2BCCJ

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
59
structure length
59
Chain Sequence
TLTARLYSLLFRRTSTFALTIVVGALLFERAFDQGADAIYEHINEGKLWKHIKHKYENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 23
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1998-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 2bccJ00
1KB9I 5KLVJ 1SQBJ 3CX5I 2BCCJ 2IBZI 1BE3J 4PD4I 3L70J 3H1IJ 1NU1J 1SQQJ 4D6TJ 3L75J 3L71J 1L0LJ 1BGYJ 1NTMJ 1P84I 1PP9J 1BCCJ 3H1JJ 1SQVJ 3TGUJ 3BCCJ 3H1LJ 3H1KJ 3H1HJ 1KYOI 3L73J 1L0NJ 3CXHI 1SQPJ 1NTZJ 2FYUJ 3CWBJ 1NTKJ 4U3FJ 3L74J 3L72J 1EZVI 1SQXJ
chains in the Genus database with same CATH superfamily
4YTPC 1OVRA 1K73Q 3HTKA 4ASWA 1SFCA 1YI2P 1OWAA 1SQVG 2O01N 3L75D 2R5DA 1H88A 3L73G 5B66E 3CC2P 1N2DC 1JEKA 4PD4H 4AQRD 2L5GB 1KYOD 1JO5A 4RKUJ 4LLHA 2G3AA 1K8AQ 4OWFA 4DJGA 2XNXA 2WPRA 3OA7A 1VQ4P 3CXHE 1DD4A 1S1CX 2WQYC 3FWNA 3I56P 3II6A 2FYUJ 3HUSB 2KIKA 3G4SP 1AFOA 5AVXB 2WPSA 1JNMA 3L74D 4C7NB 3H1IJ 1BE3G 3I5CA 2YKPA 4GOEA 2R5BA 2K88A 3MUDC 3CMAP 1RQVA 2QM7A 2FY8A 3AEDC 1NOHA 1DD3A 1IFDA 1PGJA 1NTZG 2K37A 2YO3A 3CCRP 5KKZC 2KK7A 1L4AA 4YXDC 3O6QB 2NRGA 2YXQB 3B5ND 1GU5A 1HWTC 2OYIB 3CWBE 3L35A 3L70D 3Q1MA 2RN0A 3KPEA 1KTMA 1KB9I 1VPCA 1SQPD 2JR8A 1Y8AA 2NPSB 2FXOA 1UIXA 2FYUD 2OTLP 1RHZB 3H32B 1NU1D 1L0LD 1JY3O 1BE3E 3BRVB 1YYCA 3R2PA 2Q5UA 2OYHB 1OVUA 1NTZE 2QIWA 2POHA 3A0HE 2G8YA 2PFXA 2IBZG 1JY3N 1KQFB 4D6TE 3BVHA 3CX5D 4GDOA 3NTNA 4N78E 1SQVK 5AW5B 1S9KE 4NPEA 1H8AA 1JUNA 1FZFA 2Y9YA 3H1LJ 1PIXA 3VMAA 1KYOI 1SQBK 4JBZA 2H8PD 2B87B 3CCUP 3L71E 3M9BA 3KZIH 1N73B 4CPGA 1P84D 1M7LA 2K9JA 3GF3A 1GZLA 1KMIZ 3PHLA 4K35A 1KILD 2IX7C 4Y99C 1VQKP 2K3RA 5AW8B 5C39A 1L0NG 1SLQA 1FDMA 2R32A 2JEEA 1RF1B 2IBZE 4H44B 2PGDA 4PJ0H 1SQXD 2HPCB 5CBNA 1GK6A 2W27A 4OGQC 2E75D 3PP5A 3L75E 3M0DC 1H0TB 3CCJP 1R5SA 1GL2B 3P7KA 1YTZT 3VMYA 1KYOE 1BCCJ 5GTIE 1WMKA 3E1RA 3W67A 3RK3B 4XE5B 2XDJA 4EIJA 1PL5A 1PZQA 3CI9A 2B89A 4WY4C 5APTA 4H13B 1QVFO 1LWUA 2M3EA 3HE5B 2HLOA 3P8MC 1AVOA 2Q3IA 2QJYB 3CMEP 2AEJA 3L36A 1FZEA 1IK9A 3CX5I 5B66H 2IFMA 3RBZA 3SFEC 1Q90D 3MP7B 1EDIA 1LT1A 3RL0C 1YJ9P 3TSIA 3MIWA 1JCCA 1Z56A 1ZN5A 1LT9C 1ZR4A 1OZHA 1BGYD 3CXHH 1GMJA 1BCCD 2WZ7A 3L37A 1CI6A 5KAFE 4HJGH 3M0DA 4H0LC 1SQPE 2WSFJ 1QGKB 2FYUE 1P84I 3AECC 3RK2D 4JF7A 1EZVD 2V7QJ 3AE7C 3H1IE 3V2QA 3PTZA 2AXTE 3G71P 2WTYA 1Q7YQ 3MHVA 3HRNA 1L0NK 3KXDA 3IAOA 4JYCA 3EFGA 3BRTB 1FBMA 3JCUE 1JY2O 1HH0A 2H89C 2HR3A 1S2EA 4IFDK 5AW9B 3Q5PA 1L2PA 2XU6A 3B5NB 4KJMA 2QEXP 1J2JB 5APXA 3LW5H 1RH5B 1NHLA 2WVRA 3AE1C 3H1LG 2P7JA 3B4SA 3AE9C 1GTWA 5TISE 1LT9A 2R44A 1JY2N 4GIFA 5B5EE 1HJBA 3L72J 2LXCB 5AW0B 4YPCA 1N86A 3NFQA 2M5AB 1DIPA 4WBAA 2C9NY 2D2CC 3LIDA 3A0HH 3A5TA 2HG5D 3H1KG 2N9YB 1JMBA 2FXMA 5APYA 3GHGB 2KSEA 2IFNA 1T8ZA 2BEQD 1IFPA 3USSA 1R8EA 3TGUD 2E74D 5K5GB 1JCDA 