R C;  4FA4 C;  3SVW C;  2AGL D;  2AH1 D;  3L4O C;  4FB1 C;  2HJ4 D;  2OJY D;  2AGX D;  1MG2 B;  2I0S D;  3L4M C;  3RN1 C;  1MDA L;  2IUR D;  2J55 L;  2IUV D;  3SXT C;  3ORV C;  2GC7 B;  2HXC D;  2J57 K;  3SLE C;  2MAD L;  4K3I C;  3RN0 C;  2OK6 D;  2I0R D;  2IUQ D;  2AGY D;  2BBK L;  2HKR D;  2IUP D;  4L1Q C;  4FA9 C;  2OIZ D;  2IAA B;  2H47 B;  3SWS C;  2GC4 B;  1MAE L;  2AH0 D;  2H3X B; 
#chains in the Genus database with same CATH homology
 1MAF L;  4O1Q C;  3RLM C;  2OK4 D;  2I0T D;  2Q7Q D;  3PXW C;  4FAN C;  2MTA L;  4FA1 C;  4FA5 C;  4FAV C;  2AGZ D;  3PXT C;  1MG3 B;  4L3G C;  2HJB D;  3SJL C;  2J56 L;  3RMZ C;  4L3H C;  3C75 L;  2HKM D;  2AGW D;  3PXS C;  4Y5R C;  4FA4 C;  3SVW C;  2AGL D;  2AH1 D;  3L4O C;  4FB1 C;  2HJ4 D;  2OJY D;  2AGX D;  1MG2 B;  2I0S D;  3L4M C;  3RN1 C;  1MDA L;  2IUR D;  2J55 L;  2IUV D;  3SXT C;  3ORV C;  2GC7 B;  2HXC D;  2J57 K;  3SLE C;  2MAD L;  4K3I C;  3RN0 C;  2OK6 D;  2I0R D;  2IUQ D;  2AGY D;  2BBK L;  2HKR D;  2IUP D;  4L1Q C;  4FA9 C;  2OIZ D;  2IAA B;  2H47 B;  3SWS C;  2GC4 B;  1MAE L;  2AH0 D;  2H3X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...