2BCCH

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
66
Chain Sequence
LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELFDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
total genus 21
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 2bccH00
3L74H 1SQPH 5KLVH 3CX5F 1EZVH 1PP9H 3H1HH 3H1KH 2FYUH 1L0NH 3H1IH 1SQXH 1PPJH 4PD4F 1BE3H 3TGUH 1KYOF 3L70H 1NTMH 1SQBH 1NTZH 1BCCH 1SQQH 3L72H 3H1LH 2IBZH 4U3FH 2A06H 3L75H 4D6TH 3BCCH 1P84F 1SQVH 3L73H 3CWBH 1NTKH 1L0LH 3CXHF 1NU1H 1BGYH 2BCCH 3H1JH 1KB9F 3L71H
chains in the Genus database with same CATH superfamily
3HKEB 2E74B 4DR2O 1FFTB 1ZTEA 2IH3C 3AK2A 2NN4A 2HJFC 3E35A 2Q6AA 1BSMA 2X0LA 5EZYB 3RVYA 4J11A 5B1OA 4UV8A 5FPOA 1OV9A 3FB6C 2JIZG 5EYPA 3OTFA 2FB5A 4UUJC 4DV0O 2A0LA 2XUMA 1JOYA 1GN2A 4P9OA 4YXWG 2H8PC 4NTYA 3ZEDA 3CPWU 4GX2A 1D5NA 2N04A 4MTFA 3J7AU 1RFYA 3RW0A 1XNQO 4CS2A 4NYKA 5FLXN 1PNMA 3RYHA 1HNWO 1AILA 4JTAB 5IYZB 2EIKB 4PDMA 1XHZA 4LF8B 1KECA 3OGIB 3AG4B 4O4JA 1HNZO 3OTOO 1PM9A 2P67A 4DR1O 5CA0B 2QKSA 4JI7O 3JD4A 4DV1B 2ZDIA 2XAQA 5LP6B 2UUBO 1ZL8B 1R6KA 1EN5A 1ZUQA 2XOKG 2ARHA 5CA3A 4O2AB 3FB7C 2QKCA 3K0DA 1FS0G 3GWKC 4PV1B 5LA6B 1A32A 1PP9H 1NH2D 3SJQC 2RCVA 1XHXA 3IAYA 1SETA 4RWUA 1M56B 4DUZB 2WLHA 5K1PA 3HKDA 2OCHA 3ABMB 4DR1B 5LOVB 3TXQA 2YC0A 3JCUZ 4LFBO 3PN1A 1K5QA 3KCYA 3SPGA 1KB9F 2XAHA 3CX5F 4AILC 4HNAB 3QTCA 1J5EB 2OT5A 1Z5VA 3AG1C 2A79B 1RM1C 3HR0A 1K7DA 1N36B 2KG7A 4TV8B 1M90W 1IURA 1DTOA 2QA4V 4J42A 4X88A 1AR5A 1MSWD 4O2BB 3STLC 3KKYA 5JVDA 4WBNB 4ZHQA 4O4HB 3CB2A 2HVKC 4X1YA 1WA8A 3EXAA 5KA5A 3AG2C 2EZOA 2ZQMA 4FLVA 3ZS8C 3FAVA 3AG3B 1VQPV 4O4IB 3CC4V 2XHBA 2DYRB 3UM7A 4GCZA 1IX9A 1HNXB 4X62B 1XNRB 1PNKA 3QNEA 4GT1A 3OE7G 1B06A 4GLXA 1H38A 3IC9A 5KLVH 4GKKO 5EIBC 4MW3A 4LF5B 4GKJB 4NR1A 2DW4A 2KKWA 2EIMB 3ZN0A 2UXBO 4J7ZA 5B1BB 4U7NA 1UJWB 3A8TA 4F6EA 1Q86W 4UB6Z 2VRZA 3X2QC 3D3QA 2Q67A 2QTSA 4X1IA 4EKWA 2AW9A 2Q5ZA 5IYBO 3U0ZA 1MMMA 3BY6A 2UXDO 3K58A 1L0NH 3CCMV 1NTMH 1RSOA 4DW0A 1FJGB 2KB1A 3UO2A 4FFBB 1TUBB 3WU2Z 4RAIA 1M1KW 3OT7A 4BIUA 4OX9O 4Q6GA 1Q90D 2E75B 4GX1A 1OJHA 2CGOA 5FNVB 1SZXA 5HFMA 4DV7B 1KC8W 1SESA 2AGAA 1AR1B 2EILB 5F2VO 1YSCA 1NU1H 4DYLA 4QPKA 3W7XA 2F4VB 2A7WA 1K33A 1XL6A 2W6JG 1QQCA 5KAFZ 3LSSA 1GN3A 4LR3A 2YS8A 1BL8A 3M7MX 2BOBC 1ORQC 2YXYA 2LQTA 1AI6A 1CXZB 3AEIA 2KQXA 1VF5B 4LWSB 4IHJB 1VF6A 3VBBA 1YITV 2BTQA 2OWOA 1J95A 4I50A 1N33O 4B08A 1Q82W 3MHHC 3WFVA 4KXRA 1SC5B 2CTWA 4DV4B 1IBLO 1E1QG 3L9DA 2G38A 3HKCA 1BE3H 1G6UA 5K1XA 2WPDG 1VF6C 1URFA 4X9QA 4TV8A 4FFBA 5B66Z 2ZR2A 3VQXA 1XQ8A 3ZRWB 3U10A 2RN9A 1WLEA 4I0XB 2QM8A 4MTOA 3S3XA 1XREA 1J5EO 2QWOB 2QDOA 2Y69B 1QVGU 1N0JA 1DF5A 1YDXA 4LFBB 1QR8A 1HWYA 4X20A 3ETEA 1U96A 3CWBH 2P5OA 4DW1A 1YIJV 1VQMV 2ZKOA 4FLWA 5LXTA 4DUZO 2DQ0A 1N32B 2P90A 2B1GA 1JJ2U 2F23A 2YIBA 5ITZA 3D36C 5LMNB 1D2DA 2HHHO 2YDEA 1BMFG 1SQXH 1R3LC 1V55C 3E2EA 3L70H 1DK1A 2QEXV 1GN4A 4FZ1A 1FXVA 1NT2B 2QWQB 2CTQA 3MAQA 4JGSA 5L3DA 1MG1A 4D7TA 4JI1O 1BGYH 2BCCH 2QGNA 4WFGA 4LBEC 4B3MO 4JYAB 1BQZA 4YJ2B 4FZ0A 3OM3B 1H2LA 2CGNA 5C8YA 2CTPA 5CA1A 3VQVA 5KHJA 1L0LH 4JYCA 1DGSA 3SPHA 1SQPH 2DWDC 1XNQB 3H1HH 3H1KH 4KUMA 4WFBV 3B40A 1AJQA 4GYCB 1QBZA 1SKVA 4F4LA 2QWNB 4MVSA 4XBFA 4WFFA 4TUYA 4YHHO 4DR5B 3P3PA 4IL6Z 3WG7B 3CRAA 3RYHB 3SPCA 4LF9O 1OCOC 2YIAA 1ENVA 4BIOA 3WB2A 4YJ3A 3RYIB 1S72V 3SR2C 3WG7C 2WLIB 4DR2B 4FLYA 1N32O 3C3TA 2IBZH 3QF7A 5IJ9A 5IWAO 3K9AA 3SYOA 4X64O 3SYAA 4QE9A 3ZX6A 5BMVA 4K35A 4X66O 3CMAV 4JI5B 3FD9A 3CCRV 2XTAA 2HG5C 2EZPA 1WP7A 4NXNO 5A2QN 4E2LA 1NR7A 4PDRA 5LGUA 4JF3A 4W4LA 1JJOA 1IBMB 2XNDG 4DUYO 2A06H 4LNUA 5B1AB 3IGAC 5KMGA 4ZHQB 3K79A 2P7TC 4EB6B 4TV9B 5GW7A 5JWPA 1VQ5V 3JARA 2NNUA 1NVPB 2Q4PA 4CC6A 4DV4O 1NI8A 4FFKA 1IBMO 2WA4A 3ABLC 3RWRD 1K9MW 5BZBA 1OCZC 2ODMA 2W6IG 4DV3B 2ITDC 4MVRA 2LW7A 2VWJA 2B1IA 3KG2A 3IJ4A 3J81N 5EC1C 3ASOC 5JVDB 3JAMN 