2BC5A

Crystal structure of e. coli cytochrome b562 with engineered c-type heme linkages
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMWDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stability and Folding Kinetics of Structurally Characterized Cytochrome c-b(562).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
total genus 47
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2bc5A00
3HNIA 4IARA 3M4BA 4EIYA 3ZQVA 1E83A 3ZTMA 2XLWA 5B3IA 1CGOA 2XLVA 3M4CA 4JEAA 256BA 4CIPA 3U8PA 4CX9A 3QVZA 3FOOA 3FOPA 4JE9A 3HNJA 3C63A 2J9BA 5AGFA 3NMIA 1QPUA 1CPQA 1E84A 5JLIA 2XLOA 3TOLA 3IQ6A 3QW1A 2XLDA 1CGNA 3ZTZA 5JUAA 5JP7A 3HNKA 1GQAA 4CDAA 3ZQYA 2J8WA 4IB4A 4D4NA 5JVEA 1JAFA 4JEBA 1A7VA 4N6HA 4L6RA 1MQVA 4CDYA 2QLAA 5JSLA 2YKZA 1M6TA 3DE8A 1YZAA 3HNLA 4NC3A 2XLEA 2XL8A 4D4XA 1S05A 3QW0A 2YL3A 3NMKA 3M79A 3M15A 2XLHA 4CJOA 4U9EA 3ZWIA 1NBBA 4ER9A 1YYJA 1QQ3A 2YLGA 2YLIA 2YL1A 3IQ5A 1CPRA 4IAQA 3NMJA 4WGZA 4WGYA 5JS5A 1YZCA 2YL0A 2XM0A 3L1MA 4N4WA 2XM4A 2YLDA 3C62A 5JRAA 3QVYA 3VRCA 4JKVA 3DE9A 1YYXA 2BC5A 1RCPA 1BBHA 1APCA 1LM3B 2YL7A 1E85A 4CDVA 4U9DA 2XLMA 4ULVA 5JT4A 4CJGA 2XL6A 1EKYA 3TOMA 1E86A 2CCYA
chains in the Genus database with same CATH superfamily
3GM1A 3WAQA 3RF3A 1ZHTA 3CAXA 1RMVA 4C7OB 4RDAA 3TD7A 3SYNA 2J7PA 3U9JA 3A11A 2HJ3A 4X0RA 1QSPA 2EIJC 3U8PA 3JZ0A 4J30B 4IWBA 3NYJA 1BZ4A 2VCBA 4U5GA 1FFHA 1OW7A 2A68F 5DLJA 2R7RA 2LQGA 2BE5F 5L0GA 1JMWA 2TMVP 5AGFA 1FNTc 1QPUA 4YT5A 2GWWA 3T4RA 3DXJF 1TQGA 2EIKC 3EFOA 5L0DA 4KNWA 1Z7Qc 4DVZA 2KSFA 4P6IC 5DS6A 3AG2C 2J46A 2ASRA 2RD9A 4GEHA 4MTFA 4Z9JA 2NUPB 3ASOC 4XPXA 4JJFA 1YARO 3T6BA 2L9JA 1H7IA 4JTDB 2ETSA 5K0IA 5HSWA 1NZEA 2C04A 1ST6A 2L6FA 4GQHA 2KQ9A 4CDAA 4AE4B 4G78A 3LNMB 2JPUA 4IGGA 4YT8A 1ZHYA 2XS8A 1SZIA 3AGUA 2IM8A 3K7DA 2GFHA 1QZXA 4HFFB 5BQHA 3EZHA 1TWAA 3K1IA 4N6HA 5HV9A 1VTMP 5IY5C 2EILC 3LEOA 3IQCA 3ZG1A 1T6UA 5JSLA 1V54C 2Q9AA 1NFNA 2CNWD 4E7SA 3AQBA 1WWPA 1YZAA 1Z63A 3HNLA 2XRHA 3PHF2 1L7CA 2G3KA 4MTGA 5DQTA 3K66A 2R25A 3KKBA 3MYFA 4BEMJ 4A4AA 2L6HA 4D4XA 1SF8A 4EWCA 2YL3A 3K1IC 1VK5A 1Y4CA 3NMKA 3W2VA 2X51A 2YZSA 1NFOA 2HKVA 4CSAA 1ZHZA 2PX3A 3M15A 1Z6AA 4Q5SF 1UG7A 2YRFA 3C8GA 1TR2A 3FHDA 4LDRA 1FMWA 4E17A 4U9EA 4PACA 1NBBA 1ORJA 1K04A 2PNOA 3SXZA 3ATPA 3RIPA 3V5YA 5F5FA 1PD1A 1IZMA 4I44A 1CPRA 1LE4A 3N24A 4C7OA 3KPHA 1BR4A 5KYWA 4HE8D 4JURI 4XPWA 2IXNA 2R9RB 2FGYA 3EH1A 2AWYA 3W8HA 4AK9A 3JSZA 1JR8A 2CYDA 5DVWA 1OR2A 1Q0KA 3PMRA 4U5DE 5CI9A 3S29A 3VYWA 1VLTA 2G62A 2XM0A 3PCVA 4PJJA 3U2LA 2YLDA 4DOZA 1FFTC 1ZZPA 3QVYA 3R2PA 4E0IA 1ZW3A 2HJMA 4EBKA 1ORSC 2KNHA 5BQIA 3DE9A 3G4XA 1M2VA 3TJ5A 1YDIA 1O5HA 1VB5A 4EBBA 3VM6A 3NRHA 3I5PA 1OW8A 3KYIA 5FZTA 4ZLCA 1LM3B 2J0WA 1A7DA 3RVZA 5B1BC 2YL7A 3EGXA 3RVYA 1B68A 4CDVA 2PF4E 2X0CA 4O79A 3LS1A 4Z9HA 5EGYA 1OCOC 