3H1LE 2A06G 1M8OB 1VQ8P 1LTAC 3VN0A 3L72D 3L71J 1SQBD 5GTHE 3H25A 1NTMJ 2W8ZA 1USDA 2KLUA 2IZ0A 1JTHA 1LP1B 3V2RA 4GKGA 1BSHA 1NTKJ 2FKWB 1EZVI 1H89A 1VQOP 4R4MA 3KYQA 2OTJP 1SFCC 4EYYQ 3H1HJ 5KLVK 2OYOA 1NWQA 2NZ2A 1IK7A 3SFDC 1KILB 5CCHC 2R3SA 1BDCA 2QJKB 2ZYAA 5TJHA 1YIJP 5CHXA 1J1EB 2MJZA 1KYOH 5GTIH 5KLIB 2W6BA 1NTMD 1W5CE 2NPSC 1BGYE 2E75B 1BCCE 1J1DC 1PFIA 3PRJA 1BDDA 4MN4C 2I8DA 2Y0EA 2YO2A 1LTJB 3CCMP 3MZWB 2QJPC 5H2FE 2A45G 3MGNA 3SSUA 5BU8B 2O1JA 3HUSA 1SQQK 2Y0CA 3NXSA 1L4AC 3L74J 4XA4A 2ZVNB 3AE5C 2B9BA 3OJAB 3MTUE 2KUBA 2WSCH 5AVRB 1FJPA 1OW6A 3GW6A 2KLVA 3ABVC 1N7SC 4RO0A 2WSCJ 5KAIE 2C0XA 5AW2B 3CC7P 2KNCB 2ZT9D 1PGQA 3O6QA 1VF5B 2GA1A 2Q6QA 5KAFH 4XFJA 3CWBG 1Y47A 5CCHA 2JWAA 1NYHA 3L70J 2OYIA 3AE4C 2KS1B 2P1JA 2QSIA 1N73C 5AVVB 4N6JA 1YJNP 3P8CE 2BASA 2JO1A 1SQPJ 1FZBA 3M9HA 2KZIA 2NPSA 1DX7A 2AXTH 2LR2A 1NU1J 1Q86Q 1L0LJ 1FDIA 1RF1C 3RK2B 4H44C 4IFMA 4UB6E 3JCUH 1FOSF 3KQGA 5CMZA 4GOFA 2OYHA 1E5WA 4A7PA 1KQSO 2FFDC 1SS1A 2I1JA 1PPJD 4D6TG 3WMM0 2E76C 4I7ZB 1PP9D 3KDPB 2ZYDA 3BCCD 3PJSK 1N7SA 4OGQD 5TISH 3TDKA 5B5EH 3O8ZA 3PH0A 3JSVC 4JPZB 3M0AA 1HUCA 3FXEA 2C9LY 5E79E 1P84H 1LTSC 2XV5A 3L72E 3L71G 1SQBE 2B87A 2QVAA 1N73A 5AVSB 1HF9A 2H43A 3U1AA 1X9VA 3FGAD 4L75A 3ITKA 4EDFA 1FS0E 2P10A 2HODB 4WY4D 3H1HG 3H1JD 3C1LA 1RF1A 3CCVP 4YXWH 1SQXJ 2J5UA 3IR9A 2XZRA 4HB1A 3G6EP 3Q3DA 5CCGA 3GG2A 2FYNC 2M0BA 2FFDA 3L75G 5GTHH 5APWA 3TK1A 1VQLP 3LIEA 1H0TA 3V5BA 1KB9E 1NTME 2E74B 3CL3D 3AEEC 3VTPC 3RK3E 1GL2A 1URQD 1CW5A 1LTIC 2WT7B 1CSBA 1KQGB 1NTKE 2BCCD 2KSJA 4B86A 5M1BA 1LWUC 1NJIQ 2WPQA 1R5LA 1IJDB 3D6ZA 3H1HE 3L74G 2IPPA 1YTZI 2QG4A 5KLVD 1NTZK 3M91A 2IYOA 2FYZA 1RE4A 3HE5A 1KC8Q 1T3UA 1X79B 1UIIA 5AVWB 1MUUA 5KJ7D 5AVUB 1HBWA 2WSEH 3L70G 1BGYJ 5AVTB 3T97B 5AVYB 4ZKUA 5H2FH 1JY3P 4JQ0D 2WSEJ 1EC5A 1VQMP 1SQPG 1IZNB 4KT0J 1DEBA 4DT0A 1GD2E 1ZXGA 2FYUG 4Y28J 1ZP0C 4PD4I 3F5HA 3N4XA 1S5LX 2GM4A 4DCKA 3E7KA 3H1IG 3S1KA 3TNUB 3L74E 1L0LG 2IDBA 3I55P 1SQQD 2N9BA 3RBXA 2M3BA 3V4QA 1QEXA 5KAIH 1VF5D 1GW3A 2PP6A 2FBWC 1Q2NA 1QL2A 2J59M 4ZMDA 3L70E 5AW4B 2E43A 2HYNA 3Q5RA 1A02F 1PP9E 1M56D 2WSFH 4PV1D 2A45H 2ZT9B 1EQ7A 2B88A 2WWWA 3N7NA 1FZCC 2V7QH 4Z1MH 3V2PA 2QA4P 3EFFK 2N1TC 2UWJE 1T3JA 1NU1E 1ZOYC 1L0LE 1FC2C 4UB6H 2M5AA 2OTKE 1MV8A 1SFCD 1DEEG 3IF4A 2JJLA 2Z5IA 2K1AA 1YITP 3HD7C 3AE3C 1YQ4C 2RKLA 3CX5E 4Y99B 3AE2C 1JB0J 4ASVA 1J1EC 1SQXG 1YHQP 4U3FD 2H7HA 5E79H 2KZJA 1SQVJ 3TGUJ 5DJUB 4GODA 2E75C 1Q81Q 1DH3A 1S5LE 4HH2A 1CI6B 4OGQB 3VMZA 2WSSH 1SQBJ 1M1JB 1GDTA 1P84E 4EOTA 1T2KD 4AYCA 1N8RQ 1FZCA 3CXHD 2FYUK 2DW3A 2QRXA 4IFFA 2N1TA 1ZLLA 1KILE 4L73A 5BU5A 1WT6A 1G1IA 1L4AD 2OGUA 4EI2A 4L76A 2KI7B 2PAJA 4N3YB 1VQ9P 1EDJA 3B71A 1VQ5P 1NO4A 3VP9A 2Q9IA 1SQXE 3C9IA 1KILA 1IC2A 3HE4A 1KFNA 2W83C 4WY4B 1LGHB 1SQVD 2CPSA 3HD7A 4C7RA 1KB9H 3L73D 4W7YA 