1AI4A 4X1YB 1UPGA 1W2BU 1S0VA 5KA6A 3K3WA 4JI0O 2JEXA 3R66A 5EBMC 4I55B 2P6JA 1AROP 1R3IC 1AR4A 1K92A 1QLEB 3CRMA 3I55V 2ZXWC 2CH7B 4D6TH 3SYPA 5EK0A 4CC5A 3APOA 3BABA 3FX7A 2JS3A 1M57B 1Z5WA 3ZMUA 2ILMA 3TETA 4JI6B 4YHHB 4MTGA 1XUQA 5BMVB 1F4MA 4TQDA 5DN6G 3SPJA 3OEHG 4P30A 4BW5A 2N05A 4G2KA 2AZ0A 4PJ0Z 2UUAB 2YUAA 4FM1A 1OZ0A 3N2KB 1FJGO 1NVPD 4NKGB 1VQ8V 3F7YC 1NH2B 4ASUG 3CC7V 3E22B 1VQKV 1H2GA 1CEZA 3JARB 5FL7G 4JAUA 1WB7A 4OPHA 1TGOA 2ZINA 2CE4A 3PJSK 3DGEA 2GSMB 5B1NA 3OMIB 4B3RO 4L8JA 4FM2A 5L3BA 1N34B 3FKSG 1OCCB 1PL4A 1IXBA 1XEQA 3D36A 5IY5C 3AG1B 4JI0B 1H8HG 1BS3A 4QIWF 4F6RA 4JZGA 4KHPB 1H8EG 2ZD9A 1ROPA 2ZIMA 4ZIBA 4FM0A 4K8XA 5IE9A 5TISZ 4JV5B 1HNXO 2ZE5A 3TCUA 3CJHA 2PF4E 4HAMA 3LDDA 2LW1A 3QVNA 4UXNA 1NQTA 1TA8A 4UCUA 3T4DA 1M4UA 2PYJA 1AVMA 4FLXA 1N4CA 3HKBB 2BSKB 3I56V 3CRRA 1B04A 4PHZA 1RPOA 2BTQB 4KL1A 2YXLA 4UCTA 5IT9N 2O57A 2Y0PA 2QM4A 1WN7A 3BVOA 4MVQA 2D3OW 1N36O 4AQYO 4EB6A 2P4VA 3KZIZ 3P3NA 1Q81W 3BFRA 4NB5A 2OCCC 1KP2A 3AK3A 3JSLA 3HKCB 1F7YA 4MVMA 1XBLA 3BAAA 5IJ0A 4JI8O 1KP3A 3JYCA 1HDJA 4X1KA 4OGQB 1JMKC 3SDLA 1K5SA 1PD3A 3LDCA 3OEEG 5CA0A 1LUWA 1SRYA 4PA9A 3RGBA 5B1BC 4QGPA 3E8FA 2WLLA 1Y66A 1SA0B 5IYCO 3CE2A 4A5UB 2ZE7A 5KHHA 2WSSG 2DJVA 3W7UA 5CB4B 3B09A 1K4DC 2F4VO 3LSQA 5JQGA 1N34O 1OCOB 2E76B 3JD0A 4DV2O 3G6BA 2VWKA 4NVPA 2L6LA 2R72A 4JI7B 1EN6A 2Q0OC 2V4DA 5L3CA 4MS2A 1W59A 4LF8O 4JPRA 5LOVA 4DV5O 3E8BA 1P84F 3VOUA 1VARA 3JALA 1Y74A 4HZ3A 3APQA 4TQFA 2V1DA 4UV9A 1Y76B 2KG7B 3OAAG 4DO2A 5CMUA 1GM7A 1BHAA 3STZC 3C90A 3R65A 1GTOA 4U7OA 4UVAA 2R70A 3CCUV 2R9IA 3MD0A 4IIJA 4LF4O 2PGGA 4JI1B 4CH6A 1VF7A 2Q7EA 2UXDB 1YVWA 2QM7A 4R50A 1PV0A 4R8CA 2PI5A 4DK0A 1TAEA 2FYUH 1B3QA 4J9YB 2NR5A 5LMNO 2YI8A 2JGUA 4BW9A 1QCEA 1L8DA 3K08A 3W7WA 5IYDO 4DRXA 2WLLB 4CS3A 1R3JC 4MVOA 3DXRA 4LF5O 5H2FZ 1IVSA 1WA8B 1XILA 1Q6IA 2BE3A 4Z1MG 2M7WA 3T2MA 1Q8IA 2JS5A 2ZIOA 1XOUA 4FIPC 3UT5B 3CC2V 3N2GA 4J80A 4ZI7A 4DV6B 1SZTA 2Q7HA 1AJPA 4O4LA 1B6QA 1FPOA 1H2NA 4ICGA 3CRCA 4NTXA 2D2CB 2VQEB 3ZHUA 2Q73A 2CDYA 2VQEO 4CH4A 1K3EA 2HFEC 3RYFB 3K5OA 1MA1A 3BPZA 4U3FH 3JD3A 4NXNB 4XDJA 1GM9A 2Q68A 4J7KA 4HBNA 5B3SB 1L1FA 5IJ0B 4X1KB 2W0FC 4R6ZA 4CBCA 3TJTA 2K1EA 2ADPA 3K57A 1PNLA 1RSOB 3AK1A 3CCJV 4CS4A 2JRIA 1WNSA 3JSNA 3JAKB 3TXSA 5GONA 2Q9LA 1SA0A 4LF9B 4LF6O 4CH5A 1S5LZ 3G71V 4X65O 1OCRB 1LUVA 1Q43A 4DR5O 4BAYA 5IY5B 2IJHA 3ZRXA 1I94O 3UKMA 1Y4MA 3ABLB 2Q7GA 4I5SA 4DV1O 4RQEA 3K59A 1KQSU 5H6QA 3CYOA 1YHQV 3QO8A 3P32A 2DE0X 4FJCC 4ZOLA 3H1JH 2JK5C 2XAFA 3GWOA 5GTHZ 1QHTA 2HLDG 1VQLV 1Y74B 2GHYA 3VQWA 3RVZA 5B3SC 1SQBH 4GX0A 3HKEA 4JTCB 3G6EV 3B4SA 4LWSA 5J2UB 2ETNA 2EIMC 2WLKA 3CCVV 4JYAO 5J2TB 4I50B 1PL0A 3I5DA 2RNBA 1F51A 2ZM6B 4WFAV 4FLZA 5E79Z 4GKKB 3ABKC 3H1LH 1VQNV 2YSUB 1E79G 2XASA 1R6NA 1XMQO 3ASNC 3BCCH 2HHHB 2X6AA 4LCUC 4X62O 1XNRO 2HKOA 2JJ2G 2ZR3A 3JASB 2UU9O 1R6TA 3BEHA 1Q7YW 5LP6A 3T4ZA 1EZJA 1M9NA 3D3IA 4Z1VA 4JI8B 2UUCB 3WB0A 5HFLA 3JCZA 3W7SA 3K9SA 3AG4C 4UVBA 1BHBA 2XAGA 2Y48A 4H33A 1MZFA 3OMAB 5ITZB 2ATKC 5LYJB 2BSKA 3CCSV 4ZI7B 1AI7A 4DUYB 4O4LB 3AG7A 1YJNV 1WJZA 1JFFA 1P7GA 2JEUA 1VQOV 1HR0B 3K03A 4KFMA 3UO3A 4U3JB 3ZMTA 1Q3EA 4UCVA 2UUCO 2UXXA 2BOCC 1WPBA 3RYFA 3K0GA 3E86A 5JJEB 3OFNG 4PELA 4I4TA 2UU9B 4YY3O 1Q6HA 1N33B 5GTIZ 3CCEV 2DQ3A 5C8YB 4JV5O 5DM6V 1EBOA 1H2SB 4DR7B 3BRCA 4WBNA 5LHHA 1FKAO 3HPLC 3UQ8A 4TUYB 1BCCH 4OPAA 1FXKB 2FTKA 3A0HZ 4LF7B 1MSDA 4FLTA 2IH1C 5H5NA 1QLNA 4DV7O 4XDLA 1EM1A 3QO5A 1H2MA 1AJNA 3KCXA 2DN9A 1WPXA 4PI2A 3FAVB 4Q20A 1HNWB 4YJ3B 3JALB 3BA9A 3H9VA 4OX9B 3ABKB 2AHYA 3OR7C 2HVJC 4EFEA 5LP6C 1EZVH 4JI4O 5D5QA 2UUAO 4I7ZB 2QKAA 3N27A 1FYJA 4LFCB 1KYOF 4BR6A 4B3MB 2OIGA 2RDCA 4IIJB 1NBMG 2QR4A 2B9ZA 3CMEV 3EHBB 3JAWA 3ZMVA 2WA3A 2JVDA 4JI6O 2HR3A 3CP1A 1V9PA 3THOA 4JI3B 4B3TB 4X65B 1Q5OA 4UCRA 2YIBD 2XT9A 1KBHA 1NTKH 1YXBA 1EFRG 3NXSA 2QJ1A 2X6CA 3ZRVA 3CHXA 1JA8A 