2BC5A

Crystal structure of e. coli cytochrome b562 with engineered c-type heme linkages
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMWDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Stability and Folding Kinetics of Structurally Characterized Cytochrome c-b(562).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 47
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2bc5A00
1YYXA 4N6HA 3ZQVA 4U9DA 3TOLA 5JVEA 2YLGA 3U8PA 4IAQA 2XLEA 2BC5A 1RCPA 2YKZA 2XM0A 4IARA 4N4WA 2XLDA 3M4CA 4JEAA 1CPQA 2XLVA 2QLAA 2XLOA 3HNIA 1GQAA 5JLIA 3L1MA 256BA 3M79A 1E83A 1M6TA 4WGZA 4CDVA 3M4BA 1YZCA 2XL6A 3TOMA 5AGFA 3HNLA 3QW0A 4ULVA 3QW1A 1CPRA 5JS5A 1EKYA 3IQ5A 4CDAA 1MQVA 1NBBA 4NC3A 4WGYA 4CIPA 3VRCA 3DE9A 2YLDA 1A7VA 2J9BA 3ZTZA 1CGOA 1YZAA 4D4NA 3FOOA 4CJOA 5JUAA 4JKVA 1QPUA 1CGNA 4U9EA 3QVZA 2XLMA 4CX9A 2J8WA 3NMIA 2XLHA 5JP7A 3ZTMA 1QQ3A 1BBHA 3HNJA 5JT4A 1E84A 1E86A 2YL3A 2XL8A 5JRAA 4L6RA 1JAFA 3NMJA 1APCA 3IQ6A 4JEBA 2YL1A 4EIYA 3M15A 2YLIA 4JE9A 2YL0A 3C62A 1LM3B 1E85A 1S05A 3DE8A 4D4XA 4ER9A 1YYJA 3QVYA 3C63A 3FOPA 5B3IA 4IB4A 2CCYA 2YL7A 3HNKA 2XM4A 4CDYA 3NMKA 3ZWIA 5JSLA 4CJGA 3ZQYA 2XLWA
chains in the Genus database with same CATH superfamily
1H6GA 3EQLF 1FMWA 3V7OA 2B0JA 1AEPA 3EGDB 3H2VA 3SXMA 1LIHA 3HKKA 1NU7D 3Q7LA 2HZ8A 4IAQA 3JRMO 3EZIA 3C8GB 3ZSUA 4MW3A 4HFKB 1T6IA 1RCPA 2KQ9A 2YKZA 3GEHA 5AC5A 3UR3C 4IARA 2G3KA 4CS7A 3ABLC 3Q6NA 3L0IA 1O87A 2XLDA 3GM2A 4E0HA 4DRJB 1M2VB 4CS9A 4Z9HA 4JEAA 1HY5A 4DXWA 3KYIA 1A0BA 1CPQA 1K40A 2R9RB 2XLOA 3LNMB 4K1OA 2ZXRA 4IGGA 4DOZA 4MQ9F 2WL8A 3K33A 4O6MA 2VCAA 256BA 3NDBB 1EQ1A 2ZXPA 1YDIA 2BE5F 1V4AA 3MX3A 4CIHA 1M6TA 5A6BA 4WGZA 3EJNA 3JSZA 3R7CA 1ORJA 2XS8A 2IYLD 4CDVA 3EFOB 2P1AA 3RKOF 3H2UA 4LLEA 2IXMA 2XL6A 4EBBA 3AG4C 1VOMA 3TOMA 3F47A 3MYFA 1OR2A 1PD1A 1LE4A 3KH2A 4EBKA 3EZHA 2AU5A 3NYLA 2R02A 2BL2A 5KYYA 1C02A 2HS5A 2IBFA 3QW1A 4NY3A 4KNWA 1AUEA 4YT2A 3ASNC 2YVKA 3EPVA 3B0VC 1EKYA 1FFHA 2PBEA 1G4WR 2J7PD 3K1HA 3S28A 3ABKC 3TJ6A 1K04A 1OKKA 2EPOA 1NBBA 5L3QA 3CSKA 2R7SA 4WGYA 3T6BA 2QY9A 1PV3A 3IPMO 3NKEA 4Q5SF 3C8ZA 4DVZA 4CIPA 2EPMX 1L3PA 2CDQA 1FFTC 1T6QA 3JRTA 3VRCA 2VH3A 2Y3DA 1WN0A 2I8BA 3RYLA 3OEOA 1E2XA 2TMVP 1V54C 4ANJA 2HMQA 3TJ5A 4DVYP 2R05A 4OD4A 3US6A 2MHRA 1R5ID 5JUAA 5F5FA 4N6CA 4JJGA 1QVXA 1DOWA 4U9EA 3QVZA 1U6HA 2OOCA 4U5FE 4WABA 4YL3A 3DJNB 3HTKC 1JPJA 3HJCA 2J8WA 3NMIA 3B9QA 2EIMC 1T9KA 2YHSA 5CIVA 3EGXB 1LPEA 1HW2A 1QKRA 3HNJA 1E86A 5FCLA 1E84A 2CYDA 3LESA 4XPWA 4RD9A 4CS9C 1XZQA 1UG7A 3LLKA 4L6RA 4AE4A 3RW0A 3B0PA 1M2OA 3NMJA 1RXQA 1T01A 2P61A 5T3WA 4U5GA 4A4AA 4G7OF 3DAFA 4LACB 2OJQA 4PJMA 5AC4A 1YAUO 3FMSA 2M64A 1LM3B 1ZW3A 3EHMA 1D0XA 4I44A 1CGME 4XLPF 4G7HF 1ZW2A 2B0HA 2Q9BA 3LJBA 4JW1A 3T9OA 4A2NB 4JURI 3N0TA 4GYTA 1VMAA 1YYJA 1LS1A 1LS4A 3V5ZA 