3JTLO 5KYYB 1PCXA 3FMSA 5DS4A 2W4BA 5AC4A 1K05A 2YHSA 1D1CA 5L3QA 1OXBA 2KC3A 1LKXA 3JCUQ 4HFKB 4IARA 3U9MA 4MS2A 3L34A 3AOUA 2EPOA 2KGOA 3A9CA 3M4BA 2OKUA 3ZQVA 3AGTA 1E83A 3O10A 4Z9IA 5EHHA 4FAPB 4LDQA 2Q9CA 1CGOA 1EI7A 1MMDA 5B3IA 2IXOA 2OOCA 4U5CE 3MFNA 4J7TA 3FAPB 1NG1A 3FOOA 4KBLA 4JE9A 1JPJA 2EPMX 2A69F 3HNJA 2HZ8A 3C63A 3EH2A 2V3CC 5KYYA 4XLPF 2J9BA 1Q0DA 2KJGA 1NU9C 2R03A 3KMIA 4RD9A 4K7BA 1F1MA 3U3FA 4CS9C 1E84A 5T3WA 5JLIA 2LSEA 1JPNA 2RSEB 3LAYA 4M63A 1YLMA 2XS1A 4MVMA 3RQFA 4FWVA 2XXAB 2R7XA 2ZXPA 4CIHA 4BG0A 1ZU5A 4GYTA 5E3AA 3ZDLA 3QW1A 2Q4FA 2R02A 2W45A 3I5QA 2IBFA 5F5HA 3MLGA 3MX3A 1GS9A 5KYNA 2MWQA 4J32B 1A0BA 1H9GA 1VYIA 2CDQA 2J9WA 3LESA 4AX2A 2EPLX 3ZQYA 3MYIA 5AC5A 4IB4A 3HJCA 2OJED 1RJ9B 4ONSA 1NLXA 2Q3TA 3RH3A 1T9KA 1A7VA 3GWNA 3IEEA 4H54A 2EPKX 4I3MA 4L6RA 4LLEA 2DB4A 5B1AC 1HE1A 1MNDA 4FESA 1YAUO 2ZXRA 2NSGA 1WGWA 2QLAA 3T9OA 4CS8C 4JJGA 2YKZA 3DAFA 1PV3A 1VOMA 2XSEA 4N06A 3SXMA 3F47A 1M6TA 3DE8A 2R7OA 4BJ1A 4YK5A 1RJ9A 3EHMA 3OWTA 2WZGA 4NC3A 4A2NB 4YT2A 4PK4A 1RKCA 2AP3A 4E18A 2LCHA 5KYUB 1JOGA 3E9VA 5KYWB 4E7ZA 1WATA 3AJMA 3LS0A 3RQEA 1SYQA 2E87A 3O55A 3M79A 3S27A 4WABA 1D0XA 2A0BA 4JCHA 2VC9A 1TKNA 1W2WA 3S84A 2PX0A 5DQZA 1H6GA 4KI2A 3DI5A 2DI3A 3Q7LA 2PP4A 3UR3C 3J06A 2HMZA 1OR3A 1HMOA 2DYRC 1QQ3A 3IQTA 2WL8A 3GM2A 5D92A 3C8GD 4IAQA 1WASA 4UDVA 4BJ6C 2A6HF 1FMVA 2ICWG 2P7VA 5FCLA 2GAQA 2LFDA 2LD6A 4EBJA 1I4YA 1UFBA 4PJLA 2QTVA 4ZLDA 1V74B 3L8JA 1AVOB 4N4WA 2XM4A 4DBRA 3ASNC 1T01A 1U6HA 3JRTA 2Q00A 3TK0A 3S90A 1G4WR 2OEVA 3RQGA 1S7ZA 1L3PA 1MMGA 3RFYA 3K33A 1BBHA 2GA0A 2Q9BA 4B6IA 5D91A 1APCA 1GGQA 4ULWA 3ZVRA 1HMDA 4DRJB 4MVSA 3NKEA 1VLSA 2AWCA 2LFFA 2WZLA 4JIOA 1YJGA 3TQOA 4O6MA 2XXAA 3NDBB 2B0JA 3PDMP 2XLMA 3AG4C 3UGPA 2ZD9A 5JT4A 4CSAC 1R4TA 1QLEC 3V7OA 3ZIBA 2YWAA 2VCAA 3FDQA 4JC7A 3E70C 1Z3IX 2NUPA 4EUKB 5A6JA 2AVKA 2I15A 4FX5A 4EIYA 5A69A 4JW1A 2OCCC 1WOLA 3EZIA 4O7GA 2Y39A 3ZTMA 1KTMA 2HSQA 3EPVA 4PFPA 2XLWA 1OQCA 4MTOA 2VCCA 2XLVA 1Z23A 4MW8A 3DJUB 4CIPA 2WVQA 256BA 3BEHA 4JEAA 4P9FA 5E33A 1FTSA 2CNWA 3S0XA 4CX9A 3FVYA 3FOPA 1DOWA 1KU2A 1OXKA 3VAYA 3WG7C 3B0UX 2R7QA 1M2OA 1M2VB 4BEJA 3K1HA 2GDCA 2YEVA 2A0UA 3B71A 3NMIA 4G0HA 3H2VA 2Q7RA 2MHRA 2HMQA 4XEFA 3EGXB 3GODA 2QUPA 2XLOA 4NQFA 2MYSA 1SMYF 1O87A 2D5RB 2XLDA 4YL3A 5A6KA 4MVOA 1N1CA 4LDKA 3ZTZA 1M56C 1U89A 3LUTB 1Z5ZA 2R7WA 2M64A 2NG1A 3ZSUA 3LLKA 4YL0A 2H7BA 3NYMA 3U5SA 3ECSA 3DKAA 4OD5A 3IHUA 2DYSC 2J8WA 1LS1A 4MNDA 3LEVA 4MVQA 4DRIB 4PR9A 2J45A 4WJ0A 3CEXA 1V55C 2BL2A 2IOQA 2QNLA 2ZPAA 3DZAA 3EHNA 1KNYA 3KH2A 2B0HA 4JEBA 5JVEA 2YQYA 4O6YA 4OIOF 1ZHXA 2LIGA 2JD3A 3I4UA 2CGEA 2HFIA 1D1AA 4CDYA 2OJQA 1U0BB 1EA8A 2DGJA 2PBEA 1R5ID 1K40A 3UMHA 1Q0FA 2P1AA 1VYKA 1C03A 4XWJA 1LVKA 3DAGA 4XPYA 3GORA 1RXQA 3EG9B 1SR2A 3QTHA 5BQGA 4YL1A 4XQ1A 4EKWA 2ZXOA 