1I08A 1VQ9V 3OD4A 2ZNJA 1YEWA 3C3SA 4RUEA 2DWEC 5DECA 2PTMA 3E83A 5LHGA 4TV9A 4H44B 2MK3A 1ZX3A 2WLMA 1KUQA 3RT3C 3B8NA 1U97A 4LH6A 4IGGA 1TUBA 1KMIZ 2B5UA 4K8ZA 4PDLA 1P49A 3F5WC 3H1IH 4J7JA 2BTOA 3JASA 3K5LA 1NKDA 4BIZA 4DK1A 1O9HA 2QSAA 3J80N 4B3SO 3RYCA 1LNQA 4JI3O 1ZLZA 1YCIA 4Z2WA 3OGCC 3T1HO 3AG3C 3ETQA 2FMLA 4JASA 1SQGA 2RJZA 1N0NA 4OXSA 2DYRC 4JAAA 2F66C 2XAJA 4IYIA 3CCLV 4J10A 3OR6C 4IHJA 2OCCB 4I55A 1LR1A 3UT5A 2GTAA 4I9WA 1T5EA 2LP7A 2A3QA 3LUTB 4WF9V 5KAIZ 1YJWV 3DTUB 3ETGA 4QJFB 1G8MA 5EYPB 2UXCB 1W0JG 2OTJV 4JI5O 2ITCC 4JTDB 1JPXA 4X66B 2EJ7A 4G28B 1VEWA 4PA6A 3X2QB 4GZRB 4UCSA 1K34A 1JCHA 4P9PA 1THZA 3K5NA 3N2KA 1GN6A 1GKFA 4LF7O 4UFZA 5KHKA 3E8GA 4DR3B 1SERA 2WWWA 4TT3G 3FFQA 2A9HA 5EC2C 3OMNB 2Z3YA 1QU7A 1GO3F 2E5LO 2H3OA 1RP3B 4PD4F 3DSQA 3E8HA 5D5PA 5LHIA 1DLBA 4G27B 1WAZA 2UUBB 5LXTB 1IDSA 3H01A 4RUFA 1IZ3A 2F93B 1FFXA 1HNZB 4O2AA 4JYBA 1M5IA 3RYCB 5LA6A 2LFSA 2QTOA 4EFBA 2P06A 5KUKA 2FKXA 1HR0O 1MZEA 1MOFA 4CZZA 4DV5B 2KSDA 1NTZH 3HB3B 2ZE8A 3EVKA 3O65A 4I9QA 4DV2B 1X59A 1QVFU 4JI2O 3JAWB 2UXBB 1R3KC 2CUGA 2WAMA 5JH7A 2YI9A 3HKBA 2Y0IA 2X6BA 3ZJZA 3FYEB 2LO1A 5C93A 1EN4A 4PA7A 3VQYA 4HNAA 3E89A 1M57C 4MSWC 3ZHQA 5H6RA 1FD9A 2DMXA 1XMQB 1R1BA 3FB8C 2GV9A 1AB3A 5BR8O 3ML0A 1TVKA 2PUSA 2YEVB 4FK5C 4WFHA 3IC7A 2EILC 2IJJA 3ICXA 2GBOA 2ZM6O 1W0KG 5BXZA 3K5MA 4JI2B 4DR4B 2ZE6A 4PI0A 1Y67A 4UVCA 4AQYB 1JVMA 2OTLV 4J41A 3JD1A 2EIKC 5LYJA 2ZNIA 3JATB 3RYIA 4NXMO 2R9AA 4IYHA 4JAVA 3F5TA 2Y69C 1FFXB 1RM1B 1JQ0A 5JQGB 1DF4A 5J9PC 5LMUO 4BWAA 1I0HA 5A9GA 3ABUA 1S3JA 2GDSA 1US6A 4H37A 1P4RA 2EULA 3FB5C 4N21A 2M6YA 2L35A 3LNNA 5IJ9B 2GUZA 2PZSA 1I94B 1VQ4V 2E5LB 2YXHA 1D5AA 4PA4A 4LNUB 2DYSC 2YICA 1YZBA 2ZDIC 3LNMB 1JX9A 4MT8A 4LF6B 2V7QG 3NR7A 2H94A 3P30A 5AG2A 1K4CC 4U3JA 2RQ6A 2EJRA 3ABMC 4K0KB 4UB8Z 3T1YO 1ZWIC 1I5XA 4X1IB 5KX5B 2EX3A 2GTSA 2Z5UA 2JDIG 3A0RA 4B3RB 1MNGA 4K0KO 1NS1A 1RPRA 1K73W 1KD1W 2MW2B 2QWRB 2F1MA 1V54C 3Q4HB 4JYYA 2CTRA 4LH7A 3ZMZA 3RBZA 1UFIA 3ZMSA 1V55B 1G4YB 2UXNA 4CH3A 2Y4TA 1KKCA 3G80A 5BY1A 3ZN1A 4RO2A 1SQQH 5JCOC 3L74H 4RQFA 2X7RB 3D8CA 1GAXA 3AG2B 3GB7C 3N2GB 2ZXWB 3S3WA 2CH7A 2P22C 3A0BZ 4HYOA 2ZT9B 3CD6V 2N74A 4DV0B 1GMGA 3BA8A 1VQ6V 3ASNB 3B77A 2Y4UA 2AZ2A 2DYSB 1N8RW 4L87A 4PDVA 4DV6O 1SQFA 3ZHSA 1NR1A 4C7UA 3ZIAG 3CRQA 4DR4O 1BT8A 1GRJA 2GUZB 3OW2U 1YF2A 3ZRSA 1AI5A 3QO7A 1G1XB 3CSXA 4GKJO 3CXCU 4W4KA 2IJKA 3MHSC 3G4SV 1PKXA 2R9RB 4J9ZB 2ADQB 3EFFK 3OUSA 1KU9A 1XDCA 4DV3O 3JAKA 1TVKB 5EZYA 4JZ2A 3TK1A 1GK9A 2NLJC 5IYZA 4H13B 4TOIA 4B3TO 1FXHA 3B2EE 4QNHB 4LF4B 4F6RB 4LFCO 4X20B 1SF9A 1GM8A 3JATA 1ZL8A 3ZRWA 1XI1A 1R73A 1Z2GA 4TSFG 4DR6B 4JI4B 3U11A 1XL4A 2VQFB 1VIBA 3CJHB 5GONB 3IFXA 2Q0AA 3BHPA 3CXHF 1YI2V 4X89A 4YIOA 5KHIA 4XDKA 3O9OA 2F95B 4D7SA 5IWAB 1S76D 2IU0A 3FYIB 2W0XA 3ZHVA 2AXTZ 1CP9A 1FXKC 4IT5A 3L75H 1S5HC 3A2FA 2VS0A 5CA1B 4ZOLB 4PA3A 2EBOA 5B5EZ 1VMGA 4DR7O 2PI4A 4YJ2A 1ZAUA 1H2KA 5CN0A 3CCQV 3DC6A 5J2TA 4WFEA 4K3AA 4YY3B 2E3CA 3HKDB 1YTFB 1OCRC 2WLNA 4O4HA 5J2UA 1F4NA 1TUEB 1K97A 3GVMA 5LGNA 3OTOB 5LMUB 5KUMA 1Y6XA 3Q4HA 4ZKIA 1QLEC 1AP6A 3ZCCA 4UCOA 2HEPA 3K04A 3M8AA 2WLIA 5E1AC 3SPIA 1I7FA 3ABTA 3TGUH 2VQFO 1BZKA 2IW5A 4O2BA 4NXMB 2P4KA 1IBKB 1O9GA 1SQVH 3QG5A 2EINB 4H0LB 5CB4A 5JH7B 3SJBC 4O4IA 4LP8A 5L3EA 4LFAB 3ZHRA 1VQ7V 1YJ9V 4N23A 1Y76A 2LGWA 1GH6A 4YIPA 4I4TB 4WCEV 2K9PA 5B1AC 4DXWA 2PY5A 2C2AA 5KHGA 1WP8A 2OIEA 4LFAO 3SYCA 2YEVA 2AHZA 3RN4A 4KHPO 1JFFB 4KP4A 5KMGB 2IJIA 1ZSPA 1FXKA 1F23A 2LGQA 1CPYA 4P2ZA 1S5JA 5CBHA 4QPJA 1M93A 4B7KA 2FL4A 2Z0AA 3K06A 3B8MA 2JJ1G 1IBKO 5H9CA 3LSUA 2LJ2A 2CK3G 1HP8A 4DRXB 3RFRA 2WLJA 2YIDA 3L72H 5LL6Y 3DXRB 4X8AA 5LGTA 2EINC 1OHHG 2Q69A 4MW8A 3LDEA 1IBLB 1Q6UA 1BQ0A 4AI8A 5FPRA 3ZHTA 4TWKA 1IXMA 5LBQA 4ABMA 3SJCC 4NTWA 3MDSA 4MTXA 2Q8VA 4MVUA 5L3FA 2JGDA 5FNVA 1YTFD 1SS3A 3OUFA 3CS5A 1XMOB 4GX5A 5CBFA 2ZCEA 4DR3O 