3W2WA 1YVIA 2ICWG 3C63A 3NKDA 4LERA 4MVSA 4E17A 2ZPAA 1ZHXA 5KYWA 1VK5A 2ZD9A 4Z9JA 5BUOA 5B3SC 4DJ9A 2XRHA 3W4YA 5D91A 3DKAA 3RVZA 3O6XA 1OCRC 4BJ1A 1NG1A 3OA1A 4IB4A 3X2QC 4O6NA 2YL7A 3HNKA 3MBGA 2WB7A 2XM4A 5E2QA 4MVQA 5DQZA 2R7UA 3JZ0A 1HW1A 4CS8A 1T6UA 3B29A 2PF4E 3EG9B 3NMKA 3KYJA 2L9JA 2PX3A 3O39A 4CJGA 1YARO 5DQTA 4DRHB 2ASRA 1JR8A 2LQGA 4U9DA 3SXKA 3Q7GA 1BR1A 2KW3C 3H65A 3K7DA 3BEHA 4DRIB 2LK4A 4YT4A 1U0BB 2V3CC 2DYRC 4XQ1A 4AK9A 4H4KC 1T5OA 1L7CA 2P7VA 4ONSA 4E7ZA 3AG1C 1G8XA 2BC5A 1YA7O 1OW7A 3RIPA 3JT1A 1V55C 1NLXA 4MTOA 4MVMA 2Y3HA 5KYUB 2A1DD 2CNWD 1Y4CA 2XM0A 4Q7CA 1ZHTA 4PACA 3DD7A 5F28E 3M4CA 4IWBA 2HSBA 2H8AA 1JOGA 4PJNA 1ZHYA 2G3VA 4K0DA 2QLAA 3EHNA 3HNIA 1BDJB 2F22A 3DM9B 4YT8A 5DS6A 2HJMA 4E7SA 1JPNA 1SMYF 3DZAA 1JMWA 3M79A 1E83A 1Z63A 4U5EE 5BQGA 3L34A 1Z7Qc 2H7OA 3JYYA 3U9MA 2VCBA 4B6IA 1VTMP 4JZAA 4X0RA 1MMDA 5HV9A 2J9WA 4I3MA 3LLIA 1TWCA 3T6JA 3VF0A 5A69A 5L0CA 3EH2A 3HNLA 4HFFB 3U3BA 3QW0A 4C3DA 2HJ3A 4N06A 2DB4A 4MVUA 3WHNA 2IXOA 4ULWA 4P9FA 5CI8A 3I5PA 2EIKC 1MMNA 1TKNA 3IQ5A 4BG0A 2OG2A 1C03A 3I5QA 5E33A 4CDAA 5E3AA 4ZLDA 2L6GA 2Q3TA 1PCXA 3DE9A 2GFHA 1ZHZA 2FAPB 1XZPA 3AG2C 1A7VA 1RKEA 3L8IA 4HE8D 1YZAA 1WOLA 4I1OB 4Z9IA 4CS8C 3O10A 4LDQA 1OW8A 3RF3A 1LVKA 3SZRA 4OIQF 3FXHA 3U2LA 2EILC 2W4BA 3ATPA 3MLGA 5E3CA 2NUPB 3AQBA 4JKVA 1QPUA 4PFPA 4IRUA 5TJ5E 5D92A 4XWJA 1W2WA 2RSEB 1LKXA 2HV7A 2LFDA 2Y69C 4AX2A 2JX0A 2EPLX 5A6KA 1GM5A 2KSFA 1EI7A 3GORA 5JP7A 1D1AA 3R2PA 2G62A 2NUTA 3RQFA 1WTYA 2YL3A 5GPGB 2V26A 3Q6MA 3DMDA 1OXBA 2UUIA 3U9JA 1A41A 5L0FA 4MTGA 2R7XA 4G78A 4CSAA 3CZ6A 3K66A 2DI3A 1APCA 2A69F 2OKUA 3OWTA 4JEBA 2YL1A 5EK0A 1D0ZA 2GWWA 2PP4A 3CQZA 2VB6A 3GM3A 4H54A 1LI5A 1QSPA 4EUKB 3FVYA 1ZU4A 2J9VA 2R25A 2HKVA 5DS4A 1E85A 2WVQA 3NRHA 3IEEA 1OCCC 3DE8A 2QE9A 3LNRA 3EGDA 1A7DA 4D4XA 4EWCA 5HSWA 3NYJA 4R32A 1XWJA 2OJED 3IQTA 3C8GA 2X0CA 2AWCA 4BJ6A 5KYXB 2EPNA 3X1OA 3DJUB 2Q9CA 2OEVA 1RJ9B 2FFHA 5B3IA 1DOVA 1EA8A 1HMDA 1H7IA 4CBEA 1Z5ZA 1OQCA 3GWNA 3SXZA 4QDLA 1M2VA 2L6HA 3SNHA 5L0DA 1Q0GA 2C03A 3RQGA 4JJFA 1Q0KA 4GQHA 1ZU5A 2Y3BA 1Y6DA 3GANA 1TWHA 1QLEC 3RH3A 4CDYA 3ZWIA 3NG1A 3CEXA 3WG7C 2EPKX 4O6YA 3ZQVA 2QNLA 2NSFA 5JVEA 4W8PA 3GM1A 2KGOA 3PHF2 2YLGA 3EFOA 4FESA 1BR2A 2OQMA 2Y3GA 4F4BA 1FTSA 2XLEA 2KNHA 1YLMA 2L7AA 1BR4A 4RDAA 3AGTA 4JCZA 2C04A 3DWWA 4N4WA 4E18A 4YWQA 5L0JA 1IZMA 3A9CA 1OW6A 1TWGA 3TQOA 3CAXA 2EIJC 4OIPF 1FMVA 3FDQA 2J0XA 3E70C 4AL1A 1GQAA 3W2VA 3SYNA 5JLIA 1MNDA 1SYQA 2E87A 1ZYRF 5COMA 4EKWA 2R7RA 4CSAC 5DLJA 4ZLCA 4C3EA 3B71A 1SR2A 1HE1A 3A11A 2A0BA 3M4BA 5COGA 3SXYA 1YZCA 1WWPA 3AQCA 1O5HA 3WAQA 3KL4A 1Q0DA 3AOUA 1OCOC 3DAGA 1VLTA 1YJGA 2VCCA 5AGFA 4YK5A 3V5YA 3U3FA 1G5ZA 3W8IA 2QTVA 4ULVA 3RQEA 1TFKB 3NYMA 4I1MA 5A6AA 3UGOA 3L8JA 2NG1A 4BJ6C 5EHHA 5BQHA 5JS5A 2CGEA 5KYXA 2R7TA 4OIRF 