2BCDA

X-ray crystal structure of protein phosphatase-1 with the marine toxin motuporin bound
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
293
structure length
293
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Protein Phosphatase-1 Bound to Motuporin and Dihydromicrocystin-LA: Elucidation of the Mechanism of Enzyme Inhibition by Cyanobacterial Toxins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine/threonine protein phosphatase PP1-gamma catalytic sub
total genus 106
structure length 293
sequence length 293
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2005-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2bcdA00
2BQ8X 1OI8A 3JYFA 4V0XA 5JJTA 2Z1AA 4LACC 4WWLA 5HPEA 5B8IA 4TUGA 2AHDA 4FBQA 1NNWA 4H1YP 3N5UA 2BCDA 4DT2A 3CK2A 2YVTA 2QJCA 3T1IA 4ORBA 1XZWA 1S8EA 4H2BA 4ZX2A 3IVEA 4JA7A 2P6BA 4XPNA 2IE4C 3EGHA 3E7BA 5J28A 1USHA 3KBPA 4ORAA 4ZVZA 3V4YA 3DSCA 1UF3A 3QFNA 3PSOA 1G5BA 4FBKA 2Z06A 3ZTVA 4MOVA 1OIEA 1IT6A 4Q7FA 1S70A 1V73A 4O4KA 2GJUA 4LTYA 4FBWA 5DNYA 1Z2WA 4O5GA 2JOGA 3TGHA 2NXFA 3EGGA 4H2GA 4O24A 3E7AA 4M0VA 4MP0A 2HYPA 2Z72A 2CV9A 4UT2A 2NYMC 1M63A 4KBPA 3LL8A 2NYLC 3C9FA 3P71C 4I5LC 4H1SA 3GVEA 1HO5A 4H2IA 4G9JA 4DHLA 2HY1A 3IB7A 2WDCA 1FJMA 4HD0A 1HP1A 4KKZA 4O43A 2R17A 4MOYA 4I5NC 4J6OA 2USHA 1WARA 1W24A 4V0VA 2BDXA 1JK7A 3QG5C 3DW8C 1MF8A 3HVQA 3H61A 3H69A 1AUIA 2O8AA 3H66A 5EQVA 3H67A 1S95A 2KKNA 3H64A 5IOHA 3AUZA 1OIDA 1TCOA 5GTUA 1T70A 3K7VC 2ZBMA 1UTEA 3QFKA 4NZVA 2QFRA 3H62B 4V0WA 3DSDA 2XMOA 3QFMA 4YKEA 2O8GA 4DSYA 4ORCA 2DFJA 4LU9A 3RL4A 4IYPC 1S3LA 2IE3C 5INBA 4H2FA 2QFPA 3PSNA 3H68A 1QHWA 1HPUA 3C5WC 1XM7A 3QFOA 4IL1A 2NPPC 3RL3A 5JPFA 4OR9A 1T71A 3K7WC 4UWQA 1U32A 3ZU0A 2IAEC 2Q8UA 3H63A 5JPEA 1SU1A 3RL5A 3THNA 4JA9A 3IVDA 3H60A 5C1VA 1II7A 3RQZA 1QFCA 2WDFA 1KBPA 1Z2XA 2HYOA 4F0ZA 4B2OA 3AV0A 3IB8A 2WDEA 4UT3B 2A22A 1S3MA 4TUIA 3FGAC 1WAO1 3THOB 4FCXA 5F3WA 2WDDA 4UT3A 3ICFA 1S3NA
chains in the Genus database with same CATH superfamily
