2BC5A

Crystal structure of e. coli cytochrome b562 with engineered c-type heme linkages
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMWDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Stability and Folding Kinetics of Structurally Characterized Cytochrome c-b(562).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 47
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2bc5A00
3M4BA 4D4NA 4JKVA 3ZTZA 2XLDA 2YL3A 3QW0A 5JVEA 4CDAA 1BBHA 2XL6A 1JAFA 4L6RA 1GQAA 3NMIA 3HNKA 2YL1A 3TOLA 3L1MA 1CGNA 1E86A 4ULVA 5JRAA 5JUAA 1M6TA 4EIYA 2QLAA 1S05A 3HNLA 2XLMA 2XLEA 4WGZA 1LM3B 3DE8A 4IARA 2XLWA 1YZAA 3NMKA 3IQ6A 4N6HA 5JSLA 3IQ5A 2XM4A 256BA 4CJOA 1CGOA 4U9EA 3VRCA 2J8WA 3FOOA 4U9DA 1E84A 2YKZA 2YLDA 4N4WA 2XM0A 1A7VA 3HNIA 1MQVA 2XLOA 5JLIA 3M15A 1CPQA 3U8PA 4ER9A 2YLIA 1QQ3A 3HNJA 3QW1A 4D4XA 3M79A 1YYJA 3DE9A 3TOMA 1RCPA 2XLVA 3C63A 1APCA 3QVZA 1CPRA 2BC5A 2J9BA 5JP7A 3M4CA 1E85A 1EKYA 1YYXA 4WGYA 2YL7A 4JEAA 4IAQA 3ZQVA 3ZQYA 5JS5A 1E83A 3NMJA 2YLGA 5JT4A 2XL8A 1NBBA 3ZTMA 1YZCA 4JE9A 4CDYA 4NC3A 1QPUA 4CX9A 4IB4A 2CCYA 4JEBA 2XLHA 3C62A 3FOPA 4CJGA 3QVYA 4CIPA 4CDVA 2YL0A 5B3IA 3ZWIA 5AGFA
chains in the Genus database with same CATH superfamily
3NRHA 3AQCA 2B0HA 3M4BA 3MFNA 3QZCA 2R7RA 2KSFA 1IW7F 3S29A 3K33A 2J0XA 3AG1C 2UUHA 2KJGA 1T01A 3EFOB 4PJMA 5FZTA 3RW0A 4DVYP 5BQHA 2HKVA 5A69A 1N1CA 2YRFA 4MVQA 3C7JA 1C17M 4KC9A 1NU9C 1JAFA 2RSEB 3U2MA 1GQAA 3GANA 3NMIA 5KYXA 2MYSA 3SNHA 3IEEA 3Q7GA 1RMVA 2CDQA 2IYLD 3O55A 1CGNA 1ST6A 3A9CA 3DWWA 3I5PA 4ULVA 3EZHA 3VAYA 5A6KA 5HV9A 4O6YA 3EGDA 1YARO 3CAXA 4JVSA 3EG9B 4A4AA 5L0CA 3S9OA 2L9JA 3HJCA 2E87A 1PV3A 2D4UA 2KQ9A 1ZHXA 2Q7RA 4ANJA 3ASNC 1LE4A 2LCHA 2XLMA 1TFOB 2J7PA 3RFYA 4BJ5C 1G5ZA 2YQYA 3OA1A 4AK9A 4O6NA 3EGDB 3LLKA 3NMKA 1WOLA 1UG7A 1A7EA 1T5OA 4J7TA 4YT8A 2Q00A 2QNLA 3K1HA 4MW8A 2A68F 3J06A 1JPJA 3DAGA 2VCCA 3IPMO 4JW1A 2NSFA 1I4YA 2CGEA 4G78A 4YN0B 3IQ5A 1I4ZA 5BQGA 1F1MA 2XSEA 1WN0A 3AGTA 4K1OA 3AGUA 3ABKC 1CGOA 4JJGA 4XEFA 2J8WA 3VRCA 5L0IA 5KYYA 2XXAA 1EQ1A 3GM1A 3FOOA 4AX2A 2J9WA 3LJBA 4U5DE 4DRJB 3L8JA 1TR2A 5CI8A 2DYSC 4N4WA 1VOMA 1D1CA 3LESA 3TK0A 1MQVA 2YWAA 2LIGA 3KH2A 2XLOA 1LI5A 1OCCC 3C18A 3W4YA 1Z23A 3DI5A 3T6BA 2CW0F 1DOWA 4YL0A 5KYYB 2KGOA 5DS6A 2ETSA 1LS1A 2NUPA 3U8PA 2L6HA 4IAOA 2HV6A 3KKBA 2EPKX 3HNJA 1U0BB 3VM6A 1FFHA 2C04A 3V5XA 3LLIA 1Q0MA 3I5QA 3TOMA 1PCXA 1APCA 4DRIB 4XLNF 1OQCA 1LKXA 2X0CA 3VYWA 3K6BA 1CPRA 3DMDA 2ASRA 2NUPB 3DD7A 3FMSA 4MVOA 3G50A 4P6IC 1WATA 3T4RA 3ZDLA 1D0XA 1AEPA 1MMDA 1Z63A 4CSAA 3EHNA 5KYWB 2PX0A 3DXJF 3UMKA 2J0WA 3SXMA 3SXKA 4PFOA 3EHMA 1ZHZA 3MX3A 3KL4A 3EQLF 4O79A 5JS5A 2NUTA 2J45A 4MVZA 2Y39A 2P61A 2H7OA 4NTAA 2JPUA 3S28A 3MLGA 5T3TA 5BUOA 1TWAA 2V3CC 2YLGA 3N24A 4RDAA 2UUIA 1C02A 3POVA 2XL8A 2R25A 2A0BA 4Q7CA 4G0HA 