2BBRA

Crystal structure of mc159 reveals molecular mechanism of disc assembly and vflip inhibition
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
194
structure length
189
Chain Sequence
SDSKEVPSLPFLRHLLEELDSHEDSLLLFLCHDAAPGCTTVTQALCSLSQQRKLTLAALVEMLYVLQRMDLLKSRFGLSKEGAEQLLGTSFLTRYRKLMVCVGEELDSSELRALRLFACNLNPSLSTALSESSRFVELVLALENVGLVSPSSVSVLADMLRTLRRLDLCQQLVEYEQQEQARYRYCLHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MC159 reveals molecular mechanism of DISC assembly and FLIP inhibition.
pubmed doi rcsb
source organism Molluscum contagiosum virus subtype 1
molecule tags Viral protein
molecule keywords Viral CASP8 and FADD-like apoptosis regulator
total genus 75
structure length 189
sequence length 194
ec nomenclature
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01335 DED Death effector domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2bbrA02
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2bbrA01
2BBRA 1CWWA 4JUPA 2DBHA 4IZ5E 4I16A 2A5YB 1C15A 1WMGA 2N00A 4N1LA 4FH0A 4F42A 2D96A 4ZBWA 1DDFA 3YGSC 4IZ7B 2F1SA 2KN6A 2N1FA 3J6JA 4O9FA 4O6XA 2DBGA 4LWDA 2NSNA 3T6PA 2MS8A 1A1WA 2N80A 3MOPK 2A9IA 2N97A 2L9MA 3MOPA 2YVIA 1N3KA 4IZAB 4M9ZA 3LQRA 4A2WA 2DBDA 2O71A 4F44A 4P4HI 4O9LA 2P1HA 2MN4A 2OF5H 3LQQA 4QOBA 4EWIA 1FADA 4M9XA 2M5VA 2KM6A 3MOPG 3EZQB 1DGNA 4A2QA 2BBZA 2DO9A 4M9SA 4JQWA 1UCPA 4D8OA 2G7RA 2NZ7A 3CRDA 4RHWA 3YGSP 1ICHA 2YGSA 2LWEA 1NGRA 2MS7A 1D2ZA 3J63A 2IB1A 4NQKA 3KATA 3QF2A 2YU0A 2LS7A 4N1JA 2N7ZA 4O7QA 4P4HA 2MPCA 1YGOA 2VGQA 2YQFA 1PN5A 1WXPA 1Z6TA 2NAQA 1A1ZA 4DWNA 2L6AA 4N1KA 1E3YA 2LWDA 4E9MA 1E41A 2HM2Q 4UZ0A 1WH4A 2GF5A 1CY5A 2MB9A 2DBFA 2N83A 2B1WA 3EZQA 3CL3A 4RHWE 2OF5A 1D2ZB
chains in the Genus database with same CATH superfamily
2BBRA 1CWWA 4JUPA 2DBHA 4IZ5E 4I16A 2A5YB 1C15A 1WMGA 2N00A 4N1LA 4FH0A 4F42A 2D96A 4ZBWA 1DDFA 3YGSC 4IZ7B 2F1SA 2KN6A 2N1FA 3J6JA 4O9FA 4O6XA 2DBGA 4LWDA 2NSNA 3T6PA 2MS8A 1A1WA 2N80A 3MOPK 2A9IA 2N97A 2L9MA 3MOPA 2YVIA 1N3KA 4IZAB 4M9ZA 3LQRA 4A2WA 2DBDA 2O71A 4F44A 4P4HI 4O9LA 2P1HA 2MN4A 2OF5H 3LQQA 4QOBA 4EWIA 1FADA 4M9XA 2M5VA 2KM6A 3MOPG 3EZQB 1DGNA 4A2QA 2BBZA 2DO9A 4M9SA 4JQWA 1UCPA 4D8OA 2G7RA 2NZ7A 3CRDA 4RHWA 3YGSP 1ICHA 2YGSA 2LWEA 1NGRA 2MS7A 1D2ZA 3J63A 2IB1A 4NQKA 3KATA 3QF2A 2YU0A 2LS7A 4N1JA 2N7ZA 4O7QA 4P4HA 2MPCA 1YGOA 2VGQA 2YQFA 1PN5A 1WXPA 1Z6TA 2NAQA 1A1ZA 4DWNA 2L6AA 2XV9A 4N1KA 1E3YA 2LWDA 4E9MA 1E41A 2HM2Q 4UZ0A 1WH4A 2GF5A 1CY5A 2MB9A 2DBFA 2MJMA 2B1WA 2N83A 3EZQA 3CL3A 4RHWE 2OF5A 1D2ZB
