2BCMA

Daae adhesin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
138
structure length
138
Chain Sequence
b'TFQASGTTGITTLTVTEECRVQVGNVTATLARSKLKDDTAIGVIGVTALGCNGLQAALQADPDNYDATNLYMTSRNHDKLNVKLKATDGSSWTYGNGVFYKTEGGNWGGHVGISVDGNQTDKPTGEYTLNLTGGYWTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F1845 fimbrial protein
publication title Crystal Structure and Mutational Analysis of the DaaE Adhesin of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 29
structure length 138
sequence length 138
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2bcmA00
1USQA 2IXQB 2BCMA 1USZA 1UT1A 2JKNA 2JKLA 1RXLA 1UT2A 2JKJA 2VERA 2W5PA
chains in the Genus database with same CATH superfamily
3H9SA 2RGSA 2YAPA 2R7EA 3QPXH 3RIKA 1FZOB 4H8WC 2F9BT 5B1AB 2PXYA 5BUGA 3BRGC 3IVKA 3APDA 1DBJH 2GQHA 4IJTA 3DLQR 3RURA 1B0WA 2DQGL 3DTXA 4XRCB 4Y2LA 4K8RC 4M00A 5ICYB 1IAII 2VSDA 2J88H 3ZU8A 1UOKA 2AEPL 2A0LD 1PZAA 1OQXA 3AWGA 1BOGA 2QV4A 1A8JH 4YGVB 3CWGA 4WUUA 3ULSB 1AIFB 4ZODA 2UY7A 1PL3A 2IEPA 2NX5A 2C9XA 3QPKA 4LHUB 4QNPF 4XPTH 1YC8A 2XACC 2EACA 3EIFA 4L23A 5JO5A 3QAZC 2E59A 4U1HA 4DSYA 5IVXB 2O5YL 2K0RA 4N1EA 1CGTA 2HT3D 4GG6A 4K5PA 3EYUH 4FULA 4U1NA 1RCYA 2F53A 3FT2A 3KEHA 4UOZA 4I48B 4NRZA 3UG3A 4LU5H 1SXSA 2ORBL 1D6EB 3DOHA 3MJ7A 3QIUD 4G80A 3TO2B 5HDQL 3O9WB 1JPFA 5D2NC 2YD2A 3N43B 2VNCA 3A22A 5IK3B 3QEHB 4XN4A 2HTKD 4XBGB 4ANXA 1XWVA 4F7EB 2YQ2A 1Q4NX 5IROD 3CLWA 2G5RA 4L5FH 4CJ0A 2YXMA 2KH2B 2IFFL 4K07A 4XN9A 4HFWB 3QXUA 4Y8DC 4ZAKA 1UWXH 3IDJB 3MXVL 4X9BA 1JN6A 1ZA6B 4U0QB 5D72L 3ZBMA 2BIMA 4QY8B 1AQDB 2FWOB 4PWKA 2KZWA 1SEBA 2YD0A 1G43A 4DW2L 3FOLB 4B7LA 1M42A 5ILTH 3RIAK 1YUKB 3SE4A 1QO3B 3TX4A 2QVKA 4M8QA 2MIZA 4XNMB 2ICWA 4NQVB 3UEZA 2DBLH 2W0LA 2W07A 1I7RA 4AXWA 4WCYL 4PJBA 3C5ZC 1ZGLM 1IZJA 4YOKA 4I3RH 1DDHA 1A47A 3ZY7A 3VRIA 3HUJB 5DJ0A 4GT0A 2F1EA 3KPQB 1P4UA 3OSKA 