2YWAA 2HFIA 2ETSA 3ZG1A 3EGXA 4NC3A 3DI5A 3ITFA 4C7OB 4NTFA 2A6EF 2AWYA 1I5NA 1RKCA 2YLDA 3K1IC 3ZTZA 2J9BA 3S9OA 1CGOA 1ST6A 2R7OA 3G4ZA 4JTDB 1M56C 3G50A 4OIOF 3FOOA 4CJOA 1RMVA 4MS2A 2J45A 4JCHA 1SF8A 3WODF 1UFBA 5EGYA 1MMGA 2LSEA 4FWVA 1G4US 4YN0B 3ZDLA 3DXJF 2A0UA 5L0GA 1CGNA 2YQYA 5IY5C 4XEKA 5KYYB 2M4EA 4W8KA 3VM6A 4J7YA 4FAPB 4KC9A 3ASOC 2R03A 2XLHA 2W4MA 1QQ3A 1BZ4A 2ZXWC 1F1MA 3PMRA 4WJ0A 4XEVA 2KC3A 2VC9A 4HEAJ 5JT4A 2CNWA 4RBNA 3UGPA 2P6VA 3EH1A 1VB5A 4YL1A 4NTAA 2LFFA 3VYWA 5JRAA 3LS0A 1HMOA 4BEJA 2ZXOA 3KKBA 3LS1A 4DBQA 4Q4ZF 3G4XA 3UMHA 4BJ5A 5A6BD 2J9UA 3IQ6A 4DBRA 3GODA 1NU9C 3MYIA 4YT5A 1WASA 5BQIA 2PNOA 4JRZA 5DVWA 1ORSC 4EIYA 5A6JA 3M15A 4JE9A 2HMZA 1TWAA 3EG9A 2YL0A 4JIOA 2J46A 1MMAA 3O55A 3C7JA 1K05A 3JYHA 1J8MF 3LEVA 2L81A 3U5SA 1OCZC 4LDKA 3B0UX 1V74B 1JRAA 1VYKA 2Z15A 3U0CA 4PR9A 4XEFA 3U8VA 5DS5A 1OR3A 3S84A 1OKKD 3FOPA 5KYUA 4J32B 4XTKA 4AE4B 2RD9A 2H7BA 2UUHA 4PJLA 3ZIBA 1FNTc 2NSGA 5B1BC 4MVZA 4YL0A 2A68F 2AVKA 3S90A 4C7OA 1M57C 2CCYA 4MVOA 1N1CA 1ORYA 1TFOB 2OU6A 3TD7A 3SP1A 4K7BA 4GEHA 5JSLA 2XXAB 2IOQA 2CW0F 2L6FA 2XLWA 2A6HF 1SZIA 3JCUQ 5COFA 1YYXA 4MVRA 1R4TA 2Q4FA 4N6HA 3KPHA 4U5HA 3TOLA 1J8YF 2MWQA 3IHUA 3S27A 3U8PA 3W8HA 4AL0A 2IXPA 3C8GD 4U5CE 3DM5A 5L0HA 2NPUA 2P0NA 4PK4A 2WZLA 4YJWA 3V5XA 5KYWB 1TQGA 4PJJA 3I4UA 4M63A 3KMIA 1NSGB 1VYIA 2DGJA 1KU2A 2HSQA 4BPMA 2Q9AA 5L0IA 4KI2A 1VLSA 1B68A 1A7EA 2XLVA 2I15A 2X51A 3QZCA 2J7PA 3L1MA 5B1AC 4BJ5C 1FR0A 5FZTA 3K1IA 3UNGC 1OXKA 4FX5A 4C3BA 1QZXA 1NZEA 3ECSA 4JTAB 3RVYA 5K0IA 4NCQA 2O9XA 1I4ZA 3S29A 2KYHA 5T3TA 3HLZA 1KNYA 2LP4A 4OINF 1Q0FA 4MNDA 3K6BA 4QI0A 2R7QA 1S7ZA 3JTLO 1I4YA 2FGYA 1WATA 2NUPA 2PFDA 4EBJA 3IQCA 4XPXA 2JD3A 3SEOA 1Z3IX 2GA0A 3AG3C 1CPRA 1GGQA 2HV6A 4OD5A 3T4RA 3LEOA 4MTFA 4KNVA 4O7GA 1O3UA 2GDCA 2D4UA 2J0WA 1ZVZA 1MQVA 3F46A 2WZFA 4G7ZF 3ZC4A 3PDMP 2Y39A 2D5RB 3TULA 1YA9A 1HE9A 2IM8A 1MNEA 3N2ZB 4E0IA 1TR2A 1D1BA 3BRJA 4JTCB 4NQFA 3T6GB 2R7WA 4D4NA 2H7VC 5T1DB 4EHPA 2WZGA 2XXAA 4O79A 5L3VA 4UDVA 3FHDA 4BJTA 1NFOA 1AVOB 2LIGA 2YEVA 1ZZPA 3MFNA 3UMKA 3S0XA 1IW7F 2Q7RA 2XS1A 1U89A 3U2MA 4BEMJ 2XLMA 2R7VA 4CX9A 3GWLA 1C17M 1LE2A 1LI7A 4QI2A 2XSEA 1NFNA 4NTBA 3ZTMA 1KTMA 1BBHA 2LCHA 4G0HA 3GEEA 2W9YA 2EINC 2XL8A 3M1CB 4P9TA 1Z23A 3JSEO 1RJ9A 1H9TA 4IJJA 1RKEB 1JAFA 1Z6AA 4P6IC 3POVA 2MYSA 3FAJA 1H9GA 3N24A 2XL4A 3AGUA 3PCVA 2W45A 4U5BE 3TK0A 3AJMA 2PX0A 2WVNA 2VASA 4MW8A 2YLIA 5F5HA 1ZHWA 3C62A 2KK1A 4J30B 3LAYA 1PD0A 1S05A 2DYSC 2LD6A 3C18A 4U5DE 2JPUA 3FAPB 3VAYA 4PFOA 4J7TA 3J06A 2KJGA 3LUTB 3QMKA 4ER9A 2Q00A 2YRFA 2AP3A 2QUPA 3QVYA 4LLCA 4JC7A 2NUTB 4IAOA 2YZSA 1WGWA 1Q0MA 4LDRA 2WVOA 2OCCC 1GS9A 4JVSA 4KBLA 2OEXA 1FAPB 3ABMC 2GAQA 3GEIA 3ZVRA 1D1CA 2HUJA 2IXNA 5KYNA 1D0YA 3E9VA 3UMIA 4XPYA 3RFYA 3QTHA 5CI9A 3ZQYA 4XLNF