4XTKA 1XZPA 3JT1A 3AOUA 3O10A 2L81A 4CDYA 2R7QA 4HE8D 2EINC 4JC7A 2LK4A 3LUTB 4E18A 1J8MF 2VCAA 3JSZA 4W8KA 1DOVA 3B29A 4U5BE 4AE4A 4XLPF 4C7OA 4K7BA 2R7VA 2R7OA 3GWLA 4C3EA 3EJNA 2PP4A 1SYQA 4I1OB 2BE5F 2VC9A 4LACB 5AGFA 1TWHA 3U3BA 1JPNA 3X2QC 4XPXA 4D4NA 4JKVA 5A6BD 1RKCA 1OXBA 2Y3BA 5BQIA 2YL3A 2IM8A 4DJ9A 3FDQA 3W2VA 4OIOF 3OEOA 1YA7O 4I44A 1BR1A 4FESA 3QW0A 4X0RA 3RQEA 2LD6A 2ZXOA 5E2QA 2DI3A 3IHUA 3KMIA 4BEJA 3JRMO 3LNRA 3RQGA 4CDAA 2XL6A 3DJUB 1LPEA 1NU7D 4MTGA 4XWJA 2FFHA 2Q9CA 3S90A 1WTYA 3TOLA 1HE1A 2J46A 2Y3DA 1HY5A 2VCBA 4XPYA 1E86A 4CS7A 5JRAA 5JUAA 4K0DA 3RF3A 3TULA 1M6TA 2IXNA 4QI0A 2HJ3A 2QTVA 2YHSA 1C03A 2J9VA 3F46A 5E3CA 2MHRA 3H65A 4BEMJ 4YT4A 4G7HF 2R03A 4FWVA 4OD5A 4YJWA 3GEHA 3Q7LA 2QY9A 5EK0A 3FAJA 4DVZA 5K0IA 4Q5SF 1GGQA 2IXOA 5T3WA 3DE8A 2O9XA 1KNYA 1FFTC 2XLWA 4ONSA 4Z9JA 3GEIA 4B6IA 1ORYA 4EUKB 2OG2A 1OCRC 5COGA 4U5EE 4G7ZF 5B1BC 4EBBA 1ZU4A 3L0IA 1L3PA 4C3BA 1Z3IX 2XM4A 4YK5A 3RIPA 4MTOA 4MQ9F 1YJGA 2G3VA 4JTAB 2R7UA 3ITFA 3JTLO 4CSAC 4MVRA 3LS0A 3ZIBA 5A6BA 4MNDA 4OIPF 1OW6A 3W2WA 2YLDA 1NFOA 2KW3C 3UMIA 1TWCA 2HV7A 1A7VA 3JRTA 4EKWA 5B3SC 5KYXB 3LS1A 5CIVA 3S27A 5JLIA 1FAPB 2L6GA 3DM5A 3UNGC 1VYIA 1FMVA 1FR0A 3CZ6A 5T1DB 2Y69C 1Z7Qc 2EPNA 2L7AA 2YLIA 1QQ3A 5L3QA 4G7OF 4PFPA 4CS8A 1OW7A 4D4XA 3EH2A 4NCQA 1V55C 2WVNA 3DAFA 5D92A 3WHNA 3TD7A 1YYJA 3PCVA 5F5HA 2LFDA 4DOZA 3C63A 2KC3A 3VF0A 3X1OA 3U0CA 1BR4A 3ZC4A 1D0YA 1QSPA 5DS4A 1E85A 4HFKB 1BZ4A 4LLEA 3U3FA 4U5GA 2HUJA 1Q0GA 1XWJA 2YL7A 4O7GA 4OD4A 4H4KC 4EBJA 3R2PA 4QDLA 1FTSA 5L3VA 2R7SA 1Z6AA 3ZQYA 1ZHTA 2BL2A 3GORA 1NFNA 2H8AA 1ZW3A 2X51A 4KNVA 1U6HA 1E83A 4A2NB 3H2UA 1IZMA 1EI7A 2QUPA 3FXHA 3Q6NA 3EZIA 2NSGA 1VB5A 2WL8A 3RQFA 1ZU5A 3MBGA 4JTCB 2KNHA 3NKDA 4RD9A 2XXAB 1MMNA 3ZTMA 5L0FA 3GODA 5COFA 4PJLA 4JRZA 2AWCA 2WZLA 4JE9A 4AL1A 2GDCA 4NC3A 1EA8A 4CX9A 4YWQA 3PDMP 1A7DA 1HMDA 3SEOA 2P0NA 5KYUA 4QI2A 4U5FE 4XPWA 4O6MA 1A0BA 1YVIA 3FOPA 3QVYA 3RVYA 3CSKA 3S84A 1Z5ZA 2YL0A 4JIOA 3T6GB 3HTKC 4PJJA 5B3IA 3ZWIA 3U5SA 2I15A 4IRUA 3SYNA 4E0IA 3ZTZA 3IQTA 3SXYA 3ZG1A 1NG1A 1RJ9A 1T9KA 1K40A 2R7TA 2A1DD 1OCZC 3IQCA 2HMQA 2GWWA 4OIQF 1Y6DA 3GEEA 4PK4A 1BBHA 5IY5C 1A41A 2EPLX 3V7OA 2Q9AA 3HNKA 1I5NA 4NQFA 4RBNA 4YL1A 3WAQA 5L0HA 3ATPA 1Y4CA 1LI7A 2B0JA 1RJ9B 2NUTB 3NYJA 3E70C 2WB7A 1LS4A 3B0UX 2MWQA 4NTBA 2Q3TA 4FX5A 3O39A 1NZEA 5L0JA 1LVKA 4GQHA 1R5ID 1YLMA 2HS5A 1V54C 2OKUA 2M4EA 1U89A 1VYKA 4WGZA 2XLEA 3AG4C 4MVSA 4U5CE 3FVYA 1OR2A 3HLZA 1WGWA 4JJFA 2OEXA 2HSBA 1YZAA 4CS8C 4WABA 2QE9A 4AE4B 4C7OB 1ZW2A 2Y3HA 4GYTA 4OIRF 2NG1A 1H9TA 2IXMA 2R7WA 2P6VA 2PF4E 2XL4A 2EIKC 2HMZA 4HFFB 4BJ1A 5JSLA 1WWPA 4KNWA 2G62A 2AP3A 5EGYA 1OR3A 5EHHA 3UGPA 2GFHA 3KYIA 1SF8A 2XS8A 3MYIA 256BA 2M64A 2I8BA 2IBFA 4U9EA 2RD9A 3C8GA 3LEOA 1Q0DA 1SZIA 2EPMX 3NYMA 2JD3A 2AVKA 3B0PA 1O5HA 