2BQ8X 1OI8A 3JYFA 4V0XA 5JJTA 2Z1AA 4LACC 4WWLA 5HPEA 5B8IA 4TUGA 2DXNA 2AHDA 4FBQA 1NNWA 4H1YP 3E0JA 3N5UA 2BCDA 4DT2A 2YVTA 3CK2A 2QJCA 3T1IA 4ORBA 1XZWA 1S8EA 4H2BA 4ZX2A 3IVEA 4JA7A 2P6BA 4XPNA 2IE4C 2DXLA 3EGHA 3E7BA 3FLOA 5J28A 1USHA 3KBPA 4ORAA 4ZVZA 3V4YA 3DSCA 1UF3A 3QFNA 3PSOA 1G5BA 4FBKA 2Z06A 3ZTVA 4MOVA 1OIEA 1IT6A 4Q7FA 1S70A 1V73A 4O4KA 2GJUA 4LTYA 4FBWA 5DNYA 1Z2WA 4O5GA 2JOGA 3TGHA 2NXFA 3EGGA 4H2GA 4O24A 3E7AA 4M0VA 4MP0A 2HYPA 2Z72A 2CV9A 4UT2A 2NYMC 1M63A 4KBPA 3LL8A 2ZOAA 2NYLC 3C9FA 3P71C 4I5LC 4H1SA 3GVEA 1HO5A 4H2IA 4G9JA 4DHLA 2HY1A 3IB7A 2WDCA 1FJMA 4HD0A 1HP1A 4KKZA 4O43A 2R17A 4MOYA 4I5NC 4J6OA 2USHA 1WARA 1W24A 4V0VA 2BDXA 1JK7A 3QG5C 3DW8C 1MF8A 3HVQA 3H61A 3H69A 3D03A 1AUIA 2O8AA 3H66A 5EQVA 3H67A 1S95A 2KKNA 3H64A 5IOHA 3AUZA 1OIDA 1TCOA 5GTUA 1T70A 3K7VC 2ZBMA 1UTEA 3QFKA 4NZVA 2QFRA 3H62B 4V0WA 3DSDA 2XMOA 3QFMA 4YKEA 2O8GA 4DSYA 4ORCA 2DFJA 4LU9A 3RL4A 4IYPC 1S3LA 2IE3C 5INBA 2YEQA 2QFPA 4H2FA 3PSNA 3H68A 1QHWA 1HPUA 3C5WC 1XM7A 3QFOA 4IL1A 2NPPC 3RL3A 5JPFA 4OR9A 1T71A 3K7WC 4UWQA 1U32A 3ZU0A 2IAEC 2Q8UA 2ZO9B 3H63A 1SU1A 5JPEA 3RL5A 3THNA 4JA9A 3IVDA 3H60A 5C1VA 1II7A 3RQZA 1QFCA 2WDFA 1KBPA 1Z2XA 2HYOA 4F0ZA 4B2OA 3AV0A 3IB8A 2WDEA 4UT3B 2A22A 1S3MA 4TUIA 3FGAC 1WAO1 3THOB 4FCXA 5F3WA 2WDDA 4UT3A 3ICFA 1S3NA
chains in the Genus database with same CATH topology
2BQ8X 1OI8A 3JYFA 4V0XA 5JJTA 2Z1AA 4LACC 4WWLA 5HPEA 5B8IA 4TUGA 2DXNA 2AHDA 4FBQA 1NNWA 4H1YP 3E0JA 3N5UA 2BCDA 4DT2A 2YVTA 3CK2A 2QJCA 3T1IA 4ORBA 1XZWA 1S8EA 4H2BA 4ZX2A 3IVEA 4JA7A 2P6BA 4XPNA 2IE4C 2DXLA 3EGHA 3E7BA 3FLOA 5J28A 1USHA 3KBPA 4ORAA 4ZVZA 3V4YA 3DSCA 1UF3A 3QFNA 3PSOA 1G5BA 4FBKA 2Z06A 3ZTVA 4MOVA 1OIEA 1IT6A 4Q7FA 1S70A 1V73A 4O4KA 2GJUA 4LTYA 4FBWA 5DNYA 1Z2WA 4O5GA 2JOGA 3TGHA 2NXFA 3EGGA 4H2GA 4O24A 3E7AA 4M0VA 4MP0A 2HYPA 2Z72A 2CV9A 4UT2A 2NYMC 1M63A 4KBPA 3LL8A 2ZOAA 2NYLC 3C9FA 3P71C 4I5LC 4H1SA 3GVEA 1HO5A 4H2IA 4G9JA 4DHLA 2HY1A 3IB7A 2WDCA 1FJMA 4HD0A 1HP1A 4KKZA 4O43A 2R17A 4MOYA 4I5NC 4J6OA 2USHA 1WARA 1W24A 4V0VA 2BDXA 1JK7A 3QG5C 3DW8C 1MF8A 3HVQA 3H61A 3H69A 3D03A 1AUIA 2O8AA 3H66A 5EQVA 3H67A 1S95A 2KKNA 3H64A 5IOHA 3AUZA 1OIDA 1TCOA 5GTUA 1T70A 3K7VC 2ZBMA 1UTEA 3QFKA 4NZVA 2QFRA 3H62B 4V0WA 3DSDA 2XMOA 3QFMA 4YKEA 2O8GA 4DSYA 4ORCA 2DFJA 4LU9A 