2BCMA

Daae adhesin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
138
structure length
138
Chain Sequence
TFQASGTTGITTLTVTEECRVQVGNVTATLARSKLKDDTAIGVIGVTALGCNGLQAALQADPDNYDATNLYMTSRNHDKLNVKLKATDGSSWTYGNGVFYKTEGGNWGGHVGISVDGNQTDKPTGEYTLNLTGGYWTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F1845 fimbrial protein
publication title Crystal Structure and Mutational Analysis of the DaaE Adhesin of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 29
structure length 138
sequence length 138
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2bcmA00
2W5PA 2JKNA 2VERA 1UT1A 2JKLA 1UT2A 2BCMA 2IXQB 2JKJA 1RXLA 1USQA 1USZA
chains in the Genus database with same CATH superfamily
3TZVA 3MRHB 3F7KA 5D1QC 5EU4B 2ICWB 2V33A 3VI4E 1A14L 5H37H 4HUVB 5FA4A 1T5XB 4A7GA 5CZVL 5HHVH 2G5BA 2YLHA 3BIBX 3SDCB 1AD9A 2VDRL 3DTXA 1CU4L 2E76C 3HKZA 1VPOH 3ML8A 4KNTA 2JKRM 4OZGA 2JB5L 1QRND 5A6LA 1LILA 2AEPL 5EC2B 5HDQH 3INUL 5B39B 4WW2B 3M88A 4A2FA 3ZO9A 4HDIA 1KN4L 4PVNA 4IU2A 4BD4A 4OB5L 3ZDYF 2Q2LA 4GRLC 4F7CB 3LCYA 1E27B 4JRXB 4IEFB 5IESL 3L1OH 3AY2A 1WZMA 5DHYB 5IBUB 2F5AL 1JP5A 3BP4A 3G6AB 2DQIL 2VKXA 4MJJA 4Y5XB 5L2KB 2K6YA 3NSXA 3QWRA 4P48A 1IC7H 3HZKB 3HMWL 4G9FA 2EDXA 2PCFA 1KELL 2A6JA 5K93A 3Q6GH 1DHKA 4A38A 3BSZH 3GHEH 5F2FA 3EAKA 4N2KA 1Z6JT 5AZ2L 2R56H 2ZWLT 1CZ8L 3WS6A 4F2MB 5DVNA 3DDGA 1LDSA 3FJTA 3TJPA 1T22A 3FZUD 2V17H 2VLMD 1AXSB 4OT1L 3WNPA 1U8LA 1GA2A 3HN5A 1XIWA 4ISVA 2UY6A 1FYTB 3EGSA 3HC4L 3IDIB 2UZXA 3JV5A 1M1SA 3O4LA 3RIKA 3R7QA 1AKJD 2OCJA 4D9LH 1M05A 1J12A 3QXWA 3K1DA 1SLXA 3PGFH 4GSDH 4PJEB 2JCCA 5DEGB 3UH8A 2YQGA 2WINB 1IM9A 2B2XH 1ZE3C 2IWEA 4RGNC 5DT1H 3PPSA 5DZJA 4B0MM 4L9LC 2BJML 3DETD 3LZRA 2YKKA 3AWGA 3IEAA 4HKZB 2GJ6D 5JR1H 3R18A 2KLTA 5DLLA 1H9DA 3K4ZA 2R51A 3HVDA 4X6BB 1X5GA 2ZXEB 3QFJD 3MRKA 3NSYA 2ITCA 4GO8A 5CUSL 1A1NA 5B21A 1A64A 1G1OA 3B34A 2OMYB 1EH9A 3JV0A 2AJXH 2XN9A 2DJMA 3LVTA 3NESA 2WXKA 5ALBH 3ZW3A 2HAZA 3VRIB 2HTLC 2CR6A 2N3JA 5FW7A 5MHSD 4LSPH 3U6RB 1KIUB 2ZAGA 1ZS2A 3CPLB 3HC0A 3HRZB 3VXQB 2IPUG 3O4OB 1U2CA 1F6FB 5D7LB 5E8NA 2IGLA 2APSA 4D7BA 3UBXA 4TSCL 4RZCB 4Y2OA 3N41B 3LD8C 3FUJA 3FQWA 5ACLA 4MA1C 3KDMB 3KLHD 2YXVA 1X9QA 1DVZA 4F1SA 1JHTB 3L4CA 4QRBA 1IC4L 1OY3B 3MRJB 1H6EA 4D0DA 4MNQD 2CUMA 2A38A 2VXUH 4IRZA 2Z31D 1DTUA 4NQVB 2HFTA 3WCYA 1NAMH 3L4YA 2KQMA 4JGMA 4WEBH 4JY6A 4XP5H 5DJYB 5CFAA 2A9CA 1RJZB 2B08A 3JWOL 3AXIA 1OSPH 3BW9A 4QD2E 5DO2C 4ZAKD 3ZGHA 1IKFL 2P5WE 2Q6WB 1ZHKA 3CZFB 4TUUA 2BM3A 2O4EA 3FTYA 5LAXA 3BUQA 1MCOH 3L3IA 4U1SB 2QGEA 3QNZB 1FLRL 3TTYA 1NGXA 1E7VA 3P4MA 4LPVA 5I1DA 2AK1L 4XBPA 2DBLL 4JFOB 4B9JA 1K8IB 4FFYL 4AYBA 1RZIB 2NY3C 1QFOA 1LM8V 3C2AL 4X50A 2ZTBA 5C0AE 3VFWA 4AX3A 2X6UA 3J27A 2QQNH 5DA0B 4JCWA 1JWSB 3QIUA 3IJSA 5FXCH 5PCYA 3ROLB 1MI5B 3S2CA 3VACA 3W9EA 1BM3H 1X5HA 3ARGD 3RWGB 1QBLH 5A6IA 1WIUA 5I2IA 2XBZA 3CK0H 4PVMA 2FJFB 4BSJA 4YSPA 1OPGL 2Q86B 1HS6A 3MKGA 5B7FA 1T03L 5MENA 1HZHH 3FBKA 1T6BX 3D85D 1SYSB 4EE2A 1VGEL 3WBDA 3VUAA 2FBRA 4K8RH 5LGKA 4U7MA 1ORSA 5DZ9A 3ZTJG 1J9SA 5DS8B 5B1JA 5T1LD 4E41E 3Q9PA 1RK0A 3IVKB 4U2ZA 4Z7NF 1JF1A 5J8OA 1Y07A 2AQNA 2WOYA 4PTTB 3MLPA 1GGCL 2F0CA 2FT7A 4DZ8A 1JK8B 3KPRD 3NA9L 4BZ1L 4FL4C 3NIFE 3IGUA 2CQVA 2P5PA 1OB1A 2ESVE 3VX0A 4FQ1L 1YY9D 1DE4B 1R3LB 5E2UL 1UJ3A 3LD8B 2WXOA 3X3FH 2CLVA 5EU5A 2EKJA 4FG4A 5I17B 5DD1L 1JDAA 5I1CL 5GSVA 4EMZA 1F45A 4ZMVA 4MA1B 4FQLL 4TLSA 4HQQH 4R4FL 5DUPL 5E8DL 2OTUB 2YAEA 5DJXB 3TN0C 4F8LA 4YZWA 2BMKB 1PKQB 4JJ5B 3SKJL 3KXFA 4JFTA 2Y36L 1BGXL 2F68X 5F0JB 4Q6YA 1J5OH 3B8YA 1U8NA 5G2NA 5KVDE 4N9GB 5I6XC 4J3OC 2JJUA 1EHKB 1HX0A 5DO8A 2E7LA 4FTVB 4ESKA 2NSMA 2DYPA 5D7EA 4OD2B 5FYKH 2MTAA 3WAJA 4ZX5A 3RKDD 1KXTA 4OZHB 2YFNA 3PWVB 3CG8A 1GPOL 4NQCD 4ZMTA 5J5EA 1LO2H 2I60H 1K85A 1JVLA 1F6LL 5I6NA 1SJEA 2AITA 2EABA 4WRLA 2CRIA 3G5YB 2JJSC 3QPXH 5HYEA 1S5HA 3VU2A 1LE9B 4OZFH 4HFWB 1RPUA 4QXGH 1SBSL 3D52A 3Q01A 3TCLB 1Y6MR 4BWTA 4OV5A 3S5YA 2NQDA 3GNML 1I53A 3JUYA 1OPOA 3MZGB 5FYJL 3FOLA 2R23B 1FIGL 3KWTA 2IAND 1H8SA 4PV9A 2F7OA 1D5ZA 3L3DB 4M7JL 4KKBC 3UMNA 2ZE0A 5FYLD 3X3GH 2Q5BA 3S5ZA 3ZSSA 4MQ7B 4EN3A 1CDGA 1PZAA 3HZVB 3MGTA 4LNRB 1PG7W 3HE7D 3QXAB 4O58L 1O75A 4LSTH 2ZPKL 4OQTA 4N6RB 1A6TB 2CGRL 3FQXA 2DMHA 2WLZA 5GS0H 4JREB 3ARFC 4UQEA 2CO7B 4XNMB 1Y18A 4JDTL 4LPWA 2VLRE 3IU3A 3UABA 4EUPG 1GS7A 5F7MC 3BISA 5LAPA 5DK0A 5C6TL 4QTIH 4GSRA 5EEZA 4P2QB 3QJXA 4IK6A 3D6GA 4P9MH 1QFUL 4WV1C 4IIQA 3VXUB 1A1MB 2ZX7A 1ASPA 3QSKB 5E6IC 5IV2B 4GY4A 2WXNA 4ONFH 2GTZA 5BXFA 5L88H 1NMBH 4EZLA 2XTJB 1ZPUA 2CRYA 4Y1AD 2AV7A 3QJVB 5CCHE 4MAYB 1DQJA 1Q1PA 3F7VA 4KTEH 3FN9A 4TVPL 1UH3A 3CMOL 1NSNH 2P52A 1LEGB 1SJXA 2FZ3A 3L5XL 3WL9B 3OWEA 3TN0B 2HSIA 4IYKA 1WTGT 3SDYH 4WUKH 3HAEB 3T9WA 2R2EA 4HWZA 2HX9A 3WTWA 5CWSA 4WWKB 1NLDL 3HNTL 3FMGH 2HFFA 2D31B 3PYCA 3BGFC 3ZQXA 2BNRE 4TQEL 5JIDA 4JO4L 3L3GA 5INDA 1NCBH 1OEZW 1QSEE 2H7WA 5JIPA 2CAKA 3GJEB 3DXAB 3KYNA 3NEXA 4QT5A 2R1XB 2VDPB 1EXUB 5AFAA 1YYCA 4YO0B 3QUGA 5AKRA 4DVRL 4X9FA 4F57H 1WBZA 2I07B 3LXCA 5C0ND 4UINH 3BAIA 4XT1C 3S37X 1A6VL 4HUNB 5GRZA 3TBYA 3L3KB 