1QLED 3CWBD 1M1KQ 2BEZF 1K05A 3VOPA 4ZKPA 4HKZH 1BGYG 1BCCG 3HUSC 2ZJSE 3NMDA 3R4YA 1OW8A 4R4LA 2XNDH 2H88C 2KOGA 3WU2E 3FX0A 5EFWB 3RK2C 1EZVG 1URQB 1BE3D 4H0LB 1GU4A 2P67A 2Z5HA 1XTCC 1YJWP 2Y0DA 3VP8A 1U7MA 4UB8E 2SPZA 1HVVA 4BRYB 4I2LC 1NTZD 1FAVA 1NKZB 2OYIC 2FXPA 1GK4A 1KD1Q 1ZRTD 3VYIA 1HJ0A 3AEFC 3L4FA 2CPBA 4N78D 2KNCA 1FDOA 2O1KA 2JWDA 1S9KD 4TLFA 4TT3H 1JM0A 1WRGA 1SP4A 1NAYA 3GLMA 2VRSA 3OAKA 1FJKA 3JC22 1PV3A 4LGDE 3AE8C 3CCLP 2LKMA 1K04A 3BATA 3CXHI 1JTHB 2QM8A 1EZVE 3U59A 2OYHC 2IZ1A 1QVGO 2YMKA 4C7NA 2CK3H 2ZYGA 1W2EA 3EWKA 3EQ2A 2O01J 2D2CB 4WB4A 1L0NJ 3SWFA 2IBZD 4WWIA 3BASA 3M06A 3CD6P 5CJ4A 1K9MQ 2YIUB 3P32A 1IO4A 4U3FE 1PP9J 2L91A 1IFJA 3BCCJ 1IFIA 4IOIH 3A3YB 3TGUG 2E74C 2OARA 3SWKA 3Q2YA 2Y9ZA 3TYYA 4KHXA 1OX3A 1OW7A 2WITA 2E5TA 1MFZA 4PV1B 3L72G 4I6MC 1SQBG 2I1KA 2ZAEB 4GT1A 1S72P 3GMAA 1VDFA 3H32A 2MKVA 1JOCA 3WUUA 1M90Q 1OMIA 1Y9BA 1OVVA 1G2CB 3IFMA 2OQQA 1L0ND 3CX5H 5CCGC 1AQ5A 2C0WA 2HODA 3VMXA 3HTKB 3H1JJ 1QX8A 1SFCB 1OXZA 3AE6C 4IL6X 5CBOA 1S5LH 1PGOA 1SQVE 3AEAC 3TGUE 1GL2C 1HGVA 5AVQB 3CPWO 5CJ0A 3L73E 1KZUB 4W80A 1QL1A 1T6AA 1NTMG 3RK3C 3U1CA 1KFMA 3RGUA 3GF7A 1LTBC 3AEGC 4PD4D 1IFMA 1NGMB 1OIPA 1LJ2A 1NTKG 4M3LA 1JMMA 2BCCJ 1J1DB 3W68A 4H13C 2WT7A 4ZNCA 4LC1A 3H1ID 1RE4C 2QJYC 2QJPB 3WUTA 5APUA 5KLVJ 1Q82Q 2IBZI 2HPCA 1L4AB 1ZRTE 3RL0D 4JYBA 2ZT9C 2ZXEB 3MUDA 2JP3A 1N7SB 1VL2A 1YBKA 2O3JA 1KQLA 1VQNP 1NH4A 4QMAA 3CLQA 5APSA 3F89A 4H0LD 3T97A 3WU2H 3A2AA 2YNYA 4W7ZA 3CCSP 4I1LA 2LXBA 2N1TD 4DZOA 4UB8H 1HGZA 3M9QA 3QWOC 1SQQJ 3TNUA 4O9BA 4IL6E 2YKOA 3H1KJ 1KORA 2GUVA 1YQ3C 3HD7D 1XTGB 3B5NC 1FZGA 1PPJG 5KKZB 1EXIA 1X8YA 2GUSA 2HFED 1VQPP 2JKVA 2FFDB 1PP9G 1RY3A 3BCCG 3S9OA 5KTBA 3H1LD 2E76B 1M1JC 3Q5SA 3OW2O 1PGPA 1NTMK 2J58A 1X22A 3MD0A 2K9JB 1AV1A 3CCEP 2Q7CA 1NU1G 1NTKK 2ZFCA 2D2CD 2ZVOB 2W6AA 1D7MA 1ZW0A 1FU1A 1AQTA 4U7JA 3GHGC 3H1KD 3TF5A 1S4XA 1L0NE 1AJYA 2XKMA 1ZR2A 3D70A 3H1JG 1PPJE 3G3ZA 1CZQA 3A0BE 1EDLA 4U3FJ 1IFNA 3BCCE 1RE3C 2YKQA 2AXCA 4OH8B 5BVZA 2A06D 3B5NA 3CCQP 2FYNB 1NAFA 2P58A 3FWLA 2E42A 5DJTB 4BWNA 1VQ6P 4C46A 4PD4E 1M1JA 1TU3F 1URQC 2BCCG 1KILC 3V6IA 2QJKC 2RMZA 1LWUB 3H1JE 3GHGA 1FZAA 1RF0C 5CCHD 5KLVG 4K3AA 3V4WA 1KN7A 5KLIC 2QE7H 2E5YA 3B8EB 1USEA 3CC4P 4WY4A 5L8RJ 2KYVA 3L73J 2WMMA 3CWBJ 4RJTA 1LTJC 1ZMEC 2NPSD 5KJ7C 2Q3EA 1MFTA 1W2BO 1RE3A 3D71A 1GW4A 1MZ9A 1SQPK 3A7OA 3P8CD 3AEBC 4WVZA 1A02J 1LP1A 2BCCE 2KP8A 1NU1K 3LW5J 1L0LK 2W90A 4AUWA 3QH9A 1OFCX 2AEMA 1BE3J 1URQA 1SQQG 3SWYA 3IN6A 1SVFA 2K9YA 5KLVE 4DOJA 1VF5C 4BRYA 1LTTC 2V4HA 3K5BA 1NTZJ 1N7SD 2YIUC 1ZV8A 2Q1KA 3V2NA 4BXLA 2IYPA 1FOSE 1LNQA 1U7JA 4D6TJ 1EDKA 1RF0A 2W6JH 4RESB 3RL0B 3C8VA 2YXRB 4PV1C 4NPDA 5AW1B 1LT9B 3RL0g 1KV4A 2WPVB 2KXPB 1LTJA 5KJ7A 3H6PA 5AW3B 5AW6B 1NVOA 3FXDA 1FZCB 4IL6H 1VQ7P 2ITAA 1AVYA 4NPFX 1SQQE 3KZIE 2KB7P 2N1TB 