3RL4A 4IYPC 1S3LA 2IE3C 5INBA 2YEQA 2QFPA 4H2FA 3PSNA 3H68A 1QHWA 1HPUA 3C5WC 1XM7A 3QFOA 4IL1A 2NPPC 3RL3A 5JPFA 4OR9A 1T71A 3K7WC 4UWQA 1U32A 3ZU0A 2IAEC 2Q8UA 2ZO9B 3H63A 1SU1A 5JPEA 3RL5A 3THNA 4JA9A 3IVDA 3H60A 5C1VA 1II7A 3RQZA 1QFCA 2WDFA 1KBPA 1Z2XA 2HYOA 4F0ZA 4B2OA 3AV0A 3IB8A 2WDEA 4UT3B 2A22A 1S3MA 4TUIA 3FGAC 1WAO1 3THOB 4FCXA 5F3WA 2WDDA 4UT3A 3ICFA 1S3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BQ8 X;  1OI8 A;  3JYF A;  4V0X A;  5JJT A;  2Z1A A;  4LAC C;  4WWL A;  5HPE A;  5B8I A;  4TUG A;  2AHD A;  4FBQ A;  1NNW A;  4H1Y P;  3N5U A;  2BCD A;  4DT2 A;  3CK2 A;  2YVT A;  2QJC A;  3T1I A;  4ORB A;  1XZW A;  1S8E A;  4H2B A;  4ZX2 A;  3IVE A;  4JA7 A;  2P6B A;  4XPN A;  2IE4 C;  3EGH A;  3E7B A;  5J28 A;  1USH A;  3KBP A;  4ORA A;  4ZVZ A;  3V4Y A;  3DSC A;  1UF3 A;  3QFN A;  3PSO A;  1G5B A;  4FBK A;  2Z06 A;  3ZTV A;  4MOV A;  1OIE A;  1IT6 A;  4Q7F A;  1S70 A;  1V73 A;  4O4K A;  2GJU A;  4LTY A;  4FBW A;  5DNY A;  1Z2W A;  4O5G A;  2JOG A;  3TGH A;  2NXF A;  3EGG A;  4H2G A;  4O24 A;  3E7A A;  4M0V A;  4MP0 A;  2HYP A;  2Z72 A;  2CV9 A;  4UT2 A;  2NYM C;  1M63 A;  4KBP A;  3LL8 A;  2NYL C;  3C9F A;  3P71 C;  4I5L C;  4H1S A;  3GVE A;  1HO5 A;  4H2I A;  4G9J A;  4DHL A;  2HY1 A;  3IB7 A;  2WDC A;  1FJM A;  4HD0 A;  1HP1 A;  4KKZ A;  4O43 A;  2R17 A;  4MOY A;  4I5N C;  4J6O A;  2USH A;  1WAR A;  1W24 A;  4V0V A;  2BDX A;  1JK7 A;  3QG5 C;  3DW8 C;  1MF8 A;  3HVQ A;  3H61 A;  3H69 A;  1AUI A;  2O8A A;  3H66 A;  5EQV A;  3H67 A;  1S95 A;  2KKN A;  3H64 A;  5IOH A;  3AUZ A;  1OID A;  1TCO A;  5GTU A;  1T70 A;  3K7V C;  2ZBM A;  1UTE A;  3QFK A;  4NZV A;  2QFR A;  3H62 B;  4V0W A;  3DSD A;  2XMO A;  3QFM A;  4YKE A;  2O8G A;  4DSY A;  4ORC A;  2DFJ A;  4LU9 A;  3RL4 A;  4IYP C;  1S3L A;  2IE3 C;  5INB A;  4H2F A;  2QFP A;  3PSN A;  3H68 A;  1QHW A;  1HPU A;  3C5W C;  1XM7 A;  3QFO A;  4IL1 A;  2NPP C;  3RL3 A;  5JPF A;  4OR9 A;  1T71 A;  3K7W C;  4UWQ A;  1U32 A;  3ZU0 A;  2IAE C;  2Q8U A;  3H63 A;  5JPE A;  1SU1 A;  3RL5 A;  3THN A;  4JA9 A;  3IVD A;  3H60 A;  5C1V A;  1II7 A;  3RQZ A;  1QFC A;  2WDF A;  1KBP A;  1Z2X A;  2HYO A;  4F0Z A;  4B2O A;  3AV0 A;  3IB8 A;  2WDE A;  4UT3 B;  2A22 A;  1S3M A;  4TUI A;  3FGA C;  1WAO 1;  3THO B;  4FCX A;  5F3W A;  2WDD A;  4UT3 A;  3ICF A;  1S3N A; 