3DM9B 1E84A 2PFDA 2XM0A 4ULWA 4BG0A 1KU2A 3HNIA 2A6EF 2VB6A 3BRJA 3ECSA 2Z15A 3EH1A 3G4XA 3JSEO 5AC4A 4P9TA 2VASA 1OKKD 3M15A 1QVXA 4I3MA 1CPQA 2YZSA 3ASOC 4MTFA 1OW8A 2HFIA 2DGJA 4BPMA 3AG3C 3QW1A 2AWYA 1BR2A 4W8PA 4XEVA 1ZHYA 2CYDA 3NYLA 1FNTc 1T6IA 3DE9A 3AG2C 3JZ0A 1RCPA 2HZ8A 1H9GA 3G4ZA 4FAPB 3BEHA 1JOGA 3QVZA 1ORJA 3SP1A 3NKEA 5JP7A 2OU6A 3M4CA 4DXWA 1ZHWA 1Q0KA 5DQZA 4JTDB 2HJMA 1PD0A 3JYHA 1TQGA 4YT5A 4LLCA 2OCCC 1YA9A 3L8IA 4WGYA 1EKYA 2G3KA 3DKAA 3K1IA 4MW3A 3I4UA 4NTFA 4BJTA 5F28E 3ZQVA 1SR2A 3FHDA 4M63A 4R32A 5L0GA 5F5FA 3V5ZA 3GM2A 1QZXA 1VK5A 3EG9A 1M56C 1JRAA 1ZYRF 2XRHA 3TJ5A 1NBBA 3U8VA 2OQMA 1VLSA 1YZCA 1JR8A 4XEKA 4AL0A 3W8HA 1V74B 4LDRA 1QPUA 5TJ5E 4E0HA 4N06A 4IB4A 2CCYA 4PACA 3U9JA 4EWCA 3ZSUA 4E7ZA 4JCZA 2W45A 2XLHA 4J32B 4JEBA 2H7BA 5D91A 3WG7C 3ABLC 4JURI 4DBQA 3U2LA 5DS5A 2W4BA 3B0VC 4HEAJ 1M2VA 3NG1A 4CDVA 1D1BA 2L6FA 1OKKA 1T6QA 2YEVA 3O6XA 3KYJA 2WVOA 4YL3A 1BDJB 3DZAA 3K7DA 4MS2A 1M2OA 1NSGB 1E2XA 2XLDA 1RXQA 4LERA 1RKEA 3DJNB 1S7ZA 1GM5A 4ZLDA 2LSEA 3A11A 4IWBA 3ZVRA 1HW2A 2GAQA 5FCLA 5JVEA 1M2VB 4I1MA 4MVUA 4P9FA 3US6A 1OCOC 2A69F 5L0DA 1MNEA 3ABMC 2EPOA 2OJQA 4L6RA 4E17A 2J9UA 1ZVZA 1YDIA 3T6JA 2R7XA 2YL1A 3LAYA 3L1MA 2W9YA 3WODF 3EPVA 4UDVA 2F22A 3N2ZB 2ZXWC 1RKEB 2HSQA 5COMA 4BJ6A 4EBKA 1L7CA 2DYRC 4KI2A 2KYHA 1D1AA 4EIYA 3B71A 2QLAA 3KPHA 1D0ZA 3OWTA 4JCHA 3S0XA 4CS9A 2ZXPA 3B9QA 3L34A 2A6HF 1TKNA 1S05A 2DB4A 3HNLA 3GM3A 1TWGA 4Z9HA 3C8GD 4Q4ZF 3SXZA 4CIHA 1WASA 1LM3B 1JMWA 4PJNA 4F4BA 2IOQA 2PX3A 4IARA 3C8ZA 4OINF 5KYUB 3GWNA 4XQ1A 5E3AA 2Y3GA 1UFBA 3UR3C 1G4US 5DQTA 5KYWA 1XZQA 2V26A 3IQ6A 2Q4FA 1MNDA 4N6HA 5AC5A 1LIHA 3JYYA 4DBRA 1H6GA 1G8XA 4J30B 5DVWA 1J8YF 4H54A 1HE9A 1R4TA 2KK1A 3MYFA 5DLJA 2VH3A 2NPUA 4CJOA 5A6JA 1ZZPA 1AVOB 4PR9A 4U5HA 3QMKA 5HSWA 4KBLA 2ZD9A 2IXPA 4U9DA 3AJMA 3K1IC 2LFFA 1MMAA 4MVMA 4YT2A 3PHF2 2YKZA 2XS1A 4LDKA 3CEXA 2CNWD 2P7VA 2YVKA 3M1CB 3H2VA 2W4MA 1G4WR 1GS9A 1V4AA 4NY3A 3U9MA 1SMYF 2AU5A 2LP4A 2R9RB 5GPGB 4CBEA 1VLTA 4E7SA 3K66A 4BJ5A 1CGME 2TMVP 4ER9A 2R05A 1H7IA 2A0UA 2EILC 1VMAA 1KTMA 3Q6MA 2LQGA 2WVQA 1K04A 3FAPB 3HKKA 3M79A 2PNOA 2GA0A 4IGGA 2OOCA 1Q0FA 1K05A 1MMGA 2XLVA 3LEVA 1VTMP 1HMOA 3CQZA 4DRHB 3TJ6A 3UMHA 1OXKA 2BC5A 2PBEA 2J9BA 3EGXA 2ICWG 5E33A 4GEHA 1O3UA 3RVZA 1YYXA 1NLXA 1YAUO 4IJJA 4Z9IA 3R7CA 3TQOA 4JZAA 3V5YA 3UGOA 1M57C 4JEAA 2ZXRA 5CI9A 1FMWA 1O87A 1PD1A 1TFKB 2ZPAA 4IAQA 3T9OA 4LDQA 2OJED 1QKRA 2H7VC 3EGXB 3NMJA 4EHPA 5JT4A 1T6UA 3NDBB 1W2WA 2J7PD 5KYNA 3C8GB 2EIJC 2Q9BA 3RYLA 1ORSC 3SZRA 3JCUQ 2OEVA 2P1AA 2WZGA 2R02A 3AQBA 1HW1A 3QTHA 4N6CA 3PMRA 3RKOF 1LE2A 3N0TA 3W8IA 4BJ6C 4ZLCA 4J7YA 2FAPB 4WJ0A 5A6AA 2EIMC 3EFOA 2D5RB 3C62A 3E9VA 4CS9C 2CNWA 5B1AC 1QLEC 1B68A 3F47A 2FGYA 4CJGA 2WZFA 4CIPA 1AUEA 2JX0A 4C3DA 3LNMB 2C03A 3RH3A