1COWG 1JR9A 5EIBD 3SGIA 3T1YB 1NJIW 3M99B 5JJNB 4E4EA 4EEQA 1XMOO 5JJJB 1E1RG 1AP5A 4FMTA 2PYLA 5CBGA 3ETDA 4GUNA 3ZBHA 2UXCO 4FVMA 3E22A 4FLUA 1I5YA 2HP8A 2QE7G 2CAZC 4B7EA 4R7CA 5KX5A 4DR6O 3T1CA 4FPPA 1OCCC 3W7TA 2DOSA 2F43G 1PPJH 3DC5A 3F7VC 2EIJB 2IU3A 3JD2A 2OYQA 3SJAC 2HJDA 5L3GA 3G67A 3T1HB 3CEIA 3WB1A 1K8AW 5DEDA 4O4JB 3ASOB 3L73H 2EIJC 1M56C 4LC1A 5EBLC 4B3SB 1WB8A 3L71H 1MABG 4QE7A 1FAFA 4I0XA 1NZ6A 1VP7A 4ZBMA 1X4TA 4MVZA 2QWPB 5JCOA 1V54B 2LFRA 3SYQA 1HW7A 1QNMA 1OCZB 1QR9A 2IM9A 4X64B 5IDJA 2RMKB 1KKDA 1P7BA 1S77D 4AHCA 5EBWC 2JGDB 5BR8B 3UCSC
chains in the Genus database with same CATH topology
3L74H 1SQPH 5KLVH 3CX5F 1EZVH 1PP9H 3H1HH 3H1KH 2FYUH 1L0NH 3H1IH 1SQXH 1PPJH 4PD4F 1BE3H 3TGUH 1KYOF 3L70H 1NTMH 1SQBH 1NTZH 1BCCH 1SQQH 3L72H 3H1LH 2IBZH 4U3FH 2A06H 3L75H 4D6TH 3BCCH 1P84F 1SQVH 3L73H 3CWBH 1NTKH 1L0LH 3CXHF 1NU1H 1BGYH 2BCCH 3H1JH 1KB9F 3L71H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L74 H;  1SQP H;  5KLV H;  3CX5 F;  1EZV H;  1PP9 H;  3H1H H;  3H1K H;  2FYU H;  1L0N H;  3H1I H;  1SQX H;  1PPJ H;  4PD4 F;  1BE3 H;  3TGU H;  1KYO F;  3L70 H;  1NTM H;  1SQB H;  1NTZ H;  1BCC H;  1SQQ H;  3L72 H;  3H1L H;  2IBZ H;  4U3F H;  2A06 H;  3L75 H;  4D6T H;  3BCC H;  1P84 F;  1SQV H;  3L73 H;  3CWB H;  1NTK H;  1L0L H;  3CXH F;  1NU1 H;  1BGY H;  2BCC H;  3H1J H;  1KB9 F;  3L71 H; 
#chains in the Genus database with same CATH topology
 3HKE B;  2E74 B;  4DR2 O;  1FFT B;  1ZTE A;  2IH3 C;  3AK2 A;  2NN4 A;  2HJF C;  3E35 A;  2Q6A A;  1BSM A;  2X0L A;  5EZY B;  3RVY A;  4J11 A;  5B1O A;  4UV8 A;  5FPO A;  1OV9 A;  3FB6 C;  2JIZ G;  5EYP A;  3OTF A;  2FB5 A;  4UUJ C;  4DV0 O;  2A0L A;  2XUM A;  1JOY A;  1GN2 A;  4P9O A;  4YXW G;  2H8P C;  4NTY A;  3ZED A;  3CPW U;  4GX2 A;  1D5N A;  2N04 A;  4MTF A;  3J7A U;  1RFY A;  3RW0 A;  1XNQ O;  4CS2 A;  4NYK A;  5FLX N;  1PNM A;  3RYH A;  1HNW O;  1AIL A;  4JTA B;  5IYZ B;  2EIK B;  4PDM A;  1XHZ A;  4LF8 B;  1KEC A;  3OGI B;  3AG4 B;  4O4J A;  1HNZ O;  3OTO O;  1PM9 A;  2P67 A;  4DR1 O;  5CA0 B;  2QKS A;  4JI7 O;  3JD4 A;  4DV1 B;  2ZDI A;  2XAQ A;  5LP6 B;  2UUB O;  1ZL8 B;  1R6K A;  1EN5 A;  1ZUQ A;  2XOK G;  2ARH A;  5CA3 A;  4O2A B;  3FB7 C;  2QKC A;  3K0D A;  1FS0 G;  3GWK C;  4PV1 B;  5LA6 B;  1A32 A;  1PP9 H;  1NH2 D;  3SJQ C;  2RCV A;  1XHX A;  3IAY A;  1SET A;  4RWU A;  1M56 B;  4DUZ B;  2WLH A;  5K1P A;  3HKD A;  2OCH A;  3ABM B;  4DR1 B;  5LOV B;  3TXQ A;  2YC0 A;  3JCU Z;  4LFB O;  3PN1 A;  1K5Q A;  3KCY A;  3SPG A;  1KB9 F;  2XAH A;  3CX5 F;  4AIL C;  4HNA B;  3QTC A;  1J5E B;  2OT5 A;  1Z5V A;  3AG1 C;  2A79 B;  1RM1 C;  3HR0 A;  1K7D A;  1N36 B;  2KG7 A;  4TV8 B;  1M90 W;  1IUR A;  1DTO A;  2QA4 V;  4J42 A;  4X88 A;  1AR5 A;  1MSW D;  4O2B B;  3STL C;  3KKY A;  5JVD A;  4WBN B;  4ZHQ A;  4O4H B;  3CB2 A;  2HVK C;  4X1Y A;  1WA8 A;  3EXA A;  5KA5 A;  3AG2 C;  2EZO A;  2ZQM A;  4FLV A;  3ZS8 C;  3FAV A;  3AG3 B;  1VQP V;  4O4I B;  3CC4 V;  2XHB A;  2DYR B;  3UM7 A;  4GCZ A;  1IX9 A;  1HNX B;  4X62 B;  1XNR B;  1PNK A;  3QNE A;  4GT1 A;  3OE7 G;  1B06 A;  4GLX A;  1H38 A;  3IC9 A;  5KLV H;  4GKK O;  5EIB C;  4MW3 A;  4LF5 B;  4GKJ B;  4NR1 A;  2DW4 A;  2KKW A;  2EIM B;  3ZN0 A;  2UXB O;  4J7Z A;  5B1B B;  4U7N A;  1UJW B;  3A8T A;  4F6E A;  1Q86 W;  4UB6 Z;  2VRZ A;  3X2Q C;  3D3Q A;  2Q67 A;  2QTS A;  4X1I A;  4EKW A;  2AW9 A;  2Q5Z A;  5IYB O;  3U0Z A;  1MMM A;  3BY6 A;  2UXD O;  3K58 A;  1L0N H;  3CCM V;  1NTM H;  1RSO A;  4DW0 A;  1FJG B;  2KB1 A;  3UO2 A;  4FFB B;  1TUB B;  3WU2 Z;  4RAI A;  1M1K W;  3OT7 A;  4BIU A;  4OX9 O;  4Q6G A;  1Q90 D;  2E75 B;  4GX1 A;  1OJH A;  2CGO A;  5FNV B;  1SZX A;  5HFM A;  4DV7 B;  1KC8 W;  1SES A;  2AGA A;  1AR1 B;  2EIL B;  5F2V O;  1YSC A;  1NU1 H;  4DYL A;  4QPK A;  3W7X A;  2F4V B;  2A7W A;  1K33 A;  