1JY2P 4H44D 1U57A 3H1KE 1S3JA 1X0TA 3WUVA 5CCGD 4L74A 4I7ZC 2Z4EA 3S4RA 2ZXXA 1SQXK 4D6TD 3KHUA 2E76D 3HE4B 2RH0A 1FE6A 2AEFA 1N7LA 1BSNA 4U3FG 1RQUA 3HD7B 1NKNA 2JDIH 4PJ0E 1GL2D 5AVZB 2YMYA 1M57D 5APVA 2KS1A 3G9RA 3L75J 5APQA 2A06E 2PRRA 3UIAA 1EXJA 1E79H 3L71D 1KB9D 2P2UA 3RK3D 3ZDMA 2M8RA 1LTGC 1MKMA 3D6YA 1AA0A 4HYTB 2A45I 1T2KC 3PLNA 4OVNF 2O01H 1NTKD 1HTLC 1G1JA 4H13D 2R3CA 3A0BH 5AW7B 3H1HD 1G2CA 3E1IA
chains in the Genus database with same CATH topology
1KB9I 5KLVJ 1SQBJ 3CX5I 2BCCJ 2IBZI 1BE3J 4PD4I 3L70J 3H1IJ 1NU1J 1SQQJ 4D6TJ 3L75J 3L71J 1L0LJ 1BGYJ 1NTMJ 1P84I 1PP9J 1BCCJ 3H1JJ 1SQVJ 3TGUJ 3BCCJ 3H1LJ 3H1KJ 3H1HJ 1KYOI 3L73J 1L0NJ 3CXHI 1SQPJ 1NTZJ 2FYUJ 3CWBJ 1NTKJ 4U3FJ 3L74J 3L72J 1EZVI 1SQXJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KB9 I;  5KLV J;  1SQB J;  3CX5 I;  2BCC J;  2IBZ I;  1BE3 J;  4PD4 I;  3L70 J;  3H1I J;  1NU1 J;  1SQQ J;  4D6T J;  3L75 J;  3L71 J;  1L0L J;  1BGY J;  1NTM J;  1P84 I;  1PP9 J;  1BCC J;  3H1J J;  1SQV J;  3TGU J;  3BCC J;  3H1L J;  3H1K J;  3H1H J;  1KYO I;  3L73 J;  1L0N J;  3CXH I;  1SQP J;  1NTZ J;  2FYU J;  3CWB J;  1NTK J;  4U3F J;  3L74 J;  3L72 J;  1EZV I;  1SQX J; 
#chains in the Genus database with same CATH topology
 4YTP C;  1OVR A;  1K73 Q;  3HTK A;  4ASW A;  1SFC A;  1YI2 P;  1OWA A;  1SQV G;  2O01 N;  3L75 D;  2R5D A;  1H88 A;  3L73 G;  5B66 E;  3CC2 P;  1N2D C;  1JEK A;  4PD4 H;  4AQR D;  2L5G B;  1KYO D;  1JO5 A;  4RKU J;  4LLH A;  2G3A A;  1K8A Q;  4OWF A;  4DJG A;  2XNX A;  2WPR A;  3OA7 A;  1VQ4 P;  3CXH E;  1DD4 A;  1S1C X;  2WQY C;  3FWN A;  3I56 P;  3II6 A;  2FYU J;  3HUS B;  2KIK A;  3G4S P;  1AFO A;  5AVX B;  2WPS A;  1JNM A;  3L74 D;  4C7N B;  3H1I J;  1BE3 G;  3I5C A;  2YKP A;  4GOE A;  2R5B A;  2K88 A;  3MUD C;  3CMA P;  1RQV A;  2QM7 A;  2FY8 A;  3AED C;  1NOH A;  1DD3 A;  1IFD A;  1PGJ A;  1NTZ G;  2K37 A;  2YO3 A;  3CCR P;  5KKZ C;  2KK7 A;  1L4A A;  4YXD C;  3O6Q B;  2NRG A;  2YXQ B;  3B5N D;  1GU5 A;  1HWT C;  2OYI B;  3CWB E;  3L35 A;  3L70 D;  3Q1M A;  2RN0 A;  3KPE A;  1KTM A;  1KB9 I;  1VPC A;  1SQP D;  2JR8 A;  1Y8A A;  2NPS B;  2FXO A;  1UIX A;  2FYU D;  2OTL P;  1RHZ B;  3H32 B;  1NU1 D;  1L0L D;  1JY3 O;  1BE3 E;  3BRV B;  1YYC A;  3R2P A;  2Q5U A;  2OYH B;  1OVU A;  1NTZ E;  2QIW A;  2POH A;  3A0H E;  2G8Y A;  2PFX A;  2IBZ G;  1JY3 N;  1KQF B;  4D6T E;  3BVH A;  3CX5 D;  4GDO A;  3NTN A;  4N78 E;  1SQV K;  5AW5 B;  1S9K E;  4NPE A;  1H8A A;  1JUN A;  1FZF A;  2Y9Y A;  3H1L J;  1PIX A;  3VMA A;  1KYO I;  1SQB K;  4JBZ A;  2H8P D;  2B87 B;  3CCU P;  3L71 E;  3M9B A;  3KZI H;  1N73 B;  4CPG A;  1P84 D;  1M7L A;  2K9J A;  3GF3 A;  1GZL A;  1KMI Z;  3PHL A;  4K35 A;  1KIL D;  2IX7 C;  4Y99 C;  1VQK P;  2K3R A;  5AW8 B;  5C39 A;  1L0N G;  1SLQ A;  1FDM A;  2R32 