chains in the Genus database with same CATH topology
3M4BA 4D4NA 4JKVA 3ZTZA 2XLDA 2YL3A 3QW0A 5JVEA 4CDAA 1BBHA 2XL6A 1JAFA 4L6RA 1GQAA 3NMIA 3HNKA 2YL1A 3TOLA 3L1MA 1CGNA 1E86A 4ULVA 5JRAA 5JUAA 1M6TA 4EIYA 2QLAA 1S05A 3HNLA 2XLMA 2XLEA 4WGZA 1LM3B 3DE8A 4IARA 2XLWA 1YZAA 3NMKA 3IQ6A 4N6HA 5JSLA 3IQ5A 2XM4A 256BA 4CJOA 1CGOA 4U9EA 3VRCA 2J8WA 3FOOA 4U9DA 1E84A 2YKZA 2YLDA 4N4WA 2XM0A 1A7VA 3HNIA 1MQVA 2XLOA 5JLIA 3M15A 1CPQA 3U8PA 4ER9A 2YLIA 1QQ3A 3HNJA 3QW1A 4D4XA 3M79A 1YYJA 3DE9A 3TOMA 1RCPA 2XLVA 3C63A 1APCA 3QVZA 1CPRA 2BC5A 2J9BA 5JP7A 3M4CA 1E85A 1EKYA 1YYXA 4WGYA 2YL7A 4JEAA 4IAQA 3ZQVA 3ZQYA 5JS5A 1E83A 3NMJA 2YLGA 5JT4A 2XL8A 1NBBA 3ZTMA 1YZCA 4JE9A 4CDYA 4NC3A 1QPUA 4CX9A 4IB4A 2CCYA 4JEBA 2XLHA 3C62A 3FOPA 4CJGA 3QVYA 4CIPA 4CDVA 2YL0A 5B3IA 3ZWIA 5AGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4B A;  4D4N A;  4JKV A;  3ZTZ A;  2XLD A;  2YL3 A;  3QW0 A;  5JVE A;  4CDA A;  1BBH A;  2XL6 A;  1JAF A;  4L6R A;  1GQA A;  3NMI A;  3HNK A;  2YL1 A;  3TOL A;  3L1M A;  1CGN A;  1E86 A;  4ULV A;  5JRA A;  5JUA A;  1M6T A;  4EIY A;  2QLA A;  1S05 A;  3HNL A;  2XLM A;  2XLE A;  4WGZ A;  1LM3 B;  3DE8 A;  4IAR A;  2XLW A;  1YZA A;  3NMK A;  3IQ6 A;  4N6H A;  5JSL A;  3IQ5 A;  2XM4 A;  256B A;  4CJO A;  1CGO A;  4U9E A;  3VRC A;  2J8W A;  3FOO A;  4U9D A;  1E84 A;  2YKZ A;  2YLD A;  4N4W A;  2XM0 A;  1A7V A;  3HNI A;  1MQV A;  2XLO A;  5JLI A;  3M15 A;  1CPQ A;  3U8P A;  4ER9 A;  2YLI A;  1QQ3 A;  3HNJ A;  3QW1 A;  4D4X A;  3M79 A;  1YYJ A;  3DE9 A;  3TOM A;  1RCP A;  2XLV A;  3C63 A;  1APC A;  3QVZ A;  1CPR A;  2BC5 A;  2J9B A;  5JP7 A;  3M4C A;  1E85 A;  1EKY A;  1YYX A;  4WGY A;  2YL7 A;  4JEA A;  4IAQ A;  3ZQV A;  3ZQY A;  5JS5 A;  1E83 A;  3NMJ A;  2YLG A;  5JT4 A;  2XL8 A;  1NBB A;  3ZTM A;  1YZC A;  4JE9 A;  4CDY A;  4NC3 A;  1QPU A;  4CX9 A;  4IB4 A;  2CCY A;  4JEB A;  2XLH A;  3C62 A;  3FOP A;  4CJG A;  3QVY A;  4CIP A;  4CDV A;  2YL0 A;  5B3I A;  3ZWI A;  5AGF A; 
#chains in the Genus database with same CATH topology
 3NRH A;  3AQC A;  2B0H A;  3M4B A;  3MFN A;  3QZC A;  2R7R A;  2KSF A;  1IW7 F;  3S29 A;  3K33 A;  2J0X A;  3AG1 C;  2UUH A;  2KJG A;  1T01 A;  3EFO B;  4PJM A;  5FZT A;  3RW0 A;  4DVY P;  5BQH A;  2HKV A;  5A69 A;  1N1C A;  2YRF A;  4MVQ A;  3C7J A;  1C17 M;  4KC9 A;  1NU9 C;  1JAF A;  2RSE B;  3U2M A;  1GQA A;  3GAN A;  3NMI A;  5KYX A;  2MYS A;  3SNH A;  3IEE A;  3Q7G A;  1RMV A;  2CDQ A;  2IYL D;  3O55 A;  1CGN A;  1ST6 A;  3A9C A;  3DWW A;  3I5P A;  4ULV A;  3EZH A;  3VAY A;  5A6K A;  5HV9 A;  4O6Y A;  3EGD A;  1YAR O;  3CAX A;  4JVS A;  3EG9 B;  4A4A A;  5L0C A;  3S9O A;  2L9J A;  3HJC A;  2E87 A;  1PV3 A;  2D4U A;  2KQ9 A;  1ZHX A;  2Q7R A;  4ANJ A;  3ASN C;  1LE4 A;  2LCH A;  2XLM A;  1TFO B;  2J7P A;  3RFY A;  4BJ5 C;  