1XL6 A;  2W6J G;  1QQC A;  5KAF Z;  3LSS A;  1GN3 A;  4LR3 A;  2YS8 A;  1BL8 A;  3M7M X;  2BOB C;  1ORQ C;  2YXY A;  2LQT A;  1AI6 A;  1CXZ B;  3AEI A;  2KQX A;  1VF5 B;  4LWS B;  4IHJ B;  1VF6 A;  3VBB A;  1YIT V;  2BTQ A;  2OWO A;  1J95 A;  4I50 A;  1N33 O;  4B08 A;  1Q82 W;  3MHH C;  3WFV A;  4KXR A;  1SC5 B;  2CTW A;  4DV4 B;  1IBL O;  1E1Q G;  3L9D A;  2G38 A;  3HKC A;  1BE3 H;  1G6U A;  5K1X A;  2WPD G;  1VF6 C;  1URF A;  4X9Q A;  4TV8 A;  4FFB A;  5B66 Z;  2ZR2 A;  3VQX A;  1XQ8 A;  3ZRW B;  3U10 A;  2RN9 A;  1WLE A;  4I0X B;  2QM8 A;  4MTO A;  3S3X A;  1XRE A;  1J5E O;  2QWO B;  2QDO A;  2Y69 B;  1QVG U;  1N0J A;  1DF5 A;  1YDX A;  4LFB B;  1QR8 A;  1HWY A;  4X20 A;  3ETE A;  1U96 A;  3CWB H;  2P5O A;  4DW1 A;  1YIJ V;  1VQM V;  2ZKO A;  4FLW A;  5LXT A;  4DUZ O;  2DQ0 A;  1N32 B;  2P90 A;  2B1G A;  1JJ2 U;  2F23 A;  2YIB A;  5ITZ A;  3D36 C;  5LMN B;  1D2D A;  2HHH O;  2YDE A;  1BMF G;  1SQX H;  1R3L C;  1V55 C;  3E2E A;  3L70 H;  1DK1 A;  2QEX V;  1GN4 A;  4FZ1 A;  1FXV A;  1NT2 B;  2QWQ B;  2CTQ A;  3MAQ A;  4JGS A;  5L3D A;  1MG1 A;  4D7T A;  4JI1 O;  1BGY H;  2BCC H;  2QGN A;  4WFG A;  4LBE C;  4B3M O;  4JYA B;  1BQZ A;  4YJ2 B;  4FZ0 A;  3OM3 B;  1H2L A;  2CGN A;  5C8Y A;  2CTP A;  5CA1 A;  3VQV A;  5KHJ A;  1L0L H;  4JYC A;  1DGS A;  3SPH A;  1SQP H;  2DWD C;  1XNQ B;  3H1H H;  3H1K H;  4KUM A;  4WFB V;  3B40 A;  1AJQ A;  4GYC B;  1QBZ A;  1SKV A;  4F4L A;  2QWN B;  4MVS A;  4XBF A;  4WFF A;  4TUY A;  4YHH O;  4DR5 B;  3P3P A;  4IL6 Z;  3WG7 B;  3CRA A;  3RYH B;  3SPC A;  4LF9 O;  1OCO C;  2YIA A;  1ENV A;  4BIO A;  3WB2 A;  4YJ3 A;  3RYI B;  1S72 V;  3SR2 C;  3WG7 C;  2WLI B;  4DR2 B;  4FLY A;  1N32 O;  3C3T A;  2IBZ H;  3QF7 A;  5IJ9 A;  5IWA O;  3K9A A;  3SYO A;  4X64 O;  3SYA A;  4QE9 A;  3ZX6 A;  5BMV A;  4K35 A;  4X66 O;  3CMA V;  4JI5 B;  3FD9 A;  3CCR V;  2XTA A;  2HG5 C;  2EZP A;  1WP7 A;  4NXN O;  5A2Q N;  4E2L A;  1NR7 A;  4PDR A;  5LGU A;  4JF3 A;  4W4L A;  1JJO A;  1IBM B;  2XND G;  4DUY O;  2A06 H;  4LNU A;  5B1A B;  3IGA C;  5KMG A;  4ZHQ B;  3K79 A;  2P7T C;  4EB6 B;  4TV9 B;  5GW7 A;  5JWP A;  1VQ5 V;  3JAR A;  2NNU A;  1NVP B;  2Q4P A;  4CC6 A;  4DV4 O;  1NI8 A;  4FFK A;  1IBM O;  2WA4 A;  3ABL C;  3RWR D;  1K9M W;  5BZB A;  1OCZ C;  2ODM A;  2W6I G;  4DV3 B;  2ITD C;  4MVR A;  2LW7 A;  2VWJ A;  2B1I A;  3KG2 A;  3IJ4 A;  3J81 N;  5EC1 C;  3ASO C;  5JVD B;  3JAM N;  1AI4 A;  4X1Y B;  1UPG A;  1W2B U;  1S0V A;  5KA6 A;  3K3W A;  4JI0 O;  2JEX A;  3R66 A;  5EBM C;  4I55 B;  2P6J A;  1ARO P;  1R3I C;  1AR4 A;  1K92 A;  1QLE B;  3CRM A;  3I55 V;  2ZXW C;  2CH7 B;  4D6T H;  3SYP A;  5EK0 A;  4CC5 A;  3APO A;  3BAB A;  3FX7 A;  2JS3 A;  1M57 B;  1Z5W A;  3ZMU A;  2ILM A;  3TET A;  4JI6 B;  4YHH B;  4MTG A;  1XUQ A;  5BMV B;  1F4M A;  4TQD A;  5DN6 G;  3SPJ A;  3OEH G;  4P30 A;  4BW5 A;  2N05 A;  4G2K A;  2AZ0 A;  4PJ0 Z;  2UUA B;  2YUA A;  4FM1 A;  1OZ0 A;  3N2K B;  1FJG O;  1NVP D;  4NKG B;  1VQ8 V;  3F7Y C;  1NH2 B;  4ASU G;  3CC7 V;  3E22 B;  1VQK V;  1H2G A;  1CEZ A;  3JAR B;  5FL7 G;  4JAU A;  1WB7 A;  4OPH A;  1TGO A;  2ZIN A;  2CE4 A;  3PJS K;  3DGE A;  2GSM B;  5B1N A;  3OMI B;  4B3R O;  4L8J A;  4FM2 A;  5L3B A;  1N34 B;  3FKS G;  1OCC B;  1PL4 A;  1IXB A;  1XEQ A;  3D36 A;  5IY5 C;  3AG1 B;  4JI0 B;  1H8H G;  1BS3 A;  4QIW F;  4F6R A;  4JZG A;  4KHP B;  1H8E G;  2ZD9 A;  1ROP A;  2ZIM A;  4ZIB A;  4FM0 A;  4K8X A;  5IE9 A;  5TIS Z;  4JV5 B;  1HNX O;  2ZE5 A;  3TCU A;  3CJH A;  2PF4 E;  4HAM A;  3LDD A;  2LW1 A;  3QVN A;  4UXN A;  1NQT A;  1TA8 A;  4UCU A;  3T4D A;  1M4U A;  2PYJ A;  1AVM A;  4FLX A;  1N4C A;  3HKB B;  2BSK B;  3I56 V;  3CRR A;  1B04 A;  4PHZ A;  1RPO A;  2BTQ B;  4KL1 A;  2YXL A;  4UCT A;  5IT9 N;  2O57 A;  2Y0P A;  2QM4 A;  1WN7 A;  3BVO A;  4MVQ A;  2D3O W;  1N36 