2BCCH

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
66
Chain Sequence
b'LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELFDFLHARDHCVAHKLFNSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 21
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 2bccH00
2BCCH 1SQQH 3L74H 3H1HH 3L73H 3H1LH 3TGUH 3H1KH 3L70H 1BGYH 3CX5F 1EZVH 3L71H 1NTZH 1BE3H 1SQXH 5KLVH 4U3FH 1SQBH 1KYOF 2A06H 3L72H 1SQVH 3BCCH 1PPJH 3CXHF 1NTKH 3H1IH 3L75H 1NTMH 1L0LH 1KB9F 1PP9H 3CWBH 4PD4F 1NU1H 2FYUH 3H1JH 1SQPH 1BCCH 4D6TH 1P84F 1L0NH 2IBZH
chains in the Genus database with same CATH superfamily
1AP5A 4DV7O 2GBOA 3CB2A 4YIPA 4PA9A 2UUBO 4LFCB 4MS2A 4MVQA 4FFBA 4I7ZB 3ABMC 5B3SC 4LF5O 3W7UA 1Q86W 5LBQA 3FB5C 2P6JA 4YHHB 5IT9N 3BA8A 4GYCB 3KG2A 3TCUA 1PNLA 4IYIA 1TA8A 4DV0B 5DN6G 3A0BZ 1DF5A 1FXKA 2ZT9B 3J81N 3K5LA 2KKWA 2X6BA 1GO3F 2JGDA 4X20B 2XAHA 3HB3B 3JSNA 3UM7A 4LF4O 5IJ0B 3QTCA 1AVMA 5H9CA 2B1IA 4BR6A 3IC7A 2EIMB 4DR6B 5FL7G 1BHAA 2Y48A 4U7NA 4UCOA 4QE9A 2FMLA 3T1YB 4LNUA 3DTUB 4QIWF 1NTMH 4Q20A 4JAAA 4MTGA 4LF6O 3Q4HA 3R66A 4ICGA 3K0DA 1FJGO 4ZI7A 3OTFA 1M5IA 2EIMC 2HVJC 2PYJA 1FFXA 4PA7A 4EKWA 4N21A 4B08A 4CH3A 2JJ1G 1E1QG 3ASOB 2M7WA 3D36C 2F1MA 4J7ZA 4X66B 4DR2B 2YEVA 3K04A 5FNVA 3EFFK 2LO1A 3ZCCA 2QWRB 4MVRA 4EB6A 2LW7A 1DF4A 3ZEDA 5EC1C 4XBFA 4B3RB 3CCQV 1KP2A 1MZFA 4JI4B 3ASOC 4X88A 1Q8IA 4EFEA 4ABMA 2NR5A 3B40A 3HKDB 5IJ9A 3B4SA 4TSFG 1XILA 1M93A 1QR9A 4O2AB 4BW9A 3STLC 4DV4O 2KG7A 3ZHSA 3FX7A 2O57A 2YICA 2P67A 1CEZA 4X64B 4RQEA 5LMUO 2YIBA 4W4LA 1JFFB 4QPKA 5CBFA 3FD9A 1O9HA 1YJNV 4TV8B 4HNAB 3CS5A 3BAAA 4NXNO 1ZUQA 5BXZA 1FYJA 1VF6A 1XMOO 3T4DA 3P3NA 1VMGA 1YVWA 4GX1A 3SYOA 4FZ1A 3H9VA 1ZL8A 3AK2A 1R6NA 5EC2C 4JI3B 4IHJA 2WWWA 2GDSA 2EIJB 4JYYA 5DEDA 4KL1A 3AG3B 1FXVA 1K3EA 2OWOA 2Y0IA 2RMKB 1TAEA 4JYCA 4PDRA 1MZEA 4ASUG 2E75B 2UUAB 5EK0A 4GUNA 2ZKOA 1B04A 2P06A 3OFNG 2Q7EA 1S72V 5AG2A 4MTXA 1XL6A 2WLJA 3AG3C 4CBCA 1BQZA 3ZHQA 1VQ9V 2AZ0A 4JI5O 3EVKA 2FB5A 2IJJA 3WG7B 1QLNA 3BY6A 1KP3A 1F7YA 4H44B 2WLLB 4DYLA 4B3MB 5CB4B 5BMVB 5LHGA 2CAZC 3RVYA 3JD3A 2EULA 4N23A 2RCVA 3AG2B 2R9IA 4ZIBA 1VQ8V 2BTQA 3LDDA 2PI4A 4JI6B 3FKSG 3IJ4A 1AB3A 2PY5A 1Q82W 3SR2C 5CA0B 2QDOA 1XHXA 2DYRB 3H1LH 1EZJA 4TV9A 5KUMA 1AJPA 1Q90D 3CJHB 4PDLA 2KB1A 3ABLB 1G6UA 4JAVA 1PL0A 5LXTB 1GH6A 1NVPD 3M99B 1WN7A 2DQ0A 2QJ1A 4GT1A 1SS3A 5KAFZ 3JCZA 4JTDB 3CHXA 4I9WA 4I0XA 3RW0A 4WFHA 2DYRC 4J42A 1DTOA 3CC7V 2OIGA 4J9YB 4LFAO 4GKKB 1XUQA 3ABLC 3CYOA 3A8TA 1H2MA 3N2GA 4PELA 5C8YB 1NTKH 3D3QA 3U11A 1XEQA 1UFIA 1KKDA 3T1HB 4XDLA 4BWAA 4HYOA 4PA3A 1RSOB 2W6JG 2XTAA 4DR4B 3HKBA 1NT2B 5L3BA 5GONA 4CH4A 2IU3A 3BVOA 4J9ZB 2AZ2A 4B3SO 5LA6B 2DYSC 1JJ2U 5BZBA 2ZR3A 2PUSA 3L9DA 4FVMA 3K3WA 4KP4A 2VWKA 5KAIZ 1VQ5V 1O9GA 2BOBC 1SQQH 4QE7A 5JH7B 3E2EA 4X8AA 4O4IB 4HZ3A 1N0JA 1N33B 1JA8A 3ETEA 2UU9O 1PV0A 1VF5B 1NTZH 1K97A 2NN4A 2ODMA 1R3JC 1PPJH 3BHPA 1K73W 3CXCU 1K4DC 4X1KB 4GX0A 3QO7A 1XNQO 1M4UA 1IURA 1GTOA 1YSCA 3M7MX 3CMAV 4X20A 1NH2D 1R3LC 4LH7A 2K1EA 2IJHA 1N36B 1E1RG 3STZC 4RWUA 2BSKB 5IJ0A 2JIZG 1NJIW 2E3CA 2Z5UA 3JAKB 5H2FZ 2HP8A 5FPOA 3U10A 3ETQA 1I5XA 3JCUZ 3CCSV 3DSQA 2BCCH 3UT5B 4GZRB 4DR5B 3ASNB 2IJIA 3JAWB 5IY5B 3OR6C 4ZHQB 3SPIA 2YI9A 5KX5B 1VF7A 1Z5VA 3MAQA 4B7EA 2OTJV 2CDYA 4YJ3B 4DRXB 2UUCB 2F93B 4I5SA 2WPDG 1HW7A 1PP9H 3SYQA 1SQFA 2QM4A 1AJQA 1BCCH 4Z1VA 2Q69A 3ZS8C 5IY5C 4FLTA 2QSAA 1UPGA 2Q0OC 3JASB 4MTOA 1RM1B 4GKJB 5JJNB 1HP8A 3ETDA 4JPRA 2QTOA 2LQTA 1BQ0A 3LUTB 2E5LB 1ZSPA 3HKDA 3RYIB 1JOYA 2MW2B 1GN3A 3KZIZ 1FPOA 4O2AA 3CX5F 1R3IC 4QGPA 1URFA 3E35A 4IIJB 5JCOC 3RYCB 4JGSA 3RGBA 4ZOLB 1RM1C 1IVSA 1HDJA 1JFFA 1KECA 2Z0AA 1P49A 4LC1A 5B5EZ 4TV8A 4O4HB 5JVDB 4B7KA 4HNAA 3KKYA 2X6CA 4J7JA 1SQPH 1U96A 3G80A 2IBZH 2P7TC 1Q81W 4J7KA 3RYFB 5B66Z 2HR3A 1F51A 3TGUH 4YY3B 1DGSA 3QO5A 2OYQA 2H3OA 1EBOA 4NTYA 4UCVA 1V55B 1OHHG 4K8ZA 4BIUA 1NS1A 