chains in the Genus database with same CATH topology
1YYXA 4N6HA 3ZQVA 4U9DA 3TOLA 5JVEA 2YLGA 3U8PA 4IAQA 2XLEA 2BC5A 1RCPA 2YKZA 2XM0A 4IARA 4N4WA 2XLDA 3M4CA 4JEAA 1CPQA 2XLVA 2QLAA 2XLOA 3HNIA 1GQAA 5JLIA 3L1MA 256BA 3M79A 1E83A 1M6TA 4WGZA 4CDVA 3M4BA 1YZCA 2XL6A 3TOMA 5AGFA 3HNLA 3QW0A 4ULVA 3QW1A 1CPRA 5JS5A 1EKYA 3IQ5A 4CDAA 1MQVA 1NBBA 4NC3A 4WGYA 4CIPA 3VRCA 3DE9A 2YLDA 1A7VA 2J9BA 3ZTZA 1CGOA 1YZAA 4D4NA 3FOOA 4CJOA 5JUAA 4JKVA 1QPUA 1CGNA 4U9EA 3QVZA 2XLMA 4CX9A 2J8WA 3NMIA 2XLHA 5JP7A 3ZTMA 1QQ3A 1BBHA 3HNJA 5JT4A 1E84A 1E86A 2YL3A 2XL8A 5JRAA 4L6RA 1JAFA 3NMJA 1APCA 3IQ6A 4JEBA 2YL1A 4EIYA 3M15A 2YLIA 4JE9A 2YL0A 3C62A 1LM3B 1E85A 1S05A 3DE8A 4D4XA 4ER9A 1YYJA 3QVYA 3C63A 3FOPA 5B3IA 4IB4A 2CCYA 2YL7A 3HNKA 2XM4A 4CDYA 3NMKA 3ZWIA 5JSLA 4CJGA 3ZQYA 2XLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYX A;  4N6H A;  3ZQV A;  4U9D A;  3TOL A;  5JVE A;  2YLG A;  3U8P A;  4IAQ A;  2XLE A;  2BC5 A;  1RCP A;  2YKZ A;  2XM0 A;  4IAR A;  4N4W A;  2XLD A;  3M4C A;  4JEA A;  1CPQ A;  2XLV A;  2QLA A;  2XLO A;  3HNI A;  1GQA A;  5JLI A;  3L1M A;  256B A;  3M79 A;  1E83 A;  1M6T A;  4WGZ A;  4CDV A;  3M4B A;  1YZC A;  2XL6 A;  3TOM A;  5AGF A;  3HNL A;  3QW0 A;  4ULV A;  3QW1 A;  1CPR A;  5JS5 A;  1EKY A;  3IQ5 A;  4CDA A;  1MQV A;  1NBB A;  4NC3 A;  4WGY A;  4CIP A;  3VRC A;  3DE9 A;  2YLD A;  1A7V A;  2J9B A;  3ZTZ A;  1CGO A;  1YZA A;  4D4N A;  3FOO A;  4CJO A;  5JUA A;  4JKV A;  1QPU A;  1CGN A;  4U9E A;  3QVZ A;  2XLM A;  4CX9 A;  2J8W A;  3NMI A;  2XLH A;  5JP7 A;  3ZTM A;  1QQ3 A;  1BBH A;  3HNJ A;  5JT4 A;  1E84 A;  1E86 A;  2YL3 A;  2XL8 A;  5JRA A;  4L6R A;  1JAF A;  3NMJ A;  1APC A;  3IQ6 A;  4JEB A;  2YL1 A;  4EIY A;  3M15 A;  2YLI A;  4JE9 A;  2YL0 A;  3C62 A;  1LM3 B;  1E85 A;  1S05 A;  3DE8 A;  4D4X A;  4ER9 A;  1YYJ A;  3QVY A;  3C63 A;  3FOP A;  5B3I A;  4IB4 A;  2CCY A;  2YL7 A;  3HNK A;  2XM4 A;  4CDY A;  3NMK A;  3ZWI A;  5JSL A;  4CJG A;  3ZQY A;  2XLW A; 
#chains in the Genus database with same CATH topology
 1H6G A;  3EQL F;  1FMW A;  3V7O A;  2B0J A;  1AEP A;  3EGD B;  3H2V A;  3SXM A;  1LIH A;  3HKK A;  1NU7 D;  3Q7L A;  2HZ8 A;  4IAQ A;  3JRM O;  3EZI A;  3C8G B;  3ZSU A;  4MW3 A;  4HFK B;  1T6I A;  1RCP A;  2KQ9 A;  2YKZ A;  3GEH A;  5AC5 A;  3UR3 C;  4IAR A;  2G3K A;  4CS7 A;  3ABL C;  3Q6N A;  3L0I A;  1O87 A;  2XLD A;  3GM2 A;  4E0H A;  4DRJ B;  1M2V B;  4CS9 A;  4Z9H A;  4JEA A;  1HY5 A;  4DXW A;  3KYI A;  1A0B A;  1CPQ A;  1K40 A;  2R9R B;  2XLO A;  3LNM B;  4K1O A;  2ZXR A;  4IGG A;  4DOZ A;  4MQ9 F;  2WL8 A;  3K33 A;  4O6M A;  2VCA A;  256B A;  3NDB B;  1EQ1 A;  2ZXP A;  1YDI A;  2BE5 F;  1V4A A;  3MX3 A;  4CIH A;  1M6T A;  5A6B A;  4WGZ A;  3EJN A;  3JSZ A;  3R7C A;  1ORJ A;  2XS8 A;  2IYL D;  4CDV A;  3EFO B;  2P1A A;  