O;  4AQY O;  4EB6 A;  2P4V A;  3KZI Z;  3P3N A;  1Q81 W;  3BFR A;  4NB5 A;  2OCC C;  1KP2 A;  3AK3 A;  3JSL A;  3HKC B;  1F7Y A;  4MVM A;  1XBL A;  3BAA A;  5IJ0 A;  4JI8 O;  1KP3 A;  3JYC A;  1HDJ A;  4X1K A;  4OGQ B;  1JMK C;  3SDL A;  1K5S A;  1PD3 A;  3LDC A;  3OEE G;  5CA0 A;  1LUW A;  1SRY A;  4PA9 A;  3RGB A;  5B1B C;  4QGP A;  3E8F A;  2WLL A;  1Y66 A;  1SA0 B;  5IYC O;  3CE2 A;  4A5U B;  2ZE7 A;  5KHH A;  2WSS G;  2DJV A;  3W7U A;  5CB4 B;  3B09 A;  1K4D C;  2F4V O;  3LSQ A;  5JQG A;  1N34 O;  1OCO B;  2E76 B;  3JD0 A;  4DV2 O;  3G6B A;  2VWK A;  4NVP A;  2L6L A;  2R72 A;  4JI7 B;  1EN6 A;  2Q0O C;  2V4D A;  5L3C A;  4MS2 A;  1W59 A;  4LF8 O;  4JPR A;  5LOV A;  4DV5 O;  3E8B A;  1P84 F;  3VOU A;  1VAR A;  3JAL A;  1Y74 A;  4HZ3 A;  3APQ A;  4TQF A;  2V1D A;  4UV9 A;  1Y76 B;  2KG7 B;  3OAA G;  4DO2 A;  5CMU A;  1GM7 A;  1BHA A;  3STZ C;  3C90 A;  3R65 A;  1GTO A;  4U7O A;  4UVA A;  2R70 A;  3CCU V;  2R9I A;  3MD0 A;  4IIJ A;  4LF4 O;  2PGG A;  4JI1 B;  4CH6 A;  1VF7 A;  2Q7E A;  2UXD B;  1YVW A;  2QM7 A;  4R50 A;  1PV0 A;  4R8C A;  2PI5 A;  4DK0 A;  1TAE A;  2FYU H;  1B3Q A;  4J9Y B;  2NR5 A;  5LMN O;  2YI8 A;  2JGU A;  4BW9 A;  1QCE A;  1L8D A;  3K08 A;  3W7W A;  5IYD O;  4DRX A;  2WLL B;  4CS3 A;  1R3J C;  4MVO A;  3DXR A;  4LF5 O;  5H2F Z;  1IVS A;  1WA8 B;  1XIL A;  1Q6I A;  2BE3 A;  4Z1M G;  2M7W A;  3T2M A;  1Q8I A;  2JS5 A;  2ZIO A;  1XOU A;  4FIP C;  3UT5 B;  3CC2 V;  3N2G A;  4J80 A;  4ZI7 A;  4DV6 B;  1SZT A;  2Q7H A;  1AJP A;  4O4L A;  1B6Q A;  1FPO A;  1H2N A;  4ICG A;  3CRC A;  4NTX A;  2D2C B;  2VQE B;  3ZHU A;  2Q73 A;  2CDY A;  2VQE O;  4CH4 A;  1K3E A;  2HFE C;  3RYF B;  3K5O A;  1MA1 A;  3BPZ A;  4U3F H;  3JD3 A;  4NXN B;  4XDJ A;  1GM9 A;  2Q68 A;  4J7K A;  4HBN A;  5B3S B;  1L1F A;  5IJ0 B;  4X1K B;  2W0F C;  4R6Z A;  4CBC A;  3TJT A;  2K1E A;  2ADP A;  3K57 A;  1PNL A;  1RSO B;  3AK1 A;  3CCJ V;  4CS4 A;  2JRI A;  1WNS A;  3JSN A;  3JAK B;  3TXS A;  5GON A;  2Q9L A;  1SA0 A;  4LF9 B;  4LF6 O;  4CH5 A;  1S5L Z;  3G71 V;  4X65 O;  1OCR B;  1LUV A;  1Q43 A;  4DR5 O;  4BAY A;  5IY5 B;  2IJH A;  3ZRX A;  1I94 O;  3UKM A;  1Y4M A;  3ABL B;  2Q7G A;  4I5S A;  4DV1 O;  4RQE A;  3K59 A;  1KQS U;  5H6Q A;  3CYO A;  1YHQ V;  3QO8 A;  3P32 A;  2DE0 X;  4FJC C;  4ZOL A;  3H1J H;  2JK5 C;  2XAF A;  3GWO A;  5GTH Z;  1QHT A;  2HLD G;  1VQL V;  1Y74 B;  2GHY A;  3VQW A;  3RVZ A;  5B3S C;  1SQB H;  4GX0 A;  3HKE A;  4JTC B;  3G6E V;  3B4S A;  4LWS A;  5J2U B;  2ETN A;  2EIM C;  2WLK A;  3CCV V;  4JYA O;  5J2T B;  4I50 B;  1PL0 A;  3I5D A;  2RNB A;  1F51 A;  2ZM6 B;  4WFA V;  4FLZ A;  5E79 Z;  4GKK B;  3ABK C;  3H1L H;  1VQN V;  2YSU B;  1E79 G;  2XAS A;  1R6N A;  1XMQ O;  3ASN C;  3BCC H;  2HHH B;  2X6A A;  4LCU C;  4X62 O;  1XNR O;  2HKO A;  2JJ2 G;  2ZR3 A;  3JAS B;  2UU9 O;  1R6T A;  3BEH A;  1Q7Y W;  5LP6 A;  3T4Z A;  1EZJ A;  1M9N A;  3D3I A;  4Z1V A;  4JI8 B;  2UUC B;  3WB0 A;  5HFL A;  3JCZ A;  3W7S A;  3K9S A;  3AG4 C;  4UVB A;  1BHB A;  2XAG A;  2Y48 A;  4H33 A;  1MZF A;  3OMA B;  5ITZ B;  2ATK C;  5LYJ B;  2BSK A;  3CCS V;  4ZI7 B;  1AI7 A;  4DUY B;  4O4L B;  3AG7 A;  1YJN V;  1WJZ A;  1JFF A;  1P7G A;  2JEU A;  1VQO V;  1HR0 B;  3K03 A;  4KFM A;  3UO3 A;  4U3J B;  3ZMT A;  1Q3E A;  4UCV A;  2UUC O;  2UXX A;  2BOC C;  1WPB A;  3RYF A;  3K0G A;  3E86 A;  5JJE B;  3OFN G;  4PEL A;  4I4T A;  2UU9 B;  4YY3 O;  1Q6H A;  1N33 B;  5GTI Z;  3CCE V;  2DQ3 A;  5C8Y B;  4JV5 O;  5DM6 V;  1EBO A;  1H2S B;  4DR7 B;  3BRC A;  4WBN A;  5LHH A;  1FKA O;  3HPL C;  3UQ8 A;  4TUY B;  1BCC H;  4OPA A;  1FXK B;  2FTK A;  3A0H Z;  4LF7 B;  1MSD A;  4FLT A;  2IH1 C;  5H5N A;  1QLN A;  4DV7 O;  4XDL A;  1EM1 A;  3QO5 A;  1H2M A;  1AJN A;  3KCX A;  2DN9 A;  1WPX A;  4PI2 A;  3FAV B;  4Q20 A;  1HNW B;  4YJ3 B;  3JAL B;  