2BBRA

Crystal structure of mc159 reveals molecular mechanism of disc assembly and vflip inhibition
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
194
structure length
189
Chain Sequence
SDSKEVPSLPFLRHLLEELDSHEDSLLLFLCHDAAPGCTTVTQALCSLSQQRKLTLAALVEMLYVLQRMDLLKSRFGLSKEGAEQLLGTSFLTRYRKLMVCVGEELDSSELRALRLFACNLNPSLSTALSESSRFVELVLALENVGLVSPSSVSVLADMLRTLRRLDLCQQLVEYEQQEQARYRYCLHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MC159 reveals molecular mechanism of DISC assembly and FLIP inhibition.
pubmed doi rcsb
source organism Molluscum contagiosum virus subtype 1
molecule tags Viral protein
molecule keywords Viral CASP8 and FADD-like apoptosis regulator
total genus 75
structure length 189
sequence length 194
ec nomenclature
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01335 DED Death effector domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2bbrA02
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2bbrA01
2BBZA 2L9MA 3CL3A 4E9MA 2P1HA 2DBDA 1D2ZB 4DWNA 4LWDA 2G7RA 3YGSP 2NZ7A 3EZQA 2A5YB 1Z6TA 4O6XA 1YGOA 4IZ7B 2YU0A 4M9ZA 2N00A 2VGQA 2IB1A 2MB9A 4IZAB 4ZBWA 2YVIA 4IZ5E 2D96A 1N3KA 3J6JA 4EWIA 3LQQA 4A2WA 1C15A 2DBGA 2LS7A 2DBFA 4F42A 4I16A 2NSNA 4O9LA 2YGSA 3KATA 4RHWA 2MN4A 4JQWA 2DO9A 2F1SA 1WH4A 3YGSC 3CRDA 4O9FA 2OF5A 4FH0A 1CY5A 2N1FA 2GF5A 3MOPA 4P4HI 2MS8A 1FADA 2NAQA 4O7QA 3LQRA 2B1WA 4JUPA 4F44A 2M5VA 1D2ZA 1CWWA 2A9IA 2KM6A 4M9XA 1E3YA 1ICHA 2LWEA 4N1JA 3J63A 1A1WA 2MPCA 2N83A 2L6AA 2YQFA 4P4HA 1PN5A 1WMGA 4M9SA 3MOPG 2LWDA 2N7ZA 2O71A 2BBRA 2KN6A 4N1LA 4A2QA 3T6PA 2HM2Q 1WXPA 4RHWE 1DGNA 2DBHA 4QOBA 1NGRA 2N97A 4D8OA 1E41A 3MOPK 3QF2A 3EZQB 1A1ZA 2N80A 1DDFA 1UCPA 2OF5H 4NQKA 4UZ0A 4N1KA 2MS7A
chains in the Genus database with same CATH superfamily
2BBZA 2L9MA 3CL3A 4E9MA 2P1HA 2DBDA 1D2ZB 4DWNA 4LWDA 2G7RA 3YGSP 2NZ7A 3EZQA 2A5YB 1Z6TA 4O6XA 1YGOA 4IZ7B 2YU0A 4M9ZA 2N00A 2VGQA 2IB1A 2MB9A 4IZAB 4ZBWA 2YVIA 4IZ5E 2D96A 1N3KA 3J6JA 4EWIA 3LQQA 4A2WA 1C15A 2DBGA 2LS7A 2DBFA 4F42A 4I16A 2NSNA 4O9LA 2YGSA 3KATA 4RHWA 2MN4A 4JQWA 2DO9A 2F1SA 1WH4A 3YGSC 3CRDA 4O9FA 2OF5A 4FH0A 1CY5A 2N1FA 2GF5A 3MOPA 4P4HI 2MS8A 1FADA 2NAQA 4O7QA 3LQRA 2B1WA 4JUPA 4F44A 2M5VA 1D2ZA 1CWWA 2A9IA 2KM6A 4M9XA 1E3YA 1ICHA 2LWEA 4N1JA 3J63A 1A1WA 2MJMA 2MPCA 2N83A 2L6AA 2YQFA 4P4HA 1PN5A 1WMGA 4M9SA 3MOPG 2LWDA 2N7ZA 2O71A 2BBRA 2KN6A 4N1LA 4A2QA 3T6PA 2HM2Q 1WXPA 2XV9A 4RHWE 1DGNA 2DBHA 4QOBA 1NGRA 2N97A 4D8OA 1E41A 3MOPK 3QF2A 3EZQB 1A1ZA 2N80A 1DDFA 1UCPA 2OF5H 4NQKA 4UZ0A 4N1KA 2MS7A