#chains in the Genus database with same CATH topology
 2BQ8 X;  1OI8 A;  3JYF A;  4V0X A;  5JJT A;  2Z1A A;  4LAC C;  4WWL A;  5HPE A;  5B8I A;  4TUG A;  2DXN A;  2AHD A;  4FBQ A;  1NNW A;  4H1Y P;  3E0J A;  3N5U A;  2BCD A;  4DT2 A;  2YVT A;  3CK2 A;  2QJC A;  3T1I A;  4ORB A;  1XZW A;  1S8E A;  4H2B A;  4ZX2 A;  3IVE A;  4JA7 A;  2P6B A;  4XPN A;  2IE4 C;  2DXL A;  3EGH A;  3E7B A;  3FLO A;  5J28 A;  1USH A;  3KBP A;  4ORA A;  4ZVZ A;  3V4Y A;  3DSC A;  1UF3 A;  3QFN A;  3PSO A;  1G5B A;  4FBK A;  2Z06 A;  3ZTV A;  4MOV A;  1OIE A;  1IT6 A;  4Q7F A;  1S70 A;  1V73 A;  4O4K A;  2GJU A;  4LTY A;  4FBW A;  5DNY A;  1Z2W A;  4O5G A;  2JOG A;  3TGH A;  2NXF A;  3EGG A;  4H2G A;  4O24 A;  3E7A A;  4M0V A;  4MP0 A;  2HYP A;  2Z72 A;  2CV9 A;  4UT2 A;  2NYM C;  1M63 A;  4KBP A;  3LL8 A;  2ZOA A;  2NYL C;  3C9F A;  3P71 C;  4I5L C;  4H1S A;  3GVE A;  1HO5 A;  4H2I A;  4G9J A;  4DHL A;  2HY1 A;  3IB7 A;  2WDC A;  1FJM A;  4HD0 A;  1HP1 A;  4KKZ A;  4O43 A;  2R17 A;  4MOY A;  4I5N C;  4J6O A;  2USH A;  1WAR A;  1W24 A;  4V0V A;  2BDX A;  1JK7 A;  3QG5 C;  3DW8 C;  1MF8 A;  3HVQ A;  3H61 A;  3H69 A;  3D03 A;  1AUI A;  2O8A A;  3H66 A;  5EQV A;  3H67 A;  1S95 A;  2KKN A;  3H64 A;  5IOH A;  3AUZ A;  1OID A;  1TCO A;  5GTU A;  1T70 A;  3K7V C;  2ZBM A;  1UTE A;  3QFK A;  4NZV A;  2QFR A;  3H62 B;  4V0W A;  3DSD A;  2XMO A;  3QFM A;  4YKE A;  2O8G A;  4DSY A;  4ORC A;  2DFJ A;  4LU9 A;  3RL4 A;  4IYP C;  1S3L A;  2IE3 C;  5INB A;  2YEQ A;  2QFP A;  4H2F A;  3PSN A;  3H68 A;  1QHW A;  1HPU A;  3C5W C;  1XM7 A;  3QFO A;  4IL1 A;  2NPP C;  3RL3 A;  5JPF A;  4OR9 A;  1T71 A;  3K7W C;  4UWQ A;  1U32 A;  3ZU0 A;  2IAE C;  2Q8U A;  2ZO9 B;  3H63 A;  1SU1 A;  5JPE A;  3RL5 A;  3THN A;  4JA9 A;  3IVD A;  3H60 A;  5C1V A;  1II7 A;  3RQZ A;  1QFC A;  2WDF A;  1KBP A;  1Z2X A;  2HYO A;  4F0Z A;  4B2O A;  3AV0 A;  3IB8 A;  2WDE A;  4UT3 B;  2A22 A;  1S3M A;  4TUI A;  3FGA C;  1WAO 1;  3THO B;  4FCX A;  5F3W A;  2WDD A;  4UT3 A;  3ICF A;  1S3N A; 