2CUGA 3CCLV 1B3QA 3DC6A 4OPAA 1IBKB 3B8MA 2VQFO 1B6QA 2CTPA 4TOIA 1SESA 1JR9A 2H94A 4JYAB 4ZKIA 3WFVA 1V55C 3E22B 3ABKB 5L3CA 2N05A 4WF9V 1Q5OA 2ETNA 2GUZB 3N2KB 1YXBA 2BTOA 4DV7B 1KC8W 2QGNA 2WLLA 3ZIAG 5CBHA 2IH3C 3E8HA 4LF8B 4MVOA 1SF9A 3JAMN 5K1PA 5CB4A 5BMVA 4Z2WA 3ABKC 3TK1A 1NU1H 4TWKA 5L3DA 1P4RA 4K3AA 1RFYA 3PJSK 1N4CA 3L74H 1LUWA 1M90W 3E8GA 1VQKV 1Q6UA 3SJCC 3L70H 4MW8A 5CA0A 3QG5A 1QLEC 5CA3A 1SKVA 3FFQA 3CCUV 4K0KO 3MHHC 1VP7A 1I94B 3CJHA 2Y4UA 1MSDA 1VQ6V 5LXTA 2UXDB 1YIJV 2CE4A 2HKOA 3ABTA 3P30A 1UJWB 1Q6HA 3RWRD 1RP3B 4KXRA 4DUYO 4MSWC 3ZHTA 3TXQA 5IYCO 1XMQO 4R6ZA 2EIKB 3E89A 3WB1A 1T5EA 4O4JB 4FLUA 2QEXV 5C8YA 1QVFU 1FD9A 4TT3G 2Q73A 2YIAA 4DK1A 4FLWA 4X62B 4X65B 4BIOA 3JD4A 1I7FA 1W59A 3JD2A 4WFFA 2B1GA 3CEIA 4TUYB 4NKGB 4CS2A 1D2DA 1PL4A 2ATKC 4X1YB 2HHHB 2UXCO 4D7SA 2EIKC 2B9ZA 1RSOA 4OX9O 5HFLA 3SYCA 1K7DA 2XAJA 3LSQA 4DV1O 4TQDA 4AHCA 5LMNB 5LA6A 3O65A 1HNWO 1SERA 1F23A 5ITZB 1GM9A 3P3PA 1D5AA 1MG1A 2LP7A 2QTSA 4DUZO 1AI5A 3T1CA 2GSMB 5JH7A 3DGEA 2IH1C 4O4IA 3H1IH 2ZXWB 4LFBB 5CN0A 5J2UB 3IAYA 4E4EA 2Y0PA 3RT3C 4HBNA 4LFCO 2FL4A 4X1KA 1Y6XA 1YF2A 2M6YA 2DW4A 1HR0B 5EIBD 5LP6B 1X59A 1IZ3A 1SC5B 2WLIB 5LYJB 4JV5B 3JARB 3CSXA 2ZXWC 1YTFB 4YHHO 4O2BB 1W2BU 2RNBA 1VQMV 2BSKA 3F5WC 1JVMA 1J95A 5EYPB 2JS3A 2ADQB 3CRCA 3X2QB 4DV0O 1IBMB 4DO2A 3JAKA 1B06A 1Z5WA 1PNMA 1XQ8A 1FFTB 5LP6C 3FYIB 3UT5A 5A2QN 2F4VO 3JAWA 4ZHQA 1KMIZ 3X2QC 4BW5A 5KX5A 1KD1W 3UO2A 3SGIA 1QQCA 5EBMC 4FLZA 4YJ3A 2KSDA 1BHBA 4DRXA 3LDCA 1WAZA 1AP6A 1VQLV 1YTFD 2A3QA 3RYHB 2EZOA 2XAFA 3T1YO 3DC5A 2A0LA 1YCIA 5BY1A 2ZE5A 2AGAA 2GV9A 5KA6A 1WPXA 2UXXA 4JI5B 4LF9B 3MD0A 2E76B 5JCOA 3JASA 4G27B 3WU2Z 1ZLZA 5D5PA 1M1KW 4JTAB 1MA1A 4LCUC 4UCRA 4U3JB 4LR3A 2Y69B 3BA9A 4X66O 3RYIA 4DR2O 4WBNB 1GAXA 5LGUA 4LF7B 4H0LB 1RPRA 1QU7A 4Q6GA 5C93A 3NXSA 4DW1A 3RYCA 4QNHB 4ZOLA 3G67A 3CE2A 1XOUA 3BPZA 1D5NA 1YITV 4B3RO 4CS4A 2RQ6A 2DWEC 1SRYA 3M8AA 1AROP 4JI4O 3AG4B 1IXMA 2Y69C 2EIJC 4O4HA 5JVDA 5EZYB 3A0RA 4LWSB 3ICXA 3S3XA 4CZZA 1Y76B 3RYFA 4X64O 4LH6A 2W6IG 3SPHA 1R3KC 3OD4A 4X9QA 2N04A 3QO8A 2P22C 4OXSA 3AG4C 1NVPB 2ITDC 3CMEV 4DR3O 3OGCC 1FAFA 2QR4A 2NLJC 4H33A 4WFBV 4CC6A 4DV2B 3HKEB 3IGAC 2P5OA 2C2AA 5GTHZ 1S0VA 2L6LA 4CH5A 3K59A 1WJZA 4K35A 3J80N 1PKXA 2DQ3A 2LFRA 3WG7C 4JI3O 3SJBC 3LSUA 1HNZB 5IYZB 2VQEB 4HAMA 3E86A 1EM1A 1N34B 3JALB 3FYEB 3WB2A 1RPOA 3OE7G 1K5QA 3E22A 1Y67A 3ZRWB 2R9AA 2R9RB 2YXLA 2UUAO 1H38A 3AG2C 1YJWV 2GUZA 3ZRVA 4NB5A 1SQVH 3FB7C 3N2KA 1AI7A 3CXHF 4NTWA 1MABG 1F4MA 3ZRXA 1XL4A 3K5OA 4YIOA 3KCXA 2FYUH 1XNRB 2PTMA 2QE7G 1TUEB 5KHHA 2A9HA 4PJ0Z 2L35A 2OT5A 2QM7A 2QWOB 3TXSA 3HKCB 1MNGA 4B3TB 3CRMA 2UU9B 2ZR2A 3E83A 4PA6A 1AR5A 2Z3YA 1GK9A 4UXNA 4B3MO 1XNQB 2VWJA 2CTWA 1YI2V 3JSLA 3VQYA 3L73H 4RAIA 4XDJA 2ZM6B 3L71H 1DK1A 1NH2B 2Q68A 2Q0AA 3H1JH 3IC9A 4PDMA 3SJQC 1N8RW 2JEUA 3CCRV 4GX2A 2BE3A 4O4JA 4AQYB 3ZN1A 3W7XA 1THZA 2WLMA 4JI7B 1QBZA 3ZBHA 4MVSA 4DV6B 1BZKA 1LR1A 2EJ7A 4TUYA 2QKSA 3OT7A 5KHGA 2X7RB 4X1YA 4GKKO 3G6BA 4UB6Z 1JQ0A 2OIEA 3ML0A 5B1OA 2EINB 3MDSA 1NR1A 1GN2A 4QJFB 5ITZA 2JEXA 3T1HO 4DR7O 3R65A 2LW1A 5H5NA 3K03A 2GTSA 2Q7GA 4UVCA 2ZDIC 4DR4O 4DR1B 3CRRA 2EINC 3QF7A 2IM9A 2DWDC 1LNQA 3D8CA 3FB6C 1N32B 5J2UA 1EN5A 4NXMB 4DV3B 2UXBB 1Y74B 4PI0A 2CGOA 4FFKA 3BCCH 4DV5B 3ZHUA 3SYPA 2CGNA 5LP6A 3SPGA 2Q8VA 2WLIA 5LYJA 3JARA 1ZX3A 1YZBA 1N33O 4O2BA 3RN4A 1L0NH 2ILMA 4P9OA 3ASNC 2BOCC 3ZJZA 3B77A 5EYPA 4FM1A 1Z2GA 2Q4PA 2UXNA 3AK3A 1EZVH 4JF3A 1IDSA 4IGGA 4J11A 3N27A 2YI8A 4IYHA 1L8DA 2OCHA 5TISZ 4UCUA 1N36O 4PHZA 3OTOB 4GCZA 2WA3A 1YEWA 1YHQV 4FM0A 4A5UB 1Y66A 1IBLB 4JI8B 1AR4A 2IU0A 1P7GA 2V1DA 4AILC 3RYHA 3J7AU 3THOA 1AI4A 2PZSA 1GN4A 2ZD9A 2YXYA 5J2TB 4DR5O 1IXBA 2Q5ZA 3ZMVA 3F7VC 1WP8A 5JQGB 4GLXA 3RBZA 1QR8A 2YIBD 1JCHA 1W0JG 3AEIA 2HJFC 1AR1B 2QM8A 1EFRG 1HNXB 5HFMA 1AILA 2UUCO 1I5YA 3K9SA 4U3JA 4JI1B 5D5QA 