1BR2A 2L6GA 2J9UA 5COGA 4QI2A 2UUHA 4XLNF 4OIRF 1ZYRF 1MMAA 4PJMA 4OIQF 4PFOA 3CQZA 3FAJA 2Y3GA 4XEKA 4LERA 2PFDA 3T6GB 1LPEA 2W9YA 1MMNA 3JSEO 4G7OF 3GEEA 2FFHA 3SXKA 3EGDB 4CJOA 3POVA 1LI5A 1TWGA 3C8GB 3QMKA 3EJNA 2J9VA 3VF0A 2IYLD 4ER9A 1YYJA 3L0IA 2EIMC 3LNRA 1J8MF 4NTAA 1LIHA 2A6EF 1D1BA 3W2WA 4OIPF 2IXPA 3IQ5A 4LACB 2EPNA 5E3CA 2Z15A 3G50A 5COMA 2HUJA 5EK0A 4F4BA 5L0FA 1J8YF 3GEIA 4DXWA 3US6A 4JCZA 4JVSA 3ABKC 3AG3C 3NMJA 4WGYA 2O9XA 3F46A 1H9TA 1OCCC 3B29A 1FAPB 5JS5A 1GM5A 2R7SA 1M57C 4DRHB 5B3SC 3C62A 3WHNA 4C3DA 1DOVA 3BRJA 5TJ5E 4R32A 4JKVA 3X1OA 1YYXA 3SXYA 1AUEA 2BC5A 4CS7A 1RCPA 2QY9A 4H4KC 2H8AA 5T3TA 1T6IA 3GM3A 3OEOA 4QDLA 1LI7A 2KK1A 4W8PA 2P6VA 1OW6A 4MW3A 4U5BE 1T6QA 4C3BA 1HW2A 3U3BA 2H7OA 1E85A 3JYHA 3SP1A 1E2XA 4YJWA 2C03A 1OCZC 2VB6A 3CZ6A 2H7VC 2NUTA 2R05A 3R7CA 3S9OA 1EKYA 3TOMA 2WVOA 2KW3C 2J7PD 4C3EA 3O39A 3OA1A 4CS8A 2CCYA 1XZPA 3X2QC 3GANA 3LLIA 3ITFA 2NSFA 4K1OA 4MVUA 3HNIA 4NCQA 4U5HA 1FR0A 5L0CA 3DWWA 5F28E 4BPMA 5KYXA 2R7TA 1G5ZA 2NPUA 3DD7A 1XZQA 2LK4A 3ABLC 2EINC 3K6BA 3T6JA 3M4CA 3B9QA 4IJJA 2P0NA 4K0DA 5KYUA 4CS9A 2CW0F 3N0TA 4CBEA 1VMAA 3DMDA 2AU5A 2UUIA 3QVZA 2Y3HA 4P9TA 3M1CB 4YT4A 1NU7D 4DJ9A 2OQMA 3EGDA 2J0XA 3B0VC 1EQ1A 4BJTA 4G7HF 4IRUA 4YWQA 2NUTB 3UGOA 2R7UA 2Y3BA 3MBGA 5GPGB 1D0ZA 2P61A 3HKKA 4ANJA 1A7EA 1CPQA 3V5XA 1HY5A 1C17M 1QVXA 3HTKC 4E0HA 1PD0A 3JYYA 3L8IA 4DVYP 4OD4A 2JX0A 3TOLA 4DBQA 5KYXB 5E2QA 3IQ6A 1HW1A 4KNVA 4MVRA 2HV6A 1CGNA 3JT1A 1ZW2A 3AQCA 4Q7CA 3HLZA 3EG9A 3NG1A 5A6BA 5JUAA 2VASA 4U5FE 5JP7A 3EQLF 3HNKA 3TJ6A 4AE4A 3QZCA 2YVKA 1GQAA 3C8ZA 4J7YA 4KC9A 1CGME 3LJBA 4NTFA 3G4ZA 2OEXA 1WTYA 4O6NA 4D4NA 3GEHA 1RKEA 3GWLA 3H2UA 1JAFA 2QE9A 2LP4A 1LE2A 3KL4A 5CI8A 3WODF 1NSGB 2WVNA 3H65A 3DM9B 1I4ZA 1MQVA 2L81A 3EFOB 1A41A 2M4EA 1YA9A 3RKOF 4EHPA 2WZFA 2G3VA 4U5EE 1WN0A 2Y69C 4RBNA 4OINF 4N6CA 3DM5A 2KYHA 2XLEA 2VH3A 4JTAB 4MQ9F 2XL8A 4I1OB 2A1DD 1AEPA 4JZAA 1S05A 5CIVA 2IXMA 3QW0A 1JRAA 2OG2A 3O6XA 3U8VA 1T5OA 2F22A 1ZU4A 1MNEA 1Q0MA 3FXHA 4XEVA 3RYLA 3S28A 3W8IA 3U0CA 3JRMO 1TWCA 5A6AA 1HE9A 1BDJB 1C02A 1YA7O 2FAPB 2XLHA 5L3VA 1V4AA 3NKDA 3ZWIA 4W8KA 4XTKA 3Q7GA 3UMIA 3SEOA 3CSKA 4IAOA 3V5ZA 2YLGA 3IPMO 1ZVZA 3Q6MA 2YLIA 4JRZA 2YL1A 2XL4A 3DJNB 2I8BA 4LLCA 4NY3A 3SNHA 4AL0A 2W4MA 4NTBA 4HEAJ 1O3UA 1QKRA 3SZRA 1XWJA 1OCRC 4WGZA 1LS4A 5BUOA 3TULA 1Y6DA 5COFA 3U2MA 1G4US 2Y3DA 2ZXWC 4BJ5A 4BJ5C 1YZCA 1Q0GA 2YL0A 4YN0B 2V26A 3Q6NA 5L0IA 3L1MA 1TFKB 1OKKD 5JRAA 4BJ6A 1IW7F 1TWHA 1YVIA 2D4UA 3RW0A 3VRCA 1G8XA 2HV7A 5L0HA 4MVZA 3C18A 4G7ZF 4I1MA 2HSBA 5L0JA 3C7JA 4AL1A 1D0YA 4PJNA 2R7VA 4Q4ZF 3ABMC 4JTCB 1I5NA 1RKEB 2WB7A 3N2ZB 3NYLA 3W4YA 3UNGC 5A6BD 1ORYA 3AG1C 4U9DA 1TFOB 4ULVA 2L7AA 5DS5A 4CJGA 2XL6A 5T1DB 3ZC4A 1E86A 1OKKA 2HS5A 3B0PA 1BR1A 4QI0A 3UMKA 1ZHWA 3KYJA 2OU6A