4R7LA 1LGVA 2SEBA 1DJSA 2VLJB 1U91A 2EC8A 4NLHA 4P2CG 5I1AB 1FQ9C 1I1AC 2JJVA 4HS3A 1KEGL 5DMIH 2OTWA 5E8PA 1TQBC 3S36H 2FUQA 3MYJA 1HOEA 1MXGA 1Q9KA 5DD0H 3OG4B 5MI0C 1FGVL 1W91A 4J6RL 4G6AC 3RDJA 2AJSL 4Z18A 1HHHB 3AREB 1FE8H 4UT6H 3SY6A 4QHKI 4EBQH 3EO9L 4MNHB 2IH3A 3IS1X 4M7ZB 5PAZA 4NP4H 4DP2X 2X6MA 5HYFA 1T4KA 2Q87A 2W65A 1IQWL 3RVUD 3Q3GA 2Y5TB 3VXSE 4X9IA 2JCWA 4WO0A 4YBLC 3HB3C 4OCRL 3T2NH 4MJ2A 3UZEC 2LLLA 4XMPL 2DYRB 4JFXA 3WGUB 2ARJB 4YE4L 5F0LB 2ODIA 5F1NA 3KBPA 4N2NA 1MFNA 2FX7H 1FUNA 1TJGH 2VDNB 3D4YA 3OMIB 5I73B 2JMRA 2NNAA 1W80A 2H2SC 4A7SA 3IDGB 1DJIA 3WN5C 3QG7H 6CGTA 4PHZA 2BOCA 1JHLH 1XO8A 2WWKT 4UB0H 3RYMA 3WNMA 5LWYL 4BDVB 3GMPB 1A1OB 1Y6NR 1GZPA 5GQBA 5ADPL 5CBAB 1FZKB 1UXMA 3NIGF 4WV1B 1R5VA 4PJ5D 5L7XL 3O45B 3FU8A 3EADA 1FFOB 2F58H 2E9GA 3BPCB 3IS0X 5AEAA 4M62H 3P4OA 5ENWB 1FIEA 2EDKA 3QPKA 2G3MA 3LB6D 1ACXA 3L9BA 3OAUL 4JUTA 5H4ZA 4H8VA 3QUYB 2BS9A 2OV0A 4YHNB 1T20A 1Q9LB 3V0WH 3MV8B 1M2VB 3EYQD 5DWUH 5JORA 1RVFL 3U30C 3QQXA 3RY6A 1N7MH 3BGFB 4WI6A 3E2HC 3TZVD 2ZUXA 4MS8D 2P5WA 1DBAH 4N2EA 1MCWM 4FXGA 4Z6AT 1N6QH 3H54A 3MLZH 2GY7B 2YSTA 3HLAB 3JYBA 5E9DE 1FI8C 1HXMB 4F15B 4NQEB 2LLNA 3R19A 5GJSH 5C0AA 1ESOA 3ETTA 1UH4A 4HUXB 4TSAH 4Z7OE 1UFUA 2ZXCA 1MCKA 3JTTA 1AR2A 5E6ZA 1J1XL 2BVOA 2XWBB 5ICZB 2YN3A 5JLZA 3MLWL 5MI0B 2ICWI 3MJ7A 5JPNC 1DBMH 3DIFB 5T5NF 4UILL 4NBYB 3U0TA 3NCJH 2C9AA 1HEJC 3WKMH 3BFOA 4DO5A 2CKBH 2EKSB 3DV4A 1KJVB 4KUZH 3UDWA 3PWJB 1S7VA 2NR6C 4YBLB 3ILQC 4NJAH 4FE9A 3FQNA 4UNTA 2PCPB 4JX0A 2BIMA 1NMCB 1DL7H 3CE1A 4GH7B 2CIIA 4Y9CA 1EXHA 1XIWD 4GG6E 2MQGA 3MA7A 4E41A 3EH1A 2AJVL 3EGDB 3SKOA 3O4LD 2W60B 2VN5A 5CZVH 4ZUUB 3WN5B 1IE5A 4U4BA 2VDRH 1CU4H 1S78D 1MWOA 3L2NA 4N0UB 2JB5H 3U2SB 5J12C 4AEIL 3UTSD 4L23A 3TESA 4NRZA 2ESVA 2OI9B 2X9ZA 1R5IA 2FHCA 5JO5A 1CF8H 1G7QB 1SVZA 4S1RL 1QBAA 3BT0A 2CPCA 3UJTL 2J88L 4XNXL 2IH9A 2ODHA 5DSCB 4MXWL 1KXVA 2UXFA 1LWJA 2IEPA 3E8UL 1M1XA 5IB4A 5K9QI 4Z7VE 3C5JB 1KJ2H 4J5VA 1XGUB 1QFWM 2NXYD 4JDVB 3HMWH 2XN9D 4R7DB 5HYJB 3KYAA 1ONQA 2JLPA 4XMWA 2Y7OA 1A2YB 4DEPB 5AZ2H 1T5WB 4YSCA 4U0RC 4G59C 3ZSTA 2H41A 5EU7E 3D69A 3BN3B 3FKUS 4IBLT 3V5DA 4G8EA 5HGAA 4XC1L 3E2HB 2AKRB 5D1ZD 4LZKA 1CPUA 3ULUE 4X5WA 4GQPH 2NY4C 1YNTA 2V8LA 2QLVB 4XO8A 5I5MA 5D2NC 3AZUA 3T77A 3MAWA 3U0WH 1DLFH 2FSEB 4LMQE 2VDKL 5CSBA 5EZLB 3SQBA 3L3JB 3NRFA 4NRYA 5HHQB 3S37L 4P4RA 4AM0A 3FO1B 1VF5C 1ZS8A 2HVJB 4U1GB 3TFKD 5KSAC 4OJFH 2JQMA 3NZ8B 5LN8A 4AKPA 1HESA 5FK9A 4M4PA 4LPCA 5IQNA 3TH4T 5IGXL 3CQFA 3B3IB 3POHA 5JPNB 4WNSA 3Q1EA 1UA6L 3LNDA 5AAWC 3O3EA 3S3SA 3EXJA 4AEEA 1F6AA 4OLXL 2Q1EA 2MNUA 1EHNA 5JIIA 4OAWB 5EOCL 3HG5A 4IJTA 3K71B 1OP9A 5DHDA 4PYGA 2EACA 4QOKE 4ODWA 5F72S 2F7QA 3WFBL 5SV3A 3G5ZA 2CUHA 2Y3AA 4PQXA 1AGDB 2VLRA 5TDNA 1INEL 2FBJH 2JJTA 2WIMA 3APFA 4CVZA 2ZUYA 2XVGA 4TSCH 1WG3A 2P28B 2R1WA 3QIUD 5F9JA 2WBKA 2WP3O 5B3NA 2FLRT 1A47A 3IJYB 4Y4KA 4R4BB 1FG2B 2XWEA 5KYUA 4RBPH 4FTDA 1CO1A 4YSDA 1GL4B 3GXTA 2AFNA 3MV9B 5GGRB 1C8PA 1LP9F 3AB0C 3LQMA 4PJIE 2DLFH 2CPUA 4P57A 4HS8L 2M2DA 2K7QA 3NFSL 1SQMA 2WZ0A 4K2UL 2CDFB 2OBGA 4ABQA 2OMUA 4NQSA 4HSCX 1UVQA 4KI1A 1RPKA 1XL4A 4GMTH 2DEXX 3LKQA 4RA3A 1T04B 2VH5L 4NZUH 4MJ5B 5IFAL 4PM1A 4FI8A 3GIVB 2BNRA 2MOGA 4N0FA 5BVPH 3PHQB 5A16A 1WRFA 1XH1A 3U9PL 2C26A 4WUUB 1LWRA 4S10A 1A7NL 1PNDA 3TWCH 4MAZA 2AK1H 3BZEA 2DBLH 3MU3A 4U1JB 3BYTA 4NRXB 5IB3A 2NZ1A 2Y1VA 4BUQA 5I82A 2GEQA 1BV8A 1KBKA 2NY4B 3IE9A 3DMMD 4GI8A 4YHYC 3KAAA 2ZKWA 4WFFD 2FNWA 1PSKH 1IBFA 2X4SB 1QA9A 5KVFE 1J7VR 4LSDA 2JF1A 1CDYA 3KGTA 1Q8MA 4W9ZA 3MJ6A 4NUMA 3X1BA 1HYSD 2DQEH 2E86A 4JPVH 1U8JB 1E28A 3ROOA 4KWUA 1FVEA 1RH8A 4X0KB 2Z8WC 1E6OH 4DW2L 4G5ZL 1ERNA 4NUJA 5FGCE 5KSAB 3KXFD 2ITDB 2B9BA 3CIQA 1NGYB 3VI4F 4HK0A 1SGKA 4G42A 2I7OA 1ZVSA 3C5ZC 4U33A 1OPGH 3DVNA 3HHMA 5J06A 1T03H 4WZ9A 5IB2A 2VSDA 4FQPA 2QFPA 1VGEH 2WQVA 2DYPD 3VXSA 1I8IB 3O2WL 3P11L 5IW1A 3JBG7 4YDVA 3MRDA 4N2AA 3T71A 2VITA 1GYCA 1AQKH 3C08L 3CXDL 3MRCA 3PGDB 3HHSA 2Y2WA 5DJ2B 1XDTT 4PTUA 4AUUA 5E5MB 1RZGA 4NQDB 4M61A 3MXWL 4PRIB 1VACA 3KBFA 4Z7QF 2J8UB 4MZIA 4EKJA 1P5VB 5BZZA 1TTUA 3FB6A 1SDDA 3OGOE 3B2UC 4MMYA 2YGPA 5F1KC 1SY6L 2X4PA 4LSRH 5H2BA 5HY9A 2PR4L 2BP5M 4F1ZA 4WFHD 3LRMA 3GSNL 5EHFA 2BRRL 4FP8H 4P3WA 5DD1H 4LSVH 4E9WA 5I1CH 1K3IA 5K9KA 4OLEA 3RWCA 1UG9A 4EN3D 1MFAL 4ORGB 4FQLH 2WYTA 5CBEB 3RTLA 1HYRC 2DLTA 3L3HA 1WYJA 2X4RB 1EEZB 4X0NA 1KBWA 4GW4A 1BGXH 4Q9BA 4YR6A 1SJHB 3VD5A 4XVSL 5BZWA 2O5ZL 4NCC2 3MRLA 4UTAA 1JPFA 2R27A 5LBGA 2E46A 4CU6A 2D3JA 3LVEA 1AMYA 4KC3B 1Q0YH 3F01A 5FB8B 3ZKXC 4CAGA 1DYZA 4QUOA 4P4KC 1KTLB 1OCZB 4YSAA 3RB7A 4HP5A 5TE7L 4Z76B 4JJHA 4ZX3A 3MACH 2W07A 1JPGA 3H1ZA 1QNZL 4JFHD 5I1JL 3TV3L 1DVUA 1FJ1B 4YK4C 2CMRH 2BCKA 2BS8A 3GKWH 4QF1A 2A9DA 5E9DA 4U1NB 1F4YL 2KBGA 1ETB1 1P6FA 2M8XA 3GSQB 4YHYB 5HJ3A 1KB9J 1MFDH 3GRWA 5HYSG 5IVXE 4F37F 2OA9A 3L5WA 1FIGH 4L37A 2HTKC 4JFUA 4I8DA 3UYOD 3ZIMA 3VG0H 2XWJB 3GM0A 3PWNA 4EI6B 3TV8A 2YHGA 3EBHA 2D03L 4RQQB 3C5SB 3QQDA 3RTQD 5I8EA 3SGKA 3IFNH 4OUUB 4RIRA 5HDBE 4CRPA 2OR7A 8FABB 1S9KC 3IJ9A 1KIQA 4NN6C 5CGTA 4QR7A 2NW2B 