A;  2JEE A;  1RF1 B;  2IBZ E;  4H44 B;  2PGD A;  4PJ0 H;  1SQX D;  2HPC B;  5CBN A;  1GK6 A;  2W27 A;  4OGQ C;  2E75 D;  3PP5 A;  3L75 E;  3M0D C;  1H0T B;  3CCJ P;  1R5S A;  1GL2 B;  3P7K A;  1YTZ T;  3VMY A;  1KYO E;  1BCC J;  5GTI E;  1WMK A;  3E1R A;  3W67 A;  3RK3 B;  4XE5 B;  2XDJ A;  4EIJ A;  1PL5 A;  1PZQ A;  3CI9 A;  2B89 A;  4WY4 C;  5APT A;  4H13 B;  1QVF O;  1LWU A;  2M3E A;  3HE5 B;  2HLO A;  3P8M C;  1AVO A;  2Q3I A;  2QJY B;  3CME P;  2AEJ A;  3L36 A;  1FZE A;  1IK9 A;  3CX5 I;  5B66 H;  2IFM A;  3RBZ A;  3SFE C;  1Q90 D;  3MP7 B;  1EDI A;  1LT1 A;  3RL0 C;  1YJ9 P;  3TSI A;  3MIW A;  1JCC A;  1Z56 A;  1ZN5 A;  1LT9 C;  1ZR4 A;  1OZH A;  1BGY D;  3CXH H;  1GMJ A;  1BCC D;  2WZ7 A;  3L37 A;  1CI6 A;  5KAF E;  4HJG H;  3M0D A;  4H0L C;  1SQP E;  2WSF J;  1QGK B;  2FYU E;  1P84 I;  3AEC C;  3RK2 D;  4JF7 A;  1EZV D;  2V7Q J;  3AE7 C;  3H1I E;  3V2Q A;  3PTZ A;  2AXT E;  3G71 P;  2WTY A;  1Q7Y Q;  3MHV A;  3HRN A;  1L0N K;  3KXD A;  3IAO A;  4JYC A;  3EFG A;  3BRT B;  1FBM A;  3JCU E;  1JY2 O;  1HH0 A;  2H89 C;  2HR3 A;  1S2E A;  4IFD K;  5AW9 B;  3Q5P A;  1L2P A;  2XU6 A;  3B5N B;  4KJM A;  2QEX P;  1J2J B;  5APX A;  3LW5 H;  1RH5 B;  1NHL A;  2WVR A;  3AE1 C;  3H1L G;  2P7J A;  3B4S A;  3AE9 C;  1GTW A;  5TIS E;  1LT9 A;  2R44 A;  1JY2 N;  4GIF A;  5B5E E;  1HJB A;  3L72 J;  2LXC B;  5AW0 B;  4YPC A;  1N86 A;  3NFQ A;  2M5A B;  1DIP A;  4WBA A;  2C9N Y;  2D2C C;  3LID A;  3A0H H;  3A5T A;  2HG5 D;  3H1K G;  2N9Y B;  1JMB A;  2FXM A;  5APY A;  3GHG B;  2KSE A;  2IFN A;  1T8Z A;  2BEQ D;  1IFP A;  3USS A;  1R8E A;  3TGU D;  2E74 D;  5K5G B;  1JCD A;  3H1L E;  2A06 G;  1M8O B;  1VQ8 P;  1LTA C;  3VN0 A;  3L72 D;  3L71 J;  1SQB D;  5GTH E;  3H25 A;  1NTM J;  2W8Z A;  1USD A;  2KLU A;  2IZ0 A;  1JTH A;  1LP1 B;  3V2R A;  4GKG A;  1BSH A;  1NTK J;  2FKW B;  1EZV I;  1H89 A;  1VQO P;  4R4M A;  3KYQ A;  2OTJ P;  1SFC C;  4EYY Q;  3H1H J;  5KLV K;  2OYO A;  1NWQ A;  2NZ2 A;  1IK7 A;  3SFD C;  1KIL B;  5CCH C;  2R3S A;  1BDC A;  2QJK B;  2ZYA A;  5TJH A;  1YIJ P;  5CHX A;  1J1E B;  2MJZ A;  1KYO H;  5GTI H;  5KLI B;  2W6B A;  1NTM D;  1W5C E;  2NPS C;  1BGY E;  2E75 B;  1BCC E;  1J1D C;  1PFI A;  3PRJ A;  1BDD A;  4MN4 C;  2I8D A;  2Y0E A;  2YO2 A;  1LTJ B;  3CCM P;  3MZW B;  2QJP C;  5H2F E;  2A45 G;  3MGN A;  3SSU A;  5BU8 B;  2O1J A;  3HUS A;  1SQQ K;  2Y0C A;  3NXS A;  1L4A C;  3L74 J;  4XA4 A;  2ZVN B;  3AE5 C;  2B9B A;  3OJA B;  3MTU E;  2KUB A;  2WSC H;  5AVR B;  1FJP A;  1OW6 A;  3GW6 A;  2KLV A;  3ABV C;  1N7S C;  4RO0 A;  2WSC J;  5KAI E;  2C0X A;  5AW2 B;  3CC7 P;  2KNC B;  2ZT9 D;  1PGQ A;  3O6Q A;  1VF5 B;  2GA1 A;  2Q6Q A;  5KAF H;  4XFJ A;  3CWB G;  1Y47 A;  5CCH A;  2JWA A;  1NYH A;  3L70 J;  2OYI A;  3AE4 C;  2KS1 B;  2P1J A;  2QSI