chains in the Genus database with same CATH topology
3HNIA 4IARA 3M4BA 4EIYA 3ZQVA 1E83A 3ZTMA 2XLWA 5B3IA 1CGOA 2XLVA 3M4CA 4JEAA 256BA 4CIPA 3U8PA 4CX9A 3QVZA 3FOOA 3FOPA 4JE9A 3HNJA 3C63A 2J9BA 5AGFA 3NMIA 1QPUA 1CPQA 1E84A 5JLIA 2XLOA 3TOLA 3IQ6A 3QW1A 2XLDA 1CGNA 3ZTZA 5JUAA 5JP7A 3HNKA 1GQAA 4CDAA 3ZQYA 2J8WA 4IB4A 4D4NA 5JVEA 1JAFA 4JEBA 1A7VA 4N6HA 4L6RA 1MQVA 4CDYA 2QLAA 5JSLA 2YKZA 1M6TA 3DE8A 1YZAA 3HNLA 4NC3A 2XLEA 2XL8A 4D4XA 1S05A 3QW0A 2YL3A 3NMKA 3M79A 3M15A 2XLHA 4CJOA 4U9EA 3ZWIA 1NBBA 4ER9A 1YYJA 1QQ3A 2YLGA 2YLIA 2YL1A 3IQ5A 1CPRA 4IAQA 3NMJA 4WGZA 4WGYA 5JS5A 1YZCA 2YL0A 2XM0A 3L1MA 4N4WA 2XM4A 2YLDA 3C62A 5JRAA 3QVYA 3VRCA 4JKVA 3DE9A 1YYXA 2BC5A 1RCPA 1BBHA 1APCA 1LM3B 2YL7A 1E85A 4CDVA 4U9DA 2XLMA 4ULVA 5JT4A 4CJGA 2XL6A 1EKYA 3TOMA 1E86A 2CCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HNI A;  4IAR A;  3M4B A;  4EIY A;  3ZQV A;  1E83 A;  3ZTM A;  2XLW A;  5B3I A;  1CGO A;  2XLV A;  3M4C A;  4JEA A;  256B A;  4CIP A;  3U8P A;  4CX9 A;  3QVZ A;  3FOO A;  3FOP A;  4JE9 A;  3HNJ A;  3C63 A;  2J9B A;  5AGF A;  3NMI A;  1QPU A;  1CPQ A;  1E84 A;  5JLI A;  2XLO A;  3TOL A;  3IQ6 A;  3QW1 A;  2XLD A;  1CGN A;  3ZTZ A;  5JUA A;  5JP7 A;  3HNK A;  1GQA A;  4CDA A;  3ZQY A;  2J8W A;  4IB4 A;  4D4N A;  5JVE A;  1JAF A;  4JEB A;  1A7V A;  4N6H A;  4L6R A;  1MQV A;  4CDY A;  2QLA A;  5JSL A;  2YKZ A;  1M6T A;  3DE8 A;  1YZA A;  3HNL A;  4NC3 A;  2XLE A;  2XL8 A;  4D4X A;  1S05 A;  3QW0 A;  2YL3 A;  3NMK A;  3M79 A;  3M15 A;  2XLH A;  4CJO A;  4U9E A;  3ZWI A;  1NBB A;  4ER9 A;  1YYJ A;  1QQ3 A;  2YLG A;  2YLI A;  2YL1 A;  3IQ5 A;  1CPR A;  4IAQ A;  3NMJ A;  4WGZ A;  4WGY A;  5JS5 A;  1YZC A;  2YL0 A;  2XM0 A;  3L1M A;  4N4W A;  2XM4 A;  2YLD A;  3C62 A;  5JRA A;  3QVY A;  3VRC A;  4JKV A;  3DE9 A;  1YYX A;  2BC5 A;  1RCP A;  1BBH A;  1APC A;  1LM3 B;  2YL7 A;  1E85 A;  4CDV A;  4U9D A;  2XLM A;  4ULV A;  5JT4 A;  4CJG A;  2XL6 A;  1EKY A;  3TOM A;  1E86 A;  2CCY A; 
#chains in the Genus database with same CATH topology
 3GM1 A;  3WAQ A;  3RF3 A;  1ZHT A;  3CAX A;  1RMV A;  4C7O B;  4RDA A;  3TD7 A;  3SYN A;  2J7P A;  3U9J A;  3A11 A;  2HJ3 A;  4X0R A;  1QSP A;  2EIJ C;  3U8P A;  3JZ0 A;  4J30 B;  4IWB A;  3NYJ A;  1BZ4 A;  2VCB A;  4U5G A;  1FFH A;  1OW7 A;  2A68 F;  5DLJ A;  2R7R A;  2LQG A;  2BE5 F;  5L0G A;  1JMW A;  2TMV P;  5AGF A;  1FNT c;  1QPU A;  4YT5 A;  2GWW A;  3T4R A;  3DXJ F;  1TQG A;  2EIK C;  3EFO A;  5L0D A;  4KNW A;  1Z7Q c;  4DVZ A;  2KSF A;  4P6I C;  5DS6 A;  3AG2 C;  2J46 A;  2ASR A;  2RD9 A;  4GEH A;  4MTF A;  4Z9J A;  2NUP B;  3ASO C;  4XPX A;  4JJF A;  1YAR O;  3T6B A;  2L9J A;  1H7I A;  4JTD B;  2ETS A;  5K0I A;  5HSW A;  1NZE A;  2C04 A;  1ST6 A;  2L6F A;  4GQH A;  2KQ9 A;  4CDA A;  4AE4 B;  4G78 A;  3LNM B;  