1G5Z A;  2YQY A;  3OA1 A;  4AK9 A;  4O6N A;  3EGD B;  3LLK A;  3NMK A;  1WOL A;  1UG7 A;  1A7E A;  1T5O A;  4J7T A;  4YT8 A;  2Q00 A;  2QNL A;  3K1H A;  4MW8 A;  2A68 F;  3J06 A;  1JPJ A;  3DAG A;  2VCC A;  3IPM O;  4JW1 A;  2NSF A;  1I4Y A;  2CGE A;  4G78 A;  4YN0 B;  3IQ5 A;  1I4Z A;  5BQG A;  1F1M A;  2XSE A;  1WN0 A;  3AGT A;  4K1O A;  3AGU A;  3ABK C;  1CGO A;  4JJG A;  4XEF A;  2J8W A;  3VRC A;  5L0I A;  5KYY A;  2XXA A;  1EQ1 A;  3GM1 A;  3FOO A;  4AX2 A;  2J9W A;  3LJB A;  4U5D E;  4DRJ B;  3L8J A;  1TR2 A;  5CI8 A;  2DYS C;  4N4W A;  1VOM A;  1D1C A;  3LES A;  3TK0 A;  1MQV A;  2YWA A;  2LIG A;  3KH2 A;  2XLO A;  1LI5 A;  1OCC C;  3C18 A;  3W4Y A;  1Z23 A;  3DI5 A;  3T6B A;  2CW0 F;  1DOW A;  4YL0 A;  5KYY B;  2KGO A;  5DS6 A;  2ETS A;  1LS1 A;  2NUP A;  3U8P A;  2L6H A;  4IAO A;  2HV6 A;  3KKB A;  2EPK X;  3HNJ A;  1U0B B;  3VM6 A;  1FFH A;  2C04 A;  3V5X A;  3LLI A;  1Q0M A;  3I5Q A;  3TOM A;  1PCX A;  1APC A;  4DRI B;  4XLN F;  1OQC A;  1LKX A;  2X0C A;  3VYW A;  3K6B A;  1CPR A;  3DMD A;  2ASR A;  2NUP B;  3DD7 A;  3FMS A;  4MVO A;  3G50 A;  4P6I C;  1WAT A;  3T4R A;  3ZDL A;  1D0X A;  1AEP A;  1MMD A;  1Z63 A;  4CSA A;  3EHN A;  5KYW B;  2PX0 A;  3DXJ F;  3UMK A;  2J0W A;  3SXM A;  3SXK A;  4PFO A;  3EHM A;  1ZHZ A;  3MX3 A;  3KL4 A;  3EQL F;  4O79 A;  5JS5 A;  2NUT A;  2J45 A;  4MVZ A;  2Y39 A;  2P61 A;  2H7O A;  4NTA A;  2JPU A;  3S28 A;  3MLG A;  5T3T A;  5BUO A;  1TWA A;  2V3C C;  2YLG A;  3N24 A;  4RDA A;  2UUI A;  1C02 A;  3POV A;  2XL8 A;  2R25 A;  2A0B A;  4Q7C A;  4G0H A;  4XTK A;  1XZP A;  3JT1 A;  3AOU A;  3O10 A;  2L81 A;  4CDY A;  2R7Q A;  4HE8 D;  2EIN C;  4JC7 A;  2LK4 A;  3LUT B;  4E18 A;  1J8M F;  2VCA A;  3JSZ A;  4W8K A;  1DOV A;  3B29 A;  4U5B E;  4AE4 A;  4XLP F;  4C7O A;  4K7B A;  2R7V A;  2R7O A;  3GWL A;  4C3E A;  3EJN A;  2PP4 A;  1SYQ A;  4I1O B;  2BE5 F;  2VC9 A;  4LAC B;  5AGF A;  1TWH A;  3U3B A;  1JPN A;  3X2Q C;  4XPX A;  4D4N A;  4JKV A;  5A6B D;  1RKC A;  1OXB A;  2Y3B A;  5BQI A;  2YL3 A;  2IM8 A;  4DJ9 A;  3FDQ A;  3W2V A;  4OIO F;  3OEO A;  1YA7 O;  4I44 A;  1BR1 A;  4FES A;  3QW0 A;  4X0R A;  3RQE A;  2LD6 A;  2ZXO A;  5E2Q A;  2DI3 A;  3IHU A;  3KMI A;  4BEJ A;  3JRM O;  3LNR A;  3RQG A;  4CDA A;  2XL6 A;  3DJU B;  1LPE A;  1NU7 D;  4MTG A;  4XWJ A;  2FFH A;  2Q9C A;  3S90 A;  1WTY A;  3TOL A;  1HE1 A;  2J46 A;  2Y3D A;  1HY5 A;  2VCB A;  4XPY A;  1E86 A;  4CS7 A;  5JRA A;  5JUA A;  4K0D A;  3RF3 A;  3TUL A;  1M6T A;  2IXN A;  4QI0 A;  2HJ3 A;  2QTV A;  2YHS A;  1C03 A;  2J9V A;  3F46 A;  5E3C A;  2MHR A;  3H65 A;  4BEM J;  4YT4 A;  4G7H F;  2R03 A;  4FWV A;  4OD5 A;  4YJW A;  3GEH A;  3Q7L A;  2QY9 A;  5EK0 A;  3FAJ A;  4DVZ A;  5K0I A;  4Q5S F;  1GGQ A;  2IXO A;  5T3W A;  3DE8 A;  2O9X