1P53A 2TAAA 4K23H 1Q4NX 3DX6B 3QP3A 1W72B 3SD2A 2WZPA 3MBED 5E2VL 4XMLH 4P2RA 5DLML 2QPUA 2FRGP 3IJEB 4A2LA 3TCXA 1LTXA 4F5CE 5CJXA 2MHAB 2W0KA 4QO1A 3IDMB 2G4EA 5LLIC 3C60B 1RERA 5GRJH 1V7MH 5E56A 4JQXA 1NGWA 5BS0A 4RX4D 4BFJA 2IBGA 4GG6A 1EHXA 1BJMA 3C6SB 4CU7A 4Z3HA 1IAOA 1P7QB 4ZTPH 4U1KB 5IJBC 4JAMB 2K3TA 1INDL 4HJUA 4W6YB 3ZE1E 2XCMC 4S1QH 4R7NB 3TA3A 3WMSA 2EJ1A 5B8CC 3SE4C 1BWMA 4PIBA 4FI6A 2QSVA 5FDWB 3ZQWA 1VEOA 1FVDB 2PN5A 4O51B 5E2JA 3A47A 3JTSA 5FDYA 5D8JH 3BWSA 3L5XH 3OG6B 4K15A 4PJGB 2AQQA 5D5MB 1AY1L 2VMFA 3BEVB 3N44B 5GGUA 4AT6B 5B38A 3BO8A 1GOFA 1KYFA 1IAKB 3EIFA 1QLFA 3D39E 3GK8L 3HNTH 3CGTA 3WUWB 4Z7VA 2QFRA 4JDZB 2CDEB 4JO4H 1E3XA 4W9IC 4X6FA 3IKCB 4LLMA 3LRLA 1HEHC 3NFNB 4AQ1A 1KPUA 5TH2B 1R5WB 2FJGA 2HVKA 3AS0A 2YFOA 4M5ZL 4NO0B 1H6FA 3PWPE 3B2MA 3FFDB 4PLOB 3RWJA 3V0VA 2FNBA 4X7SH 1B6DA 2JK5B 4XXWC 3V6OC 4EZJA 2XN2A 1T7ZA 4LCWD 5HPMB 3TBSB 1Q0EA 4N9OB 4PJBB 2Z64C 3IFLH 2H6PB 5IIEB 1W2KT 2BXZA 4AVKA 2CJSA 4KU1A 1A9BA 4B6ZA 3MX0B 2EDTA 2UWEE 3FSAA 2WUCL 2ADFH 5GHWL 4DK5A 2V4LA 1PF3A 1QUNA 4H13C 5GGVY 4AL8C 2P8LA 2R4SL 1IQWH 3NIFF 4JCMA 3BPNC 4WWPA 3KW8A 3C87A 3MPCA 1P2CB 4OCRH 1HHJA 1UWXH 2P5WD 4X7CC 5HDQL 4NENA 1F3DJ 1HNYA 5DD6A 1J5DA 1OW0C 1ZT4A 2KLRA 1DQVA 1MOEA 4B3EA 3VWKD 4ZYKA 4ZUWB 2GPZA 2OMVA 1YECL 3CSTA 5A3ID 3RWFA 2W95A 4QOKA 3OKOA 2WJ5A 4W68A 4NZDA 2AZAA 3NP4A 4KROC 5JYLA 2AS5M 5C0AD 1ZXQA 1RZJC 4JKWA 5LWYH 2ZZUT 1T21B 5D4IA 1G84A 3V0GA 3BVTA 4DP7X 5BW7C 4HIIB 1DEEB 4J6IA 1EHAA 2Z91B 1ADQH 4X83A 3RWDA 2AV1A 1KF9B 3CVCA 4V33A 1G43A 5B8CB 1T66C 1KENL 2OQJA 4F58L 4JN2A 2P5EE 3KZ8A 3HI5H 1UATA 3PABA 4MB3A 1V3LA 2WXGA 4BFRA 1T0NB 4XNBA 5HVFB 1CLCA 2G30A 2EIJB 5AW4B 3QFDA 3MUJA 2VMCA 3BFQG 4GNKB 4HD9A 5TQ0L 3LX9A 2YC1A 4GEJA 4HZLB 2OZ4A 4BK5A 1CDIA 3FONB 3OLIA 4Y9GA 3GBNL 1NBYA 1PLBA 4G7SB 1GSKA 4UU9A 4AVIA 4YHLL 3PIQB 2W9EH 1P5UB 3NIDF 4NSKB 4E41D 4PGDB 4JRYB 1F18A 2KZ1B 3UAEA 4RLDA 2EDNA 1TFPA 2YXFA 3BVNB 3CHOA 2IALA 4ZFFA 4MA8L 4D8PA 2JTDA 5K59F 5FYKE 5EB9A 2ESVD 4K3EH 3GI9H 4GXVL 4HKJA 3DHUA 1CQYA 3MLUL 2WB7A 4LEOB 3IDJA 1VFMA 2PUQT 3O6LL 4DKEH 2I9LA 1A6AA 3MBWA 4CUCA 5DRNB 1A25A 2ERJC 3HN8A 2R0KL 2K6WA 3RUGA 4JFYB 1G7LB 4XMKH 1FV1A 4UILH 4XVUD 5CCKH 2YN5A 4OCSL 2I25N 5DJ0B 3B2DC 2BP8B 3E6FB 1U3HA 3QIBC 2FECL 2ALWA 3BPNB 1CFBA 4MX7B 4JANA 3T3PE 4IU3A 3CC1A 4NDMA 2FYYA 4D9QD 2PTTB 2I69A 4YSSA 1HJCA 2YPLA 1JI2A 2VXQL 3N06B 1U4EA 5AVYB 4NS0A 1RD6A 5DUBA 4AI7A 4PWEA 2VMDA 4N5ED 5IW3A 2XT1B 4YHOL 4I85A 3Q1SL 2PCYA 4UF7C 1MJJA 3GHPA 3QW9A 1SXSA 2EIDA 5INCA 5H37A 4XI5C 2C7UB 1S7XA 1JDCA 1E4KC 2FB4L 4HHAB 2WTRB 4IRJC 2J88H 2B1AH 1RJLA 2K9FB 3G9VA 3GHBL 3OR7A 1BF8A 1JZ5A 1QKZL 1UOKA 4HUMB 4MXWH 4YFLI 5EA0L 5LGHL 4E5XB 4L5FH 4L29B 3JVGA 5JPMC 4M1DL 4TV3A 1FN4A 5FYJD 1OF2B 3QDJB 3DX7B 3E1F1 5DUJA 3HR6A 2IDFA 3HS9A 1DBKL 3KCPB 2NY1C 4P2AA 2X2HA 3AY4A 4AMWA 1ES0B 2Q20A 3MJ8B 4FFTA 5FLVA 3ZGIA 3F84A 3WEMA 1LD9B 4PJ7B 2VLRD 2Z4TA 2JJWA 2XFGB 4KX7A 2HFEB 4M7LL 2MCAA 2FO1A 5DRZB 4J3UA 2A6KB 2EICA 5FGRA 3TIEB 1OL0A 2RGSA 4GSQA 3BSZA 3V6BR 2QELA 4DUVA 2DQMA 2H3KA 4A55A 2KERA 1K2DB 1JVKA 5CIPA 4LRIA 5IQLA 1KZQA 2FQEA 4HBCL 1YNLL 3O2VL 3UAFA 1MG3C 1GJIA 5E1GA 5K39A 3QJHA 1RK1A 4XX1G 3S37H 2R0WL 3IMTA 3DBXA 1G9MC 4FKHA 3DUHA 3G6JB 3M8OL 4PS4L 1M7UA 5IVXA 2BHZA 2FWSA 1RLBA 5DJDB 3DUUB 5C0JB 4YDLC 5T5FH 3TO2A 4NUQA 4H88L 1VKXA 1FPTH 2CWRA 4JO8A 5E5UB 4Z7QB 1ND0A 4PP2B 3UPRA 3ECBA 1LEIA 1CL7I 3OC8A 4KAQL 1LE5B 1H8LA 3DTDA 3QNXB 4PP1C 3FRUB 2BVEA 4TVPD 1ULVA 4HIJA 4ZUSB 2WBJB 1N4XL 4FAAB 4R26H 1WO2A 1J1PL 3CXHK 1OQOA 4LBEA 4V1DA 5I16B 4LLVA 4N86A 4HJ1A 4QKXB 4F5CA 1IC1A 1IL1B 4N0RA 4PRAB 5J1SC 3KPOA 4IHBA 4EXKA 2J6EH 1BAGA 5I1LA 2FHFA 5TE6L 4F91B 2P7TA 4F8TA 3LKPB 5T33L 1LK3L 4DQOH 4NQXA 4JHAL 3FPXA 2EUVA 4PWGA 4QJ3B 3S9DB 1TZGL 1BZDA 5HSFA 1KEMH 3VD2A 1OGTB 4EIUA 3H3PL 4FMVA 4YBQC 3TPUA 1GMEA 2QSQA 2UUDH 2LU4A 3AW5A 3UJIL 5EBMB 3HC3L 1DVSA 4HS8H 3FT2A 4X4MA 3IGLA 5CSZB 4BH7B 4E9YA 2AAAA 5ID1B 1GGIL 4F24A 1CLZL 4HF5L 4FQJL 4QRQA 3CFKB 4U1IB 4CNIA 1F4XH 3P4NA 3VXSD 2HMID 3LPFA 5D7KD 5T1DL 3QAQA 2B8OT 2EYRA 2YPVH 3W56A 4Q7DA 2NNXA 2WCPA 1BG9A 3BN9D 2VH5H 3MLTB 1BJ8A 1OK8A 1X5KA 4RBPK 4U1LA 5DI8B 4Z7OF 4DPCX 3WJJA 5IFAH 5I8KL 3IDNB 1NAMA 1VFBB 5ICXB 4UAOC 4FMKA 2YMOA 3U9PH 3LS5H 4X7TB 2WY3B 4L1DA 1KTRL 1MCDA 3CVHL 1ZEAL 3LMJL 3V5KB 2HPTA 1C5BL 3F6JA 3PWPA 3FOMB 2AXHA 4KXZH 5FFLA 3QI9C 1A4BA 4RGMB 5DHXB 3UCRA 3DBSA 4JG0H 2H4EA 3NDZE 3C6LB 1JPEA 2Y22A 4XBEL 1P6WA 1X3DA 2X3CA 3ARUA 2BFVL 1F00I 3DHPA 3QUMH 2YUVA 3QZOA 4G7QB 1EJFA 3CPUA 4JM2D 2VDNL 4I0PA 3HFMH 3QO1A 5I1HH 1NGPL 1QR4A 5BPPA 1EERB 1NA8A 2YD2A 1MCQA 4G5ZH 4YPGB 3IFPA 4B0MB 3GMLB 4XAWL 1GZQB 1IBZA 3BKCH 2ICES 2UWEA 3W0WA 4YDLB 2RA1A 5DQ9B 3BCDA 4PG2C 1SEBA 4A2MA 4NIYE 3O9WA 3BI9X 1CE1L 3ZRSA 5J89A 1KT2A 3X13B 3BSHA 1R19A 4TS6A 3RVVC 1HILB 1NC4B 3KPMB 3Q44A 2DWSA 1HDMB 4GW5A 4RDQG 5BZDB 3UTTE 4NN7B 1U3YA 2CIKA 4FYQA 5D1XE 1XF4B 1BAFL 3G04A 2E5EA 5D1QA 3DX8A 5SWSE 3EBAA 3F6IA 1XCXA 3UAAA 3L13A 4LCCB 2GCYB 2ICEC 3ARDA 3SKMB 3W5NA 3QUZC 3U36A 1SY6H 2CJUH 2KQNA 5IK3A 3WU1A 1KGYE 