2JPU A;  4IGG A;  4YT8 A;  1ZHY A;  2XS8 A;  1SZI A;  3AGU A;  2IM8 A;  3K7D A;  2GFH A;  1QZX A;  4HFF B;  5BQH A;  3EZH A;  1TWA A;  3K1I A;  4N6H A;  5HV9 A;  1VTM P;  5IY5 C;  2EIL C;  3LEO A;  3IQC A;  3ZG1 A;  1T6U A;  5JSL A;  1V54 C;  2Q9A A;  1NFN A;  2CNW D;  4E7S A;  3AQB A;  1WWP A;  1YZA A;  1Z63 A;  3HNL A;  2XRH A;  3PHF 2;  1L7C A;  2G3K A;  4MTG A;  5DQT A;  3K66 A;  2R25 A;  3KKB A;  3MYF A;  4BEM J;  4A4A A;  2L6H A;  4D4X A;  1SF8 A;  4EWC A;  2YL3 A;  3K1I C;  1VK5 A;  1Y4C A;  3NMK A;  3W2V A;  2X51 A;  2YZS A;  1NFO A;  2HKV A;  4CSA A;  1ZHZ A;  2PX3 A;  3M15 A;  1Z6A A;  4Q5S F;  1UG7 A;  2YRF A;  3C8G A;  1TR2 A;  3FHD A;  4LDR A;  1FMW A;  4E17 A;  4U9E A;  4PAC A;  1NBB A;  1ORJ A;  1K04 A;  2PNO A;  3SXZ A;  3ATP A;  3RIP A;  3V5Y A;  5F5F A;  1PD1 A;  1IZM A;  4I44 A;  1CPR A;  1LE4 A;  3N24 A;  4C7O A;  3KPH A;  1BR4 A;  5KYW A;  4HE8 D;  4JUR I;  4XPW A;  2IXN A;  2R9R B;  2FGY A;  3EH1 A;  2AWY A;  3W8H A;  4AK9 A;  3JSZ A;  1JR8 A;  2CYD A;  5DVW A;  1OR2 A;  1Q0K A;  3PMR A;  4U5D E;  5CI9 A;  3S29 A;  3VYW A;  1VLT A;  2G62 A;  2XM0 A;  3PCV A;  4PJJ A;  3U2L A;  2YLD A;  4DOZ A;  1FFT C;  1ZZP A;  3QVY A;  3R2P A;  4E0I A;  1ZW3 A;  2HJM A;  4EBK A;  1ORS C;  2KNH A;  5BQI A;  3DE9 A;  3G4X A;  1M2V A;  3TJ5 A;  1YDI A;  1O5H A;  1VB5 A;  4EBB A;  3VM6 A;  3NRH A;  3I5P A;  1OW8 A;  3KYI A;  5FZT A;  4ZLC A;  1LM3 B;  2J0W A;  1A7D A;  3RVZ A;  5B1B C;  2YL7 A;  3EGX A;  3RVY A;  1B68 A;  4CDV A;  2PF4 E;  2X0C A;  4O79 A;  3LS1 A;  4Z9H A;  5EGY A;  1OCO C;  3JTL O;  5KYY B;  1PCX A;  3FMS A;  5DS4 A;  2W4B A;  5AC4 A;  1K05 A;  2YHS A;  1D1C A;  5L3Q A;  1OXB A;  2KC3 A;  1LKX A;  3JCU Q;  4HFK B;  4IAR A;  3U9M A;  4MS2 A;  3L34 A;  3AOU A;  2EPO A;  2KGO A;  3A9C A;  3M4B A;  2OKU A;  3ZQV A;  3AGT A;  1E83 A;  3O10 A;  4Z9I A;  5EHH A;  4FAP B;  4LDQ A;  2Q9C A;  1CGO A;  1EI7 A;  1MMD A;  5B3I A;  2IXO A;  2OOC A;  4U5C E;  3MFN A;  4J7T A;  3FAP B;  1NG1 A;  3FOO A;  4KBL A;  4JE9 A;  1JPJ A;  2EPM X;  2A69 F;  3HNJ A;  2HZ8 A;  3C63 A;  3EH2 A;  2V3C C;  5KYY A;  4XLP F;  2J9B A;  1Q0D A;  2KJG A;  1NU9 C;  2R03 A;  3KMI A;  4RD9 A;  4K7B A;  1F1M A;  3U3F A;  4CS9 C;  1E84 A;  5T3W A;  5JLI A;  2LSE A;  1JPN A;  2RSE B;  3LAY A;  4M63 A;  1YLM A;  2XS1 A;  4MVM A;  3RQF A;  4FWV A;  2XXA B;  2R7X A;  2ZXP A;  4CIH A;  4BG0 A;  1ZU5 A;  4GYT A;  5E3A A;  3ZDL A;  3QW1 A;  2Q4F A;  2R02 A;  2W45 A;  3I5Q A;  2IBF A;  5F5H A;  3MLG A;  3MX3 A;  1GS9 A;  5KYN A;  2MWQ A;  4J32 B;  1A0B A;  1H9G A;  1VYI A;  2CDQ A;  2J9W A;  3LES A;  4AX2 A;  2EPL X;  3ZQY A;  3MYI A;  5AC5 A;  4IB4 A;  3HJC A;  2OJE D;  1RJ9 B;  4ONS A;  1NLX A;  2Q3T A;  3RH3 A;  1T9K A;  1A7V A;  3GWN A;  3IEE A;  4H54 A;  2EPK X;  