3QB7C 4N2OA 1MW1A 2WLIA 4GRWE 1OCWL 1X4YA 1SDYA 1VGKA 1MELA 4ZFQA 4BXSV 1JNJA 4KHTL 4HXAH 4FFYL 5FWQA 5FUCC 3SDAA 3HZ3A 4WK2B 4AIZB 4NM8H 1FGVL 3MV8D 5HI5C 2K8MA 4Y88A 5KYUB 1TVHA 4NZJA 2VLKB 3TJHD 5IUCA 3U9PH 5DYFA 2BCMA 3TBSA 1TJHL 4RMRA 1FP5A 3GSWA 3RDTD 5HGDB 1C16A 1MUJB 4LEXL 3QUHA 4JQVC 3LQMA 1NGXB 3RQ3A 4LLDA 3B2UD 4TQEL 3ZDYE 3L7EB 4Z8FL 2E5EA 5LXGL 5K1JA 2X1OA 1T83C 1N10A 4KY1L 1NAML 5IVXE 3PV6A 4G9FD 4NKQB 3PWLA 4QRPB 4D0DB 4RZCB 2AK4D 4NC2B 4HMDA 2VDLH 2ZCKH 2HXAA 2HX8A 4HHAB 1T2JA 3L7FB 1Q94B 2ZAIA 5SWZA 3FK3A 1KYDA 3SYAA 2IAMA 1OW0C 4S1SL 4PGCB 1CL7L 3TA3B 3HN5A 4TOYL 1XD1A 3IM1A 5J1SC 4IOIA 4J3WA 4UUJA 3S3SA 5EO0A 3ZE0B 3RGVD 1KCLA 4NQTA 3FUNA 3VFTA 5FYLE 4DOHE 1G0XA 2IWGA 3OHMB 2X4PA 3H9HA 3GIVB 5IMKA 2NXZC 3CSTA 1W72B 3GSOA 1G7LA 3LH2H 1SOKA 5KSBB 4BFNA 5JPMB 3B9KA 4AT6A 2VDPH 1RULH 1Y07A 2GTWA 3L1GA 4YZFF 5IW1B 2EC9U 3GXPA 2DTSA 5HYJA 5IQ9B 2ZX8A 1XMEB 1H3PL 1WEJL 2F54D 2UXGA 2VN6A 2XPGA 2QHLA 1UH4A 3LD8B 3MOBH 2OK0H 4X6FB 1UWGH 1N59A 5KYYA 3QJSB 1EBAA 1DJIA 3QI9C 4FLSA 4PP2B 3UDWC 2ITCA 4X9HA 3ZL4L 5BVJA 2JJSA 3K5SA 2FL5A 1KTDA 1JPTL 5DJDA 2BIIA 1QMUA 3U6XS 5D7LE 3OMIB 1O7DC 3BIKB 3CBJB 5F1NA 1T0NB 4AM0B 2F5BL 3TH4T 2QPSA 3VXMA 4MAYC 3CX5J 4M93B 5F0JB 5D7JA 4UM8A 1IBGH 3F8UB 5HJ3B 3L4ZA 2WWNA 3ZDZF 1EV2E 1XF4A 2I24N 4HZAA 2TSAA 1YEGH 1D7FA 5LWYH 1JMZA 4M5ZH 3RTQA 4GFTB 4F8LA 4WI2A 5EUOA 4FQ2L 2K6WA 5F7KC 3BGAA 3NRQA 5H94A 3G6JA 1GRWA 4G6AC 1BCIA 3BEWA 3FQNA 2H0EA 4POZC 5TF1H 4HD5A 3VFMA 4ERSL 1S9WA 1UGKA 3LNDA 3NSJA 3QISA 1H9VA 4KUCD 3V8OA 3RVVD 2DQUH 3KDPB 4PBWD 4IKJA 5AKSA 3A4FA 4WV1B 5C09A 1PAZA 4GKSB 1EQWA 5CJXA 3C6LC 4KKPA 3CVHB 1RIVL 3FOMB 3NSYA 1XVSA 5CCKH 3P0GB 1CXLA 4BSJA 1N18A 5I1GL 1JXKA 4IW4C 3GSNB 3HW7A 1NSNH 1B0IA 2VR8A 3SPJA 4EDWL 3SGEI 3C08H 2FQEA 5C0RL 3FO0H 3DHUA 4TL4A 3RPIB 3BSZH 2CAKA 1MFAH 3BZDA 1MREH 4OCSH 4XXDB 1ADQH 3MV9D 2HX7A 