2BCDA

X-ray crystal structure of protein phosphatase-1 with the marine toxin motuporin bound
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
293
structure length
293
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Protein Phosphatase-1 Bound to Motuporin and Dihydromicrocystin-LA: Elucidation of the Mechanism of Enzyme Inhibition by Cyanobacterial Toxins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine/threonine protein phosphatase PP1-gamma catalytic sub
total genus 106
structure length 293
sequence length 293
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2005-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2bcdA00
5F3WA 2Z72A 3CK2A 1XZWA 3IB8A 3H68A 3DSCA 1JK7A 3E7AA 2QJCA 3H61A 4MOVA 2AHDA 1S70A 1USHA 4OR9A 4XPNA 3RQZA 3H67A 4O43A 4O4KA 5DNYA 1WAO1 2NXFA 2QFPA 3E7BA 3RL5A 1HPUA 2HYPA 3TGHA 4ZX2A 4TUGA 2WDEA 4UT3B 2BQ8X 5IOHA 1M63A 2Z1AA 4ORBA 4I5NC 1OI8A 4LTYA 4V0WA 2DFJA 2R17A 4TUIA 5HPEA 1AUIA 1II7A 3P71C 3T1IA 4O24A 1U32A 3KBPA 1S3LA 1WARA 5GTUA 3H69A 4H2BA 5B8IA 3H62B 1W24A 4FBWA 3ZU0A 1T70A 1KBPA 4IL1A 1XM7A 1UF3A 4JA9A 4FBQA 3DW8C 1S8EA 2XMOA 1G5BA 3QFMA 3QFKA 2O8AA 3K7WC 3QFOA 4FBKA 4LU9A 4H2IA 4DT2A 4H1SA 3AUZA 1V73A 2Q8UA 1T71A 3RL3A 1MF8A 2P6BA 4J6OA 2KKNA 4HD0A 1Z2XA 4ZVZA 2BCDA 3H66A 3QG5C 4O5GA 2BDXA 2IE4C 3QFNA 4V0VA 4G9JA 4WWLA 2QFRA 1HP1A 2Z06A 3GVEA 3C5WC 5J28A 2YVTA 4KKZA 1UTEA 4UWQA 4DHLA 5JPEA 1SU1A 2NPPC 1OIDA 1OIEA 2A22A 4IYPC 4MOYA 4ORAA 4H1YP 4MP0A 3LL8A 3PSOA 1HO5A 3ICFA 2NYMC 4Q7FA 4FCXA 3HVQA 3EGHA 3FGAC 4F0ZA 1TCOA 4DSYA 1QFCA 2ZBMA 2JOGA 3JYFA 3IVEA 4B2OA 2USHA 3IB7A 4KBPA 4H2FA 5JJTA 4M0VA 3H63A 4ORCA 1S3NA 1QHWA 3N5UA 4V0XA 4UT3A 1S95A 1FJMA 3THOB 5JPFA 2WDFA 4YKEA 5INBA 2IE3C 2GJUA 3IVDA 5EQVA 3PSNA 4NZVA 3K7VC 3DSDA 4H2GA 2HY1A 2O8GA 2CV9A 3AV0A 3EGGA 2NYLC 3H60A 4LACC 4I5LC 1S3MA 2WDDA 1NNWA 3H64A 4JA7A 4UT2A 3V4YA 1Z2WA 1IT6A 3C9FA 3ZTVA 3THNA 5C1VA 2IAEC 3RL4A 2WDCA 2HYOA
chains in the Genus database with same CATH superfamily