4I3M A;  4L6R A;  4LLE A;  2DB4 A;  5B1A C;  1HE1 A;  1MND A;  4FES A;  1YAU O;  2ZXR A;  2NSG A;  1WGW A;  2QLA A;  3T9O A;  4CS8 C;  4JJG A;  2YKZ A;  3DAF A;  1PV3 A;  1VOM A;  2XSE A;  4N06 A;  3SXM A;  3F47 A;  1M6T A;  3DE8 A;  2R7O A;  4BJ1 A;  4YK5 A;  1RJ9 A;  3EHM A;  3OWT A;  2WZG A;  4NC3 A;  4A2N B;  4YT2 A;  4PK4 A;  1RKC A;  2AP3 A;  4E18 A;  2LCH A;  5KYU B;  1JOG A;  3E9V A;  5KYW B;  4E7Z A;  1WAT A;  3AJM A;  3LS0 A;  3RQE A;  1SYQ A;  2E87 A;  3O55 A;  3M79 A;  3S27 A;  4WAB A;  1D0X A;  2A0B A;  4JCH A;  2VC9 A;  1TKN A;  1W2W A;  3S84 A;  2PX0 A;  5DQZ A;  1H6G A;  4KI2 A;  3DI5 A;  2DI3 A;  3Q7L A;  2PP4 A;  3UR3 C;  3J06 A;  2HMZ A;  1OR3 A;  1HMO A;  2DYR C;  1QQ3 A;  3IQT A;  2WL8 A;  3GM2 A;  5D92 A;  3C8G D;  4IAQ A;  1WAS A;  4UDV A;  4BJ6 C;  2A6H F;  1FMV A;  2ICW G;  2P7V A;  5FCL A;  2GAQ A;  2LFD A;  2LD6 A;  4EBJ A;  1I4Y A;  1UFB A;  4PJL A;  2QTV A;  4ZLD A;  1V74 B;  3L8J A;  1AVO B;  4N4W A;  2XM4 A;  4DBR A;  3ASN C;  1T01 A;  1U6H A;  3JRT A;  2Q00 A;  3TK0 A;  3S90 A;  1G4W R;  2OEV A;  3RQG A;  1S7Z A;  1L3P A;  1MMG A;  3RFY A;  3K33 A;  1BBH A;  2GA0 A;  2Q9B A;  4B6I A;  5D91 A;  1APC A;  1GGQ A;  4ULW A;  3ZVR A;  1HMD A;  4DRJ B;  4MVS A;  3NKE A;  1VLS A;  2AWC A;  2LFF A;  2WZL A;  4JIO A;  1YJG A;  3TQO A;  4O6M A;  2XXA A;  3NDB B;  2B0J A;  3PDM P;  2XLM A;  3AG4 C;  3UGP A;  2ZD9 A;  5JT4 A;  4CSA C;  1R4T A;  1QLE C;  3V7O A;  3ZIB A;  2YWA A;  2VCA A;  3FDQ A;  4JC7 A;  3E70 C;  1Z3I X;  2NUP A;  4EUK B;  5A6J A;  2AVK A;  2I15 A;  4FX5 A;  4EIY A;  5A69 A;  4JW1 A;  2OCC C;  1WOL A;  3EZI A;  4O7G A;  2Y39 A;  3ZTM A;  1KTM A;  2HSQ A;  3EPV A;  4PFP A;  2XLW A;  1OQC A;  4MTO A;  2VCC A;  2XLV A;  1Z23 A;  4MW8 A;  3DJU B;  4CIP A;  2WVQ A;  256B A;  3BEH A;  4JEA A;  4P9F A;  5E33 A;  1FTS A;  2CNW A;  3S0X A;  4CX9 A;  3FVY A;  3FOP A;  1DOW A;  1KU2 A;  1OXK A;  3VAY A;  3WG7 C;  3B0U X;  2R7Q A;  1M2O A;  1M2V B;  4BEJ A;  3K1H A;  2GDC A;  2YEV A;  2A0U A;  3B71 A;  3NMI A;  4G0H A;  3H2V A;  2Q7R A;  2MHR A;  2HMQ A;  4XEF A;  3EGX B;  3GOD A;  2QUP A;  2XLO A;  4NQF A;  2MYS A;  1SMY F;  1O87 A;  2D5R B;  2XLD A;  4YL3 A;  5A6K A;  4MVO A;  1N1C A;  4LDK A;  3ZTZ A;  1M56 C;  1U89 A;  3LUT B;  1Z5Z A;  2R7W A;  2M64 A;  2NG1 A;  3ZSU A;  3LLK A;  4YL0 A;  2H7B A;  3NYM A;  3U5S A;  3ECS A;  3DKA A;  4OD5 A;  3IHU A;  2DYS C;  2J8W A;  1LS1 A;  4MND A;  3LEV A;  4MVQ A;  4DRI B;  4PR9 A;  2J45 A;  4WJ0 A;  3CEX A;  1V55 C;  2BL2 A;  2IOQ A;  2QNL A;  2ZPA A;  3DZA A;  3EHN A;  1KNY A;  3KH2 A;  2B0H A;  4JEB A;  5JVE A;  2YQY A;  4O6Y A;  4OIO F;  1ZHX A;  2LIG A;  2JD3 A;  3I4U A;  2CGE A;  2HFI A;  1D1A A;  4CDY A;  2OJQ A;  1U0B B;  1EA8 A;  2DGJ A;  2PBE A;  1R5I D;  1K40 A;  