A;  1KNY A;  1FFT C;  2XLW A;  4ONS A;  4Z9J A;  3GEI A;  4B6I A;  1ORY A;  4EUK B;  2OG2 A;  1OCR C;  5COG A;  4U5E E;  4G7Z F;  5B1B C;  4EBB A;  1ZU4 A;  3L0I A;  1L3P A;  4C3B A;  1Z3I X;  2XM4 A;  4YK5 A;  3RIP A;  4MTO A;  4MQ9 F;  1YJG A;  2G3V A;  4JTA B;  2R7U A;  3ITF A;  3JTL O;  4CSA C;  4MVR A;  3LS0 A;  3ZIB A;  5A6B A;  4MND A;  4OIP F;  1OW6 A;  3W2W A;  2YLD A;  1NFO A;  2KW3 C;  3UMI A;  1TWC A;  2HV7 A;  1A7V A;  3JRT A;  4EKW A;  5B3S C;  5KYX B;  3LS1 A;  5CIV A;  3S27 A;  5JLI A;  1FAP B;  2L6G A;  3DM5 A;  3UNG C;  1VYI A;  1FMV A;  1FR0 A;  3CZ6 A;  5T1D B;  2Y69 C;  1Z7Q c;  2EPN A;  2L7A A;  2YLI A;  1QQ3 A;  5L3Q A;  4G7O F;  4PFP A;  4CS8 A;  1OW7 A;  4D4X A;  3EH2 A;  4NCQ A;  1V55 C;  2WVN A;  3DAF A;  5D92 A;  3WHN A;  3TD7 A;  1YYJ A;  3PCV A;  5F5H A;  2LFD A;  4DOZ A;  3C63 A;  2KC3 A;  3VF0 A;  3X1O A;  3U0C A;  1BR4 A;  3ZC4 A;  1D0Y A;  1QSP A;  5DS4 A;  1E85 A;  4HFK B;  1BZ4 A;  4LLE A;  3U3F A;  4U5G A;  2HUJ A;  1Q0G A;  1XWJ A;  2YL7 A;  4O7G A;  4OD4 A;  4H4K C;  4EBJ A;  3R2P A;  4QDL A;  1FTS A;  5L3V A;  2R7S A;  1Z6A A;  3ZQY A;  1ZHT A;  2BL2 A;  3GOR A;  1NFN A;  2H8A A;  1ZW3 A;  2X51 A;  4KNV A;  1U6H A;  1E83 A;  4A2N B;  3H2U A;  1IZM A;  1EI7 A;  2QUP A;  3FXH A;  3Q6N A;  3EZI A;  2NSG A;  1VB5 A;  2WL8 A;  3RQF A;  1ZU5 A;  3MBG A;  4JTC B;  2KNH A;  3NKD A;  4RD9 A;  2XXA B;  1MMN A;  3ZTM A;  5L0F A;  3GOD A;  5COF A;  4PJL A;  4JRZ A;  2AWC A;  2WZL A;  4JE9 A;  4AL1 A;  2GDC A;  4NC3 A;  1EA8 A;  4CX9 A;  4YWQ A;  3PDM P;  1A7D A;  1HMD A;  3SEO A;  2P0N A;  5KYU A;  4QI2 A;  4U5F E;  4XPW A;  4O6M A;  1A0B A;  1YVI A;  3FOP A;  3QVY A;  3RVY A;  3CSK A;  3S84 A;  1Z5Z A;  2YL0 A;  4JIO A;  3T6G B;  3HTK C;  4PJJ A;  5B3I A;  3ZWI A;  3U5S A;  2I15 A;  4IRU A;  3SYN A;  4E0I A;  3ZTZ A;  3IQT A;  3SXY A;  3ZG1 A;  1NG1 A;  1RJ9 A;  1T9K A;  1K40 A;  2R7T A;  2A1D D;  1OCZ C;  3IQC A;  2HMQ A;  2GWW A;  4OIQ F;  1Y6D A;  3GEE A;  4PK4 A;  1BBH A;  5IY5 C;  1A41 A;  2EPL X;  3V7O A;  2Q9A A;  3HNK A;  1I5N A;  4NQF A;  4RBN A;  4YL1 A;  3WAQ A;  5L0H A;  3ATP A;  1Y4C A;  1LI7 A;  2B0J A;  1RJ9 B;  2NUT B;  3NYJ A;  3E70 C;  2WB7 A;  1LS4 A;  3B0U X;  2MWQ A;  4NTB A;  2Q3T A;  4FX5 A;  3O39 A;  1NZE A;  5L0J A;  1LVK A;  4GQH A;  1R5I D;  1YLM A;  2HS5 A;  1V54 C;  2OKU A;  2M4E A;  1U89 A;  1VYK A;  4WGZ A;  2XLE A;  3AG4 C;  4MVS A;  4U5C E;  3FVY A;  1OR2 A;  3HLZ A;  1WGW A;  4JJF A;  2OEX A;  2HSB A;  1YZA A;  4CS8 C;  4WAB A;  2QE9 A;  4AE4 B;  4C7O B;  1ZW2 A;  2Y3H A;  4GYT A;  4OIR F;  2NG1 A;  1H9T A;  2IXM A;  2R7W A;  2P6V A;  2PF4 E;  2XL4 A;  2EIK C;  2HMZ A;  4HFF B;  4BJ1 A;  5JSL A;  1WWP A;  4KNW A;  2G62 A;  2AP3 A;  5EGY A;  1OR3 A;  5EHH A;  3UGP A;  2GFH A;  3KYI