1VHPA 4PJGE 2A77H 1LK2A 3EO1B 4G6KH 5A2LH 4AUYA 1BQHA 1O9ZA 3U0PB 3P0YL 1U42A 2X89D 1DBML 1N7ML 4KC3B 4PY7A 4XPHL 3ZE0E 3HE7D 4AZUA 3D3VE 4FTVA 3MVSA 3RNKB 4UANA 3UH8A 1J9CT 2JKSA 2VR5A 4NHCL 1W15A 3F84A 3T3PF 3UMNA 2CPCA 5F72S 3ARGB 4YHZH 3WIAA 3SOBH 4Q4EA 4MTMA 3E2HC 5DURB 2V2XB 5AG8A 3L1OH 2YD7A 1RHHA 2CHZA 3EJSA 4S0TD 2VW7A 3TO4C 4ZO8A 2WCGA 3UTTE 1Z9MA 5DTFA 4OQ1A 1F97A 1OB1B 4MZRA 5KVMC 4MYPA 1XR8B 1HDMA 2HG5A 3KMDA 3B7TA 4FZEL 4IBTA 1VFBA 2A9AA 4NBZB 4OIBA 2WXRA 5CN1A 5CP7B 3U30C 1OPGH 2VDQB 3O3UN 1U58B 2Y0SA 3L3GA 4JFSA 1KJ2L 3QWQB 3H7BA 1OEZW 3PWVA 5EWIL 1TQUA 2AQ2A 1PY4A 4YHNA 4UM9D 3QXDA 2HTKC 4ZXBA 2JQAA 5DK3A 5J12C 5I8CA 3U46B 1ITBB 1TENA 3Q5YA 4WTZG 4NKDA 5C0CA 2FHCA 3C2AH 4ZQKA 1FUNA 4NZFA 2CLRB 4TUOB 3I6KA 1ZIBA 1OTUC 3FQTA 3GJFH 3P1VA 4FQJL 4HH9A 2F1BA 2C9RA 4PJ5B 2J8OA 2VLRB 2E7HA 2OTWB 5E2TH 3C9NA 2JIXB 4UT7H 1E8WA 2HVKA 1KPVB 3VCLA 3WS6C 2DQIH 5C0DA 2LU7A 3FU7B 4CL7A 4PJHE 4DPCX 4PCSA 1NM4A 4BDVB 2P5PA 4XMKL 3V4UL 3V9EA 4P9ML 2Y1ZA 3VGBA 1NKRA 3QULA 4MQXC 4Y1TA 1PAMA 5I6LA 1MHEB 3FYIB 3NIGB 2BOBA 2XIBA 3QUMH 2WTPA 4P2RD 4XWGH 3SDXB 2M8XA 3BUIA 2DWDB 4KVNL 4EN3D 4KJYB 1G9ML 4M56A 2P7TB 2YGQA 3S96A 5DLML 2RAMA 2FEEL 1UATA 3G08B 5D70H 3OQ3B 3K7UA 4CVZB 3DYMA 4LEOA 3BP5A 4WI0A 3OL2A 1RPKA 4OGXH 1OQOA 1PS3A 4LLMB 1G6RH 1HSAB 4C4BA 4MJJA 5DC9B 1LDPL 2W65B 2Q7YA 4JFQB 4XNZB 4I13B 3CN4A 3IFPA 5FM5M 1XDTT 2WLZA 3DMMD 4JZNB 2ARJQ 2DJUA 3FCUB 4IDJH 1ZHBA 1PD6A 2AGJH 2AJZA 4HJGA 3RDTC 1PY9A 4BEIA 4GMSH 3P3TA 5HVHC 4G5ZH 1IGTA 3VG9B 1NBQA 2QKIB 3B2UC 5FHBL 5DVMA 4TNGA 3PHOB 2MCG1 3II2A 1OAYL 4PGEB 3P4NA 1TTCA 1D5ZB 1NIAA 3MCLL 5CFAA 3EJUA 3F7YB 5FW8A 1E3XA 1NL0L 5CR8A 3B3IA 1LNUA 2KPWA 2CHXA 2NSQA 2OL3H 4IIQC 3MV9E 4JHUA 1E9QB 2LQRA 4G9DA 1RP8A 4TUJA 3HMXA 4LEBA 3CFBB 2GY7B 4XNBA 3QUZA 5IJCC 1C5DB 4NQSB 5DJ2B 2WQVA 3OAUH 2FBRA 1KC5H 4P5KA 4FLOA 3RL1B 3TCLB 2NY0B 