3BA9 A;  3H9V A;  4OX9 B;  3ABK B;  2AHY A;  3OR7 C;  2HVJ C;  4EFE A;  5LP6 C;  1EZV H;  4JI4 O;  5D5Q A;  2UUA O;  4I7Z B;  2QKA A;  3N27 A;  1FYJ A;  4LFC B;  1KYO F;  4BR6 A;  4B3M B;  2OIG A;  2RDC A;  4IIJ B;  1NBM G;  2QR4 A;  2B9Z A;  3CME V;  3EHB B;  3JAW A;  3ZMV A;  2WA3 A;  2JVD A;  4JI6 O;  2HR3 A;  3CP1 A;  1V9P A;  3THO A;  4JI3 B;  4B3T B;  4X65 B;  1Q5O A;  4UCR A;  2YIB D;  2XT9 A;  1KBH A;  1NTK H;  1YXB A;  1EFR G;  3NXS A;  2QJ1 A;  2X6C A;  3ZRV A;  3CHX A;  1JA8 A;  1I08 A;  1VQ9 V;  3OD4 A;  2ZNJ A;  1YEW A;  3C3S A;  4RUE A;  2DWE C;  5DEC A;  2PTM A;  3E83 A;  5LHG A;  4TV9 A;  4H44 B;  2MK3 A;  1ZX3 A;  2WLM A;  1KUQ A;  3RT3 C;  3B8N A;  1U97 A;  4LH6 A;  4IGG A;  1TUB A;  1KMI Z;  2B5U A;  4K8Z A;  4PDL A;  1P49 A;  3F5W C;  3H1I H;  4J7J A;  2BTO A;  3JAS A;  3K5L A;  1NKD A;  4BIZ A;  4DK1 A;  1O9H A;  2QSA A;  3J80 N;  4B3S O;  3RYC A;  1LNQ A;  4JI3 O;  1ZLZ A;  1YCI A;  4Z2W A;  3OGC C;  3T1H O;  3AG3 C;  3ETQ A;  2FML A;  4JAS A;  1SQG A;  2RJZ A;  1N0N A;  4OXS A;  2DYR C;  4JAA A;  2F66 C;  2XAJ A;  4IYI A;  3CCL V;  4J10 A;  3OR6 C;  4IHJ A;  2OCC B;  4I55 A;  1LR1 A;  3UT5 A;  2GTA A;  4I9W A;  1T5E A;  2LP7 A;  2A3Q A;  3LUT B;  4WF9 V;  5KAI Z;  1YJW V;  3DTU B;  3ETG A;  4QJF B;  1G8M A;  5EYP B;  2UXC B;  1W0J G;  2OTJ V;  4JI5 O;  2ITC C;  4JTD B;  1JPX A;  4X66 B;  2EJ7 A;  4G28 B;  1VEW A;  4PA6 A;  3X2Q B;  4GZR B;  4UCS A;  1K34 A;  1JCH A;  4P9P A;  1THZ A;  3K5N A;  3N2K A;  1GN6 A;  1GKF A;  4LF7 O;  4UFZ A;  5KHK A;  3E8G A;  4DR3 B;  1SER A;  2WWW A;  4TT3 G;  3FFQ A;  2A9H A;  5EC2 C;  3OMN B;  2Z3Y A;  1QU7 A;  1GO3 F;  2E5L O;  2H3O A;  1RP3 B;  4PD4 F;  3DSQ A;  3E8H A;  5D5P A;  5LHI A;  1DLB A;  4G27 B;  1WAZ A;  2UUB B;  5LXT B;  1IDS A;  3H01 A;  4RUF A;  1IZ3 A;  2F93 B;  1FFX A;  1HNZ B;  4O2A A;  4JYB A;  1M5I A;  3RYC B;  5LA6 A;  2LFS A;  2QTO A;  4EFB A;  2P06 A;  5KUK A;  2FKX A;  1HR0 O;  1MZE A;  1MOF A;  4CZZ A;  4DV5 B;  2KSD A;  1NTZ H;  3HB3 B;  2ZE8 A;  3EVK A;  3O65 A;  4I9Q A;  4DV2 B;  1X59 A;  1QVF U;  4JI2 O;  3JAW B;  2UXB B;  1R3K C;  2CUG A;  2WAM A;  5JH7 A;  2YI9 A;  3HKB A;  2Y0I A;  2X6B A;  3ZJZ A;  3FYE B;  2LO1 A;  5C93 A;  1EN4 A;  4PA7 A;  3VQY A;  4HNA A;  3E89 A;  1M57 C;  4MSW C;  3ZHQ A;  5H6R A;  1FD9 A;  2DMX A;  1XMQ B;  1R1B A;  3FB8 C;  2GV9 A;  1AB3 A;  5BR8 O;  3ML0 A;  1TVK A;  2PUS A;  2YEV B;  4FK5 C;  4WFH A;  3IC7 A;  2EIL C;  2IJJ A;  3ICX A;  2GBO A;  2ZM6 O;  1W0K G;  5BXZ A;  3K5M A;  4JI2 B;  4DR4 B;  2ZE6 A;  4PI0 A;  1Y67 A;  4UVC A;  4AQY B;  1JVM A;  2OTL V;  4J41 A;  3JD1 A;  2EIK C;  5LYJ A;  2ZNI A;  3JAT B;  3RYI A;  4NXM O;  2R9A A;  4IYH A;  4JAV A;  3F5T A;  2Y69 C;  1FFX B;  1RM1 B;  1JQ0 A;  5JQG B;  1DF4 A;  5J9P C;  5LMU O;  4BWA A;  1I0H A;  5A9G A;  3ABU A;  1S3J A;  2GDS A;  1US6 A;  4H37 A;  1P4R A;  2EUL A;  3FB5 C;  4N21 A;  2M6Y A;  2L35 A;  3LNN A;  5IJ9 B;  2GUZ A;  2PZS A;  1I94 B;  1VQ4 V;  2E5L B;  2YXH A;  1D5A A;  4PA4 A;  4LNU B;  2DYS C;  2YIC A;  1YZB A;  2ZDI C;  3LNM B;  1JX9 A;  4MT8 A;  4LF6 B;  2V7Q G;  3NR7 A;  2H94 A;  3P30 A;  5AG2 A;  1K4C C;  4U3J A;  2RQ6 A;  2EJR A;  3ABM C;  4K0K B;  4UB8 Z;  3T1Y O;  1ZWI C;  1I5X A;  4X1I B;  5KX5 B;  2EX3 A;  2GTS A;  2Z5U A;  2JDI G;  3A0R A;  4B3R B;  1MNG A;  4K0K O;  1NS1 A;  1RPR A;  1K73 W;  1KD1 W;  2MW2 B;  2QWR B;  2F1M A;  1V54 C;  3Q4H B;  4JYY A;  2CTR A;  4LH7 A;  3ZMZ A;  3RBZ A;  1UFI A;  3ZMS A;  1V55 B;  1G4Y B;  2UXN A;  4CH3 A;  2Y4T A;  1KKC A;  3G80 A;  5BY1 A;  3ZN1 A;  4RO2 A;  1SQQ H;  5JCO C;  3L74 H;  4RQF A;  2X7R B;  3D8C A;  1GAX A;  3AG2 B;  3GB7 C;  3N2G B;  2ZXW B;  3S3W A;  2CH7 A;  2P22 C;  3A0B Z;  4HYO A;  2ZT9 B;  3CD6 V;  2N74 A;  4DV0 B;  1GMG A;  3BA8 A;  1VQ6 V;  3ASN B;  3B77 A;  2Y4U