5JJEB 2XNDG 4WBNA 4JI2B 4FLYA 1J5EB 4PI2A 1EN4A 1OCCB 3C3SA 2F23A 1U97A 1PNKA 5E1AC 1AJNA 1MSWD 4GKJO 2ZINA 4FLVA 2QWQB 4JTCB 2E5LO 1ENVA 2CTRA 1COWG 4WFGA 5EZYA 5IWAB 4LWSA 5B1NA 1VQPV 4FMTA 4P9PA 3JD0A 4PD4F 4K0KB 5L3GA 1Y76A 3LSSA 1OCCC 1CP9A 1GM8A 5BR8B 2W0XA 4JI0O 4PA4A 2KQXA 1US6A 2JGUA 2GHYA 5L3EA 1M57B 3GWKC 1QCEA 2UUBB 1H2KA 5KHKA 3F5TA 5KUKA 2XUMA 3HKEA 2CTQA 3CWBH 3WB0A 4R8CA 4LF5B 1PM9A 4YY3O 5E79Z 2ZIMA 1K8AW 1TVKB 5LGTA 2JDIG 3ZMSA 5B1AB 2YXHA 1M57C 2EBOA 3CP1A 5IYZA 1SZTA 3A0HZ 1SQXH 3JALA 4KFMA 1Q43A 4CH6A 3ZX6A 3ZRWA 3UKMA 3FB8C 3RFRA 4D6TH 4UVBA 1IBKO 5DECA 3E8FA 1OCRB 4WFEA 2ADPA 3MHSC 5B1AC 1WB8A 2QWNB 4P30A 4C7UA 4LF4B 2F43G 2AHZA 4OGQB 4I4TB 4FIPC 1BT8A 3HPLC 3U0ZA 1H8HG 1OJHA 5JJJB 5K1XA 4I55B 3ABMB 1NQTA 3HKCA 2GTAA 2HEPA 3AG1B 2LGQA 1OCRC 3CPWU 3OEEG 2FTKA 4LF6B 1Y4MA 1I08A 2DN9A 1FJGB 4LBEC 3JD1A 4LF8O 1P7BA 1DLBA 1L1FA 1SQGA 2XASA 1VQNV 4J80A 4KHPO 4NVPA 3OMAB 2EJRA 3OGIB 3AG1C 4R50A 5A9GA 1VARA 1S77D 4BIZA 4UCTA 2DE0X 3FAVB 2PF4E 4R7CA 4U7OA 3H1KH 1ZTEA 2V4DA 1CPYA 2YIDA 4JZ2A 1I94O 1SQBH 3ZMUA 2ZE7A 5EIBC 3CRQA 3C90A 2UXDO 4FLXA 2F4VB 4JASA 1MMMA 1WA8B 1G4YB 4DV4B 1WB7A 5H6RA 4F4LA 2R70A 5LMUB 4X1IB 3ZRSA 5KMGB 2ZDIA 1BE3H 1K92A 1BL8A 3OUSA 4J41A 1WNSA 2W0FC 4NXNB 1S3JA 1K9MW 4X62O 1XMOB 4X65O 2XAQA 3CCEV 3SJAC 1BS3A 4YJ2B 2XHBA 3H1HH 5LOVB 2WSSG 4NYKA 2HHHO 4L87A 2PI5A 2EX3A 2V7QG 3GVMA 1X4TA 2EILB 5LMNO 4MT8A 2XAGA 5DM6V 1Y74A 3P32A 1KUQA 4AI8A 4DR6O 3CCJV 1JX9A 4O4LB 1JPXA 2Q9LA 2AHYA 3JATB 2EILC 2D2CB 4LFBO 2JRIA 1PD3A 3IFXA 4K8XA 1K33A 4NR1A 4P2ZA 4QPJA 1HR0O 1TUBB 4JV5O 4DR3B 2JK5C 5CA1B 1M56B 4EEQA 2A7WA 1GM7A 1SZXA 1IBMO 3OM3B 3G6EV 3KCYA 4IIJA 5IE9A 3ZMZA 1VQ4V 1H2LA 3ABUA 2VS0A 2AXTZ 1E79G 3SPCA 1Q7YW 2CK3G 5J2TA 1M56C 2MK3A 5FPRA 1A32A 5JQGA 3O9OA 4OPHA 1W0KG 3K06A 2Q7HA 2ZIOA 4W4KA 3E8BA 5GTIZ 4F6RB 1ORQC 4RUEA 3EHBB 3CRAA 1K5SA 2RJZA 2CH7B 5EBLC 2WLKA 4Z1MG 4LF9O 4LFAB 4IT5A 3ZHRA 1Q3EA 1KBHA 3DXRB 3T2MA 3ZN0A 2RDCA 4I50B 2IW5A 2B5UA 4RQFA 1N0NA 5EBWC 1S76D 3BFRA 2H8PC 4LF7O 4UVAA 1FXHA 4G28B 2JJ2G 1BSMA 4G2KA 3UO3A 1XHZA 4FM2A 4FPPA 3GB7C 1GN6A 1YJ9V 3F7YC 2NNUA 1NBMG 4FJCC 1VEWA 2D3OW 4H13B 4GX5A 1R6KA 4B3SB 4X89A 1SA0B 5H6QA 1V54B 2AW9A 1R1BA 3B2EE 5B1BB 2X0LA 4D7TA 1VIBA 4H37A 3VBBA 1S5LZ 3RVZA 4LP8A 5JWPA 1QVGU 5KHIA 4JYBA 3AG7A 1G1XB 3K5MA 1TVKA 2P90A 3W7SA 2DJVA 1V54C 2JVDA 5KHJA 5B1BC 2WLNA 2F95B 2YUAA 3VQWA 4DV2O 4FFBB 1GKFA 1KKCA 1VQ7V 3APQA 2P4VA 4UV9A 4UCSA 4MVMA 1BGYH 2WAMA 4JI6O 1NZ6A 1HNZO 3L75H 2VQEO 2DYSB 1L0LH 1JJOA 4I4TA 1N34O 1R73A 4NTXA 4DR7B 1FXKB 1P84F 3I55V 4I55A 2ZCEA 1EN6A 2FKXA 3K79A 4BAYA 3LDEA 5IYDO 4PDVA 3QNEA 3QVNA 2Q6AA 2JGDB 3OR7C 3HR0A 1ROPA 1XDCA 1S5JA 2QA4V 3APOA 4UUJC 5LHIA 4YXWG 2WA4A 4U3FH 1KYOF 1V9PA 2ZNJA 1XNRO 1GRJA 3CC4V 2N74A 3BEHA 3AK1A 1FXKC 2A79B 1WLEA 3ZHVA 3B09A 4MVUA 3BRCA 4LNUB 5J9PC 1Q6IA 2X6AA 4B3TO 1WP7A 3CD6V 3FAVA 2HFEC 3Q4HB 4DW0A 3K5NA 2ZE8A 4ZI7B 4FZ0A 3I5DA 5LHHA 4DK0A 3BABA 1FFXB 2PGGA 2QKAA 3SYAA 3A2FA 2ZM6O 2YEVB 2R72A 5FNVB 1LUVA 1WA8A 1G8MA 3CC2V 4EB6B 4FK5C 3SPJA 1OCZB 3VQXA 2LGWA 4X1IA 3PN1A 3K57A 3D36A 5KMGA 5L3FA 3W7TA 4AQYO 2Q67A 5IJ9B 3ZMTA 3W7WA 3TJTA 2KG7B 5FLXN 4JI7O 1OCZC 1I0HA 3OUFA 4PV1B 1H2SB 1ZWIC 2YS8A 2ZQMA 5CBGA 4YJ2A 4E2LA 4DV6O 1QHTA 4MVZA 5LOVA 2DOSA 5LGNA 2HG5C 4MTFA 1H2NA 1FS0G 2ZNIA 2Y4TA 2QKCA 2YSUB 3D3IA 1OZ0A 5CMUA 4JAUA 4I9QA 1M9NA 1CXZB 3UCSC 4WFAV 4O4LA 4KUMA 3L72H 3JATA 2G38A 1ZL8B 2VQFB 4IL6Z 4DR1O 4IHJB 4J10A 3LNMB 3G71V 2P4KA 1N32O 4NXMO 4DV3O 2XOKG 2YDEA 1VF6C 1R6TA 2UXBO 3OW2U 2HVKC 4DV5O 4RO2A 1H2GA 3K9AA 1TUBA 2F66C 4JI0B 3CCMV 3K08A 3C3TA 5F2VO 5CA1A 3OMIB 5GW7A 3ETGA 1BMFG 4F6EA 3T4ZA 3OMNB 1VQOV 3K58A 4ZBMA 2OCCB 1GMGA 3VOUA 2IJKA 2LJ2A 4RUFA 3TETA 1YDXA 1NR7A 4DXWA 5KA5A 3SDLA 4XDKA 3OEHG 4MW3A 3OTOO 1HWYA 1NI8A 1KB9F 1K34A 2XT9A 1TGOA 4EFBA 1IBLO 4JI8O 1XBLA 2OCCC 2WLHA 4L8JA 