2Z7UA 3C60D 3GIZH 4RIRA 4AL8C 2CRYA 3D39E 1BBDL 1JV5A 1BECA 1RZIA 2Y3AA 3RIFK 1JVOA 4YL4A 4AQEA 4LQ1A 3QIWD 5CHNA 3WNIA 5DZPA 3QFDA 3MRKB 1CU4H 4PRPB 2NTSP 3BKYH 1QLRA 2J8UF 2CCWA 5C9JB 1ND0A 3SPGA 5IR1B 2VLRE 5FA4B 3P73A 1SF5A 2R2HA 3HHRB 4M6OH 3GS7A 3RWGB 4YH6A 5JXEA 1CYWA 4OLZL 4LSUH 4R4BB 3FPXA 1N3NA 2PPAA 4ABUA 4ZUSA 2XV2A 3BPCB 1H3XA 2H32A 2VDMH 3GRWH 3TP4A 1UA7A 1OGAB 3UTOA 1E5BA 1THAA 4R7DA 3FTSA 5C1MB 3VD3A 4M7JH 4M8RA 3RB7A 1FFNA 5HYSA 1MW3A 1GGBH 4M7ZC 2WNGA 1LLAA 1HJCA 2Y1VA 5KVDL 3CZLA 4WY7H 5I1AA 3ECQA 4Q2ZA 2J88L 3TEWA 1R5WA 4GKZA 4J4PD 1VAHA 1A9VA 5F89B 2KQMA 3SPVB 1Q9LB 4B0MB 3X14B 2K6ZA 3PFUA 1TQBB 3N0PB 3FFDB 4BUHA 4OGYL 3LKOA 3JUYA 2HP4A 4L1LA 1B2WH 1OP3K 4JDZB 3T4AC 1A4BA 2IDFA 2A99A 3E80A 3PRZA 4E42B 1X44A 5BOPA 1FL5A 4HPHA 3B2DC 1MF2H 1I8KB 3B4NA 2PF6A 3O6FA 3WMQA 1AOHA 2RJMA 3SKNA 1M7IA 4DAGH 4G70B 3IJSA 4DESA 5JIMA 3T1FA 4OFIA 1VEPA 3VO0A 1NZRA 3MUZ1 4O58H 4HUVA 4JRYA 4FD0A 1UT1A 1Y6MR 2WAQA 1B4JH 2CK0H 1KYOK 4HDIA 4OZGA 3NSDA 3WHE1 2IDQA 1OK8A 3LQAH 3UP1A 3GHPA 5E0QA 1AHWB 3RPBA 5GGVY 2A74A 3GMMA 2FH8A 4ZDHA 4NFCA 1A6UL 4XH2A 2LTQC 2X9ZA 4WW2C 1RK0B 2CWRA 3WN5C 1YY8B 1KG0B 5FAAA 1KGCD 3QJXA 5ABDE 2ZSWB 2DBJA 1KIPA 1ZTXE 2YS4A 1RERA 4IBVA 3L2NA 3WE1A 3MFFB 3MJ9A 2K3TA 2W8CA 2HVJA 3O4OB 4JQIH 4X4YB 5HYEA 3VXQA 3VQ1C 1TYJA 4GPVA 3V6OC 2YAHA 5D6DA 2XG4A 3KLSA 1WHPA 4PSRA 4E2OA 2CHNA 2ITFA 5AYTA 2YOAA 5GZOC 1RY7B 3S4SG 4OB5L 1DE4A 2WGNB 3AXHA 3C09B 1AQHA 4YSQA 4KZEL 2FATH 1RZGB 2XWEA 3EZ8A 3JWOH 1WFTA 1MJJA 4PREA 3E6HB 4E9TA 1DCLA 1UGNA 2C4FU 1MLBB 2IJ0C 3NJKA 4N90E 3SDDD 4A7GA 5I8KH 5KEZA 1NBVH 2HFEB 3SEPA 4LT7A 3Q2NA 4OM1L 4U1JA 1BX2B 1QSZA 1F4AA 3MLUL 2GFBA 2QTEA 3IB4A 1ZHLA 3VI3F 1J1OH 4PRID 5HDBE 5F9OH 1LVEA 1LO4H 1DSFH 1Z0MA 2JF1A 4KV5F 4Q6YA 1FFPA 3NIDE 4XC3L 1ASOA 1MRFL 5F44A 2QFRA 2WP3O 4Z0BL 3WFDH 3TVMB 3IRZA 3O3EA 1M2VB 1EAQA 4WK4B 4YVUA 3U9PL 