A;  2AZ2 A;  2DYS B;  1N8R W;  4L87 A;  4PDV A;  4DV6 O;  1SQF A;  3ZHS A;  1NR1 A;  4C7U A;  3ZIA G;  3CRQ A;  4DR4 O;  1BT8 A;  1GRJ A;  2GUZ B;  3OW2 U;  1YF2 A;  3ZRS A;  1AI5 A;  3QO7 A;  1G1X B;  3CSX A;  4GKJ O;  3CXC U;  4W4K A;  2IJK A;  3MHS C;  3G4S V;  1PKX A;  2R9R B;  4J9Z B;  2ADQ B;  3EFF K;  3OUS A;  1KU9 A;  1XDC A;  4DV3 O;  3JAK A;  1TVK B;  5EZY A;  4JZ2 A;  3TK1 A;  1GK9 A;  2NLJ C;  5IYZ A;  4H13 B;  4TOI A;  4B3T O;  1FXH A;  3B2E E;  4QNH B;  4LF4 B;  4F6R B;  4LFC O;  4X20 B;  1SF9 A;  1GM8 A;  3JAT A;  1ZL8 A;  3ZRW A;  1XI1 A;  1R73 A;  1Z2G A;  4TSF G;  4DR6 B;  4JI4 B;  3U11 A;  1XL4 A;  2VQF B;  1VIB A;  3CJH B;  5GON B;  3IFX A;  2Q0A A;  3BHP A;  3CXH F;  1YI2 V;  4X89 A;  4YIO A;  5KHI A;  4XDK A;  3O9O A;  2F95 B;  4D7S A;  5IWA B;  1S76 D;  2IU0 A;  3FYI B;  2W0X A;  3ZHV A;  2AXT Z;  1CP9 A;  1FXK C;  4IT5 A;  3L75 H;  1S5H C;  3A2F A;  2VS0 A;  5CA1 B;  4ZOL B;  4PA3 A;  2EBO A;  5B5E Z;  1VMG A;  4DR7 O;  2PI4 A;  4YJ2 A;  1ZAU A;  1H2K A;  5CN0 A;  3CCQ V;  3DC6 A;  5J2T A;  4WFE A;  4K3A A;  4YY3 B;  2E3C A;  3HKD B;  1YTF B;  1OCR C;  2WLN A;  4O4H A;  5J2U A;  1F4N A;  1TUE B;  1K97 A;  3GVM A;  5LGN A;  3OTO B;  5LMU B;  5KUM A;  1Y6X A;  3Q4H A;  4ZKI A;  1QLE C;  1AP6 A;  3ZCC A;  4UCO A;  2HEP A;  3K04 A;  3M8A A;  2WLI A;  5E1A C;  3SPI A;  1I7F A;  3ABT A;  3TGU H;  2VQF O;  1BZK A;  2IW5 A;  4O2B A;  4NXM B;  2P4K A;  1IBK B;  1O9G A;  1SQV H;  3QG5 A;  2EIN B;  4H0L B;  5CB4 A;  5JH7 B;  3SJB C;  4O4I A;  4LP8 A;  5L3E A;  4LFA B;  3ZHR A;  1VQ7 V;  1YJ9 V;  4N23 A;  1Y76 A;  2LGW A;  1GH6 A;  4YIP A;  4I4T B;  4WCE V;  2K9P A;  5B1A C;  4DXW A;  2PY5 A;  2C2A A;  5KHG A;  1WP8 A;  2OIE A;  4LFA O;  3SYC A;  2YEV A;  2AHZ A;  3RN4 A;  4KHP O;  1JFF B;  4KP4 A;  5KMG B;  2IJI A;  1ZSP A;  1FXK A;  1F23 A;  2LGQ A;  1CPY A;  4P2Z A;  1S5J A;  5CBH A;  4QPJ A;  1M93 A;  4B7K A;  2FL4 A;  2Z0A A;  3K06 A;  3B8M A;  2JJ1 G;  1IBK O;  5H9C A;  3LSU A;  2LJ2 A;  2CK3 G;  1HP8 A;  4DRX B;  3RFR A;  2WLJ A;  2YID A;  3L72 H;  5LL6 Y;  3DXR B;  4X8A A;  5LGT A;  2EIN C;  1OHH G;  2Q69 A;  4MW8 A;  3LDE A;  1IBL B;  1Q6U A;  1BQ0 A;  4AI8 A;  5FPR A;  3ZHT A;  4TWK A;  1IXM A;  5LBQ A;  4ABM A;  3SJC C;  4NTW A;  3MDS A;  4MTX A;  2Q8V A;  4MVU A;  5L3F A;  2JGD A;  5FNV A;  1YTF D;  1SS3 A;  3OUF A;  3CS5 A;  1XMO B;  4GX5 A;  5CBF A;  2ZCE A;  4DR3 O;  1COW G;  1JR9 A;  5EIB D;  3SGI A;  3T1Y B;  1NJI W;  3M99 B;  5JJN B;  4E4E A;  4EEQ A;  1XMO O;  5JJJ B;  1E1R G;  1AP5 A;  4FMT A;  2PYL A;  5CBG A;  3ETD A;  4GUN A;  3ZBH A;  2UXC O;  4FVM A;  3E22 A;  4FLU A;  1I5Y A;  2HP8 A;  2QE7 G;  2CAZ C;  4B7E A;  4R7C A;  5KX5 A;  4DR6 O;  3T1C A;  4FPP A;  1OCC C;  3W7T A;  2DOS A;  2F43 G;  1PPJ H;  3DC5 A;  3F7V C;  2EIJ B;  2IU3 A;  3JD2 A;  2OYQ A;  3SJA C;  2HJD A;  5L3G A;  3G67 A;  3T1H B;  3CEI A;  3WB1 A;  1K8A W;  5DED A;  4O4J B;  3ASO B;  3L73 H;  2EIJ C;  1M56 C;  4LC1 A;  5EBL C;  4B3S B;  1WB8 A;  3L71 H;  1MAB G;  4QE7 A;  1FAF A;  4I0X A;  1NZ6 A;  1VP7 A;  4ZBM A;  1X4T A;  4MVZ A;  2QWP B;  5JCO A;  1V54 B;  2LFR A;  3SYQ A;  1HW7 A;  1QNM A;  1OCZ B;  1QR9 A;  2IM9 A;  4X64 B;  5IDJ A;  2RMK B;  1KKD A;  1P7B A;  1S77 D;  4AHC A;  5EBW C;  2JGD B;  5BR8 B;  3UCS C; 
#chains in the Genus database with same CATH homology
 3L74 H;  1SQP H;  5KLV H;  3CX5 F;  1EZV H;  1PP9 H;  3H1H H;  3H1K H;  2FYU H;  1L0N H;  3H1I H;  1SQX H;  1PPJ H;  4PD4 F;  1BE3 H;  3TGU H;  1KYO F;  3L70 H;  1NTM H;  1SQB H;  1NTZ H;  1BCC H;  1SQQ H;  3L72 H;  3H1L H;  2IBZ H;  4U3F H;  2A06 H;  3L75 H;  4D6T H;  3BCC H;  1P84 F;  1SQV H;  3L73 H;  3CWB H;  1NTK H;  1L0L H;  3CXH F;  1NU1 H;  1BGY H;  2BCC H;  3H1J H;  1KB9 F;  3L71 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...