3NR7A 2YC0A 5IYBO 1OV9A 2BTQB 2RN9A 4TQFA 4F6RA 2VRZA 3I56V 2LFSA 4DUYB 2CH7A 2EZPA 3S3WA 1FKAO 4TV9B 1XI1A 1XMQB 4WCEV 3K0GA 2E74B 1HNXO 3DXRA 1OCOB 3EXAA 4I50A 1MOFA 2K9PA 4JI1O 3OAAG 2OTLV 1QNMA 1ZAUA 4JI2O 2QWPB 5KLVH 2A06H 3UQ8A 1QLEB 1J5EO 2JS5A 4I0XB 3G4SV 2DMXA 2HJDA 1NKDA 1JMKC 3GWOA 1H8EG 4UB8Z 2ZE6A 3VQVA 1KQSU 4KHPB 4OX9B 2UXCB 1OCOC 1WPBA 3H01A 3JYCA 2ARHA 4UV8A 4CC5A 2PYLA 1K4CC 2HLDG 4DV1B 3N2GB 1S5HC 1F4NA 5LL6Y 1SA0A 1HNWB 1KU9A 4JZGA 5IWAO 3B8NA 4JYAO 1XREA 2ITCC 4UFZA 4DUZB 4CS3A 5B3SB 3CCVV 1AI6A 5BR8O 5IDJA 1IX9A 3HKBB 3LNNA 1SETA 5GONB
chains in the Genus database with same CATH topology
2BCCH 1SQQH 3L74H 3H1HH 3L73H 3H1LH 3TGUH 3H1KH 3L70H 1BGYH 3CX5F 1EZVH 3L71H 1NTZH 1BE3H 1SQXH 5KLVH 4U3FH 1SQBH 1KYOF 2A06H 3L72H 1SQVH 3BCCH 1PPJH 3CXHF 1NTKH 3H1IH 3L75H 1NTMH 1L0LH 1KB9F 1PP9H 3CWBH 4PD4F 1NU1H 2FYUH 3H1JH 1SQPH 1BCCH 4D6TH 1P84F 1L0NH 2IBZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCC H;  1SQQ H;  3L74 H;  3H1H H;  3L73 H;  3H1L H;  3TGU H;  3H1K H;  3L70 H;  1BGY H;  3CX5 F;  1EZV H;  3L71 H;  1NTZ H;  1BE3 H;  1SQX H;  5KLV H;  4U3F H;  1SQB H;  1KYO F;  2A06 H;  3L72 H;  1SQV H;  3BCC H;  1PPJ H;  3CXH F;  1NTK H;  3H1I H;  3L75 H;  1NTM H;  1L0L H;  1KB9 F;  1PP9 H;  3CWB H;  4PD4 F;  1NU1 H;  2FYU H;  3H1J H;  1SQP H;  1BCC H;  4D6T H;  1P84 F;  1L0N H;  2IBZ H; 
#chains in the Genus database with same CATH topology
 1AP5 A;  4DV7 O;  2GBO A;  3CB2 A;  4YIP A;  4PA9 A;  2UUB O;  4LFC B;  4MS2 A;  4MVQ A;  4FFB A;  4I7Z B;  3ABM C;  5B3S C;  4LF5 O;  3W7U A;  1Q86 W;  5LBQ A;  3FB5 C;  2P6J A;  4YHH B;  5IT9 N;  3BA8 A;  4GYC B;  3KG2 A;  3TCU A;  1PNL A;  4IYI A;  1TA8 A;  4DV0 B;  5DN6 G;  3A0B Z;  1DF5 A;  1FXK A;  2ZT9 B;  3J81 N;  3K5L A;  2KKW A;  2X6B A;  1GO3 F;  2JGD A;  4X20 B;  2XAH A;  3HB3 B;  3JSN A;  3UM7 A;  4LF4 O;  5IJ0 B;  3QTC A;  1AVM A;  5H9C A;  2B1I A;  4BR6 A;  3IC7 A;  2EIM B;  4DR6 B;  5FL7 G;  1BHA A;  2Y48 A;  4U7N A;  4UCO A;  4QE9 A;  2FML A;  3T1Y B;  4LNU A;  3DTU B;  4QIW F;  1NTM H;  4Q20 A;  4JAA A;  4MTG A;  4LF6 O;  3Q4H A;  3R66 A;  4ICG A;  3K0D A;  1FJG O;  4ZI7 A;  3OTF A;  1M5I A;  2EIM C;  2HVJ C;  2PYJ A;  1FFX A;  4PA7 A;  4EKW A;  4N21 A;  4B08 A;  4CH3 A;  2JJ1 G;  1E1Q G;  3ASO B;  2M7W A;  3D36 C;  2F1M A;  4J7Z A;  4X66 B;  4DR2 B;  2YEV A;  3K04 A;  5FNV A;  3EFF K;  2LO1 A;  3ZCC A;  2QWR B;  4MVR A;  4EB6 A;  2LW7 A;  1DF4 A;  3ZED A;  5EC1 C;  4XBF A;  4B3R B;  3CCQ V;  1KP2 A;  1MZF A;  4JI4 B;  3ASO C;  4X88 A;  1Q8I A;  4EFE A;  4ABM A;  2NR5 A;  3B40 A;  3HKD B;  5IJ9 A;  3B4S A;  4TSF G;  1XIL A;  1M93 A;  1QR9 A;  4O2A B;  4BW9 A;  3STL C;  4DV4 O;  2KG7 A;  3ZHS A;  3FX7 A;  2O57 A;  2YIC A;  2P67 A;  1CEZ A;  4X64 B;  4RQE A;  5LMU O;  2YIB A;  4W4L A;  1JFF B;  4QPK A;  5CBF A;  3FD9 A;  1O9H A;  1YJN V;  4TV8 B;  4HNA B;  3CS5 A;  3BAA A;  4NXN O;  1ZUQ A;  5BXZ A;  1FYJ A;  1VF6 A;  1XMO O;  3T4D A;  3P3N A;  1VMG A;  1YVW A;  4GX1 A;  3SYO A;  4FZ1 A;  3H9V A;  1ZL8 A;  3AK2 A;  1R6N A;  5EC2 C;  4JI3 B;  4IHJ A;  2WWW A;  2GDS A;  2EIJ B;  4JYY A;  5DED A;  4KL1 A;  3AG3 B;  1FXV A;  1K3E A;  2OWO A;  2Y0I A;  2RMK B;  1TAE A;  4JYC A;  4PDR A;  1MZE A;  4ASU G;  2E75 B;  2UUA B;  5EK0 A;  4GUN A;  2ZKO A;  1B04 A;  2P06 A;  3OFN G;  2Q7E A;  1S72 V;  5AG2 A;  4MTX A;  1XL6 A;  2WLJ A;  3AG3 C;  4CBC A;  1BQZ A;  3ZHQ A;  1VQ9 V;  2AZ0 A;  4JI5 O;  3EVK A;  2FB5 A;  2IJJ A;  3WG7 B;  1QLN A;  3BY6 A;  1KP3 A;  1F7Y A;  4H44 B;  2WLL B;  4DYL A;  4B3M B;  5CB4 B;  5BMV B;  5LHG A;  2CAZ C;  3RVY A;  3JD3 A;  2EUL A;  4N23 A;  2RCV A;  3AG2 B;  2R9I A;  4ZIB A;  1VQ8 V;  2BTQ A;  3LDD A;  2PI4 A;  4JI6 B;  3FKS G;  3IJ4 A;  1AB3 A;  2PY5 A;  1Q82 W;  3SR2 C;  5CA0 B;  2QDO A;  1XHX A;  2DYR B;  3H1L H;  1EZJ A;  