3UMH A;  1Q0F A;  2P1A A;  1VYK A;  1C03 A;  4XWJ A;  1LVK A;  3DAG A;  4XPY A;  3GOR A;  1RXQ A;  3EG9 B;  1SR2 A;  3QTH A;  5BQG A;  4YL1 A;  4XQ1 A;  4EKW A;  2ZXO A;  1BR2 A;  2L6G A;  2J9U A;  5COG A;  4QI2 A;  2UUH A;  4XLN F;  4OIR F;  1ZYR F;  1MMA A;  4PJM A;  4OIQ F;  4PFO A;  3CQZ A;  3FAJ A;  2Y3G A;  4XEK A;  4LER A;  2PFD A;  3T6G B;  1LPE A;  2W9Y A;  1MMN A;  3JSE O;  4G7O F;  3GEE A;  2FFH A;  3SXK A;  3EGD B;  4CJO A;  3POV A;  1LI5 A;  1TWG A;  3C8G B;  3QMK A;  3EJN A;  2J9V A;  3VF0 A;  2IYL D;  4ER9 A;  1YYJ A;  3L0I A;  2EIM C;  3LNR A;  1J8M F;  4NTA A;  1LIH A;  2A6E F;  1D1B A;  3W2W A;  4OIP F;  2IXP A;  3IQ5 A;  4LAC B;  2EPN A;  5E3C A;  2Z15 A;  3G50 A;  5COM A;  2HUJ A;  5EK0 A;  4F4B A;  5L0F A;  1J8Y F;  3GEI A;  4DXW A;  3US6 A;  4JCZ A;  4JVS A;  3ABK C;  3AG3 C;  3NMJ A;  4WGY A;  2O9X A;  3F46 A;  1H9T A;  1OCC C;  3B29 A;  1FAP B;  5JS5 A;  1GM5 A;  2R7S A;  1M57 C;  4DRH B;  5B3S C;  3C62 A;  3WHN A;  4C3D A;  1DOV A;  3BRJ A;  5TJ5 E;  4R32 A;  4JKV A;  3X1O A;  1YYX A;  3SXY A;  1AUE A;  2BC5 A;  4CS7 A;  1RCP A;  2QY9 A;  4H4K C;  2H8A A;  5T3T A;  1T6I A;  3GM3 A;  3OEO A;  4QDL A;  1LI7 A;  2KK1 A;  4W8P A;  2P6V A;  1OW6 A;  4MW3 A;  4U5B E;  1T6Q A;  4C3B A;  1HW2 A;  3U3B A;  2H7O A;  1E85 A;  3JYH A;  3SP1 A;  1E2X A;  4YJW A;  2C03 A;  1OCZ C;  2VB6 A;  3CZ6 A;  2H7V C;  2NUT A;  2R05 A;  3R7C A;  3S9O A;  1EKY A;  3TOM A;  2WVO A;  2KW3 C;  2J7P D;  4C3E A;  3O39 A;  3OA1 A;  4CS8 A;  2CCY A;  1XZP A;  3X2Q C;  3GAN A;  3LLI A;  3ITF A;  2NSF A;  4K1O A;  4MVU A;  3HNI A;  4NCQ A;  4U5H A;  1FR0 A;  5L0C A;  3DWW A;  5F28 E;  4BPM A;  5KYX A;  2R7T A;  1G5Z A;  2NPU A;  3DD7 A;  1XZQ A;  2LK4 A;  3ABL C;  2EIN C;  3K6B A;  3T6J A;  3M4C A;  3B9Q A;  4IJJ A;  2P0N A;  4K0D A;  5KYU A;  4CS9 A;  2CW0 F;  3N0T A;  4CBE A;  1VMA A;  3DMD A;  2AU5 A;  2UUI A;  3QVZ A;  2Y3H A;  4P9T A;  3M1C B;  4YT4 A;  1NU7 D;  4DJ9 A;  2OQM A;  3EGD A;  2J0X A;  3B0V C;  1EQ1 A;  4BJT A;  4G7H F;  4IRU A;  4YWQ A;  2NUT B;  3UGO A;  2R7U A;  2Y3B A;  3MBG A;  5GPG B;  1D0Z A;  2P61 A;  3HKK A;  4ANJ A;  1A7E A;  1CPQ A;  3V5X A;  1HY5 A;  1C17 M;  1QVX A;  3HTK C;  4E0H A;  1PD0 A;  3JYY A;  3L8I A;  4DVY P;  4OD4 A;  2JX0 A;  3TOL A;  4DBQ A;  5KYX B;  5E2Q A;  3IQ6 A;  1HW1 A;  4KNV A;  4MVR A;  2HV6 A;  1CGN A;  3JT1 A;  1ZW2 A;  3AQC A;  4Q7C A;  3HLZ A;  3EG9 A;  3NG1 A;  5A6B A;  5JUA A;  2VAS A;  4U5F E;  5JP7 A;  3EQL F;  3HNK A;  3TJ6 A;  4AE4 A;  3QZC A;  2YVK A;  1GQA A;  3C8Z A;  4J7Y A;  4KC9 A;  1CGM E;  3LJB A;  4NTF A;  3G4Z A;  2OEX A;  1WTY A;  4O6N A;  4D4N A;  3GEH A;  1RKE A;  3GWL A;  3H2U A;  1JAF A;  2QE9 A;  2LP4 A;  1LE2 A;  3KL4 A;  5CI8 A;  3WOD F;  1NSG B;  2WVN A;  3H65 A;  3DM9 B;  