A;  1N73 C;  5AVV B;  4N6J A;  1YJN P;  3P8C E;  2BAS A;  2JO1 A;  1SQP J;  1FZB A;  3M9H A;  2KZI A;  2NPS A;  1DX7 A;  2AXT H;  2LR2 A;  1NU1 J;  1Q86 Q;  1L0L J;  1FDI A;  1RF1 C;  3RK2 B;  4H44 C;  4IFM A;  4UB6 E;  3JCU H;  1FOS F;  3KQG A;  5CMZ A;  4GOF A;  2OYH A;  1E5W A;  4A7P A;  1KQS O;  2FFD C;  1SS1 A;  2I1J A;  1PPJ D;  4D6T G;  3WMM 0;  2E76 C;  4I7Z B;  1PP9 D;  3KDP B;  2ZYD A;  3BCC D;  3PJS K;  1N7S A;  4OGQ D;  5TIS H;  3TDK A;  5B5E H;  3O8Z A;  3PH0 A;  3JSV C;  4JPZ B;  3M0A A;  1HUC A;  3FXE A;  2C9L Y;  5E79 E;  1P84 H;  1LTS C;  2XV5 A;  3L72 E;  3L71 G;  1SQB E;  2B87 A;  2QVA A;  1N73 A;  5AVS B;  1HF9 A;  2H43 A;  3U1A A;  1X9V A;  3FGA D;  4L75 A;  3ITK A;  4EDF A;  1FS0 E;  2P10 A;  2HOD B;  4WY4 D;  3H1H G;  3H1J D;  3C1L A;  1RF1 A;  3CCV P;  4YXW H;  1SQX J;  2J5U A;  3IR9 A;  2XZR A;  4HB1 A;  3G6E P;  3Q3D A;  5CCG A;  3GG2 A;  2FYN C;  2M0B A;  2FFD A;  3L75 G;  5GTH H;  5APW A;  3TK1 A;  1VQL P;  3LIE A;  1H0T A;  3V5B A;  1KB9 E;  1NTM E;  2E74 B;  3CL3 D;  3AEE C;  3VTP C;  3RK3 E;  1GL2 A;  1URQ D;  1CW5 A;  1LTI C;  2WT7 B;  1CSB A;  1KQG B;  1NTK E;  2BCC D;  2KSJ A;  4B86 A;  5M1B A;  1LWU C;  1NJI Q;  2WPQ A;  1R5L A;  1IJD B;  3D6Z A;  3H1H E;  3L74 G;  2IPP A;  1YTZ I;  2QG4 A;  5KLV D;  1NTZ K;  3M91 A;  2IYO A;  2FYZ A;  1RE4 A;  3HE5 A;  1KC8 Q;  1T3U A;  1X79 B;  1UII A;  5AVW B;  1MUU A;  5KJ7 D;  5AVU B;  1HBW A;  2WSE H;  3L70 G;  1BGY J;  5AVT B;  3T97 B;  5AVY B;  4ZKU A;  5H2F H;  1JY3 P;  4JQ0 D;  2WSE J;  1EC5 A;  1VQM P;  1SQP G;  1IZN B;  4KT0 J;  1DEB A;  4DT0 A;  1GD2 E;  1ZXG A;  2FYU G;  4Y28 J;  1ZP0 C;  4PD4 I;  3F5H A;  3N4X A;  1S5L X;  2GM4 A;  4DCK A;  3E7K A;  3H1I G;  3S1K A;  3TNU B;  3L74 E;  1L0L G;  2IDB A;  3I55 P;  1SQQ D;  2N9B A;  3RBX A;  2M3B A;  3V4Q A;  1QEX A;  5KAI H;  1VF5 D;  1GW3 A;  2PP6 A;  2FBW C;  1Q2N A;  1QL2 A;  2J59 M;  4ZMD A;  3L70 E;  5AW4 B;  2E43 A;  2HYN A;  3Q5R A;  1A02 F;  1PP9 E;  1M56 D;  2WSF H;  4PV1 D;  2A45 H;  2ZT9 B;  1EQ7 A;  2B88 A;  2WWW A;  3N7N A;  1FZC C;  2V7Q H;  4Z1M H;  3V2P A;  2QA4 P;  3EFF K;  2N1T C;  2UWJ E;  1T3J A;  1NU1 E;  1ZOY C;  1L0L E;  1FC2 C;  4UB6 H;  2M5A A;  2OTK E;  1MV8 A;  1SFC D;  1DEE G;  3IF4 A;  2JJL A;  2Z5I A;  2K1A A;  1YIT P;  3HD7 C;  3AE3 C;  1YQ4 C;  2RKL A;  3CX5 E;  4Y99 B;  3AE2 C;  1JB0 J;  4ASV A;  1J1E C;  1SQX G;  1YHQ P;  4U3F D;  2H7H A;  5E79 H;  2KZJ A;  1SQV J;  3TGU J;  5DJU B;  4GOD A;  2E75 C;  1Q81 Q;  1DH3 A;  1S5L E;  4HH2 A;  1CI6 B;  4OGQ B;  3VMZ A;  2WSS H;  1SQB J;  1M1J B;  1GDT A;  1P84 E;  4EOT A;  1T2K D;  4AYC A;  1N8R Q;  1FZC A;  3CXH D;  2FYU K;  2DW3 A;  2QRX A;  4IFF A;  2N1T A;  1ZLL A;  1KIL E;  4L73 A;  5BU5 A;  1WT6 A;  1G1I A;  1L4A D;  2OGU A;  4EI2 A;  4L76 