4TV9 A;  5KUM A;  1AJP A;  1Q90 D;  3CJH B;  4PDL A;  2KB1 A;  3ABL B;  1G6U A;  4JAV A;  1PL0 A;  5LXT B;  1GH6 A;  1NVP D;  3M99 B;  1WN7 A;  2DQ0 A;  2QJ1 A;  4GT1 A;  1SS3 A;  5KAF Z;  3JCZ A;  4JTD B;  3CHX A;  4I9W A;  4I0X A;  3RW0 A;  4WFH A;  2DYR C;  4J42 A;  1DTO A;  3CC7 V;  2OIG A;  4J9Y B;  4LFA O;  4GKK B;  1XUQ A;  3ABL C;  3CYO A;  3A8T A;  1H2M A;  3N2G A;  4PEL A;  5C8Y B;  1NTK H;  3D3Q A;  3U11 A;  1XEQ A;  1UFI A;  1KKD A;  3T1H B;  4XDL A;  4BWA A;  4HYO A;  4PA3 A;  1RSO B;  2W6J G;  2XTA A;  4DR4 B;  3HKB A;  1NT2 B;  5L3B A;  5GON A;  4CH4 A;  2IU3 A;  3BVO A;  4J9Z B;  2AZ2 A;  4B3S O;  5LA6 B;  2DYS C;  1JJ2 U;  5BZB A;  2ZR3 A;  2PUS A;  3L9D A;  4FVM A;  3K3W A;  4KP4 A;  2VWK A;  5KAI Z;  1VQ5 V;  1O9G A;  2BOB C;  1SQQ H;  4QE7 A;  5JH7 B;  3E2E A;  4X8A A;  4O4I B;  4HZ3 A;  1N0J A;  1N33 B;  1JA8 A;  3ETE A;  2UU9 O;  1PV0 A;  1VF5 B;  1NTZ H;  1K97 A;  2NN4 A;  2ODM A;  1R3J C;  1PPJ H;  3BHP A;  1K73 W;  3CXC U;  1K4D C;  4X1K B;  4GX0 A;  3QO7 A;  1XNQ O;  1M4U A;  1IUR A;  1GTO A;  1YSC A;  3M7M X;  3CMA V;  4X20 A;  1NH2 D;  1R3L C;  4LH7 A;  2K1E A;  2IJH A;  1N36 B;  1E1R G;  3STZ C;  4RWU A;  2BSK B;  5IJ0 A;  2JIZ G;  1NJI W;  2E3C A;  2Z5U A;  3JAK B;  5H2F Z;  2HP8 A;  5FPO A;  3U10 A;  3ETQ A;  1I5X A;  3JCU Z;  3CCS V;  3DSQ A;  2BCC H;  3UT5 B;  4GZR B;  4DR5 B;  3ASN B;  2IJI A;  3JAW B;  5IY5 B;  3OR6 C;  4ZHQ B;  3SPI A;  2YI9 A;  5KX5 B;  1VF7 A;  1Z5V A;  3MAQ A;  4B7E A;  2OTJ V;  2CDY A;  4YJ3 B;  4DRX B;  2UUC B;  2F93 B;  4I5S A;  2WPD G;  1HW7 A;  1PP9 H;  3SYQ A;  1SQF A;  2QM4 A;  1AJQ A;  1BCC H;  4Z1V A;  2Q69 A;  3ZS8 C;  5IY5 C;  4FLT A;  2QSA A;  1UPG A;  2Q0O C;  3JAS B;  4MTO A;  1RM1 B;  4GKJ B;  5JJN B;  1HP8 A;  3ETD A;  4JPR A;  2QTO A;  2LQT A;  1BQ0 A;  3LUT B;  2E5L B;  1ZSP A;  3HKD A;  3RYI B;  1JOY A;  2MW2 B;  1GN3 A;  3KZI Z;  1FPO A;  4O2A A;  3CX5 F;  1R3I C;  4QGP A;  1URF A;  3E35 A;  4IIJ B;  5JCO C;  3RYC B;  4JGS A;  3RGB A;  4ZOL B;  1RM1 C;  1IVS A;  1HDJ A;  1JFF A;  1KEC A;  2Z0A A;  1P49 A;  4LC1 A;  5B5E Z;  4TV8 A;  4O4H B;  5JVD B;  4B7K A;  4HNA A;  3KKY A;  2X6C A;  4J7J A;  1SQP H;  1U96 A;  3G80 A;  2IBZ H;  2P7T C;  1Q81 W;  4J7K A;  3RYF B;  5B66 Z;  2HR3 A;  1F51 A;  3TGU H;  4YY3 B;  1DGS A;  3QO5 A;  2OYQ A;  2H3O A;  1EBO A;  4NTY A;  4UCV A;  1V55 B;  1OHH G;  4K8Z A;  4BIU A;  1NS1 A;  2CUG A;  3CCL V;  1B3Q A;  3DC6 A;  4OPA A;  1IBK B;  3B8M A;  2VQF O;  1B6Q A;  2CTP A;  4TOI A;  1SES A;  1JR9 A;  2H94 A;  4JYA B;  4ZKI A;  3WFV A;  1V55 C;  3E22 B;  3ABK B;  5L3C A;  2N05 A;  4WF9 V;  1Q5O A;  2ETN A;  2GUZ B;  3N2K B;  1YXB A;  2BTO A;  4DV7 B;  1KC8 W;  2QGN A;  2WLL A;  3ZIA G;  5CBH A;  2IH3 C;  3E8H A;  4LF8 B;  4MVO A;  1SF9 A;  3JAM N;  5K1P A;  5CB4 A;  5BMV A;  4Z2W A;  3ABK C;  3TK1 A;  1NU1 H;  4TWK A;  5L3D A;  1P4R A;  4K3A A;  1RFY A;  3PJS K;  1N4C A;  3L74 H;  1LUW A;  1M90 W;  3E8G A;  1VQK V;  1Q6U A;  3SJC C;  3L70 H;  4MW8 A;  5CA0 A;  3QG5 A;  1QLE C;  5CA3 A;  1SKV A;  3FFQ A;  3CCU V;  4K0K O;  3MHH C;  1VP7 A;  1I94 B;  3CJH A;  2Y4U A;  1MSD A;  1VQ6 V;  5LXT A;  2UXD B;  1YIJ V;  2CE4 A;  2HKO A;  3ABT A;  3P30 A;  1UJW B;  1Q6H A;  3RWR D;  1RP3 B;  4KXR A;  4DUY O;  4MSW C;  3ZHT A;  3TXQ A;  5IYC O;  1XMQ O;  4R6Z A;  2EIK B;  3E89 A;  3WB1 A;  1T5E A;  4O4J B;  4FLU A;  2QEX V;  5C8Y A;  1QVF U;  1FD9 A;  4TT3 G;  2Q73 A;  2YIA A;  4DK1 A;  4FLW A;  4X62 B;  4X65 B;  4BIO A;  3JD4 A;  1I7F A;  1W59 A;  3JD2 A;  4WFF A;  2B1G A;  3CEI A;  4TUY B;  4NKG B;  4CS2 A;  1D2D A;  1PL4 A;  2ATK C;  4X1Y B;  2HHH B;  2UXC O;  4D7S A;  2EIK C;  2B9Z A;  1RSO A;  4OX9 O;  5HFL A;  3SYC A;  1K7D A;  2XAJ A;  3LSQ A;  4DV1 O;  4TQD A;  4AHC A;  5LMN B;  5LA6 A;  3O65 A;  1HNW O;  1SER A;  1F23 