3RKO F;  3H2U A;  4LLE A;  2IXM A;  2XL6 A;  4EBB A;  3AG4 C;  1VOM A;  3TOM A;  3F47 A;  3MYF A;  1OR2 A;  1PD1 A;  1LE4 A;  3KH2 A;  4EBK A;  3EZH A;  2AU5 A;  3NYL A;  2R02 A;  2BL2 A;  5KYY A;  1C02 A;  2HS5 A;  2IBF A;  3QW1 A;  4NY3 A;  4KNW A;  1AUE A;  4YT2 A;  3ASN C;  2YVK A;  3EPV A;  3B0V C;  1EKY A;  1FFH A;  2PBE A;  1G4W R;  2J7P D;  3K1H A;  3S28 A;  3ABK C;  3TJ6 A;  1K04 A;  1OKK A;  2EPO A;  1NBB A;  5L3Q A;  3CSK A;  2R7S A;  4WGY A;  3T6B A;  2QY9 A;  1PV3 A;  3IPM O;  3NKE A;  4Q5S F;  3C8Z A;  4DVZ A;  4CIP A;  2EPM X;  1L3P A;  2CDQ A;  1FFT C;  1T6Q A;  3JRT A;  3VRC A;  2VH3 A;  2Y3D A;  1WN0 A;  2I8B A;  3RYL A;  3OEO A;  1E2X A;  2TMV P;  1V54 C;  4ANJ A;  2HMQ A;  3TJ5 A;  4DVY P;  2R05 A;  4OD4 A;  3US6 A;  2MHR A;  1R5I D;  5JUA A;  5F5F A;  4N6C A;  4JJG A;  1QVX A;  1DOW A;  4U9E A;  3QVZ A;  1U6H A;  2OOC A;  4U5F E;  4WAB A;  4YL3 A;  3DJN B;  3HTK C;  1JPJ A;  3HJC A;  2J8W A;  3NMI A;  3B9Q A;  2EIM C;  1T9K A;  2YHS A;  5CIV A;  3EGX B;  1LPE A;  1HW2 A;  1QKR A;  3HNJ A;  1E86 A;  5FCL A;  1E84 A;  2CYD A;  3LES A;  4XPW A;  4RD9 A;  4CS9 C;  1XZQ A;  1UG7 A;  3LLK A;  4L6R A;  4AE4 A;  3RW0 A;  3B0P A;  1M2O A;  3NMJ A;  1RXQ A;  1T01 A;  2P61 A;  5T3W A;  4U5G A;  4A4A A;  4G7O F;  3DAF A;  4LAC B;  2OJQ A;  4PJM A;  5AC4 A;  1YAU O;  3FMS A;  2M64 A;  1LM3 B;  1ZW3 A;  3EHM A;  1D0X A;  4I44 A;  1CGM E;  4XLP F;  4G7H F;  1ZW2 A;  2B0H A;  2Q9B A;  3LJB A;  4JW1 A;  3T9O A;  4A2N B;  4JUR I;  3N0T A;  4GYT A;  1VMA A;  1YYJ A;  1LS1 A;  1LS4 A;  3V5Z A;  3W2W A;  1YVI A;  2ICW G;  3C63 A;  3NKD A;  4LER A;  4MVS A;  4E17 A;  2ZPA A;  1ZHX A;  5KYW A;  1VK5 A;  2ZD9 A;  4Z9J A;  5BUO A;  5B3S C;  4DJ9 A;  2XRH A;  3W4Y A;  5D91 A;  3DKA A;  3RVZ A;  3O6X A;  1OCR C;  4BJ1 A;  1NG1 A;  3OA1 A;  4IB4 A;  3X2Q C;  4O6N A;  2YL7 A;  3HNK A;  3MBG A;  2WB7 A;  2XM4 A;  5E2Q A;  4MVQ A;  5DQZ A;  2R7U A;  3JZ0 A;  1HW1 A;  4CS8 A;  1T6U A;  3B29 A;  2PF4 E;  3EG9 B;  3NMK A;  3KYJ A;  2L9J A;  2PX3 A;  3O39 A;  4CJG A;  1YAR O;  5DQT A;  4DRH B;  2ASR A;  1JR8 A;  2LQG A;  4U9D A;  3SXK A;  3Q7G A;  1BR1 A;  2KW3 C;  3H65 A;  3K7D A;  3BEH A;  4DRI B;  2LK4 A;  4YT4 A;  1U0B B;  2V3C C;  2DYR C;  4XQ1 A;  4AK9 A;  4H4K C;  1T5O A;  1L7C A;  2P7V A;  4ONS A;  4E7Z A;  3AG1 C;  1G8X A;  2BC5 A;  1YA7 O;  1OW7 A;  3RIP A;  3JT1 A;  1V55 C;  1NLX A;  4MTO A;  4MVM A;  2Y3H A;  5KYU B;  2A1D D;  2CNW D;  1Y4C A;  2XM0 A;  4Q7C A;  1ZHT A;  4PAC A;  3DD7 A;  5F28 E;  3M4C A;  4IWB A;  2HSB A;  2H8A A;  1JOG A;  4PJN A;  1ZHY A;  2G3V A;  4K0D A;  2QLA A;  3EHN A;  3HNI A;  1BDJ B;  2F22 A;  3DM9 B;  4YT8 A;  5DS6 A;  2HJM A;  4E7S A;  1JPN A;  1SMY F;  3DZA A;  1JMW A;  3M79 A;  1E83 A;  1Z63 A;  4U5E E;  5BQG