A;  1SF8 A;  2XS8 A;  3MYI A;  256B A;  2M64 A;  2I8B A;  2IBF A;  4U9E A;  2RD9 A;  3C8G A;  3LEO A;  1Q0D A;  1SZI A;  2EPM X;  3NYM A;  2JD3 A;  2AVK A;  3B0P A;  1O5H A;  3DM9 B;  1E84 A;  2PFD A;  2XM0 A;  4ULW A;  4BG0 A;  1KU2 A;  3HNI A;  2A6E F;  2VB6 A;  3BRJ A;  3ECS A;  2Z15 A;  3EH1 A;  3G4X A;  3JSE O;  5AC4 A;  4P9T A;  2VAS A;  1OKK D;  3M15 A;  1QVX A;  4I3M A;  1CPQ A;  2YZS A;  3ASO C;  4MTF A;  1OW8 A;  2HFI A;  2DGJ A;  4BPM A;  3AG3 C;  3QW1 A;  2AWY A;  1BR2 A;  4W8P A;  4XEV A;  1ZHY A;  2CYD A;  3NYL A;  1FNT c;  1T6I A;  3DE9 A;  3AG2 C;  3JZ0 A;  1RCP A;  2HZ8 A;  1H9G A;  3G4Z A;  4FAP B;  3BEH A;  1JOG A;  3QVZ A;  1ORJ A;  3SP1 A;  3NKE A;  5JP7 A;  2OU6 A;  3M4C A;  4DXW A;  1ZHW A;  1Q0K A;  5DQZ A;  4JTD B;  2HJM A;  1PD0 A;  3JYH A;  1TQG A;  4YT5 A;  4LLC A;  2OCC C;  1YA9 A;  3L8I A;  4WGY A;  1EKY A;  2G3K A;  3DKA A;  3K1I A;  4MW3 A;  3I4U A;  4NTF A;  4BJT A;  5F28 E;  3ZQV A;  1SR2 A;  3FHD A;  4M63 A;  4R32 A;  5L0G A;  5F5F A;  3V5Z A;  3GM2 A;  1QZX A;  1VK5 A;  3EG9 A;  1M56 C;  1JRA A;  1ZYR F;  2XRH A;  3TJ5 A;  1NBB A;  3U8V A;  2OQM A;  1VLS A;  1YZC A;  1JR8 A;  4XEK A;  4AL0 A;  3W8H A;  1V74 B;  4LDR A;  1QPU A;  5TJ5 E;  4E0H A;  4N06 A;  4IB4 A;  2CCY A;  4PAC A;  3U9J A;  4EWC A;  3ZSU A;  4E7Z A;  4JCZ A;  2W45 A;  2XLH A;  4J32 B;  4JEB A;  2H7B A;  5D91 A;  3WG7 C;  3ABL C;  4JUR I;  4DBQ A;  3U2L A;  5DS5 A;  2W4B A;  3B0V C;  4HEA J;  1M2V A;  3NG1 A;  4CDV A;  1D1B A;  2L6F A;  1OKK A;  1T6Q A;  2YEV A;  3O6X A;  3KYJ A;  2WVO A;  4YL3 A;  1BDJ B;  3DZA A;  3K7D A;  4MS2 A;  1M2O A;  1NSG B;  1E2X A;  2XLD A;  1RXQ A;  4LER A;  1RKE A;  3DJN B;  1S7Z A;  1GM5 A;  4ZLD A;  2LSE A;  3A11 A;  4IWB A;  3ZVR A;  1HW2 A;  2GAQ A;  5FCL A;  5JVE A;  1M2V B;  4I1M A;  4MVU A;  4P9F A;  3US6 A;  1OCO C;  2A69 F;  5L0D A;  1MNE A;  3ABM C;  2EPO A;  2OJQ A;  4L6R A;  4E17 A;  2J9U A;  1ZVZ A;  1YDI A;  3T6J A;  2R7X A;  2YL1 A;  3LAY A;  3L1M A;  2W9Y A;  3WOD F;  3EPV A;  4UDV A;  2F22 A;  3N2Z B;  2ZXW C;  1RKE B;  2HSQ A;  5COM A;  4BJ6 A;  4EBK A;  1L7C A;  2DYR C;  4KI2 A;  2KYH A;  1D1A A;  4EIY A;  3B71 A;  2QLA A;  3KPH A;  1D0Z A;  3OWT A;  4JCH A;  3S0X A;  4CS9 A;  2ZXP A;  3B9Q A;  3L34 A;  2A6H F;  1TKN A;  1S05 A;  2DB4 A;  3HNL A;  3GM3 A;  1TWG A;  4Z9H A;  3C8G D;  4Q4Z F;  3SXZ A;  4CIH A;  1WAS A;  1LM3 B;  1JMW A;  4PJN A;  4F4B A;  2IOQ A;  2PX3 A;  4IAR A;  3C8Z A;  4OIN F;  5KYU B;  3GWN A;  4XQ1 A;  5E3A A;  2Y3G A;  1UFB A;  3UR3 C;  1G4U S;  5DQT A;  5KYW A;  1XZQ A;  2V26 A;  3IQ6 A;  2Q4F A;  1MND A;  4N6H A;  5AC5 A;  1LIH A;  3JYY A;  4DBR A;  1H6G A;  1G8X A;  4J30 B;  5DVW A;  1J8Y F;  4H54 A;  1HE9 A;  1R4T A;  2KK1 A;  3MYF A;  5DLJ A;  2VH3 A;  2NPU A;  