5F3WA 2Z72A 3CK2A 1XZWA 3IB8A 3H68A 3DSCA 1JK7A 3E7AA 2QJCA 3H61A 4MOVA 2AHDA 1S70A 1USHA 2YEQA 4OR9A 4XPNA 3RQZA 3H67A 4O43A 4O4KA 5DNYA 1WAO1 2NXFA 2QFPA 3E7BA 3RL5A 1HPUA 2HYPA 3TGHA 4ZX2A 4TUGA 2WDEA 4UT3B 2BQ8X 5IOHA 1M63A 2Z1AA 4ORBA 4I5NC 1OI8A 4LTYA 4V0WA 2DFJA 2R17A 4TUIA 5HPEA 1AUIA 1II7A 3P71C 3T1IA 4O24A 1U32A 3KBPA 1S3LA 1WARA 5GTUA 3H69A 4H2BA 5B8IA 3H62B 1W24A 4FBWA 3ZU0A 1T70A 1KBPA 4IL1A 2ZOAA 1XM7A 1UF3A 4JA9A 4FBQA 3DW8C 1S8EA 2XMOA 1G5BA 3QFMA 3QFKA 2O8AA 3K7WC 3QFOA 4FBKA 4LU9A 4H2IA 2DXNA 4DT2A 4H1SA 3AUZA 1V73A 2Q8UA 1T71A 3RL3A 1MF8A 3FLOA 2P6BA 4J6OA 2KKNA 4HD0A 1Z2XA 4ZVZA 2BCDA 3H66A 3QG5C 4O5GA 2BDXA 2IE4C 3QFNA 4V0VA 4G9JA 4WWLA 2QFRA 1HP1A 2Z06A 3GVEA 3C5WC 5J28A 2YVTA 4KKZA 1UTEA 4UWQA 4DHLA 5JPEA 2DXLA 1SU1A 2NPPC 1OIDA 1OIEA 2A22A 4IYPC 4MOYA 4ORAA 4H1YP 4MP0A 3LL8A 3PSOA 1HO5A 3ICFA 2NYMC 4Q7FA 4FCXA 3HVQA 3EGHA 3FGAC 4F0ZA 1TCOA 4DSYA 1QFCA 2ZBMA 2JOGA 3JYFA 3IVEA 4B2OA 2USHA 3IB7A 4KBPA 4H2FA 5JJTA 4M0VA 3H63A 4ORCA 1S3NA 1QHWA 3N5UA 4V0XA 4UT3A 1S95A 1FJMA 3THOB 5JPFA 2WDFA 4YKEA 5INBA 2IE3C 2GJUA 3IVDA 5EQVA 3PSNA 4NZVA 3K7VC 2ZO9B 3DSDA 4H2GA 2HY1A 2O8GA 2CV9A 3E0JA 3AV0A 3EGGA 2NYLC 3H60A 4LACC 4I5LC 1S3MA 2WDDA 1NNWA 3H64A 4JA7A 4UT2A 3V4YA 1Z2WA 1IT6A 3C9FA 3ZTVA 3D03A 5C1VA 3THNA 2IAEC 3RL4A 2WDCA 2HYOA
chains in the Genus database with same CATH topology
5F3WA 2Z72A 3CK2A 1XZWA 3IB8A 3H68A 3DSCA 1JK7A 3E7AA 2QJCA 3H61A 4MOVA 2AHDA 1S70A 1USHA 2YEQA 4OR9A 4XPNA 3RQZA 3H67A 4O43A 4O4KA 5DNYA 1WAO1 2NXFA 2QFPA 3E7BA 3RL5A 1HPUA 2HYPA 3TGHA 4ZX2A 4TUGA 2WDEA 4UT3B 2BQ8X 5IOHA 1M63A 2Z1AA 4ORBA 4I5NC 1OI8A 4LTYA 4V0WA 2DFJA 2R17A 4TUIA 5HPEA 1AUIA 1II7A 3P71C 3T1IA 4O24A 1U32A 3KBPA 1S3LA 1WARA 5GTUA 3H69A 4H2BA 5B8IA 3H62B 1W24A 4FBWA 3ZU0A 1T70A 1KBPA 4IL1A 2ZOAA 1XM7A 1UF3A 4JA9A 4FBQA 3DW8C 1S8EA 2XMOA 1G5BA 3QFMA 3QFKA 2O8AA 3K7WC 3QFOA 4FBKA 4LU9A 4H2IA 2DXNA 4DT2A 4H1SA 3AUZA 1V73A 2Q8UA 1T71A 3RL3A 1MF8A 3FLOA 2P6BA 4J6OA 2KKNA 4HD0A 1Z2XA 4ZVZA 2BCDA 3H66A 3QG5C 4O5GA 2BDXA 2IE4C 3QFNA 4V0VA 4G9JA 4WWLA 2QFRA 1HP1A 2Z06A 3GVEA 3C5WC 5J28A 2YVTA 4KKZA 1UTEA 4UWQA 4DHLA 5JPEA 2DXLA 1SU1A 2NPPC 1OIDA 1OIEA 2A22A 4IYPC 4MOYA 4ORAA 4H1YP 4MP0A 3LL8A 3PSOA 1HO5A 3ICFA 2NYMC 4Q7FA 4FCXA 3HVQA 3EGHA 3FGAC 4F0ZA 1TCOA 4DSYA 1QFCA 2ZBMA 