#chains in the Genus database with same CATH homology
 2BQ8 X;  1OI8 A;  3JYF A;  4V0X A;  5JJT A;  2Z1A A;  4LAC C;  4WWL A;  5HPE A;  5B8I A;  4TUG A;  2DXN A;  2AHD A;  4FBQ A;  1NNW A;  4H1Y P;  3E0J A;  3N5U A;  2BCD A;  4DT2 A;  2YVT A;  3CK2 A;  2QJC A;  3T1I A;  4ORB A;  1XZW A;  1S8E A;  4H2B A;  4ZX2 A;  3IVE A;  4JA7 A;  2P6B A;  4XPN A;  2IE4 C;  2DXL A;  3EGH A;  3E7B A;  3FLO A;  5J28 A;  1USH A;  3KBP A;  4ORA A;  4ZVZ A;  3V4Y A;  3DSC A;  1UF3 A;  3QFN A;  3PSO A;  1G5B A;  4FBK A;  2Z06 A;  3ZTV A;  4MOV A;  1OIE A;  1IT6 A;  4Q7F A;  1S70 A;  1V73 A;  4O4K A;  2GJU A;  4LTY A;  4FBW A;  5DNY A;  1Z2W A;  4O5G A;  2JOG A;  3TGH A;  2NXF A;  3EGG A;  4H2G A;  4O24 A;  3E7A A;  4M0V A;  4MP0 A;  2HYP A;  2Z72 A;  2CV9 A;  4UT2 A;  2NYM C;  1M63 A;  4KBP A;  3LL8 A;  2ZOA A;  2NYL C;  3C9F A;  3P71 C;  4I5L C;  4H1S A;  3GVE A;  1HO5 A;  4H2I A;  4G9J A;  4DHL A;  2HY1 A;  3IB7 A;  2WDC A;  1FJM A;  4HD0 A;  1HP1 A;  4KKZ A;  4O43 A;  2R17 A;  4MOY A;  4I5N C;  4J6O A;  2USH A;  1WAR A;  1W24 A;  4V0V A;  2BDX A;  1JK7 A;  3QG5 C;  3DW8 C;  1MF8 A;  3HVQ A;  3H61 A;  3H69 A;  3D03 A;  1AUI A;  2O8A A;  3H66 A;  5EQV A;  3H67 A;  1S95 A;  2KKN A;  3H64 A;  5IOH A;  3AUZ A;  1OID A;  1TCO A;  5GTU A;  1T70 A;  3K7V C;  2ZBM A;  1UTE A;  3QFK A;  4NZV A;  2QFR A;  3H62 B;  4V0W A;  3DSD A;  2XMO A;  3QFM A;  4YKE A;  2O8G A;  4DSY A;  4ORC A;  2DFJ A;  4LU9 A;  3RL4 A;  4IYP C;  1S3L A;  2IE3 C;  5INB A;  2YEQ A;  2QFP A;  4H2F A;  3PSN A;  3H68 A;  1QHW A;  1HPU A;  3C5W C;  1XM7 A;  3QFO A;  4IL1 A;  2NPP C;  3RL3 A;  5JPF A;  4OR9 A;  1T71 A;  3K7W C;  4UWQ A;  1U32 A;  3ZU0 A;  2IAE C;  2Q8U A;  2ZO9 B;  3H63 A;  1SU1 A;  5JPE A;  3RL5 A;  3THN A;  4JA9 A;  3IVD A;  3H60 A;  5C1V A;  1II7 A;  3RQZ A;  1QFC A;  2WDF A;  1KBP A;  1Z2X A;  2HYO A;  4F0Z A;  4B2O A;  3AV0 A;  3IB8 A;  2WDE A;  4UT3 B;  2A22 A;  1S3M A;  4TUI A;  3FGA C;  1WAO 1;  3THO B;  4FCX A;  5F3W A;  2WDD A;  4UT3 A;  3ICF A;  1S3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...