chains in the Genus database with same CATH topology
2BBZA 2L9MA 3CL3A 4E9MA 2P1HA 2DBDA 1D2ZB 4DWNA 4LWDA 2G7RA 3YGSP 2NZ7A 3EZQA 2A5YB 1Z6TA 4O6XA 1YGOA 4IZ7B 2YU0A 4M9ZA 2N00A 2VGQA 2IB1A 2MB9A 4IZAB 4ZBWA 2YVIA 4IZ5E 2D96A 1N3KA 3J6JA 4EWIA 3LQQA 4A2WA 1C15A 2DBGA 2LS7A 2DBFA 4F42A 4I16A 2NSNA 4O9LA 2YGSA 3KATA 4RHWA 2MN4A 4JQWA 2DO9A 2F1SA 1WH4A 3YGSC 3CRDA 4O9FA 2OF5A 4FH0A 1CY5A 2N1FA 2GF5A 3MOPA 4P4HI 2MS8A 1FADA 2NAQA 4O7QA 3LQRA 2B1WA 4JUPA 4F44A 2M5VA 1D2ZA 1CWWA 2A9IA 2KM6A 4M9XA 1E3YA 1ICHA 2LWEA 4N1JA 3J63A 1A1WA 2MJMA 2MPCA 2N83A 2L6AA 2YQFA 4P4HA 1PN5A 1WMGA 4M9SA 3MOPG 2LWDA 2N7ZA 2O71A 2BBRA 2KN6A 4N1LA 4A2QA 3T6PA 2HM2Q 1WXPA 2XV9A 4RHWE 1DGNA 2DBHA 4QOBA 1NGRA 2N97A 4D8OA 1E41A 3MOPK 3QF2A 3EZQB 1A1ZA 2N80A 1DDFA 1UCPA 2OF5H 4NQKA 4UZ0A 4N1KA 2MS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBZ A;  2L9M A;  3CL3 A;  4E9M A;  2P1H A;  2DBD A;  1D2Z B;  4DWN A;  4LWD A;  2G7R A;  3YGS P;  2NZ7 A;  3EZQ A;  2A5Y B;  1Z6T A;  4O6X A;  1YGO A;  4IZ7 B;  2YU0 A;  4M9Z A;  2N00 A;  2VGQ A;  2IB1 A;  2MB9 A;  4IZA B;  4ZBW A;  2YVI A;  4IZ5 E;  2D96 A;  1N3K A;  3J6J A;  4EWI A;  3LQQ A;  4A2W A;  1C15 A;  2DBG A;  2LS7 A;  2DBF A;  4F42 A;  4I16 A;  2NSN A;  4O9L A;  2YGS A;  3KAT A;  4RHW A;  2MN4 A;  4JQW A;  2DO9 A;  2F1S A;  1WH4 A;  3YGS C;  3CRD A;  4O9F A;  2OF5 A;  4FH0 A;  1CY5 A;  2N1F A;  2GF5 A;  3MOP A;  4P4H I;  2MS8 A;  1FAD A;  2NAQ A;  4O7Q A;  3LQR A;  2B1W A;  4JUP A;  4F44 A;  2M5V A;  1D2Z A;  1CWW A;  2A9I A;  2KM6 A;  4M9X A;  1E3Y A;  1ICH A;  2LWE A;  4N1J A;  3J63 A;  1A1W A;  2MPC A;  2N83 A;  2L6A A;  2YQF A;  4P4H A;  1PN5 A;  1WMG A;  4M9S A;  3MOP G;  2LWD A;  2N7Z A;  2O71 A;  2BBR A;  2KN6 A;  4N1L A;  4A2Q A;  3T6P A;  2HM2 Q;  1WXP A;  4RHW E;  1DGN A;  2DBH A;  4QOB A;  1NGR A;  2N97 A;  4D8O A;  1E41 A;  3MOP K;  3QF2 A;  3EZQ B;  1A1Z A;  2N80 A;  1DDF A;  1UCP A;  2OF5 H;  4NQK A;  4UZ0 A;  4N1K A;  2MS7 A; 
#chains in the Genus database with same CATH topology