2JOGA 3JYFA 3IVEA 4B2OA 2USHA 3IB7A 4KBPA 4H2FA 5JJTA 4M0VA 3H63A 4ORCA 1S3NA 1QHWA 3N5UA 4V0XA 4UT3A 1S95A 1FJMA 3THOB 5JPFA 2WDFA 4YKEA 5INBA 2IE3C 2GJUA 3IVDA 5EQVA 3PSNA 4NZVA 3K7VC 2ZO9B 3DSDA 4H2GA 2HY1A 2O8GA 2CV9A 3E0JA 3AV0A 3EGGA 2NYLC 3H60A 4LACC 4I5LC 1S3MA 2WDDA 1NNWA 3H64A 4JA7A 4UT2A 3V4YA 1Z2WA 1IT6A 3C9FA 3ZTVA 3D03A 5C1VA 3THNA 2IAEC 3RL4A 2WDCA 2HYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F3W A;  2Z72 A;  3CK2 A;  1XZW A;  3IB8 A;  3H68 A;  3DSC A;  1JK7 A;  3E7A A;  2QJC A;  3H61 A;  4MOV A;  2AHD A;  1S70 A;  1USH A;  4OR9 A;  4XPN A;  3RQZ A;  3H67 A;  4O43 A;  4O4K A;  5DNY A;  1WAO 1;  2NXF A;  2QFP A;  3E7B A;  3RL5 A;  1HPU A;  2HYP A;  3TGH A;  4ZX2 A;  4TUG A;  2WDE A;  4UT3 B;  2BQ8 X;  5IOH A;  1M63 A;  2Z1A A;  4ORB A;  4I5N C;  1OI8 A;  4LTY A;  4V0W A;  2DFJ A;  2R17 A;  4TUI A;  5HPE A;  1AUI A;  1II7 A;  3P71 C;  3T1I A;  4O24 A;  1U32 A;  3KBP A;  1S3L A;  1WAR A;  5GTU A;  3H69 A;  4H2B A;  5B8I A;  3H62 B;  1W24 A;  4FBW A;  3ZU0 A;  1T70 A;  1KBP A;  4IL1 A;  1XM7 A;  1UF3 A;  4JA9 A;  4FBQ A;  3DW8 C;  1S8E A;  2XMO A;  1G5B A;  3QFM A;  3QFK A;  2O8A A;  3K7W C;  3QFO A;  4FBK A;  4LU9 A;  4H2I A;  4DT2 A;  4H1S A;  3AUZ A;  1V73 A;  2Q8U A;  1T71 A;  3RL3 A;  1MF8 A;  2P6B A;  4J6O A;  2KKN A;  4HD0 A;  1Z2X A;  4ZVZ A;  2BCD A;  3H66 A;  3QG5 C;  4O5G A;  2BDX A;  2IE4 C;  3QFN A;  4V0V A;  4G9J A;  4WWL A;  2QFR A;  1HP1 A;  2Z06 A;  3GVE A;  3C5W C;  5J28 A;  2YVT A;  4KKZ A;  1UTE A;  4UWQ A;  4DHL A;  5JPE A;  1SU1 A;  2NPP C;  1OID A;  1OIE A;  2A22 A;  4IYP C;  4MOY A;  4ORA A;  4H1Y P;  4MP0 A;  3LL8 A;  3PSO A;  1HO5 A;  3ICF A;  2NYM C;  4Q7F A;  4FCX A;  3HVQ A;  3EGH A;  3FGA C;  4F0Z A;  1TCO A;  4DSY A;  1QFC A;  2ZBM A;  2JOG A;  3JYF A;  3IVE A;  4B2O A;  2USH A;  3IB7 A;  4KBP A;  4H2F A;  5JJT A;  4M0V A;  3H63 A;  4ORC A;  1S3N A;  1QHW A;  3N5U A;  4V0X A;  4UT3 A;  1S95 A;  1FJM A;  3THO B;  5JPF A;  2WDF A;  4YKE A;  5INB A;  2IE3 C;  2GJU A;  3IVD A;  5EQV A;  3PSN A;  4NZV A;  3K7V C;  3DSD A;  4H2G A;  2HY1 A;  2O8G A;  2CV9 A;  3AV0 A;  3EGG A;  2NYL C;  3H60 A;  4LAC C;  4I5L C;  1S3M A;  2WDD A;  1NNW A;  3H64 A;  4JA7 A;  4UT2 A;  3V4Y A;  1Z2W A;  1IT6 A;  3C9F A;  3ZTV A;  3THN A;  5C1V A;  2IAE C;  3RL4 A;  2WDC A;  2HYO A; 