1GZHA 2VN6A 3H85A 5JQHC 5MEQB 4HH8A 3HG4A 1PZ2A 4K73A 2DS4A 2BRRH 4JPIA 3T8MA 3VFNB 1HCFX 2X4QB 1MCPL 3SBPA 4B9YA 4KX8A 4OGYH 2NZ9D 2CK0L 1ITCA 4TPRH 1MFAH 4O02B 3SQOL 3BIKB 2DM3A 4X6EA 1GR7A 4NJ9L 4Z7WF 2P5EA 4W4OC 4YH6A 1HWWA 1N8ZA 2J21A 2WZPD 1TKWA 3UZVA 1F8TH 4XTRD 2OK0H 3CDFA 4P2RD 3U0PA 1HWHB 4O5LL 4UCFA 1NFDB 3EG9B 3PP4L 1UASA 4F7MB 5LDSA 4IS6B 3C6EA 4JFFE 4JPKL 3W9DA 2VR9A 3HUJB 1AHWB 4NPKA 4EPSA 5BS0D 2ZAHA 4UAOB 5MP6L 2H0JA 4MMZA 1P7KB 3VXOB 5IQ7H 2HKFH 4U6TA 4FA6A 3FQUB 2NUPA 3MV7E 1QNZH 4OLUL 5EF3A 1QHPA 2CHZA 1JN6A 3TA3D 3X14A 2EEXA 1E6JL 1XF3A 4ES9A 5E2TH 1O0VA 2PO6C 1FDLL 4LOUD 1MFBH 3QI9B 1RZ7L 3DHJA 1JMZA 1UT9A 4XB8A 2IADB 4PLKD 1H3WM 3VXRE 5LGJB 1J05A 4OFPA 5JMOC 4L9LA 5AZEL 2OXHA 5EO9A 1E43A 1F42A 4C58B 1XGYL 2LV4A 4JZOB 4L1HA 4AH2A 2KPWA 5FHBL 1X5LA 2AQ3A 1AR1C 1MW0A 1S8DB 3Q13A 4E9SA 4OZFA 1CUOA 3DOSA 2YWYA 4GBXC 5F3HB 3FSOA 1NUNB 2WSPA 3BVUA 3STZB 1J0HA 1K4CB 4PRHE 5CLXA 1T1YB 4M43H 1CGTA 4QHPA 1IGTA 5C7ZA 3T8VA 5B39G 5AW6B 4I18B 5DLMH 4Y19B 1PX4A 3ILPA 5AVWB 1ZJAA 4Y9EA 4NWUL 4KNUA 4NLAA 3V4PB 4AV0A 3CHXA 1AIFB 3QNYA 4PJIF 5T3XL 4WAFA 3ULUD 2O6EA 4CJ0A 3SB3A 4O2FA 3GSRB 3MLRL 4I4WB 1CFNA 1F4HA 3BDBA 4XOAA 4I3RH 5IBUG 2ENSA 2EDWA 5GRWA 3OV6A 3GMRA 1LQBC 4L4TB 2IV9A 2C9SA 4JQIL 1CD1B 4HAGA 1CI5A 3UGXA 1CFTB 1OVZA 5EPMB 1T2XA 3BXNA 2FEDD 5E99L 2IVFC 4GKOA 3V6FA 4MVBC 1ZHLA 2OMXB 3N5AA 5ISZB 1AY1H 3I6GB 4FFZH 4XPHH 4Z3FA 2D0GA 1EJOH 4EEEA 4PJDB 3ULVC 2X44D 3MYZA 3VSUA 3ZIYA 2PF6A 4PCTA 5DU7A 2A74C 4HJEA 3VG9B 1BZ7B 3RX5A 2V9TA 1OCWL 3VFRA 4KX9A 1EGJL 2YBGA 1GIGH 1D6EA 2OL3H 3NCCB 3QORA 5EIIB 1I8KB 4M5ZH 5FOBB 4XMXA 1NCGA 3N1GC 1UACL 1MHEB 1BEXA 4NC2B 4WHYH 4XCFH 1H3TA 1UD5A 2BSSA 4OD3H 4ZXBC 3G6DH 4AE0A 4FQXD 5G4OA 2D3VA 1I9JH 3FC8A 3MUGA 3K6FA 4HPHA 3BUYB 4QTHB 3OB8A 3E6HB 5E23A 4F3FB 5KYXB 1JDDA 1VZIA 3X1GA 5EBWB 1MFUA 5ES4B 4XGZA 4N2IA 2O61A 4KZEH 4JJOA 2DN7A 3IJHA 3IMRA 4YHPB 1XTMA 5IWLC 3F5WA 3GB7B 4B53A 1QUPA 4LVNC 1D5MB 2IQ9L 1U42A 3MV11 5GHWH 3V4VB 2ZWYA 3E80A 2RIKA 1AR1B 3P3TA 3E7JA 4HT1L 3VXNB 3UMTA 4GBXB 1CL7L 1KXQA 2CHNA 2UV3A 1Q94B 1HI6B 3B7RL 5IOPA 4OGAD 4UT6A 4MD0A 4AV5A 3VFMB 1D9KC 4KHTL 2WWMC 1QR1A 3BVDB 1B4TA 3CQPA 2R2HA 2F54E 1I7ZB 4JFQB 4Y1TA 2Q7YB 4ELDA 2EUXA 1YECH 2N0KA 2J5WA 4UUJA 2QMKA 4GUCA 3EOBB 3EBIA 4BRJA 1FHNA 1XGQB 4X98B 3FCUB 2J1ZA 4KMLB 1A4CA 1Q9WA 4ELMA 2X9XA 2XRAL 2K7PA 3B5TA 2ZOOA 3C12A 4CW1B 3TNMA 3QUXC 3H0TA 3QZWA 3AXLB 1ZTXH 3KJ4C 1PBYA 2OMTA 3QK0A 4ZFOB 1UWXK 1BFTA 5IMOA 3OAWA 3EOTL 5JHAA 3ZBMA 2IMMA 3RWEA 1AOZA 1KENH 4AQEA 4F58H 5E1AA 2C9PA 3T4YA 1TZHA 2B14A 3KNBB 4PB0L 5I76B 1U3HD 4WTWA 2Z93A 5E2WH 1AO7D 5GSRB 1KWGA 1T0MA 3N55A 4AM0Q 4XZUB 2Z3FA 3JWNC 2WNGA 5TQ0H 1AVAA 3UTQA 5IQ9A 3LH9A 2TSAA 4PMFA 1R3HA 2R4RL 3QQ4B 2H6UA 5D7HA 2N56A 2YPLD 3Q7JA 3C8HA 3QNFA 3O3DB 3WXWL 2X4OB 3LKNB 4GW1B 4P9HC 4IHOB 2F9BT 1IZJA 4X80H 3F04A 2MCMA 2J2ZA 1YUHB 1FNEB 2EILB 3IKKA 3NCMA 1ZWIB 2D2CC 2EIZB 2XQBL 3BVXA 1JGDB 3T6VA 3RFZC 2VXTL 4YDNA 1MIML 4APQD 4KDVA 4I9WE 4P06A 1NANI 1TQUA 3F2LA 4GXVH 4OF3A 1RFDL 2SODB 1JUFB 4ONHB 4K5NA 3IAGC 4C56E 5C0FA 3UZQA 5JOEA 1MWAA 3DETC 3O6LH 4XZ4A 1CDJA 3MXVL 3V95A 4LLYA 2QGBA 4EN2A 4R2GC 3MLXL 4QKTA 1KGCE 1MFCL 4FI7A 4MA7H 4LPYA 3P4LA 2NTSP 3FUEA 2YQBA 2CDGA 2R0KH 3I3EA 5DZPA 1Q90A 2WTPA 3T0XA 2AQTA 3OX8B 1UWYA 4FHBD 4LVNB 4GKZB 2LE9A 4C47A 2GUYA 1QVOA 2XV2A 1VCAA 2A1WL 5KOVC 1L6PA 3F7YA 5J0BA 1KULA 1DBJH 2LABA 4FYTA 4FULA 4WY7L 2CBOA 2F1BA 2CLZB 5L4JA 1V05A 3QO0A 5EORL 1UJTA 1I9IL 3U6XA 1AC0A 2CKBA 2W81C 5D1XA 1PLGH 3CFCL 2PTVA 1XBRA 2H1PH 4PCYA 3OZLA 4F7PB 3V4UH 3FQ2A 4YHIB 1HINH 1QRNB 1WFUA 3AS2A 3HNVL 4YHOH 3SJVE 4R97B 5E6IA 1AGBB 4GQZA 5EDXA 4LCYA 2JNZA 1T7VA 3TT1H 3GDBA 3KJ4B 1RQ5A 1G7MA 2Y7QB 3WXVL 1A3ZA 2IH1B 1TVBB 1SBBA 4XO3A 2WLLB 3I3BA 2Z31C 3SDDA 2FB4H 4JL1A 1YC7A 5GRVL 2Z7UA 2J8HA 4AGQA 2BW5A 5GGVH 2D9QB 3GHBH 4H1LB 5C09E 1QKZH 2ADJB 2JVUA 3NABH 5CSGA 5EA0H 4ZAKC 3S8FB 4F7KA 1J0IA 1DJZA 2OPCA 1WEJH 2VN3A 4G8FB 2AJZA 1MNUH 5IM7A 4JB9L 1DBKH 1KJ3H 3ZDZE 4ONGL 4FDWA 4V1DD 3U4BL 1FNLA 3ZUCA 5KBPA 5GS2H 3S97C 1F0LA 1ZD6A 5I71C 1KJ2A 1VLXA 1XVSA 2F61A 3WIHL 4M7LH 1KC5L 2PXYA 4JFFA 4TQHA 1AKPA 5BJTA 3O0RL 1GY2A 4XVJL 3TBVA 2UVFA 1OTTC 3RL2B 3VVVA 3WKQA 5D2LE 1AKJB 2I5YL 2QADD 1I1AA 3MV7A 1TITA 1URLA 4X8JA 1EZUA 3O2VH 5JTWA 3ARGC 4PJCF 1B2WH 2H47C 3DK2A 1CXIA 3DRTA 2XZQL 3ETBF 2R0WH 2RMNA 3DWTA 1LEKB 3VXRA 1EBPA 2A4ZA 2HJLA 3OJDB 4AJYV 2FT8A 2XQYK 2YRBA 1IAIH 1USQA 3FQYA 3OKDA 4YWGL 1SHSA 2IAMD 2GJ6B 1CT8A 2BNQE 1WCBA 3CD4A 1N6VA 5GGTH 3F12A 1M71A 2LVEA 1LDPL 3D5OF 3RPKA 1AFVH 3MRMB 3QFJB 3PF2A 2P48B 2ZF8A 3Q2VA 3AJ7A 2VZUA 4KAQH 1JK9B 5ID0A 1AS7A 2W1NA 2CCVA 4PJAE 3TFBA 2R1YA 2WUBH 3I6SA 1BXXA 1HHGA 1DSWA 3BP6B 4FNSA 4UWQB 4OJDH 3GSVA 3OJ2C 4OJCA 2YARA 4WWNA 1C08A 5C2UB 4FZEL 5H35B 3PWPD 3RIFK 3SCMA 3FF8A 4MCYA 1OAKL 1EIBA 1XEUA 3HAEH 3TF7C 2G2RA 4Z7WB 1DO6A 4GG8B 5IEHA 1YY9C 3FU3A 3M1BA 5DJAB 3HPJB 3IYLW 5KUKA 5AUMA 3LN5B 4A6YA 5DYFA 5ICYA 2YSSB 2O26U 3GI8H 3OKLA 2YS4A 3H9HA 1TZGH 4RMUA 1DQKA 5I19H 4Q9QL 3AT0A 4MCMA 5F89B 3ET9F 4J3OG 3V0JA 1MW2A 