chains in the Genus database with same CATH topology
2BBRA 1CWWA 4JUPA 2DBHA 4IZ5E 4I16A 2A5YB 1C15A 1WMGA 2N00A 4N1LA 4FH0A 4F42A 2D96A 4ZBWA 1DDFA 3YGSC 4IZ7B 2F1SA 2KN6A 2N1FA 3J6JA 4O9FA 4O6XA 2DBGA 4LWDA 2NSNA 3T6PA 2MS8A 1A1WA 2N80A 3MOPK 2A9IA 2N97A 2L9MA 3MOPA 2YVIA 1N3KA 4IZAB 4M9ZA 3LQRA 4A2WA 2DBDA 2O71A 4F44A 4P4HI 4O9LA 2P1HA 2MN4A 2OF5H 3LQQA 4QOBA 4EWIA 1FADA 4M9XA 2M5VA 2KM6A 3MOPG 3EZQB 1DGNA 4A2QA 2BBZA 2DO9A 4M9SA 4JQWA 1UCPA 4D8OA 2G7RA 2NZ7A 3CRDA 4RHWA 3YGSP 1ICHA 2YGSA 2LWEA 1NGRA 2MS7A 1D2ZA 3J63A 2IB1A 4NQKA 3KATA 3QF2A 2YU0A 2LS7A 4N1JA 2N7ZA 4O7QA 4P4HA 2MPCA 1YGOA 2VGQA 2YQFA 1PN5A 1WXPA 1Z6TA 2NAQA 1A1ZA 4DWNA 2L6AA 2XV9A 4N1KA 1E3YA 2LWDA 4E9MA 1E41A 2HM2Q 4UZ0A 1WH4A 2GF5A 1CY5A 2MB9A 2DBFA 2MJMA 2B1WA 2N83A 3EZQA 3CL3A 4RHWE 2OF5A 1D2ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBR A;  1CWW A;  4JUP A;  2DBH A;  4IZ5 E;  4I16 A;  2A5Y B;  1C15 A;  1WMG A;  2N00 A;  4N1L A;  4FH0 A;  4F42 A;  2D96 A;  4ZBW A;  1DDF A;  3YGS C;  4IZ7 B;  2F1S A;  2KN6 A;  2N1F A;  3J6J A;  4O9F A;  4O6X A;  2DBG A;  4LWD A;  2NSN A;  3T6P A;  2MS8 A;  1A1W A;  2N80 A;  3MOP K;  2A9I A;  2N97 A;  2L9M A;  3MOP A;  2YVI A;  1N3K A;  4IZA B;  4M9Z A;  3LQR A;  4A2W A;  2DBD A;  2O71 A;  4F44 A;  4P4H I;  4O9L A;  2P1H A;  2MN4 A;  2OF5 H;  3LQQ A;  4QOB A;  4EWI A;  1FAD A;  4M9X A;  2M5V A;  2KM6 A;  3MOP G;  3EZQ B;  1DGN A;  4A2Q A;  2BBZ A;  2DO9 A;  4M9S A;  4JQW A;  1UCP A;  4D8O A;  2G7R A;  2NZ7 A;  3CRD A;  4RHW A;  3YGS P;  1ICH A;  2YGS A;  2LWE A;  1NGR A;  2MS7 A;  1D2Z A;  3J63 A;  2IB1 A;  4NQK A;  3KAT A;  3QF2 A;  2YU0 A;  2LS7 A;  4N1J A;  2N7Z A;  4O7Q A;  4P4H A;  2MPC A;  1YGO A;  2VGQ A;  2YQF A;  1PN5 A;  1WXP A;  1Z6T A;  2NAQ A;  1A1Z A;  4DWN A;  2L6A A;  4N1K A;  1E3Y A;  2LWD A;  4E9M A;  1E41 A;  2HM2 Q;  4UZ0 A;  1WH4 A;  2GF5 A;  1CY5 A;  2MB9 A;  2DBF A;  2N83 A;  2B1W A;  3EZQ A;  3CL3 A;  4RHW E;  2OF5 A;  1D2Z B; 
#chains in the Genus database with same CATH topology