1I4Z A;  1MQV A;  2L81 A;  3EFO B;  1A41 A;  2M4E A;  1YA9 A;  3RKO F;  4EHP A;  2WZF A;  2G3V A;  4U5E E;  1WN0 A;  2Y69 C;  4RBN A;  4OIN F;  4N6C A;  3DM5 A;  2KYH A;  2XLE A;  2VH3 A;  4JTA B;  4MQ9 F;  2XL8 A;  4I1O B;  2A1D D;  1AEP A;  4JZA A;  1S05 A;  5CIV A;  2IXM A;  3QW0 A;  1JRA A;  2OG2 A;  3O6X A;  3U8V A;  1T5O A;  2F22 A;  1ZU4 A;  1MNE A;  1Q0M A;  3FXH A;  4XEV A;  3RYL A;  3S28 A;  3W8I A;  3U0C A;  3JRM O;  1TWC A;  5A6A A;  1HE9 A;  1BDJ B;  1C02 A;  1YA7 O;  2FAP B;  2XLH A;  5L3V A;  1V4A A;  3NKD A;  3ZWI A;  4W8K A;  4XTK A;  3Q7G A;  3UMI A;  3SEO A;  3CSK A;  4IAO A;  3V5Z A;  2YLG A;  3IPM O;  1ZVZ A;  3Q6M A;  2YLI A;  4JRZ A;  2YL1 A;  2XL4 A;  3DJN B;  2I8B A;  4LLC A;  4NY3 A;  3SNH A;  4AL0 A;  2W4M A;  4NTB A;  4HEA J;  1O3U A;  1QKR A;  3SZR A;  1XWJ A;  1OCR C;  4WGZ A;  1LS4 A;  5BUO A;  3TUL A;  1Y6D A;  5COF A;  3U2M A;  1G4U S;  2Y3D A;  2ZXW C;  4BJ5 A;  4BJ5 C;  1YZC A;  1Q0G A;  2YL0 A;  4YN0 B;  2V26 A;  3Q6N A;  5L0I A;  3L1M A;  1TFK B;  1OKK D;  5JRA A;  4BJ6 A;  1IW7 F;  1TWH A;  1YVI A;  2D4U A;  3RW0 A;  3VRC A;  1G8X A;  2HV7 A;  5L0H A;  4MVZ A;  3C18 A;  4G7Z F;  4I1M A;  2HSB A;  5L0J A;  3C7J A;  4AL1 A;  1D0Y A;  4PJN A;  2R7V A;  4Q4Z F;  3ABM C;  4JTC B;  1I5N A;  1RKE B;  2WB7 A;  3N2Z B;  3NYL A;  3W4Y A;  3UNG C;  5A6B D;  1ORY A;  3AG1 C;  4U9D A;  1TFO B;  4ULV A;  2L7A A;  5DS5 A;  4CJG A;  2XL6 A;  5T1D B;  3ZC4 A;  1E86 A;  1OKK A;  2HS5 A;  3B0P A;  1BR1 A;  4QI0 A;  3UMK A;  1ZHW A;  3KYJ A;  2OU6 A; 
#chains in the Genus database with same CATH homology
 3HNI A;  4IAR A;  3M4B A;  4EIY A;  3ZQV A;  1E83 A;  3ZTM A;  2XLW A;  5B3I A;  1CGO A;  2XLV A;  3M4C A;  4JEA A;  256B A;  4CIP A;  3U8P A;  4CX9 A;  3QVZ A;  3FOO A;  3FOP A;  4JE9 A;  3HNJ A;  3C63 A;  2J9B A;  5AGF A;  3NMI A;  1QPU A;  1CPQ A;  1E84 A;  5JLI A;  2XLO A;  3TOL A;  3IQ6 A;  3QW1 A;  2XLD A;  1CGN A;  3ZTZ A;  5JUA A;  5JP7 A;  3HNK A;  1GQA A;  4CDA A;  3ZQY A;  2J8W A;  4IB4 A;  4D4N A;  5JVE A;  1JAF A;  4JEB A;  1A7V A;  4N6H A;  4L6R A;  1MQV A;  4CDY A;  2QLA A;  5JSL A;  2YKZ A;  1M6T A;  3DE8 A;  1YZA A;  3HNL A;  4NC3 A;  2XLE A;  2XL8 A;  4D4X A;  1S05 A;  3QW0 A;  2YL3 A;  3NMK A;  3M79 A;  3M15 A;  2XLH A;  4CJO A;  4U9E A;  3ZWI A;  1NBB A;  4ER9 A;  1YYJ A;  1QQ3 A;  2YLG A;  2YLI A;  2YL1 A;  3IQ5 A;  1CPR A;  4IAQ A;  3NMJ A;  4WGZ A;  4WGY A;  5JS5 A;  1YZC A;  2YL0 A;  2XM0 A;  3L1M A;  4N4W A;  2XM4 A;  2YLD A;  3C62 A;  5JRA A;  3QVY A;  3VRC A;  4JKV A;  3DE9 A;  1YYX A;  2BC5 A;  1RCP A;  1BBH A;  1APC A;  1LM3 B;  2YL7 A;  1E85 A;  4CDV A;  4U9D A;  2XLM A;  4ULV A;  5JT4 A;  4CJG A;  2XL6 A;  1EKY A;  3TOM A;  1E86 A;  2CCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...