A;  5ITZ B;  1GM9 A;  3P3P A;  1D5A A;  1MG1 A;  2LP7 A;  2QTS A;  4DUZ O;  1AI5 A;  3T1C A;  2GSM B;  5JH7 A;  3DGE A;  2IH1 C;  4O4I A;  3H1I H;  2ZXW B;  4LFB B;  5CN0 A;  5J2U B;  3IAY A;  4E4E A;  2Y0P A;  3RT3 C;  4HBN A;  4LFC O;  2FL4 A;  4X1K A;  1Y6X A;  1YF2 A;  2M6Y A;  2DW4 A;  1HR0 B;  5EIB D;  5LP6 B;  1X59 A;  1IZ3 A;  1SC5 B;  2WLI B;  5LYJ B;  4JV5 B;  3JAR B;  3CSX A;  2ZXW C;  1YTF B;  4YHH O;  4O2B B;  1W2B U;  2RNB A;  1VQM V;  2BSK A;  3F5W C;  1JVM A;  1J95 A;  5EYP B;  2JS3 A;  2ADQ B;  3CRC A;  3X2Q B;  4DV0 O;  1IBM B;  4DO2 A;  3JAK A;  1B06 A;  1Z5W A;  1PNM A;  1XQ8 A;  1FFT B;  5LP6 C;  3FYI B;  3UT5 A;  5A2Q N;  2F4V O;  3JAW A;  4ZHQ A;  1KMI Z;  3X2Q C;  4BW5 A;  5KX5 A;  1KD1 W;  3UO2 A;  3SGI A;  1QQC A;  5EBM C;  4FLZ A;  4YJ3 A;  2KSD A;  1BHB A;  4DRX A;  3LDC A;  1WAZ A;  1AP6 A;  1VQL V;  1YTF D;  2A3Q A;  3RYH B;  2EZO A;  2XAF A;  3T1Y O;  3DC5 A;  2A0L A;  1YCI A;  5BY1 A;  2ZE5 A;  2AGA A;  2GV9 A;  5KA6 A;  1WPX A;  2UXX A;  4JI5 B;  4LF9 B;  3MD0 A;  2E76 B;  5JCO A;  3JAS A;  4G27 B;  3WU2 Z;  1ZLZ A;  5D5P A;  1M1K W;  4JTA B;  1MA1 A;  4LCU C;  4UCR A;  4U3J B;  4LR3 A;  2Y69 B;  3BA9 A;  4X66 O;  3RYI A;  4DR2 O;  4WBN B;  1GAX A;  5LGU A;  4LF7 B;  4H0L B;  1RPR A;  1QU7 A;  4Q6G A;  5C93 A;  3NXS A;  4DW1 A;  3RYC A;  4QNH B;  4ZOL A;  3G67 A;  3CE2 A;  1XOU A;  3BPZ A;  1D5N A;  1YIT V;  4B3R O;  4CS4 A;  2RQ6 A;  2DWE C;  1SRY A;  3M8A A;  1ARO P;  4JI4 O;  3AG4 B;  1IXM A;  2Y69 C;  2EIJ C;  4O4H A;  5JVD A;  5EZY B;  3A0R A;  4LWS B;  3ICX A;  3S3X A;  4CZZ A;  1Y76 B;  3RYF A;  4X64 O;  4LH6 A;  2W6I G;  3SPH A;  1R3K C;  3OD4 A;  4X9Q A;  2N04 A;  3QO8 A;  2P22 C;  4OXS A;  3AG4 C;  1NVP B;  2ITD C;  3CME V;  4DR3 O;  3OGC C;  1FAF A;  2QR4 A;  2NLJ C;  4H33 A;  4WFB V;  4CC6 A;  4DV2 B;  3HKE B;  3IGA C;  2P5O A;  2C2A A;  5GTH Z;  1S0V A;  2L6L A;  4CH5 A;  3K59 A;  1WJZ A;  4K35 A;  3J80 N;  1PKX A;  2DQ3 A;  2LFR A;  3WG7 C;  4JI3 O;  3SJB C;  3LSU A;  1HNZ B;  5IYZ B;  2VQE B;  4HAM A;  3E86 A;  1EM1 A;  1N34 B;  3JAL B;  3FYE B;  3WB2 A;  1RPO A;  3OE7 G;  1K5Q A;  3E22 A;  1Y67 A;  3ZRW B;  2R9A A;  2R9R B;  2YXL A;  2UUA O;  1H38 A;  3AG2 C;  1YJW V;  2GUZ A;  3ZRV A;  4NB5 A;  1SQV H;  3FB7 C;  3N2K A;  1AI7 A;  3CXH F;  4NTW A;  1MAB G;  1F4M A;  3ZRX A;  1XL4 A;  3K5O A;  4YIO A;  3KCX A;  2FYU H;  1XNR B;  2PTM A;  2QE7 G;  1TUE B;  5KHH A;  2A9H A;  4PJ0 Z;  2L35 A;  2OT5 A;  2QM7 A;  2QWO B;  3TXS A;  3HKC B;  1MNG A;  4B3T B;  3CRM A;  2UU9 B;  2ZR2 A;  3E83 A;  4PA6 A;  1AR5 A;  2Z3Y A;  1GK9 A;  4UXN A;  4B3M O;  1XNQ B;  2VWJ A;  2CTW A;  1YI2 V;  3JSL A;  3VQY A;  3L73 H;  4RAI A;  4XDJ A;  2ZM6 B;  3L71 H;  1DK1 A;  1NH2 B;  2Q68 A;  2Q0A A;  3H1J H;  3IC9 A;  4PDM A;  3SJQ C;  1N8R W;  2JEU A;  3CCR V;  4GX2 A;  2BE3 A;  4O4J A;  4AQY B;  3ZN1 A;  3W7X A;  1THZ A;  2WLM A;  4JI7 B;  1QBZ A;  3ZBH A;  4MVS A;  4DV6 B;  1BZK A;  1LR1 A;  2EJ7 A;  4TUY A;  2QKS A;  3OT7 A;  5KHG A;  2X7R B;  4X1Y A;  4GKK O;  3G6B A;  4UB6 Z;  1JQ0 A;  2OIE A;  3ML0 A;  5B1O A;  2EIN B;  3MDS A;  1NR1 A;  1GN2 A;  4QJF B;  5ITZ A;  2JEX A;  3T1H O;  4DR7 O;  3R65 A;  2LW1 A;  5H5N A;  3K03 A;  2GTS A;  2Q7G A;  4UVC A;  2ZDI C;  4DR4 O;  4DR1 B;  3CRR A;  2EIN C;  3QF7 A;  2IM9 A;  2DWD C;  1LNQ A;  3D8C A;  3FB6 C;  1N32 B;  5J2U A;  1EN5 A;  4NXM B;  4DV3 B;  2UXB B;  1Y74 B;  4PI0 A;  2CGO A;  4FFK A;  3BCC H;  4DV5 B;  3ZHU A;  3SYP A;  2CGN A;  5LP6 A;  3SPG A;  2Q8V A;  2WLI A;  5LYJ A;  3JAR A;  1ZX3 A;  1YZB A;  1N33 O;  4O2B A;  3RN4 A;  1L0N H;  2ILM A;  4P9O A;  3ASN C;  2BOC C;  3ZJZ A;  3B77 A;  5EYP A;  4FM1 A;  1Z2G A;  2Q4P A;  2UXN A;  3AK3 A;  1EZV H;  4JF3 A;  1IDS A;  4IGG A;  4J11 A;  3N27 A;  2YI8 A;  4IYH A;  1L8D A;  2OCH A;  5TIS Z;  