4CJO A;  5A6J A;  1ZZP A;  1AVO B;  4PR9 A;  4U5H A;  3QMK A;  5HSW A;  4KBL A;  2ZD9 A;  2IXP A;  4U9D A;  3AJM A;  3K1I C;  2LFF A;  1MMA A;  4MVM A;  4YT2 A;  3PHF 2;  2YKZ A;  2XS1 A;  4LDK A;  3CEX A;  2CNW D;  2P7V A;  2YVK A;  3M1C B;  3H2V A;  2W4M A;  1G4W R;  1GS9 A;  1V4A A;  4NY3 A;  3U9M A;  1SMY F;  2AU5 A;  2LP4 A;  2R9R B;  5GPG B;  4CBE A;  1VLT A;  4E7S A;  3K66 A;  4BJ5 A;  1CGM E;  2TMV P;  4ER9 A;  2R05 A;  1H7I A;  2A0U A;  2EIL C;  1VMA A;  1KTM A;  3Q6M A;  2LQG A;  2WVQ A;  1K04 A;  3FAP B;  3HKK A;  3M79 A;  2PNO A;  2GA0 A;  4IGG A;  2OOC A;  1Q0F A;  1K05 A;  1MMG A;  2XLV A;  3LEV A;  1VTM P;  1HMO A;  3CQZ A;  4DRH B;  3TJ6 A;  3UMH A;  1OXK A;  2BC5 A;  2PBE A;  2J9B A;  3EGX A;  2ICW G;  5E33 A;  4GEH A;  1O3U A;  3RVZ A;  1YYX A;  1NLX A;  1YAU O;  4IJJ A;  4Z9I A;  3R7C A;  3TQO A;  4JZA A;  3V5Y A;  3UGO A;  1M57 C;  4JEA A;  2ZXR A;  5CI9 A;  1FMW A;  1O87 A;  1PD1 A;  1TFK B;  2ZPA A;  4IAQ A;  3T9O A;  4LDQ A;  2OJE D;  1QKR A;  2H7V C;  3EGX B;  3NMJ A;  4EHP A;  5JT4 A;  1T6U A;  3NDB B;  1W2W A;  2J7P D;  5KYN A;  3C8G B;  2EIJ C;  2Q9B A;  3RYL A;  1ORS C;  3SZR A;  3JCU Q;  2OEV A;  2P1A A;  2WZG A;  2R02 A;  3AQB A;  1HW1 A;  3QTH A;  4N6C A;  3PMR A;  3RKO F;  1LE2 A;  3N0T A;  3W8I A;  4BJ6 C;  4ZLC A;  4J7Y A;  2FAP B;  4WJ0 A;  5A6A A;  2EIM C;  3EFO A;  2D5R B;  3C62 A;  3E9V A;  4CS9 C;  2CNW A;  5B1A C;  1QLE C;  1B68 A;  3F47 A;  2FGY A;  4CJG A;  2WZF A;  4CIP A;  1AUE A;  2JX0 A;  4C3D A;  3LNM B;  2C03 A;  3RH3 A; 
#chains in the Genus database with same CATH homology
 3M4B A;  4D4N A;  4JKV A;  3ZTZ A;  2XLD A;  2YL3 A;  3QW0 A;  5JVE A;  4CDA A;  1BBH A;  2XL6 A;  1JAF A;  4L6R A;  1GQA A;  3NMI A;  3HNK A;  2YL1 A;  3TOL A;  3L1M A;  1CGN A;  1E86 A;  4ULV A;  5JRA A;  5JUA A;  1M6T A;  4EIY A;  2QLA A;  1S05 A;  3HNL A;  2XLM A;  2XLE A;  4WGZ A;  1LM3 B;  3DE8 A;  4IAR A;  2XLW A;  1YZA A;  3NMK A;  3IQ6 A;  4N6H A;  5JSL A;  3IQ5 A;  2XM4 A;  256B A;  4CJO A;  1CGO A;  4U9E A;  3VRC A;  2J8W A;  3FOO A;  4U9D A;  1E84 A;  2YKZ A;  2YLD A;  4N4W A;  2XM0 A;  1A7V A;  3HNI A;  1MQV A;  2XLO A;  5JLI A;  3M15 A;  1CPQ A;  3U8P A;  4ER9 A;  2YLI A;  1QQ3 A;  3HNJ A;  3QW1 A;  4D4X A;  3M79 A;  1YYJ A;  3DE9 A;  3TOM A;  1RCP A;  2XLV A;  3C63 A;  1APC A;  3QVZ A;  1CPR A;  2BC5 A;  2J9B A;  5JP7 A;  3M4C A;  1E85 A;  1EKY A;  1YYX A;  4WGY A;  2YL7 A;  4JEA A;  4IAQ A;  3ZQV A;  3ZQY A;  5JS5 A;  1E83 A;  3NMJ A;  2YLG A;  5JT4 A;  2XL8 A;  1NBB A;  3ZTM A;  1YZC A;  4JE9 A;  4CDY A;  4NC3 A;  1QPU A;  4CX9 A;  4IB4 A;  2CCY A;  4JEB A;  2XLH A;  3C62 A;  3FOP A;  4CJG A;  3QVY A;  4CIP A;  4CDV A;  2YL0 A;  5B3I A;  3ZWI A;  5AGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...