#chains in the Genus database with same CATH topology
 5F3W A;  2Z72 A;  3CK2 A;  1XZW A;  3IB8 A;  3H68 A;  3DSC A;  1JK7 A;  3E7A A;  2QJC A;  3H61 A;  4MOV A;  2AHD A;  1S70 A;  1USH A;  2YEQ A;  4OR9 A;  4XPN A;  3RQZ A;  3H67 A;  4O43 A;  4O4K A;  5DNY A;  1WAO 1;  2NXF A;  2QFP A;  3E7B A;  3RL5 A;  1HPU A;  2HYP A;  3TGH A;  4ZX2 A;  4TUG A;  2WDE A;  4UT3 B;  2BQ8 X;  5IOH A;  1M63 A;  2Z1A A;  4ORB A;  4I5N C;  1OI8 A;  4LTY A;  4V0W A;  2DFJ A;  2R17 A;  4TUI A;  5HPE A;  1AUI A;  1II7 A;  3P71 C;  3T1I A;  4O24 A;  1U32 A;  3KBP A;  1S3L A;  1WAR A;  5GTU A;  3H69 A;  4H2B A;  5B8I A;  3H62 B;  1W24 A;  4FBW A;  3ZU0 A;  1T70 A;  1KBP A;  4IL1 A;  2ZOA A;  1XM7 A;  1UF3 A;  4JA9 A;  4FBQ A;  3DW8 C;  1S8E A;  2XMO A;  1G5B A;  3QFM A;  3QFK A;  2O8A A;  3K7W C;  3QFO A;  4FBK A;  4LU9 A;  4H2I A;  2DXN A;  4DT2 A;  4H1S A;  3AUZ A;  1V73 A;  2Q8U A;  1T71 A;  3RL3 A;  1MF8 A;  3FLO A;  2P6B A;  4J6O A;  2KKN A;  4HD0 A;  1Z2X A;  4ZVZ A;  2BCD A;  3H66 A;  3QG5 C;  4O5G A;  2BDX A;  2IE4 C;  3QFN A;  4V0V A;  4G9J A;  4WWL A;  2QFR A;  1HP1 A;  2Z06 A;  3GVE A;  3C5W C;  5J28 A;  2YVT A;  4KKZ A;  1UTE A;  4UWQ A;  4DHL A;  5JPE A;  2DXL A;  1SU1 A;  2NPP C;  1OID A;  1OIE A;  2A22 A;  4IYP C;  4MOY A;  4ORA A;  4H1Y P;  4MP0 A;  3LL8 A;  3PSO A;  1HO5 A;  3ICF A;  2NYM C;  4Q7F A;  4FCX A;  3HVQ A;  3EGH A;  3FGA C;  4F0Z A;  1TCO A;  4DSY A;  1QFC A;  2ZBM A;  2JOG A;  3JYF A;  3IVE A;  4B2O A;  2USH A;  3IB7 A;  4KBP A;  4H2F A;  5JJT A;  4M0V A;  3H63 A;  4ORC A;  1S3N A;  1QHW A;  3N5U A;  4V0X A;  4UT3 A;  1S95 A;  1FJM A;  3THO B;  5JPF A;  2WDF A;  4YKE A;  5INB A;  2IE3 C;  2GJU A;  3IVD A;  5EQV A;  3PSN A;  4NZV A;  3K7V C;  2ZO9 B;  3DSD A;  4H2G A;  2HY1 A;  2O8G A;  2CV9 A;  3E0J A;  3AV0 A;  3EGG A;  2NYL C;  3H60 A;  4LAC C;  4I5L C;  1S3M A;  2WDD A;  1NNW A;  3H64 A;  4JA7 A;  4UT2 A;  3V4Y A;  1Z2W A;  1IT6 A;  3C9F A;  3ZTV A;  3D03 A;  5C1V A;  3THN A;  2IAE C;  3RL4 A;  2WDC A;  2HYO A; 