3QG6A 2VDPH 2CXKA 1M7IB 4TULL 3N85L 3UJIH 3WHE0 3CBJB 4I5BB 3W0WD 4MNQB 3MRQA 5F71A 4WJ5A 4G9DB 1OAXL 2Z31B 2H32A 4CVWA 4ZQKA 4ODBD 1LMIA 1ZA6A 4WGWB 3O9WD 1IQDA 2XBDA 4IQHA 4FQJH 4RAUA 2UYLA 2VMEA 4PRPA 5A2JH 3X17A 1F13A 3O41B 4ZAKB 5HYIA 4P5TB 4ZPTB 3FXIC 2L7EA 3JXAA 1KTJA 4XPGL 43C9B 4M6NL 5D1QD 2BWQA 4CA4A 1Q1JL 3BQUA 4AIEA 5DYOB 2UUDK 2VM3A 1RLWA 4K8RD 4TUJB 3TNNA 4UDUA 2FIKA 1K4DA 3ARDD 3IETB 3LMJH 4NKOA 5C70A 5KN5B 2AP2A 2V2WB 5HGHB 3MNZA 4UTBA 2QKIA 2BC4A 3MV01 1BFOB 4YZFF 1I82A 4L8CB 2WO4A 1A3RL 3ZT5A 3BDXA 4BSVB 3T0DA 3QVAA 4GRLD 3VYNA 4EVNB 4PJXF 2DB8A 4OIIL 5EIQA 3KGRA 2BFVH 5I28A 1P4UA 2R69L 1P1ZA 2XWXA 2VDNH 1CGWA 1IC5L 3ARGB 1ZKAA 4KV5F 1NGPH 3H3BC 4JCLA 2A9ML 1SYVA 4PRBA 4KK6D 4XAWH 3HE7C 1QEXA 1KBVA 1G1YA 4JKPL 2DQCH 2YD8A 3CH1B 4Y5YB 3WKPA 4DVBB 1U8CA 2FWOB 3FT9A 3DJRA 1YEKL 5T1LB 4RFEB 4YDIL 4ZUVB 5DZLA 3VX1A 1BAFH 3GUTB 4HYTB 3KPRB 4CC1A 4KK5D 3DDFA 2F54A 1XCQB 2FIRT 4BH8B 3T0VA 3FTGA 5FYKD 5KSBE 5CJQL 4G6FD 2FL5A 5DCCA 1CGSH 3AAZB 3H9SE 2DQUL 1UD3A 2RH0A 4N8VB 3SYPA 5A7EA 4FXKA 1CYXA 5AL8A 1B4JH 4ABVA 1BBJA 1CLYL 3OKNB 5ITBL 4RAVA 3QHZL 2D7NA 2X4UA 2BXYA 1MCPH 1GYUA 2G0LA 3EYFB 2CK0H 2IDCA 3CU7A 4ZNEA 3SQOH 4HU2A 4NFDA 1YN6B 1DN0B 3RVTC 4HG4J 1ACZA 1TLMA 3FTXA 2OYPA 1DFXA 1J0KA 2IQAA 3NN8A 2Q7AA 1CR9L 5D55A 2AJUL 4UZGA 4PVBA 1RUAH 2H0PA 5F9DC 5GIRA 2HTLD 2X2IA 4X4YA 4O5LH 4L5FE 2GBUA 1NEUA 2AEIT 4APXA 4M7LT 4FLHA 2ETWA 3Q6FA 5C0NC 1JYVA 3V6OE 3Q5OA 3TT3H 3DUSB 4NQCB 2NTFB 5MP6H 1TNMA 3FCTA 1HWGB 3IRCA 4J8RB 5GS0D 5D2NA 5SWZE 1SLVA 4AL8L 3OR6A 4GXUM 1C12B 5I5IA 1ITBB 1HXKA 4OLUH 2WM0A 1TZIA 5E0QA 4KJPC 4X4KA 4LDOB 1E50A 1NLBL 2DYSB 2W9DL 2LHAA 5B1AB 5GPRA 1Z5LA 5EOTA 4ZTOH 1S9WA 1T6WA 2IANB 3QJOA 4GUPA 5IVZB 4C56A 4ETQB 3RIAK 1ICTA 3ORJA 1XGYH 4FA7B 5DO2D 2DTMH 4PLNC 1JRHI 2X3BA 3RVUC 3SPVB 3T2QA 4A7VA 4YX2H 2X89A 4BGLA 3W2DH 1XSKA 4ZMAT 3J8F7 4ZOBA 3DSNA 4KJWC 4CN4A 3KR3L 3MRIA 4KVCH 4DGVL 1NDGB 3HE7B 3LQZB 5I75C 3I50H 3QIWC 1IBGH 6PAZA 1F90L 3LHPH 3QORD 5ITFA 1QEWA 1RULL 1ZLEA 2H45A 3BPLB 2DEYX 2C1PA 1D7DA 5HI4C 4UDTA 1BQLH 3CUPB 2JELH 2NY3D 3GSWA 3PGCB 3S35X 2CO2A 2VZSA 2AXGB 5DRXA 5DQJA 3HE6A 4BRVA 4WU5B 1GGBL 1U8OB 1XAUA 5L6YH 2KL6A 4HKBB 4HIEA 2Q2EB 2WB1A 2WLJA 1J0ZA 3AU0A 3IJ7A 4JQIH 3EZ8A 3SJVA 1U2YA 3V4LA 5KW9H 4Y1AB 4NBZB 4PWFA 1EHLH 3SO3C 5CAYB 5GXBB 2CBQA 2PNDA 2ZNWA 1UEMA 1CICC 4ZD3H 2KC0A 3ML9A 1KGXA 1IARB 5DS2A 4G71B 1X7SA 2P45B 4AG4H 5AD0B 2XA8L 5HD8D 3K74B 3TIDA 1K5NA 4BCYA 4NC0B 4ADJA 2WQAA 2R59A 3KBEA 4JW3A 4QHNB 3FU7A 5SWQA 3DVGA 3L4WA 5D7IF 4O00A 4NZJA 2VLKE 4ZO9A 3TZVC 1UB5B 1NDMA 3KG5A 5AZUA 3QHTC 1EGJH 4QJ4B 4X4ZA 2I9TB 3PHSA 1N0LA 1P6AB 3CVIL 5FYJU 1FNGB 1I3RA 1KSRA 2Z4QB 2R0LH 1HK6A 4PJHB 3KLLA 3MCYA 3D12B 1XD1A 1OM9A 4R4NC 1L7IL 1IGML 3FH5A 5J13C 3CX5K 3S5LA 4AEHL 5IR1B 1XCTB 4G6MH 1NGQH 4P2OA 2V5TA 1UWGL 2D9CA 5D2LA 3CC5A 5IFHL 4WENB 5JW3H 3FUMA 4PS3A 3TH2T 4LSQL 5EZJA 2HN7A 3MMEA 4GS7C 3U2JA 2DWEA 4CN1A 4ZFGL 1XR9A 1XF5B 2QDWA 1TZOA 4U3SB 5HGGS 5C07E 2FR4A 4I2XB 3QULB 1D3CA 4ODVL 4F27A 2BX5A 2DM2A 2GHWB 2QQQA 3B43A 4HCIA 4JPQA 4L8DB 3I6KA 3IWVA 4GRWE 1JXKA 1RMFH 3UP6A 4JUSA 1BLNA 3HNSL 4PJFF 3HEIB 1YA5A 3FCGA 1EEYA 3B9KC 5I75B 4I87A 4AYFA 5C86A 4UT9L 3AUWB 4PJAA 1E4XI 4CSSA 4RMWA 1U3NA 2EC9T 5FUOH 4QXTB 1JTOA 5MEPB 2VMJA 3K72B 4UQDA 4XR8C 1XGTB 4IKIA 1S78C 1UM5L 4DZBA 2ZJSL 2WQXA 1XTLA 5AAMA 1HCZA 2OW6A 4XVTH 1RU9L 1T1XB 2B1HL 4RFNB 1MRFL 1INQB 1TQCB 1XD0A 4PJ5B 3MOAL 4ZZKA 1CK0L 3IU4L 4HEPA 1RZKC 3X1NA 2NUTB 1BZ9A 1PQZB 2R0ZH 3NK4A 1RSYA 5MEOA 1FFTB 1T1ZA 3C8KA 1DZ0A 1XZ0A 1MF2L 2NXYC 1R24A 5HJBA 5I1EL 4GAJH 4CMMA 1ADQA 1NBQA 1O6VA 3T6QC 2C4FT 5JW5B 3ARFD 1L0QA 4XP9L 4L3EE 3QXDA 4FQHB 4RMQA 5JHMA 3TZVB 4IRSA 4YLBA 4H0HB 4FQ2L 3LRGA 1G9ML 4M3JA 1CF1A 4QXUH 5FA4B 5L2JA 1EQWA 2AQRA 5D6CA 5E1IA 1AD9B 4ZS6D 3NJNA 4OZGB 4ABUA 1A6ZA 2EH7L 3PAVA 4DP6X 2VDQB 1ZGLP 1G6VK 2AF2A 5E6ID 2VXTH 2F19L 1X4YA 1JXJA 1UURA 1MIMH 2CSPA 4L9DA 2V3FA 4KH2A 2PYFA 1BFVL 1RFDH 4IU2B 3Q43A 3R8BB 3SY0B 4WFEE 3TFKC 5C0IA 3SDDD 3L54A 4KTDL 2G3XA 3V7AG 1HKFA 1PJ9A 3ARZA 3LPWA 1UEYA 1VJSA 3KWUA 3BP4B 1S9VA 1I8LC 2Y25A 4MWFA 5JZ7D 2PCFB 2XJLA 2ZXBA 1YNKL 4AMXA 4NNXA 1N12A 4FRWA 2FK9A 5DMJB 5DXWA 2BP3A 3VH8G 3TYGL 4PI0A 3K0YA 2QPSA 5I6LA 2P80A 4FQQA 1SMAA 1T22B 3O6KH 4ZSOE 2CE6A 5AVQB 1U8LB 2IDTA 2PXYD 1KB3A 4JFFD 4OI8A 1XIWB 4OCWL 4AYGA 1RUPL 3EGSB 3CLEL 2UZXB 1FNSH 1H5BA 4XE0A 3NQKA 43CAA 3O4LB 3VGAC 1MXDA 1I1AD 3MV7D 1N59B 1M9WA 5IVOA 2Y23A 4JRXE 2J1XA 5JHDD 2JCCB 2ADIA 2IJ0C 1A8JH 3HNVH 4RMVA 2MJWA 3UTSB 5L2KE 5KSBA 2EDMA 3H9SA 2Y9RT 3V79C 1SOQA 3S96A 2AABH 4LASH 3ZR6A 1RURL 4PW3A 1G6RA 3OMZA 1H3XA 1PLAA 4JDEB 4MB5A 1BYOA 3HB3D 3MO1A 3PQYA 3WD5L 4BZ2H 1AHKA 3MRKB 2ITCB 1A1NB 4LRNL 1S9XB 3CFTA 5IMLB 1U8PA 1HHIA 2AQ1A 3O2DL 2NXYB 5B1JC 2XN9B 1OTSC 2ZUVA 4TRPH 4YSUA 4IDJH 4K3DH 1G9HA 5GJTL 3NCYS 4JB9H 4MD5A 3PREA 4WTZA 1FYTE 4R5VA 3HI1A 5AVVB 1MFEL 2H2SD 3S5LG 4M6ML 4AC4A 4PJXB 3HC0B 3MUY1 3TBTA 1HCVA 1OWRM 3SCMD 4L3FA 5DTFA 1RV6X 4PJEE 5E8NB 4CSPA 5D1ZB 2VZ3A 3VCLA 2WBXA 3B7YA 4GT0A 4O2CA 3WIHH 2ZSVA 3UCQA 4Y2OB 1KC5H 