A;  3L34 A;  1Z7Q c;  2H7O A;  3JYY A;  3U9M A;  2VCB A;  4B6I A;  1VTM P;  4JZA A;  4X0R A;  1MMD A;  5HV9 A;  2J9W A;  4I3M A;  3LLI A;  1TWC A;  3T6J A;  3VF0 A;  5A69 A;  5L0C A;  3EH2 A;  3HNL A;  4HFF B;  3U3B A;  3QW0 A;  4C3D A;  2HJ3 A;  4N06 A;  2DB4 A;  4MVU A;  3WHN A;  2IXO A;  4ULW A;  4P9F A;  5CI8 A;  3I5P A;  2EIK C;  1MMN A;  1TKN A;  3IQ5 A;  4BG0 A;  2OG2 A;  1C03 A;  3I5Q A;  5E33 A;  4CDA A;  5E3A A;  4ZLD A;  2L6G A;  2Q3T A;  1PCX A;  3DE9 A;  2GFH A;  1ZHZ A;  2FAP B;  1XZP A;  3AG2 C;  1A7V A;  1RKE A;  3L8I A;  4HE8 D;  1YZA A;  1WOL A;  4I1O B;  4Z9I A;  4CS8 C;  3O10 A;  4LDQ A;  1OW8 A;  3RF3 A;  1LVK A;  3SZR A;  4OIQ F;  3FXH A;  3U2L A;  2EIL C;  2W4B A;  3ATP A;  3MLG A;  5E3C A;  2NUP B;  3AQB A;  4JKV A;  1QPU A;  4PFP A;  4IRU A;  5TJ5 E;  5D92 A;  4XWJ A;  1W2W A;  2RSE B;  1LKX A;  2HV7 A;  2LFD A;  2Y69 C;  4AX2 A;  2JX0 A;  2EPL X;  5A6K A;  1GM5 A;  2KSF A;  1EI7 A;  3GOR A;  5JP7 A;  1D1A A;  3R2P A;  2G62 A;  2NUT A;  3RQF A;  1WTY A;  2YL3 A;  5GPG B;  2V26 A;  3Q6M A;  3DMD A;  1OXB A;  2UUI A;  3U9J A;  1A41 A;  5L0F A;  4MTG A;  2R7X A;  4G78 A;  4CSA A;  3CZ6 A;  3K66 A;  2DI3 A;  1APC A;  2A69 F;  2OKU A;  3OWT A;  4JEB A;  2YL1 A;  5EK0 A;  1D0Z A;  2GWW A;  2PP4 A;  3CQZ A;  2VB6 A;  3GM3 A;  4H54 A;  1LI5 A;  1QSP A;  4EUK B;  3FVY A;  1ZU4 A;  2J9V A;  2R25 A;  2HKV A;  5DS4 A;  1E85 A;  2WVQ A;  3NRH A;  3IEE A;  1OCC C;  3DE8 A;  2QE9 A;  3LNR A;  3EGD A;  1A7D A;  4D4X A;  4EWC A;  5HSW A;  3NYJ A;  4R32 A;  1XWJ A;  2OJE D;  3IQT A;  3C8G A;  2X0C A;  2AWC A;  4BJ6 A;  5KYX B;  2EPN A;  3X1O A;  3DJU B;  2Q9C A;  2OEV A;  1RJ9 B;  2FFH A;  5B3I A;  1DOV A;  1EA8 A;  1HMD A;  1H7I A;  4CBE A;  1Z5Z A;  1OQC A;  3GWN A;  3SXZ A;  4QDL A;  1M2V A;  2L6H A;  3SNH A;  5L0D A;  1Q0G A;  2C03 A;  3RQG A;  4JJF A;  1Q0K A;  4GQH A;  1ZU5 A;  2Y3B A;  1Y6D A;  3GAN A;  1TWH A;  1QLE C;  3RH3 A;  4CDY A;  3ZWI A;  3NG1 A;  3CEX A;  3WG7 C;  2EPK X;  4O6Y A;  3ZQV A;  2QNL A;  2NSF A;  5JVE A;  4W8P A;  3GM1 A;  2KGO A;  3PHF 2;  2YLG A;  3EFO A;  4FES A;  1BR2 A;  2OQM A;  2Y3G A;  4F4B A;  1FTS A;  2XLE A;  2KNH A;  1YLM A;  2L7A A;  1BR4 A;  4RDA A;  3AGT A;  4JCZ A;  2C04 A;  3DWW A;  4N4W A;  4E18 A;  4YWQ A;  5L0J A;  1IZM A;  3A9C A;  1OW6 A;  1TWG A;  3TQO A;  3CAX A;  2EIJ C;  4OIP F;  1FMV A;  3FDQ A;  2J0X A;  3E70 C;  4AL1 A;  1GQA A;  3W2V A;  3SYN A;  5JLI A;  1MND A;  1SYQ A;  2E87 A;  1ZYR F;  5COM A;  4EKW A;  2R7R A;  4CSA C;  5DLJ A;  4ZLC A;  4C3E A;  3B71 A;  1SR2 A;  1HE1 A;  3A11 A;  2A0B A;  3M4B A;  5COG A;  3SXY A;  1YZC A;  1WWP A;  3AQC A;  1O5H A;  3WAQ A;  3KL4 A;  1Q0D A;  3AOU A;  1OCO C;  3DAG A;  1VLT A;  1YJG A;  2VCC A;  5AGF A;  4YK5 A;  3V5Y A;  3U3F A;  1G5Z