 2BBZ A;  2L9M A;  3CL3 A;  4E9M A;  2P1H A;  2DBD A;  1D2Z B;  4DWN A;  4LWD A;  2G7R A;  3YGS P;  2NZ7 A;  3EZQ A;  2A5Y B;  1Z6T A;  4O6X A;  1YGO A;  4IZ7 B;  2YU0 A;  4M9Z A;  2N00 A;  2VGQ A;  2IB1 A;  2MB9 A;  4IZA B;  4ZBW A;  2YVI A;  4IZ5 E;  2D96 A;  1N3K A;  3J6J A;  4EWI A;  3LQQ A;  4A2W A;  1C15 A;  2DBG A;  2LS7 A;  2DBF A;  4F42 A;  4I16 A;  2NSN A;  4O9L A;  2YGS A;  3KAT A;  4RHW A;  2MN4 A;  4JQW A;  2DO9 A;  2F1S A;  1WH4 A;  3YGS C;  3CRD A;  4O9F A;  2OF5 A;  4FH0 A;  1CY5 A;  2N1F A;  2GF5 A;  3MOP A;  4P4H I;  2MS8 A;  1FAD A;  2NAQ A;  4O7Q A;  3LQR A;  2B1W A;  4JUP A;  4F44 A;  2M5V A;  1D2Z A;  1CWW A;  2A9I A;  2KM6 A;  4M9X A;  1E3Y A;  1ICH A;  2LWE A;  4N1J A;  3J63 A;  1A1W A;  2MJM A;  2MPC A;  2N83 A;  2L6A A;  2YQF A;  4P4H A;  1PN5 A;  1WMG A;  4M9S A;  3MOP G;  2LWD A;  2N7Z A;  2O71 A;  2BBR A;  2KN6 A;  4N1L A;  4A2Q A;  3T6P A;  2HM2 Q;  1WXP A;  2XV9 A;  4RHW E;  1DGN A;  2DBH A;  4QOB A;  1NGR A;  2N97 A;  4D8O A;  1E41 A;  3MOP K;  3QF2 A;  3EZQ B;  1A1Z A;  2N80 A;  1DDF A;  1UCP A;  2OF5 H;  4NQK A;  4UZ0 A;  4N1K A;  2MS7 A; 
#chains in the Genus database with same CATH homology
 2BBZ A;  2L9M A;  3CL3 A;  4E9M A;  2P1H A;  2DBD A;  1D2Z B;  4DWN A;  4LWD A;  2G7R A;  3YGS P;  2NZ7 A;  3EZQ A;  2A5Y B;  1Z6T A;  4O6X A;  1YGO A;  4IZ7 B;  2YU0 A;  4M9Z A;  2N00 A;  2VGQ A;  2IB1 A;  2MB9 A;  4IZA B;  4ZBW A;  2YVI A;  4IZ5 E;  2D96 A;  1N3K A;  3J6J A;  4EWI A;  3LQQ A;  4A2W A;  1C15 A;  2DBG A;  2LS7 A;  2DBF A;  4F42 A;  4I16 A;  2NSN A;  4O9L A;  2YGS A;  3KAT A;  4RHW A;  2MN4 A;  4JQW A;  2DO9 A;  2F1S A;  1WH4 A;  3YGS C;  3CRD A;  4O9F A;  2OF5 A;  4FH0 A;  1CY5 A;  2N1F A;  2GF5 A;  3MOP A;  4P4H I;  2MS8 A;  1FAD A;  2NAQ A;  4O7Q A;  3LQR A;  2B1W A;  4JUP A;  4F44 A;  2M5V A;  1D2Z A;  1CWW A;  2A9I A;  2KM6 A;  4M9X A;  1E3Y A;  1ICH A;  2LWE A;  4N1J A;  3J63 A;  1A1W A;  2MJM A;  2MPC A;  2N83 A;  2L6A A;  2YQF A;  4P4H A;  1PN5 A;  1WMG A;  4M9S A;  3MOP G;  2LWD A;  2N7Z A;  2O71 A;  2BBR A;  2KN6 A;  4N1L A;  4A2Q A;  3T6P A;  2HM2 Q;  1WXP A;  2XV9 A;  4RHW E;  1DGN A;  2DBH A;  4QOB A;  1NGR A;  2N97 A;  4D8O A;  1E41 A;  3MOP K;  3QF2 A;  3EZQ B;  1A1Z A;  2N80 A;  1DDF A;  1UCP A;  2OF5 H;  4NQK A;  4UZ0 A;  4N1K A;  2MS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...