1SDYA 3LPOA 2O6PA 3V6OA 1HOCB 1XMWA 4DAGL 2E56A 3V10A 3MLYH 5D96B 5MERA 1W72H 2XQYA 1HYSC 2XNAA 5T3XD 1FYHB 3NFPA 3NUKA 5ETUA 5J9PB 3V4PL 4HWEH 3LEXA 1Z5HA 2QVMA 2VLLA 4LL1A 5FX3A 4HLZH 4NKMB 2K8MA 2OS7A 4YWGH 4EI0A 4PRPD 3CWGA 3BW9B 1KGUA 1JPSL 3I2CH 3OPZL 2QL1A 5EUOE 1HH9A 1A7OL 4M6OL 5GZNA 1LDPH 1X5XA 3DNKA 3IMSA 4JHZA 5IMMA 1L9NA 5D7LE 2M1KA 4TNGA 1OE3A 3Q2NA 3L3IB 4Y7MA 5FUCE 4ZMZA 2IBZX 4EI5C 4ADGA 1NGXB 5T5FA 3P4MB 5I1DB 4KZDH 2YAHA 4XBPB 1I8AA 2W38A 3JVFC 3ZN6A 4QRFA 1IFHH 3NT0A 2RFXA 3NMEA 4G6JL 2IDQA 3VFWB 4LIQL 3L4VA 2MIZA 1SOKA 4HGWA 1QSFE 3QISA 3QIUB 3IJSB 4MSWB 3VGAB 5CP3H 4OF0A 5T1MA 1QFWI 3GXUB 3W9EB 4DSYA 1YEGH 3BHBA 4XBMA 4XWOD 1OD9A 2B20A 2J6EA 1IEAA 5I2IB 1JGVH 5K33A 3IRZA 1ZTXE 4TULH 3N85H 1JE6A 3KYMA 3DX9A 1CXFA 1OAXH 2JI1A 5F3FA 2CALA 1MHCB 2HFGH 3HBQA 3RNKA 1ZV2A 1PEWA 1BQHA 2GTWA 1ORSB 3WV0A 5EIVA 1A7QL 1QSZA 2BH0A 1RK0B 4M6NH 3UL4A 4YXLL 2OCCB 1XR8A 2OYKA 1JF1B 2X05A 2CJTA 2VLKA 3RP1A 1YJDC 4DZ8B 1I9RH 2NSXA 1Q1JH 2F54D 15C8L 4MXQC 2BO0A 4KXAA 4OY9A 4IIQC 3V4VL 1ZHNA 4F7TB 2YPVA 4POUB 1FBIL 2EADA 1QACA 2IBZY 2PWHA 1V3KA 2PWDA 1KTDA 1X5ZA 1UJ3B 2FGWL 3DMMB 4M7KL 4EZMA 3SYCA 4PLJD 3HOGA 3ZE0B 2CLVB 5EU5B 3WNNA 2BSBA 4Y8DC 4Y2LA 4EOWL 4JY4B 5GS1A 2F7PA 2GFBB 3CFMA 1TZ8A 5M95B 5D6DA 5E1HB 3RA7L 1JPTH 5KAQG 3O3AA 3KLKA 2R69H 4AKQA 7FABH 2VW6A 2HPOA 2VABB 5L8JB 2QPFA 3OKKA 2X12A 1JZIA 3KXFB 4LKCA 5HVHB 4CSTA 4HWBL 3NH7H 4P04A 4ZS7H 3CFDB 3QIBA 3QUMA 4JL2A 1RUKH 1WFTA 4B97A 4ZFOL 4JKPH 35C8L 3KL5A 2GYSA 4Z77A 2WXRA 2X4NA 4X6DE 1KXTB 5F6IB 1ILSA 3PDDA 1E4XL 2E0PA 4AZUA 4YDIH 2Z8SA 4KJQD 3IF1B 1SJEB 4L8SA 4H2CA 5CZKA 1OT1A 2FVNA 3UFIA 4L3CA 2QVFB 3A0OA 1S5HB 3RU8L 1JZGA 1MVYA 1EBAA 4RFOH 1VHPA 5AVTB 4R3SA 1MCFA 1XZWA 4A1RA 3KHOA 4LOFA 7TAAA 1PKQE 3ULVL 2UZIL 1N5AA 1AP2A 3FOLB 2VRKA 2IG2H 4R90H 4DPAX 1CG9B 5LGYA 4PV9B 3DX1A 4HPYH 2WC7A 2XACC 1E4KA 4IRJA 5LCVH 5FCSH 4EN3B 2VM4A 1MN4A 2X89D 4LVHB 3MGTB 1KGCD 2FX8H 2COQA 4FTVE 3RGVA 4JS7A 3VXTA 1ZOXA 2APBA 1HIMH 4LLWB 4YDKH 5BNXD 3UAJA 3DYOA 3T3MF 3MGOA 5JPMA 4LP8A 3EF7A 4OZHE 5K9JL 3F7PC 2OLDA 3CHSA 1EO5A 2MEJB 4BHUI 1IZKA 5HYQB 2AJUH 2E6QA 1GW0A 2DMCA 2KT6A 3BE1H 3C75A 1KCWA 1Y18B 4NN5C 3AGVA 3IU3B 1NJ9A 5H94A 1CYWA 2ZCLL 2P3YA 4L3EA 5DK0B 3US0A 4HXBH 3IWUA 3MC0A 3TOPA 2M83A 1AMXA 3U4EA 3CU1A 3KPPA 4K7PY 1BVKA 3ERXA 4C8XA 5KSVA 3GXNA 4IIQB 3FQ4A 3PWUB 1EAJA 4KUCD 4XN1A 5JOPE 1YEJH 2EIKB 2GTZB 4R6UA 3SJVD 4TVSa 2XLLA 5EZOL 2AV7B 2BSCA 1DQJB 2F74A 3F7VB 4K7FA 1ZLWH 4Q97A 5LXGL 5B22A 2FZ3B 1NGZB 4X8XA 3KYKL 3HG1E 2WKOA 2Z1KA 4OLVH 2VDML 3OAYH 5CWSB 3RTQB 3AU1A 4JFWA 2HFFB 1F3RB 4D0CB 3I02A 2VUOA 2DLGA 4DGVH 4PWIA 2ZICA 2VR6A 3L3GB 4K94C 5INDB 2W80C 3EOYG 4P2QE 4BINA 3Q5TA 4JM2F 5EU4A 4AWJC 3MBEB 3CDYA 3SDCA 2YD5A 1WBZB 5A3IC 5E8OA 4ZSOA 4MCZA 4OR1A 1NOFA 2XTJE 1IFGA 4ANUA 2GIMA 5BRQA 4FABL 2SEBB 4NM4H 5ECGA 1GGBH 4E5XG 4B7IA 4HS3B 3A6CL 4X8CA 1TENA 2OTWB 2FQGA 2HZHA 5E8PB 3QRFM 1NWPA 3MYJB 1JOIA 4HALA 5GS3A 1Q9KB 3S4SA 2K9UA 2AQPA 3RVXC 1E27A 4JRXA 1KNOB 1AJ7H 5C0BA 4RZKA 3ZMRA 1Q0XL 2QSTA 5C2BH 2VGLM 5L2KA 4Y5XA 3HZKA 2IH3B 1ECYA 2PW2A 3VMNA 4E9RA 1XX9C 1T4KB 4OFYA 2P8MA 3C5ZD 3MR9B 1CGYA 4P9HL 1ZMYA 5BO1L 1JYWA 3Q3GB 3FTUA 4QHUA 3UDWC 1MCSA 2JI3A 4L0PB 3DXAE 2XA8H 2D3NA 3BMWA 5AOZA 2O30A 4ERSL 4JFXB 2ALAA 3UTZA 3ZE2E 4XO4A 4X9BA 3FHEA 3LEVH 3P3SA 2V9UA 2A9NL 1CDHA 4PJ6A 3CN3A 3QHFL 2QQLH 2NNAB 2C34A 4IOIB 5TGBA 2VLJE 3GMQB 3ZPDA 4YHZL 3IDIA 4NN5B 1YMHA 4FFZA 4FJYA 2MQCA 4QHKJ 2X5PA 3OSKA 5C97A 2BOCB 3PHAA 3OWRA 5JIQA 4PJEA 5DEGA 4WW1A 2J7LA 1UCBH 5CEXA 1GZPB 2DQJL 5CR1A 5LBSA 1WSST 3DX0A 1UT2A 2OL3A 1R5VB 1XHHA 4LCWB 2ZUTA 2DQDH 2MPVA 4N2LA 2NLJB 2AEQH 3K6NA 4KK9D 2QR0A 3GBML 4W4NA 5IFHH 1HE7A 1KXVC 1OAYH 4C54A 4FXLA 3P4OB 2YD3A 2BDNH 2BS71 4QWWD 4XP1L 1JS4A 4UNUA 4XVUC 1ET7A 4ODVH 5C0GB 4K9EL 3KYOA 1L3WA 3UPCA 2OMYA 3H42L 1LNUA 3ZUNC 1T20B 1ZLUH 4D94A 3PXJA 3MNVA 2EIBA 3VRIA 3ZDYE 2YJLA 3HNSH 4AZ8A 1MH5A 5EUOA 2X88A 3UO1H 1WGOA 3CN2A 3CPLA 2P5WB 4IRSD 3HRZA 5AVZB 1FZMB 2DKMA 3MTRA 4P4KD 4FXGB 3P73B 4AOFA 5D7LA 3I84A 4OZ4A 2V7NA 3G9AB 2EEAA 3OXRA 4PVLA 4ACPA 5BVJB 1QFPA 3VWKB 3EJQA 4DP8X 1QOKA 1BECA 5AB0A 3H56A 5K5YA 5ABZA 4N5EC 1VEMA 2ICEA 5HP5A 4YLCA 3ZK0A 4IBTA 1JHTA 5C0AB 5IW6B 2AERT 3ESVF 3MRJA 1QFWL 4QYOA 3WHXA 3TWYA 2CKNA 2HTKD 1QSFA 3JTTB 4PD4J 2BVOB 5F1SA 1RU9H 3BP5A 3JWDC 1G9NH 3L3OA 2HX7A 2EE0A 3B5GA 3QEHA 4Y2DC 1L4IA 3MJ7B 1RJZA 1UYWL 5I8CB 4HJGB 5FM4A 3BRDA 3NSCA 3QRGH 3JV4A 5DS1A 3CHQA 2Q6WA 4QNPF 1VIWA 4ODTH 2VL5A 1TO4A 2WLHA 3DV4B 4B96A 4PUBL 4L8BB 4WCYL 1CFQA 4FG2A 4MGXA 5HHPB 3HI6L 4ALAH 5FO8A 1S7VB 1NIBA 1W9XA 3QNZA 3VAEA 4YEFA 3FQNB 5C3TA 5AALA 4PY7A 1I85A 3KWWB 2CIIB 2V0AA 5TJWK 2WKLA 4NQEE 1FO0H 2JJTC 1CFVL 1WFNA 3MA7B 4XNQB 4E41B 3GXMA 4WVRA 3SKOB 1N5YH 1FG9C 2FEEI 4NUGH 3X12A 4KKLD 3P0YH 4QLWA 5JHLH 4Y4KC 1KFAH 4YE0A 5BUPA 1JWSA 4R5TA 3B8SA 1L5GA 2IWGA 2F19H 2OX5A 2ESVB 2XV0A 4NRZB 2PO6A 1AGCA 1DUZB 2BZDA 4LO9A 5F9OL 3STBA 25C8L 4HXAL 4DO4A 1BOYA 1BFVH 4MCNA 3R4RA 3B83A 4KTDH 2NSQA 4OGXH 3HA0A 3QGVA 3PQYD 2ZYRA 1M1XB 4PI2A 5IB4B 2PW1B 2IOOA 3N43F 