A;  3W8I A;  2QTV A;  4ULV A;  3RQE A;  1TFK B;  3NYM A;  4I1M A;  5A6A A;  3UGO A;  3L8J A;  2NG1 A;  4BJ6 C;  5EHH A;  5BQH A;  5JS5 A;  2CGE A;  5KYX A;  2R7T A;  4OIR F;  2YWA A;  2HFI A;  2ETS A;  3ZG1 A;  3EGX A;  4NC3 A;  3DI5 A;  3ITF A;  4C7O B;  4NTF A;  2A6E F;  2AWY A;  1I5N A;  1RKC A;  2YLD A;  3K1I C;  3ZTZ A;  2J9B A;  3S9O A;  1CGO A;  1ST6 A;  2R7O A;  3G4Z A;  4JTD B;  1M56 C;  3G50 A;  4OIO F;  3FOO A;  4CJO A;  1RMV A;  4MS2 A;  2J45 A;  4JCH A;  1SF8 A;  3WOD F;  1UFB A;  5EGY A;  1MMG A;  2LSE A;  4FWV A;  1G4U S;  4YN0 B;  3ZDL A;  3DXJ F;  2A0U A;  5L0G A;  1CGN A;  2YQY A;  5IY5 C;  4XEK A;  5KYY B;  2M4E A;  4W8K A;  3VM6 A;  4J7Y A;  4FAP B;  4KC9 A;  3ASO C;  2R03 A;  2XLH A;  2W4M A;  1QQ3 A;  1BZ4 A;  2ZXW C;  1F1M A;  3PMR A;  4WJ0 A;  4XEV A;  2KC3 A;  2VC9 A;  4HEA J;  5JT4 A;  2CNW A;  4RBN A;  3UGP A;  2P6V A;  3EH1 A;  1VB5 A;  4YL1 A;  4NTA A;  2LFF A;  3VYW A;  5JRA A;  3LS0 A;  1HMO A;  4BEJ A;  2ZXO A;  3KKB A;  3LS1 A;  4DBQ A;  4Q4Z F;  3G4X A;  3UMH A;  4BJ5 A;  5A6B D;  2J9U A;  3IQ6 A;  4DBR A;  3GOD A;  1NU9 C;  3MYI A;  4YT5 A;  1WAS A;  5BQI A;  2PNO A;  4JRZ A;  5DVW A;  1ORS C;  4EIY A;  5A6J A;  3M15 A;  4JE9 A;  2HMZ A;  1TWA A;  3EG9 A;  2YL0 A;  4JIO A;  2J46 A;  1MMA A;  3O55 A;  3C7J A;  1K05 A;  3JYH A;  1J8M F;  3LEV A;  2L81 A;  3U5S A;  1OCZ C;  4LDK A;  3B0U X;  1V74 B;  1JRA A;  1VYK A;  2Z15 A;  3U0C A;  4PR9 A;  4XEF A;  3U8V A;  5DS5 A;  1OR3 A;  3S84 A;  1OKK D;  3FOP A;  5KYU A;  4J32 B;  4XTK A;  4AE4 B;  2RD9 A;  2H7B A;  2UUH A;  4PJL A;  3ZIB A;  1FNT c;  2NSG A;  5B1B C;  4MVZ A;  4YL0 A;  2A68 F;  2AVK A;  3S90 A;  4C7O A;  1M57 C;  2CCY A;  4MVO A;  1N1C A;  1ORY A;  1TFO B;  2OU6 A;  3TD7 A;  3SP1 A;  4K7B A;  4GEH A;  5JSL A;  2XXA B;  2IOQ A;  2CW0 F;  2L6F A;  2XLW A;  2A6H F;  1SZI A;  3JCU Q;  5COF A;  1YYX A;  4MVR A;  1R4T A;  2Q4F A;  4N6H A;  3KPH A;  4U5H A;  3TOL A;  1J8Y F;  2MWQ A;  3IHU A;  3S27 A;  3U8P A;  3W8H A;  4AL0 A;  2IXP A;  3C8G D;  4U5C E;  3DM5 A;  5L0H A;  2NPU A;  2P0N A;  4PK4 A;  2WZL A;  4YJW A;  3V5X A;  5KYW B;  1TQG A;  4PJJ A;  3I4U A;  4M63 A;  3KMI A;  1NSG B;  1VYI A;  2DGJ A;  1KU2 A;  2HSQ A;  4BPM A;  2Q9A A;  5L0I A;  4KI2 A;  1VLS A;  1B68 A;  1A7E A;  2XLV A;  2I15 A;  2X51 A;  3QZC A;  2J7P A;  3L1M A;  5B1A C;  4BJ5 C;  1FR0 A;  5FZT A;  3K1I A;  3UNG C;  1OXK A;  4FX5 A;  4C3B A;  1QZX A;  1NZE A;  3ECS A;  4JTA B;  3RVY A;  5K0I A;  4NCQ A;  2O9X A;  1I4Z A;  3S29 A;  2KYH A;  5T3T A;  3HLZ A;  1KNY A;  2LP4 A;  4OIN F;  1Q0F A;  4MND A;  3K6B A;  4QI0 A;  2R7Q A;  1S7Z A;  3JTL O;  1I4Y A;  2FGY A;  1WAT A;  2NUP A;  2PFD A;  4EBJ A;  3IQC A;  4XPX A;  2JD3 A;  3SEO A;  1Z3I X;  2GA0 A;  3AG3 C;  1CPR A;  1GGQ A;  