A;  2KI7 B;  2PAJ A;  4N3Y B;  1VQ9 P;  1EDJ A;  3B71 A;  1VQ5 P;  1NO4 A;  3VP9 A;  2Q9I A;  1SQX E;  3C9I A;  1KIL A;  1IC2 A;  3HE4 A;  1KFN A;  2W83 C;  4WY4 B;  1LGH B;  1SQV D;  2CPS A;  3HD7 A;  4C7R A;  1KB9 H;  3L73 D;  4W7Y A;  1QLE D;  3CWB D;  1M1K Q;  2BEZ F;  1K05 A;  3VOP A;  4ZKP A;  4HKZ H;  1BGY G;  1BCC G;  3HUS C;  2ZJS E;  3NMD A;  3R4Y A;  1OW8 A;  4R4L A;  2XND H;  2H88 C;  2KOG A;  3WU2 E;  3FX0 A;  5EFW B;  3RK2 C;  1EZV G;  1URQ B;  1BE3 D;  4H0L B;  1GU4 A;  2P67 A;  2Z5H A;  1XTC C;  1YJW P;  2Y0D A;  3VP8 A;  1U7M A;  4UB8 E;  2SPZ A;  1HVV A;  4BRY B;  4I2L C;  1NTZ D;  1FAV A;  1NKZ B;  2OYI C;  2FXP A;  1GK4 A;  1KD1 Q;  1ZRT D;  3VYI A;  1HJ0 A;  3AEF C;  3L4F A;  2CPB A;  4N78 D;  2KNC A;  1FDO A;  2O1K A;  2JWD A;  1S9K D;  4TLF A;  4TT3 H;  1JM0 A;  1WRG A;  1SP4 A;  1NAY A;  3GLM A;  2VRS A;  3OAK A;  1FJK A;  3JC2 2;  1PV3 A;  4LGD E;  3AE8 C;  3CCL P;  2LKM A;  1K04 A;  3BAT A;  3CXH I;  1JTH B;  2QM8 A;  1EZV E;  3U59 A;  2OYH C;  2IZ1 A;  1QVG O;  2YMK A;  4C7N A;  2CK3 H;  2ZYG A;  1W2E A;  3EWK A;  3EQ2 A;  2O01 J;  2D2C B;  4WB4 A;  1L0N J;  3SWF A;  2IBZ D;  4WWI A;  3BAS A;  3M06 A;  3CD6 P;  5CJ4 A;  1K9M Q;  2YIU B;  3P32 A;  1IO4 A;  4U3F E;  1PP9 J;  2L91 A;  1IFJ A;  3BCC J;  1IFI A;  4IOI H;  3A3Y B;  3TGU G;  2E74 C;  2OAR A;  3SWK A;  3Q2Y A;  2Y9Z A;  3TYY A;  4KHX A;  1OX3 A;  1OW7 A;  2WIT A;  2E5T A;  1MFZ A;  4PV1 B;  3L72 G;  4I6M C;  1SQB G;  2I1K A;  2ZAE B;  4GT1 A;  1S72 P;  3GMA A;  1VDF A;  3H32 A;  2MKV A;  1JOC A;  3WUU A;  1M90 Q;  1OMI A;  1Y9B A;  1OVV A;  1G2C B;  3IFM A;  2OQQ A;  1L0N D;  3CX5 H;  5CCG C;  1AQ5 A;  2C0W A;  2HOD A;  3VMX A;  3HTK B;  3H1J J;  1QX8 A;  1SFC B;  1OXZ A;  3AE6 C;  4IL6 X;  5CBO A;  1S5L H;  1PGO A;  1SQV E;  3AEA C;  3TGU E;  1GL2 C;  1HGV A;  5AVQ B;  3CPW O;  5CJ0 A;  3L73 E;  1KZU B;  4W80 A;  1QL1 A;  1T6A A;  1NTM G;  3RK3 C;  3U1C A;  1KFM A;  3RGU A;  3GF7 A;  1LTB C;  3AEG C;  4PD4 D;  1IFM A;  1NGM B;  1OIP A;  1LJ2 A;  1NTK G;  4M3L A;  1JMM A;  2BCC J;  1J1D B;  3W68 A;  4H13 C;  2WT7 A;  4ZNC A;  4LC1 A;  3H1I D;  1RE4 C;  2QJY C;  2QJP B;  3WUT A;  5APU A;  5KLV J;  1Q82 Q;  2IBZ I;  2HPC A;  1L4A B;  1ZRT E;  3RL0 D;  4JYB A;  2ZT9 C;  2ZXE B;  3MUD A;  2JP3 A;  1N7S B;  1VL2 A;  1YBK A;  2O3J A;  1KQL A;  1VQN P;  1NH4 A;  4QMA A;  3CLQ A;  5APS A;  3F89 A;  4H0L D;  3T97 A;  3WU2 H;  3A2A A;  2YNY A;  4W7Z A;  3CCS P;  4I1L A;  2LXB A;  2N1T D;  4DZO A;  4UB8 H;  1HGZ A;  3M9Q A;  3QWO C;  1SQQ J;  3TNU A;  4O9B A;  4IL6 E;  2YKO A;  3H1K J;  1KOR A;  2GUV A;  1YQ3 C;  3HD7 D;  1XTG B;  3B5N C;  1FZG A;  1PPJ G;  5KKZ B;  1EXI A;  1X8Y A;  2GUS A;  2HFE D;  1VQP P;  2JKV A;  2FFD B;  1PP9 G;  1RY3 A;  3BCC G;  3S9O A;  5KTB A;  3H1L D;  