4UCU A;  1N36 O;  4PHZ A;  3OTO B;  4GCZ A;  2WA3 A;  1YEW A;  1YHQ V;  4FM0 A;  4A5U B;  1Y66 A;  1IBL B;  4JI8 B;  1AR4 A;  2IU0 A;  1P7G A;  2V1D A;  4AIL C;  3RYH A;  3J7A U;  3THO A;  1AI4 A;  2PZS A;  1GN4 A;  2ZD9 A;  2YXY A;  5J2T B;  4DR5 O;  1IXB A;  2Q5Z A;  3ZMV A;  3F7V C;  1WP8 A;  5JQG B;  4GLX A;  3RBZ A;  1QR8 A;  2YIB D;  1JCH A;  1W0J G;  3AEI A;  2HJF C;  1AR1 B;  2QM8 A;  1EFR G;  1HNX B;  5HFM A;  1AIL A;  2UUC O;  1I5Y A;  3K9S A;  4U3J A;  4JI1 B;  5D5Q A;  5JJE B;  2XND G;  4WBN A;  4JI2 B;  4FLY A;  1J5E B;  4PI2 A;  1EN4 A;  1OCC B;  3C3S A;  2F23 A;  1U97 A;  1PNK A;  5E1A C;  1AJN A;  1MSW D;  4GKJ O;  2ZIN A;  4FLV A;  2QWQ B;  4JTC B;  2E5L O;  1ENV A;  2CTR A;  1COW G;  4WFG A;  5EZY A;  5IWA B;  4LWS A;  5B1N A;  1VQP V;  4FMT A;  4P9P A;  3JD0 A;  4PD4 F;  4K0K B;  5L3G A;  1Y76 A;  3LSS A;  1OCC C;  1CP9 A;  1GM8 A;  5BR8 B;  2W0X A;  4JI0 O;  4PA4 A;  2KQX A;  1US6 A;  2JGU A;  2GHY A;  5L3E A;  1M57 B;  3GWK C;  1QCE A;  2UUB B;  1H2K A;  5KHK A;  3F5T A;  5KUK A;  2XUM A;  3HKE A;  2CTQ A;  3CWB H;  3WB0 A;  4R8C A;  4LF5 B;  1PM9 A;  4YY3 O;  5E79 Z;  2ZIM A;  1K8A W;  1TVK B;  5LGT A;  2JDI G;  3ZMS A;  5B1A B;  2YXH A;  1M57 C;  2EBO A;  3CP1 A;  5IYZ A;  1SZT A;  3A0H Z;  1SQX H;  3JAL A;  4KFM A;  1Q43 A;  4CH6 A;  3ZX6 A;  3ZRW A;  3UKM A;  3FB8 C;  3RFR A;  4D6T H;  4UVB A;  1IBK O;  5DEC A;  3E8F A;  1OCR B;  4WFE A;  2ADP A;  3MHS C;  5B1A C;  1WB8 A;  2QWN B;  4P30 A;  4C7U A;  4LF4 B;  2F43 G;  2AHZ A;  4OGQ B;  4I4T B;  4FIP C;  1BT8 A;  3HPL C;  3U0Z A;  1H8H G;  1OJH A;  5JJJ B;  5K1X A;  4I55 B;  3ABM B;  1NQT A;  3HKC A;  2GTA A;  2HEP A;  3AG1 B;  2LGQ A;  1OCR C;  3CPW U;  3OEE G;  2FTK A;  4LF6 B;  1Y4M A;  1I08 A;  2DN9 A;  1FJG B;  4LBE C;  3JD1 A;  4LF8 O;  1P7B A;  1DLB A;  1L1F A;  1SQG A;  2XAS A;  1VQN V;  4J80 A;  4KHP O;  4NVP A;  3OMA B;  2EJR A;  3OGI B;  3AG1 C;  4R50 A;  5A9G A;  1VAR A;  1S77 D;  4BIZ A;  4UCT A;  2DE0 X;  3FAV B;  2PF4 E;  4R7C A;  4U7O A;  3H1K H;  1ZTE A;  2V4D A;  1CPY A;  2YID A;  4JZ2 A;  1I94 O;  1SQB H;  3ZMU A;  2ZE7 A;  5EIB C;  3CRQ A;  3C90 A;  2UXD O;  4FLX A;  2F4V B;  4JAS A;  1MMM A;  1WA8 B;  1G4Y B;  4DV4 B;  1WB7 A;  5H6R A;  4F4L A;  2R70 A;  5LMU B;  4X1I B;  3ZRS A;  5KMG B;  2ZDI A;  1BE3 H;  1K92 A;  1BL8 A;  3OUS A;  4J41 A;  1WNS A;  2W0F C;  4NXN B;  1S3J A;  1K9M W;  4X62 O;  1XMO B;  4X65 O;  2XAQ A;  3CCE V;  3SJA C;  1BS3 A;  4YJ2 B;  2XHB A;  3H1H H;  5LOV B;  2WSS G;  4NYK A;  2HHH O;  4L87 A;  2PI5 A;  2EX3 A;  2V7Q G;  3GVM A;  1X4T A;  2EIL B;  5LMN O;  4MT8 A;  2XAG A;  5DM6 V;  1Y74 A;  3P32 A;  1KUQ A;  4AI8 A;  4DR6 O;  3CCJ V;  1JX9 A;  4O4L B;  1JPX A;  2Q9L A;  2AHY A;  3JAT B;  2EIL C;  2D2C B;  4LFB O;  2JRI A;  1PD3 A;  3IFX A;  4K8X A;  1K33 A;  4NR1 A;  4P2Z A;  4QPJ A;  1HR0 O;  1TUB B;  4JV5 O;  4DR3 B;  2JK5 C;  5CA1 B;  1M56 B;  4EEQ A;  2A7W A;  1GM7 A;  1SZX A;  1IBM O;  3OM3 B;  3G6E V;  3KCY A;  4IIJ A;  5IE9 A;  3ZMZ A;  1VQ4 V;  1H2L A;  3ABU A;  2VS0 A;  2AXT Z;  1E79 G;  3SPC A;  1Q7Y W;  2CK3 G;  5J2T A;  1M56 C;  2MK3 A;  5FPR A;  1A32 A;  5JQG A;  3O9O A;  4OPH A;  1W0K G;  3K06 A;  2Q7H A;  2ZIO A;  4W4K A;  3E8B A;  5GTI Z;  4F6R B;  1ORQ C;  4RUE A;  3EHB B;  3CRA A;  1K5S A;  2RJZ A;  2CH7 B;  5EBL C;  2WLK A;  4Z1M G;  4LF9 O;  4LFA B;  4IT5 A;  3ZHR A;  1Q3E A;  1KBH A;  3DXR B;  3T2M A;  3ZN0 A;  2RDC A;  4I50 B;  2IW5 A;  2B5U A;  4RQF A;  1N0N A;  5EBW C;  1S76 D;  3BFR A;  2H8P C;  4LF7 O;  4UVA A;  1FXH A;  4G28 B;  2JJ2 G;  1BSM A;  4G2K A;  3UO3 A;  1XHZ A;  4FM2 A;  4FPP A;  3GB7 C;  1GN6 A;  1YJ9 V;  3F7Y C;  2NNU A;  1NBM G;  4FJC C;  1VEW A;  2D3O W;  4H13 B;  4GX5 A;  1R6K A;  4B3S B;  4X89 A;  1SA0 B;  5H6Q A;  1V54 B;  2AW9 A;  1R1B A;  3B2E E;  5B1B