#chains in the Genus database with same CATH homology
 5F3W A;  2Z72 A;  3CK2 A;  1XZW A;  3IB8 A;  3H68 A;  3DSC A;  1JK7 A;  3E7A A;  2QJC A;  3H61 A;  4MOV A;  2AHD A;  1S70 A;  1USH A;  2YEQ A;  4OR9 A;  4XPN A;  3RQZ A;  3H67 A;  4O43 A;  4O4K A;  5DNY A;  1WAO 1;  2NXF A;  2QFP A;  3E7B A;  3RL5 A;  1HPU A;  2HYP A;  3TGH A;  4ZX2 A;  4TUG A;  2WDE A;  4UT3 B;  2BQ8 X;  5IOH A;  1M63 A;  2Z1A A;  4ORB A;  4I5N C;  1OI8 A;  4LTY A;  4V0W A;  2DFJ A;  2R17 A;  4TUI A;  5HPE A;  1AUI A;  1II7 A;  3P71 C;  3T1I A;  4O24 A;  1U32 A;  3KBP A;  1S3L A;  1WAR A;  5GTU A;  3H69 A;  4H2B A;  5B8I A;  3H62 B;  1W24 A;  4FBW A;  3ZU0 A;  1T70 A;  1KBP A;  4IL1 A;  2ZOA A;  1XM7 A;  1UF3 A;  4JA9 A;  4FBQ A;  3DW8 C;  1S8E A;  2XMO A;  1G5B A;  3QFM A;  3QFK A;  2O8A A;  3K7W C;  3QFO A;  4FBK A;  4LU9 A;  4H2I A;  2DXN A;  4DT2 A;  4H1S A;  3AUZ A;  1V73 A;  2Q8U A;  1T71 A;  3RL3 A;  1MF8 A;  3FLO A;  2P6B A;  4J6O A;  2KKN A;  4HD0 A;  1Z2X A;  4ZVZ A;  2BCD A;  3H66 A;  3QG5 C;  4O5G A;  2BDX A;  2IE4 C;  3QFN A;  4V0V A;  4G9J A;  4WWL A;  2QFR A;  1HP1 A;  2Z06 A;  3GVE A;  3C5W C;  5J28 A;  2YVT A;  4KKZ A;  1UTE A;  4UWQ A;  4DHL A;  5JPE A;  2DXL A;  1SU1 A;  2NPP C;  1OID A;  1OIE A;  2A22 A;  4IYP C;  4MOY A;  4ORA A;  4H1Y P;  4MP0 A;  3LL8 A;  3PSO A;  1HO5 A;  3ICF A;  2NYM C;  4Q7F A;  4FCX A;  3HVQ A;  3EGH A;  3FGA C;  4F0Z A;  1TCO A;  4DSY A;  1QFC A;  2ZBM A;  2JOG A;  3JYF A;  3IVE A;  4B2O A;  2USH A;  3IB7 A;  4KBP A;  4H2F A;  5JJT A;  4M0V A;  3H63 A;  4ORC A;  1S3N A;  1QHW A;  3N5U A;  4V0X A;  4UT3 A;  1S95 A;  1FJM A;  3THO B;  5JPF A;  2WDF A;  4YKE A;  5INB A;  2IE3 C;  2GJU A;  3IVD A;  5EQV A;  3PSN A;  4NZV A;  3K7V C;  2ZO9 B;  3DSD A;  4H2G A;  2HY1 A;  2O8G A;  2CV9 A;  3E0J A;  3AV0 A;  3EGG A;  2NYL C;  3H60 A;  4LAC C;  4I5L C;  1S3M A;  2WDD A;  1NNW A;  3H64 A;  4JA7 A;  4UT2 A;  3V4Y A;  1Z2W A;  1IT6 A;  3C9F A;  3ZTV A;  3D03 A;  5C1V A;  3THN A;  2IAE C;  3RL4 A;  2WDC A;  2HYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...