4AQAB 2PWEA 4MRBA 1DSYA 2GVYA 1FNHA 4DGIH 3P9WB 1ONQB 2IPTL 4QHMA 5E94B 5DK2B 2ADYA 2XICA 4AIOA 4FFWD 3RY5A 5DVMA 3D69B 4YFDB 2NOYA 3JT0A 4G8EB 5HGAB 1FL6A 1S3KL 4QRRE 4X5WB 4OLWL 4PWJA 1YNTB 2O5XL 1R46A 2HT2D 4O02H 4X6DA 5ILTL 1RUPH 3WLBB 4AGLA 3PWLA 5F9AC 3CLEH 3EH5B 1VGKA 3FB8A 3T77B 1X7QA 1E5ZA 2Y7LA 1NH6A 3S35H 4ZPVA 4P4RB 4AM0B 4ZFZA 4A67A 1ZS8B 3VTAA 1KXHA 2R8SL 4KDWA 4CVUA 1MLBB 4LLDB 1DJXA 5HYJE 4GUQA 1QP1A 5FK9B 1MCNA 1Z3GL 4GXUN 5F97E 5DVLA 3UBXI 3ZHFA 4A63A 3SGJA 3D2UA 4N9GA 5D72H 3RAJL 3UO8B 4N8CL 4DGUA 2B3IA 4UIMA 4XPFH 3T0BA 5HYSB 2HMIC 2QEJA 3VFGH 4NZRL 4W9FC 1TTGA 1CIDA 4FTVA 2JXMA 2A74A 1A7BA 3DI3B 3BN9C 3WAKA 1FORL 4OD2A 5B4MC 2YEQA 4OZHA 3SYQA 4PS7A 4PREA 4LLAA 2B5IB 2MWCA 3CSGA 4H4NA 5H8DA 4HULB 3OZ9L 4ODWB 4PGJA 4N8UA 1JV5A 1JGUL 2CBPA 5M94B 1MJ7L 2VLRB 4CVZB 5FYLL 4KROD 4NAJA 5GGSB 4DETA 4MBRA 5E5LA 4ZXBA 2R1WB 3UG4A 4J3TA 5FCUH 1T2QL 1RIVH 5F9JB 6FABH 4O9HL 3D34A 2YA2A 1IMHC 4Z7NE 4X7FC 1HCYA 1E4HA 3BH9A 4HC1H 4XPAH 4CKQA 5FA3B 4MQ7A 4P57B 3HZVA 3MJ9H 1EO8L 1UM6L 4LNRA 2BVPB 5IWLA 4QHLA 4NQSB 3NJJA 3WDJA 1UVQB 2RHEA 4HX1A 4XE5B 1KIPA 5AOMA 1DSFH 5TD4A 4RDQF 4PJ8B 1A6TA 3HG1A 1JNNH 2VOTA 1G7HB 3LKQB 2N4IA 2QPDB 5I1GL 2C3VA 1A7OH 4S2SA 1MRDH 1CLOL 4WNQA 4LE8A 2Y1YA 3BDYL 2YPKA 4NNYA 2XTSA 3QUKA 4TTDD 1JF5A 4N0FB 4G83A 3ALPA 2VLKD 4C55A 5IFJB 4HMDA 5AOIA 5A16B 2AGJL 2RB8A 5K9OB 2HJFA 1TJXA 3QA3A 2JKIS 4PN6A 5DMYA 1JZJA 5GGTA 3BZEB 1ZLSH 1BZQK 5IB3B 3B2XA 1HSBA 4AGMA 3MV9E 4XPTH 5E7FA 2FQDA 5FGSA 1WHOA 3V52L 1QA9B 3T3MB 4OFQA 5IREA 5FEBA 4H40A 4XC3H 4B9CA 5IVNA 3G5VB 2RJMA 5A2IH 3UYRH 1M57B 2H9GB 4GAAA 3L2MA 3ROOB 4AQ8A 1FVEB 2EYSA 1RZPA 3P2DA 2NZ9C 4CKVX 1K6QL 4NUJB 3WLWC 3HAEA 4FLOA 2X53A 3SGKC 1CTNA 2VQ1A 2APFA 5IBTL 4HK0B 4KI5E 4G42B 9PCYA 4TNEA 3AT8A 3QIBD 3DVNB 4PIRF 1SHMA 3LS4L 3N40P 4ENEC 4XTRC 3TVMA 1ROWA 1MHHB 3VXSB 4K55A 4BKLA 4F20A 5CJXC 3GJEA 4YDVB 3DXAA 3MRDB 2R1XA 1EXUA 2VITB 4F8QA 4YO0A 4ZO7A 3HHSB 3JV6A 3WNKA 4MYWB 1A7QH 2Y06H 3TBWB 4JQXC 4PTUB 1RZGB 4IKNA 3CCHA 3QEQB 2B9AA 2AMGA 2DIJA 1FAIL 4RRPA 3U7WL 2VLJA 1D2PA 1N6UA 5TFSL 5C92A 3FB6B 1SDDB 1NCHA 3HN3A 3GRBA 1IU1A 5E4IA 2X4PB 4YUEH 3ELAT 5HY9B 4B5ZA 2FGWH 4M7KH 4XNAA 1HHHA 4PV8A 5K9KB 2X4TA 4XNUL 2HA1A 4IGBC 3RWCB 3C9NA 4IRJD 4MNHA 5IHHA 4JM2B 1TQSA 3RA7H 1AGEA 4EDXB 5DURD 5CN3A 3ULSA 4HS6B 3SGDI 3RGVD 4UOW1 1TMQA 3L3HB 3MRGB 3LXUX 1UQSA 4WW2F 3UAJD 3ZX1A 5FO9A 1CWVA 1N67A 4UANA 5D4QA 4GW4B 2XIDA 4YR6B 5BZWB 2NY1D 3BWUF 4XH2B 3L4UA 2X70B 3MRLB 4FLSA 1JPFB 2GHZA 4NQDE 1BXVA 3VFVB 6TAAA 5J1TC 5C08D 4F8PA 5LQBL 1JNLL 3SSGA 35C8H 3DKHA 5I1IL 2B39A 5EU7C 4J4PC 3ULUC 3FUDA 2EEDA 2ZUQC 2EXYD 4U3XA 4G7VL 2W07B 1JPGB 3GMPA 5FWRA 2BVYA 1HU8A 2DMBA 3DROB 4X99A 2BCKB 4QF1B 3HR5B 1ED3B 4MKMA 2OXGA 4MJHA 4MKTA 3KS0J 3O45A 4HJIA 1FFOA 2VDLB 2YD4A 5AL0A 4RGOH 4L37B 2UZYB 3FHAA 4H8WH 2FEDC 2HG0A 2OTPA 3THML 4Z9KB 4N1CA 3UJJL 2MNJB 4P99A 3NSJA 1MUJA 1Q9OB 2E27L 4TNWF 3EO0B 2L7QA 1N3NA 3QQDB 1ZLDA 2VDQL 3A6OA 3DI2B 4RIRB 3MREA 2OR9H 3CZEA 3D8MA 5C0EB 4G8IA 1KIQB 1IKOP 4YSRA 3OM3B 2C9QA 1A4AA 4F33A 3BAYA 5CFHA 3W81A 4P2RB 2PTUA 3B6SA 1ZA3A 1SOSA 3SDCD 4QO1B 3ZHNA 4JO2L 3WNOA 5E4AA 1FNAA 2ZX5A 2HH0L 2RCSL 4NHUA 4BUGA 2GC4C 5ANHA 2FEEL 1NGWB 1X9RA 4NQEA 5BS0B 1RAMA 5JIKA 4RNRA 1T3FB 4NPYB 5JDSA 1D6VL 3W39A 4HUXA 4UQAA 5CINH 1F3DH 4FFVD 1WK0A 5ALCH 1YG9A 4JRXD 5T3ZH 3TA3B 4CDGC 5C0BD 1M7DA 5F7EH 4NKIL 3COOA 4JY5L 2I32A 3NJLA 4YDJB 1KMGA 1OCRB 5LXGH 4LKXA 2RALA 3BKJL 4OH2A 3N41F 4NM8L 4OFYD 5F7KC 5LNEA 2Z8VC 4DH2A 5JA8B 1RPQA 1JPST 3JTSB 3DO4A 2CO4A 5A7BA 4IKLA 1WT5C 3EKCA 3NIGE 5GGUB 4BK5C 2Q3AA 4LSSH 3BO8B 1QLFB 1JZEA 4Z7VB 4L4VD 3AQYA 3CHPA 3SHSA 4KQ0A 3IPFA 4Z78A 2EC9U 4OGAC 3DOIA 4X6FB 1AH1A 2CK2A 4E9QA 4AQ1B 1KPUB 12E8L 2FJGB 2HVKB 4FLRA 3B2VL 5J6HA 3GO1H 1LO4L 3ZTNL 1ZLWK 2W60A 3OXSB 4CGUB 1ZHBA 3V0VB 1RZKL 4QRRA 5FHAH 4H1LH 4WQOA 3OAYK 1R0AL 3LQAH 3GF8A 4GEIA 1JZHA 5D93B 2BY1A 1DFBL 3FRPG 3IMBA 4GSUA 4LEXH 1COBA 1PPIA 3OMAB 1ACYL 4Z5RB 5DFTA 3JWNG 4KKNA 4MA3A 1ZAGA 1A9BB 2ENPA 3EOAB 4BE6A 1A9EA 3CLWA 1OOWA 5I6MA 1BPVA 2R15A 3C5JA 1YYMH 2BY2A 2C4FU 4WGKA 2AJYH 4ZO8A 1U8QA 5HYJA 2P8LB 4NO2A 4MMXB 5BO1H 5CEYB 1KLGB 3R1GL 5JXAH 3H6AA 2FO8A 4Y9BA 1A2YA 5GRYA 4KBPA 4JQIA 1T5WA 3Q8BA 1HHJB 2MQ3A 5AYQA 5KYWB 3B4NA 3AUVA 2G3ZA 2VC2B 4RMBA 2FUTA 5D7LD 5DD6B 2GSMB 4UIKL 2DI8A 2A9NH 4FMFA 3U1SH 4YSQA 5EO0A 5KSUA 3MA9H 3D25A 4OLZH 5IJCC 4IRZL 1CXKA 4KO9A 4ZYKB 1HAUA 2OMVB 2WXIA 4WK4B 2NW3A 5E6UB 4POZD 4PJBE 2EDBA 3OKOB 4G7RB 1PYWA 1OANA 2X0UA 2LU5A 2W0PA 5EZLA 2NX5E 1YQVL 5I18L 4FQXB 2C3XA 1QSFD 1C1EL 1BD2E 2ZXQA 1R4XA 4G6KL 4WEEA 3RG1C 4ZX6A 2HG5A 2AV1B 1WH0A 5EEYA 3WE6B 1TJIL 4OF7A 3L9YA 4JN2B 5LG6A 1FP5A 1LLAA 3PABB 4K3JL 3JVGC 2QT6A 4FXTA 5KVEE 3QJRB 4OUOA 5A40E 2EDYA 3QFDB 1KBGH 3AY4C 4K9EH 1N64L 3Q5YA 5E8EB 2YC1B 3EYSH 1UD4A 2KZWA 5FKPA 5AG9A 1U9KA 3STLA 1PZ5A 3S98A 3K71A 1NBYB 1YY8A 2EECA 4X2UA 3ZZ1A 3N1MC 4UU9B 1NL0H 2BSRA 1GCYA 1KGWA 3KPLA 1TIUA 2NY0C 4HCRH 4DEUA 3KEHA 3BKYH 2ZOLB 4LRIC 2IXQA 4M48L 3U1QA 4EQ2A 4NX0A 5LNGA 1WQVT 2EVJA 1BEYL 2PO6D 4J3XA 4HKJB 