B;  2X0L A;  4D7T A;  1VIB A;  4H37 A;  3VBB A;  1S5L Z;  3RVZ A;  4LP8 A;  5JWP A;  1QVG U;  5KHI A;  4JYB A;  3AG7 A;  1G1X B;  3K5M A;  1TVK A;  2P90 A;  3W7S A;  2DJV A;  1V54 C;  2JVD A;  5KHJ A;  5B1B C;  2WLN A;  2F95 B;  2YUA A;  3VQW A;  4DV2 O;  4FFB B;  1GKF A;  1KKC A;  1VQ7 V;  3APQ A;  2P4V A;  4UV9 A;  4UCS A;  4MVM A;  1BGY H;  2WAM A;  4JI6 O;  1NZ6 A;  1HNZ O;  3L75 H;  2VQE O;  2DYS B;  1L0L H;  1JJO A;  4I4T A;  1N34 O;  1R73 A;  4NTX A;  4DR7 B;  1FXK B;  1P84 F;  3I55 V;  4I55 A;  2ZCE A;  1EN6 A;  2FKX A;  3K79 A;  4BAY A;  3LDE A;  5IYD O;  4PDV A;  3QNE A;  3QVN A;  2Q6A A;  2JGD B;  3OR7 C;  3HR0 A;  1ROP A;  1XDC A;  1S5J A;  2QA4 V;  3APO A;  4UUJ C;  5LHI A;  4YXW G;  2WA4 A;  4U3F H;  1KYO F;  1V9P A;  2ZNJ A;  1XNR O;  1GRJ A;  3CC4 V;  2N74 A;  3BEH A;  3AK1 A;  1FXK C;  2A79 B;  1WLE A;  3ZHV A;  3B09 A;  4MVU A;  3BRC A;  4LNU B;  5J9P C;  1Q6I A;  2X6A A;  4B3T O;  1WP7 A;  3CD6 V;  3FAV A;  2HFE C;  3Q4H B;  4DW0 A;  3K5N A;  2ZE8 A;  4ZI7 B;  4FZ0 A;  3I5D A;  5LHH A;  4DK0 A;  3BAB A;  1FFX B;  2PGG A;  2QKA A;  3SYA A;  3A2F A;  2ZM6 O;  2YEV B;  2R72 A;  5FNV B;  1LUV A;  1WA8 A;  1G8M A;  3CC2 V;  4EB6 B;  4FK5 C;  3SPJ A;  1OCZ B;  3VQX A;  2LGW A;  4X1I A;  3PN1 A;  3K57 A;  3D36 A;  5KMG A;  5L3F A;  3W7T A;  4AQY O;  2Q67 A;  5IJ9 B;  3ZMT A;  3W7W A;  3TJT A;  2KG7 B;  5FLX N;  4JI7 O;  1OCZ C;  1I0H A;  3OUF A;  4PV1 B;  1H2S B;  1ZWI C;  2YS8 A;  2ZQM A;  5CBG A;  4YJ2 A;  4E2L A;  4DV6 O;  1QHT A;  4MVZ A;  5LOV A;  2DOS A;  5LGN A;  2HG5 C;  4MTF A;  1H2N A;  1FS0 G;  2ZNI A;  2Y4T A;  2QKC A;  2YSU B;  3D3I A;  1OZ0 A;  5CMU A;  4JAU A;  4I9Q A;  1M9N A;  1CXZ B;  3UCS C;  4WFA V;  4O4L A;  4KUM A;  3L72 H;  3JAT A;  2G38 A;  1ZL8 B;  2VQF B;  4IL6 Z;  4DR1 O;  4IHJ B;  4J10 A;  3LNM B;  3G71 V;  2P4K A;  1N32 O;  4NXM O;  4DV3 O;  2XOK G;  2YDE A;  1VF6 C;  1R6T A;  2UXB O;  3OW2 U;  2HVK C;  4DV5 O;  4RO2 A;  1H2G A;  3K9A A;  1TUB A;  2F66 C;  4JI0 B;  3CCM V;  3K08 A;  3C3T A;  5F2V O;  5CA1 A;  3OMI B;  5GW7 A;  3ETG A;  1BMF G;  4F6E A;  3T4Z A;  3OMN B;  1VQO V;  3K58 A;  4ZBM A;  2OCC B;  1GMG A;  3VOU A;  2IJK A;  2LJ2 A;  4RUF A;  3TET A;  1YDX A;  1NR7 A;  4DXW A;  5KA5 A;  3SDL A;  4XDK A;  3OEH G;  4MW3 A;  3OTO O;  1HWY A;  1NI8 A;  1KB9 F;  1K34 A;  2XT9 A;  1TGO A;  4EFB A;  1IBL O;  4JI8 O;  1XBL A;  2OCC C;  2WLH A;  4L8J A;  3NR7 A;  2YC0 A;  5IYB O;  1OV9 A;  2BTQ B;  2RN9 A;  4TQF A;  4F6R A;  2VRZ A;  3I56 V;  2LFS A;  4DUY B;  2CH7 A;  2EZP A;  3S3W A;  1FKA O;  4TV9 B;  1XI1 A;  1XMQ B;  4WCE V;  3K0G A;  2E74 B;  1HNX O;  3DXR A;  1OCO B;  3EXA A;  4I50 A;  1MOF A;  2K9P A;  4JI1 O;  3OAA G;  2OTL V;  1QNM A;  1ZAU A;  4JI2 O;  2QWP B;  5KLV H;  2A06 H;  3UQ8 A;  1QLE B;  1J5E O;  2JS5 A;  4I0X B;  3G4S V;  2DMX A;  2HJD A;  1NKD A;  1JMK C;  3GWO A;  1H8E G;  4UB8 Z;  2ZE6 A;  3VQV A;  1KQS U;  4KHP B;  4OX9 B;  2UXC B;  1OCO C;  1WPB A;  3H01 A;  3JYC A;  2ARH A;  4UV8 A;  4CC5 A;  2PYL A;  1K4C C;  2HLD G;  4DV1 B;  3N2G B;  1S5H C;  1F4N A;  5LL6 Y;  1SA0 A;  1HNW B;  1KU9 A;  4JZG A;  5IWA O;  3B8N A;  4JYA O;  1XRE A;  2ITC C;  4UFZ A;  4DUZ B;  4CS3 A;  5B3S B;  3CCV V;  1AI6 A;  5BR8 O;  5IDJ A;  1IX9 A;  3HKB B;  3LNN A;  1SET A;  5GON B; 
#chains in the Genus database with same CATH homology
 2BCC H;  1SQQ H;  3L74 H;  3H1H H;  3L73 H;  3H1L H;  3TGU H;  3H1K H;  3L70 H;  1BGY H;  3CX5 F;  1EZV H;  3L71 H;  1NTZ H;  1BE3 H;  1SQX H;  5KLV H;  4U3F H;  1SQB H;  1KYO F;  2A06 H;  3L72 H;  1SQV H;  3BCC H;  1PPJ H;  3CXH F;  1NTK H;  3H1I H;  3L75 H;  1NTM H;  1L0L H;  1KB9 F;  1PP9 H;  3CWB H;  4PD4 F;  1NU1 H;  2FYU H;  3H1J H;  1SQP H;  1BCC H;  4D6T H;  1P84 F;  1L0N H;  2IBZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...