 2BBR A;  1CWW A;  4JUP A;  2DBH A;  4IZ5 E;  4I16 A;  2A5Y B;  1C15 A;  1WMG A;  2N00 A;  4N1L A;  4FH0 A;  4F42 A;  2D96 A;  4ZBW A;  1DDF A;  3YGS C;  4IZ7 B;  2F1S A;  2KN6 A;  2N1F A;  3J6J A;  4O9F A;  4O6X A;  2DBG A;  4LWD A;  2NSN A;  3T6P A;  2MS8 A;  1A1W A;  2N80 A;  3MOP K;  2A9I A;  2N97 A;  2L9M A;  3MOP A;  2YVI A;  1N3K A;  4IZA B;  4M9Z A;  3LQR A;  4A2W A;  2DBD A;  2O71 A;  4F44 A;  4P4H I;  4O9L A;  2P1H A;  2MN4 A;  2OF5 H;  3LQQ A;  4QOB A;  4EWI A;  1FAD A;  4M9X A;  2M5V A;  2KM6 A;  3MOP G;  3EZQ B;  1DGN A;  4A2Q A;  2BBZ A;  2DO9 A;  4M9S A;  4JQW A;  1UCP A;  4D8O A;  2G7R A;  2NZ7 A;  3CRD A;  4RHW A;  3YGS P;  1ICH A;  2YGS A;  2LWE A;  1NGR A;  2MS7 A;  1D2Z A;  3J63 A;  2IB1 A;  4NQK A;  3KAT A;  3QF2 A;  2YU0 A;  2LS7 A;  4N1J A;  2N7Z A;  4O7Q A;  4P4H A;  2MPC A;  1YGO A;  2VGQ A;  2YQF A;  1PN5 A;  1WXP A;  1Z6T A;  2NAQ A;  1A1Z A;  4DWN A;  2L6A A;  2XV9 A;  4N1K A;  1E3Y A;  2LWD A;  4E9M A;  1E41 A;  2HM2 Q;  4UZ0 A;  1WH4 A;  2GF5 A;  1CY5 A;  2MB9 A;  2DBF A;  2MJM A;  2B1W A;  2N83 A;  3EZQ A;  3CL3 A;  4RHW E;  2OF5 A;  1D2Z B; 
#chains in the Genus database with same CATH homology
 2BBR A;  1CWW A;  4JUP A;  2DBH A;  4IZ5 E;  4I16 A;  2A5Y B;  1C15 A;  1WMG A;  2N00 A;  4N1L A;  4FH0 A;  4F42 A;  2D96 A;  4ZBW A;  1DDF A;  3YGS C;  4IZ7 B;  2F1S A;  2KN6 A;  2N1F A;  3J6J A;  4O9F A;  4O6X A;  2DBG A;  4LWD A;  2NSN A;  3T6P A;  2MS8 A;  1A1W A;  2N80 A;  3MOP K;  2A9I A;  2N97 A;  2L9M A;  3MOP A;  2YVI A;  1N3K A;  4IZA B;  4M9Z A;  3LQR A;  4A2W A;  2DBD A;  2O71 A;  4F44 A;  4P4H I;  4O9L A;  2P1H A;  2MN4 A;  2OF5 H;  3LQQ A;  4QOB A;  4EWI A;  1FAD A;  4M9X A;  2M5V A;  2KM6 A;  3MOP G;  3EZQ B;  1DGN A;  4A2Q A;  2BBZ A;  2DO9 A;  4M9S A;  4JQW A;  1UCP A;  4D8O A;  2G7R A;  2NZ7 A;  3CRD A;  4RHW A;  3YGS P;  1ICH A;  2YGS A;  2LWE A;  1NGR A;  2MS7 A;  1D2Z A;  3J63 A;  2IB1 A;  4NQK A;  3KAT A;  3QF2 A;  2YU0 A;  2LS7 A;  4N1J A;  2N7Z A;  4O7Q A;  4P4H A;  2MPC A;  1YGO A;  2VGQ A;  2YQF A;  1PN5 A;  1WXP A;  1Z6T A;  2NAQ A;  1A1Z A;  4DWN A;  2L6A A;  2XV9 A;  4N1K A;  1E3Y A;  2LWD A;  4E9M A;  1E41 A;  2HM2 Q;  4UZ0 A;  1WH4 A;  2GF5 A;  1CY5 A;  2MB9 A;  2DBF A;  2MJM A;  2B1W A;  2N83 A;  3EZQ A;  3CL3 A;  4RHW E;  2OF5 A;  1D2Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...