3TURA 1ZLUK 1UENA 3I74A 3K6IA 3MV9A 3APNA 1UXWA 3BT2L 3ATFA 3IDJB 3EJCA 5CEZE 3O8XA 3UEQA 4KZ0A 1KBPA 2KZBA 2I9LB 2HYMA 4I48B 4IOSD 3MBWB 4BWUA 3ARBC 1T4WA 1WLHA 1E4WL 3F00A 4BFEA 3FT0A 3RUGB 2XG5A 3O6FC 3US1A 1FV1B 3LSOA 1F11B 2V7HB 3O11A 3VSVA 4AENB 4UOJA 3K6SA 2P44B 3H9ZA 2NZIA 1GKOA 5FGCB 3VFTA 4M8QA 4GIAA 3OKEA 4L0ZA 1YLBB 1U3HB 2GC7C 3GMNA 1AO7B 2X0WA 3CFJA 2QDVA 3D0AA 4PUBH 1JGLH 3GIVA 2EDEA 5ERWA 1RIHL 2ZSWA 3WSQL 2QSCH 4D9RE 3M17A 3HI6H 3NP3A 4JANB 3RB5A 4IU3B 2GG1A 1C5CH 4NDMB 5LXVA 3FO0H 4ZMXA 3CXHJ 4W81A 2FYYB 4WO4B 4XRCA 4NRXA 2YPLB 3LZLA 2PKDA 1Z7JA 4F37K 4UM9A 3BZFA 4UV7L 4MLSA 5DUBB 2VN4A 1KCRH 2VR7A 1SXCA 4OLYH 4JO3L 3AG4B 1OO2A 2BWIA 1N0XH 1AGFB 3DSFL 5AB2A 1MJJB 1T6VN 2QADC 3NAAH 2VE6B 4LLUA 4APQB 5DJ8A 4Z95H 2E4FA 3U7YL 5INCB 3VDCA 4W9KC 2OMZB 3VWJA 2BVQA 1S7XB 1D2OA 1NGYA 4ACTA 3V6ZA 4W6XB 2L0DA 3D2UD 2YK1H 1RJLB 3CZJA 3OR7B 5CMAA 5DEFA 5FO7B 5F88A 3RQ3A 3DX4A 1U8MA 4GLRI 2ZUSA 1N2RA 4X5XA 1FN4B 1B2YA 1WD8A 1WD9A 4TOYH 1E3FA 1LP9E 1G4MA 3WJJC 2IPTH 1ZK9A 1NCUA 4G1EA 5DJ2A 2N7AA 1Q38A 2YGOA 1IJNA 4TL4A 3TJEL 1YDPB 4JFDE 4AMKL 1NDTA 5J56B 4KOCA 2DM4A 3GYRA 3MNWA 1P5VA 1OAQH 4OLWH 4ZXBD 1S3RA 1J8HD 5C0RL 4HOMA 2B1OA 2O5XH 5ANME 3SE6A 4GSXA 4BCXA 5ILTH 4FQIH 3ESMA 2K3HA 4LCIH 4BQCA 3QCUH 4KZCA 4ODHL 1A6UH 4J3OF 5CIPB 4OQTL 2NYKA 4N0YH 5DD3H 3K3QA 3TEUA 4UNVA 5JOPD 4ODXA 2VR8A 4I0PC 4E9XA 3QJHB 1RK1B 4MDIA 1UOLA 3DBXB 3LXBA 1P84J 3T2PA 1DANU 1NCTA 1IO4C 1FFNA 2R8SH 4LK4A 2X4RA 1EEZA 3UTOA 5IVXB 4NYLA 3M1OA 2F5BH 2WXQA 3FU9A 1CICA 4P49A 3TO2B 1YJDL 4TUOA 1VKXB 2BP0A 3HG1D 4J27A 3BAEH 2H1LM 2D3LA 3DRQB 1ND0B 1JTPA 1S5IL 3O3BB 1SN5A 5TK4A 3UPRB 3ECBB 4Y4HC 4TLUA 3A4FA 4NO3A 3QDGA 5FB8A 3WMPA 5HDBB 5EOQL 1D9KD 2MOQA 4HIJB 2L04A 4A2GA 1I1YA 2E74C 1Y7VA 5C3IA 3MCG1 2IO5A 4LBEB 1Q72L 4V1DB 5F21B 5I15L 1NUFA 1GW6A 3P3UA 2NY5H 5E4EB 4K8RC 4BZ2A 2CRMA 4PRDA 2Z92B 4OZIA 1OQXA 3ARDC 5IT2L 4AVHA 2P7TB 1OE2A 4KKRA 4NQXB 2PLTA 1GZHC 1T2QH 2W91A 2YZ1A 3QUXD 4LP4A 1R1CA 4ZOCA 2FSDA 1KG0A 1L3NA 2UY7A 2YRZA 5CU5A 5EU6E 5JQ6L 2QADB 3ZE1B 2ZONA 1L7TL 3AMLA 2Y3NA 1B0IA 3TPUB 3AWFA 2ZOTA 4Z7QE 1RJYB 3LPGA 5DVKA 4H8PA 3FT2B 1EO8H 4YHKH 2AAVA 1T5KA 4OUUA 4KK6C 4UM8A 5KS9F 4QRQB 4CNIB 3FO2A 4XOCA 3TVMD 1PKOA 2IAMB 4Y4FA 4DT2A 3P4NB 1W72A 3L9RA 3QCVH 2AI0H 2EYRB 1AYRA 3UC0L 5I1GH 5KBDA 2A77H 3CSYA 3QRBA 2MHAA 1CLOH 1G0XA 4HMEA 4U1LB 3IDMA 2VTFA 3B9KA 4EZKA 1O6SA 2FWLB 3C60A 1NAMB 1H15A 2BSDA 2Q8BL 1HHKA 4LHUA 4MMZC 4GAGL 4QRTB 1EFQA 2VYRE 3RNQA 1BREA 2VLJD 1W0WB 3GMMA 2WW8A 4CN6A 1P4BL 4KK5C 3PWPB 4DCQA 1J8KA 1MQKL 1XSIA 2N0MA 1ZANL 5E08L 3K7UA 3N0PB 3CFEA 5CZRA 1MY7A 2JIXA 3KGSA 2WLYA 3ZT7A 1I7UA 3VM5A 1F3JA 3T65A 1R3KB 2NXZD 1FVDA 5E51A 4R2GD 4G80A 2VJ0A 3QO1B 5IB1B 2LVCA 3T0AA 1ZGLB 2H6OA 2FT6A 1IAKA 2UWEB 3W0WB 2AXJA 3MODH 5KJ4A 4W9DC 5KOMC 4JDZA 4TL5A 3WUWA 1SEBB 3GLZA 1RUML 3O9WB 3IKCA 1II4E 3MROB 4NZTH 5DGQA 4S1SH 1R5WA 2EQDA 2W88A 5BOZG 3MLVL 3AGWA 2J1KA 3CN0A 3DC0A 5DC0A 4GW5B 2DQGL 4Y2NA 3ZKMC 2EZ0C 2CIKB 2H0EA 5KBMA 4MAUL 5D1QB 3DX8B 4HV8B 4OJYA 2XWRA 4XN4A 2JK5A 3UYPA 3P0GB 2CA4A 1OSZA 1SRDA 3MZTA 5GS0C 4LL9A 1FAIH 3SEPA 1DQLL 1MZYA 1WTLA 4MNGB 5TFSH 3TBSA 3WIIL 3ARDB 3WY1A 2DF3A 2H6PA 3U36B 5DR5H 5IK3B 1PS3A 4AK2A 1KB9K 2NX5A 4OFIA 4RWYH 4YGVB 5EZPA 1HL8A 4Q8BA 4K94L 2X40A 4JPIB 4WU7A 1BD2A 1DVTA 2GAZB 4GRLB 1GSMA 1IFRA 2WK2A 2WXMA 3GSOA 3KLQA 1PZSA 4KY1H 4B9IA 2IFFH 5DDHA 2EAEA 3P3RA 4XCNA 2PPDA 4LBAA 3VQ1C 1I8LA 2AXWA 3FSWA 5GGSY 1NFKA 1N8ZB 3QEGL 4ZQTA 1PG7L 3F62A 3QZPA 2EINB 2NRDA 3U0PB 4LPUA 3QORC 2YOAA 1JVOA 1RIUH 2EE3A 4O4YH 5BRPA 2KZKA 1F2XK 2E7BA 1FL5B 4ZUWA 5I1IH 5I1KH 2FGZA 1P7BA 4G7VH 3VXMA 2NUPB 3D4CA 1OTTD 4ZT1A 5GRUH 1IJ9A 1M6OA 1IE4A 2JKTM 1MW3A 1XF3B 2CZNA 3E38A 1ZXKA 3R06B 1NMAL 2EDHA 3CZKA 4NAQA 4G6FB 4NWTL 5EWIL 2YO3A 4RGNB 1J05B 1B0GA 1YEDB 2B4CH 3HJ0A 4KGLA 4L9LB 2OXHB 4YFLF 2A3TA 1S7SA 4TNVK 4AGOA 3THMH 2BW4A 3TEZA 3UJJH 1CURA 4V2BA 5J3HD 4OZFB 4AJ0A 3JZYA 2CUIA 5EFIB 5HD8C 1YZZA 3WFEH 2LAGB 3FONA 1JD7A 3ELQA 1JXGA 3ZTJH 2Z35B 3BZ4A 3HUJE 1CGVA 4FCHA 1P5UA 3CZUB 3HMXH 1OAUH 4EXPX 5LCVA 2WN2A 4TMPA 1YEWA 2DWDB 5ADOH 1CTMA 2X10A 3VA2C 3QNYB 3DO3A 3ZMNA 3BVNA 1QO3A 2VT0A 1R3JA 4QRRD 4KKQA 3NG5A 4O2FB 5L9DL 1CFNB 3PUCA 2G9KA 2I85A 3GMRB 5DEJA 4I88A 4N3TA 3FCSB 5KVDL 2LFEA 1AZCA 1NKOA 2ZCKH 4PPTA 3RBSA 3NVQA 4L4JA 4DN3L 3LZFH 2OP4L 1DVYA 3BKJH 5EUKB 3V6FB 1MHPL 3LZQA 5HYJD 5DJ0A 3KE0A 2BP8A 3DECA 1ZHLB 3PNRB 1GHFL 2XVKA 1OGAE 4NUPA 1F02I 1U3ZA 3SYOA 1TTCA 1RSFA 3VD7A 2MPAH 2E6JA 4P59L 1KB5A 3N9GH 3QYNA 4OCNC 4LMQI 1GGUA 5IB5A 4ANWA 2PTTA 1LP9A 5F7DA 3SKUD 1TCRB 3QORB 3U7AA 2NNCA 4EI5A 1GC1H 3PCYA 4QGTA 3EH4B 1SJVA 3PY9A 4JFZH 1LO4H 2HX8A 4L4TE 1MJUL 4H20L 4OFDA 2D7QA 2AQSA 2NY3B 2P49B 2BSSB 2W8CA 3OHXA 4JFDA 1UA7A 1HQ4A 4DGYH 4ZMPA 4KI5F 1UKQA 5AW8B 4OF8A 1R0AH 3NIDE 5ANMA 3NJXA 2JKWA 1JHKH 4KQ3L 1DFBH 1J11A 2C7UA 4H25A 2BIHA 4U0QB 4NXSA 5IEKA 4IJ3C 1SEQL 3U6XS 4XGZB 3WO4C 5ISZE 3R8QA 4UBDD 1ILUA 2O61B 3IJHB 4PJDE 5K59E 4QRSB 3MRRA 1MCJA 3B7SA 3LEYL 4KRNA 2ZOKA 5JXEA 5AG8A 3NBNA 2HRPL 3U79A 3KCPA 3UBXG 4OCXL 2WVSA