2HV6 A;  4OD5 A;  3T4R A;  3LEO A;  4MTF A;  4KNV A;  4O7G A;  1O3U A;  2GDC A;  2D4U A;  2J0W A;  1ZVZ A;  1MQV A;  3F46 A;  2WZF A;  4G7Z F;  3ZC4 A;  3PDM P;  2Y39 A;  2D5R B;  3TUL A;  1YA9 A;  1HE9 A;  2IM8 A;  1MNE A;  3N2Z B;  4E0I A;  1TR2 A;  1D1B A;  3BRJ A;  4JTC B;  4NQF A;  3T6G B;  2R7W A;  4D4N A;  2H7V C;  5T1D B;  4EHP A;  2WZG A;  2XXA A;  4O79 A;  5L3V A;  4UDV A;  3FHD A;  4BJT A;  1NFO A;  1AVO B;  2LIG A;  2YEV A;  1ZZP A;  3MFN A;  3UMK A;  3S0X A;  1IW7 F;  2Q7R A;  2XS1 A;  1U89 A;  3U2M A;  4BEM J;  2XLM A;  2R7V A;  4CX9 A;  3GWL A;  1C17 M;  1LE2 A;  1LI7 A;  4QI2 A;  2XSE A;  1NFN A;  4NTB A;  3ZTM A;  1KTM A;  1BBH A;  2LCH A;  4G0H A;  3GEE A;  2W9Y A;  2EIN C;  2XL8 A;  3M1C B;  4P9T A;  1Z23 A;  3JSE O;  1RJ9 A;  1H9T A;  4IJJ A;  1RKE B;  1JAF A;  1Z6A A;  4P6I C;  3POV A;  2MYS A;  3FAJ A;  1H9G A;  3N24 A;  2XL4 A;  3AGU A;  3PCV A;  2W45 A;  4U5B E;  3TK0 A;  3AJM A;  2PX0 A;  2WVN A;  2VAS A;  4MW8 A;  2YLI A;  5F5H A;  1ZHW A;  3C62 A;  2KK1 A;  4J30 B;  3LAY A;  1PD0 A;  1S05 A;  2DYS C;  2LD6 A;  3C18 A;  4U5D E;  2JPU A;  3FAP B;  3VAY A;  4PFO A;  4J7T A;  3J06 A;  2KJG A;  3LUT B;  3QMK A;  4ER9 A;  2Q00 A;  2YRF A;  2AP3 A;  2QUP A;  3QVY A;  4LLC A;  4JC7 A;  2NUT B;  4IAO A;  2YZS A;  1WGW A;  1Q0M A;  4LDR A;  2WVO A;  2OCC C;  1GS9 A;  4JVS A;  4KBL A;  2OEX A;  1FAP B;  3ABM C;  2GAQ A;  3GEI A;  3ZVR A;  1D1C A;  2HUJ A;  2IXN A;  5KYN A;  1D0Y A;  3E9V A;  3UMI A;  4XPY A;  3RFY A;  3QTH A;  5CI9 A;  3ZQY A;  4XLN F; 
#chains in the Genus database with same CATH homology
 1YYX A;  4N6H A;  3ZQV A;  4U9D A;  3TOL A;  5JVE A;  2YLG A;  3U8P A;  4IAQ A;  2XLE A;  2BC5 A;  1RCP A;  2YKZ A;  2XM0 A;  4IAR A;  4N4W A;  2XLD A;  3M4C A;  4JEA A;  1CPQ A;  2XLV A;  2QLA A;  2XLO A;  3HNI A;  1GQA A;  5JLI A;  3L1M A;  256B A;  3M79 A;  1E83 A;  1M6T A;  4WGZ A;  4CDV A;  3M4B A;  1YZC A;  2XL6 A;  3TOM A;  5AGF A;  3HNL A;  3QW0 A;  4ULV A;  3QW1 A;  1CPR A;  5JS5 A;  1EKY A;  3IQ5 A;  4CDA A;  1MQV A;  1NBB A;  4NC3 A;  4WGY A;  4CIP A;  3VRC A;  3DE9 A;  2YLD A;  1A7V A;  2J9B A;  3ZTZ A;  1CGO A;  1YZA A;  4D4N A;  3FOO A;  4CJO A;  5JUA A;  4JKV A;  1QPU A;  1CGN A;  4U9E A;  3QVZ A;  2XLM A;  4CX9 A;  2J8W A;  3NMI A;  2XLH A;  5JP7 A;  3ZTM A;  1QQ3 A;  1BBH A;  3HNJ A;  5JT4 A;  1E84 A;  1E86 A;  2YL3 A;  2XL8 A;  5JRA A;  4L6R A;  1JAF A;  3NMJ A;  1APC A;  3IQ6 A;  4JEB A;  2YL1 A;  4EIY A;  3M15 A;  2YLI A;  4JE9 A;  2YL0 A;  3C62 A;  1LM3 B;  1E85 A;  1S05 A;  3DE8 A;  4D4X A;  4ER9 A;  1YYJ A;  3QVY A;  3C63 A;  3FOP A;  5B3I A;  4IB4 A;  2CCY A;  2YL7 A;  3HNK A;  2XM4 A;  4CDY A;  3NMK A;  3ZWI A;  5JSL A;  4CJG A;  3ZQY A;  2XLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...