2E76 B;  1M1J C;  3Q5S A;  3OW2 O;  1PGP A;  1NTM K;  2J58 A;  1X22 A;  3MD0 A;  2K9J B;  1AV1 A;  3CCE P;  2Q7C A;  1NU1 G;  1NTK K;  2ZFC A;  2D2C D;  2ZVO B;  2W6A A;  1D7M A;  1ZW0 A;  1FU1 A;  1AQT A;  4U7J A;  3GHG C;  3H1K D;  3TF5 A;  1S4X A;  1L0N E;  1AJY A;  2XKM A;  1ZR2 A;  3D70 A;  3H1J G;  1PPJ E;  3G3Z A;  1CZQ A;  3A0B E;  1EDL A;  4U3F J;  1IFN A;  3BCC E;  1RE3 C;  2YKQ A;  2AXC A;  4OH8 B;  5BVZ A;  2A06 D;  3B5N A;  3CCQ P;  2FYN B;  1NAF A;  2P58 A;  3FWL A;  2E42 A;  5DJT B;  4BWN A;  1VQ6 P;  4C46 A;  4PD4 E;  1M1J A;  1TU3 F;  1URQ C;  2BCC G;  1KIL C;  3V6I A;  2QJK C;  2RMZ A;  1LWU B;  3H1J E;  3GHG A;  1FZA A;  1RF0 C;  5CCH D;  5KLV G;  4K3A A;  3V4W A;  1KN7 A;  5KLI C;  2QE7 H;  2E5Y A;  3B8E B;  1USE A;  3CC4 P;  4WY4 A;  5L8R J;  2KYV A;  3L73 J;  2WMM A;  3CWB J;  4RJT A;  1LTJ C;  1ZME C;  2NPS D;  5KJ7 C;  2Q3E A;  1MFT A;  1W2B O;  1RE3 A;  3D71 A;  1GW4 A;  1MZ9 A;  1SQP K;  3A7O A;  3P8C D;  3AEB C;  4WVZ A;  1A02 J;  1LP1 A;  2BCC E;  2KP8 A;  1NU1 K;  3LW5 J;  1L0L K;  2W90 A;  4AUW A;  3QH9 A;  1OFC X;  2AEM A;  1BE3 J;  1URQ A;  1SQQ G;  3SWY A;  3IN6 A;  1SVF A;  2K9Y A;  5KLV E;  4DOJ A;  1VF5 C;  4BRY A;  1LTT C;  2V4H A;  3K5B A;  1NTZ J;  1N7S D;  2YIU C;  1ZV8 A;  2Q1K A;  3V2N A;  4BXL A;  2IYP A;  1FOS E;  1LNQ A;  1U7J A;  4D6T J;  1EDK A;  1RF0 A;  2W6J H;  4RES B;  3RL0 B;  3C8V A;  2YXR B;  4PV1 C;  4NPD A;  5AW1 B;  1LT9 B;  3RL0 g;  1KV4 A;  2WPV B;  2KXP B;  1LTJ A;  5KJ7 A;  3H6P A;  5AW3 B;  5AW6 B;  1NVO A;  3FXD A;  1FZC B;  4IL6 H;  1VQ7 P;  2ITA A;  1AVY A;  4NPF X;  1SQQ E;  3KZI E;  2KB7 P;  2N1T B;  1JY2 P;  4H44 D;  1U57 A;  3H1K E;  1S3J A;  1X0T A;  3WUV A;  5CCG D;  4L74 A;  4I7Z C;  2Z4E A;  3S4R A;  2ZXX A;  1SQX K;  4D6T D;  3KHU A;  2E76 D;  3HE4 B;  2RH0 A;  1FE6 A;  2AEF A;  1N7L A;  1BSN A;  4U3F G;  1RQU A;  3HD7 B;  1NKN A;  2JDI H;  4PJ0 E;  1GL2 D;  5AVZ B;  2YMY A;  1M57 D;  5APV A;  2KS1 A;  3G9R A;  3L75 J;  5APQ A;  2A06 E;  2PRR A;  3UIA A;  1EXJ A;  1E79 H;  3L71 D;  1KB9 D;  2P2U A;  3RK3 D;  3ZDM A;  2M8R A;  1LTG C;  1MKM A;  3D6Y A;  1AA0 A;  4HYT B;  2A45 I;  1T2K C;  3PLN A;  4OVN F;  2O01 H;  1NTK D;  1HTL C;  1G1J A;  4H13 D;  2R3C A;  3A0B H;  5AW7 B;  3H1H D;  1G2C A;  3E1I A; 
#chains in the Genus database with same CATH homology
 1KB9 I;  5KLV J;  1SQB J;  3CX5 I;  2BCC J;  2IBZ I;  1BE3 J;  4PD4 I;  3L70 J;  3H1I J;  1NU1 J;  1SQQ J;  4D6T J;  3L75 J;  3L71 J;  1L0L J;  1BGY J;  1NTM J;  1P84 I;  1PP9 J;  1BCC J;  3H1J J;  1SQV J;  3TGU J;  3BCC J;  3H1L J;  3H1K J;  3H1H J;  1KYO I;  3L73 J;  1L0N J;  3CXH I;  1SQP J;  1NTZ J;  2FYU J;  3CWB J;  1NTK J;  4U3F J;  3L74 J;  3L72 J;  1EZV I;  1SQX J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...