4IS6B 4YDJB 3UAJC 2BSRA 2WTRA 4JGNA 5GGTH 2P46B 4YBLC 3MJGX 4Y9CA 4POYA 1NLBL 1KJ3H 4WEMB 1FYTE 2WTOA 1TO5A 2WVSA 3MV7D 3QZOA 3QORC 2Y07H 2JMRA 1RXLA 3WHXA 1VACA 4YAQA 5AVVB 1EFXB 2EDRA 2H8PA 5EEXA 5BS0D 2JSFA 5E7FA 4F1SA 1CS6A 4S1DD 1XGTA 2BO0A 3U6XA 4AYGA 2C9UA 3IEAA 4IIZA 1E4WL 5FYJL 3JV5A 4JPVH 1RZFH 1X3DA 2FZ3A 1QSFB 4HGMA 4PJEF 2L7JA 2FT6A 1UM4H 2BMKB 3AG2B 4WEBL 4HWEH 1K2DB 4CU7A 4JKNA 3SJVD 1I8IB 1YO4A 3PQYD 4F93B 2Q8AH 4KOBA 4H88H 1JERA 2KMWA 1IQDB 1P4IH 1EZLA 3LEYL 2DKSA 1BM3L 3AGWA 4XCYB 1NFDB 3AROA 3MRDA 1G7PB 2F0CA 5LKNA 2BP0B 5KN5A 1HVXA 3N1MC 3QEQD 3KNBA 2ZCHH 4L3EA 3UYRL 5A6IA 5IWLA 4PLJD 2WBKA 3MLVH 5GSVA 1XB6A 4GRLD 4OFDA 3ETTA 4QXTA 1YN6A 2RA1A 4GH7B 1UWGL 1PYWB 2CRZA 2WOYA 4JGMA 3R18A 3GK8L 2D2OA 2NUTB 3O41B 3P9LA 3HAEB 4UAOB 2ZOLA 5KUKA 1R46A 2WNKA 3TZVB 1EO8H 1JS4A 3GXFA 3NJIA 1KUMA 3O45B 3PJSA 3UC2A 3QS2A 1ILUA 3JWDH 4AC2A 3HZKB 3OAWA 4AQ1C 2EYSB 3B9EA 4NDMB 1Z9OA 3AWFA 5C0FB 1IBGL 4IRSB 5JOPE 5GS3A 4MMZB 3BAKA 4KKAD 1YEGL 3HG3A 4AMWA 2J43A 1X5IA 5I8EA 3VFVB 3BESR 1RJZB 3HA0A 1GW0A 1OALA 3B9DA 4GQ9H 4JRXE 4POUB 1QTPA 3UBXG 2PTTA 5DJAB 5HHMB 2G9KA 1HWGB 3BQUA 4JCWA 5T1KD 1BYOA 5H35B 3LKNB 4F2ME 3QZPA 1G7QA 4MA7L 4AQAA 2J1WA 5CP3H 3C60C 4FLHA 2EIJB 3PWNB 3ARTA 2YMXH 4N8CH 3ARZA 2OJZL 5GRVL 1ZLUK 3VQMA 3QIWC 2OJEA 4JG5A 1WBZB 4R96A 3VA6A 1ZHKA 5TDPA 4CMHB 2ZOKB 4AMKL 4GXFA 3QVAA 2GSIB 4FMFA 3VFUA 3GMRA 1CG9A 3C5JA 3DHJA 3MLSL 1BF2A 3BVTA 1SBSL 2E7MA 4KZCA 4Z7AA 3DX1A 4OZFA 1BXUA 3IJYA 4CN1A 3C8KB 4JY6B 4P2OB 3WFCL 1FH5L 3BP6B 4RVBA 4AYFB 1ADQL 1QR1B 4P5SA 1NGYB 5DRWB 2A77L 2YUZA 3ISYA 2WJ7A 5ITBH 2JH2A 3IGFA 2FUTA 4X9FA 2X2HA 1BZ7A 4YPGB 4RCAA 3MXWL 1DZ0A 2NY1D 5AW2B 2W9EL 3WEAA 3U79A 2APXA 2O72A 4EUPA 5KG9B 4Q6IC 4U4BA 1MCWM 2ZUVA 4IU3A 3LQZB 3P3UA 1MHCA 3C6SA 3T8MA 5ETUB 4NUPA 4WF7A 5C0IB 3O2DL 3TONA 3NUKA 5JLZA 1U92B 4MMYA 5AVZB 1AZUA 2FGZA 5EZIH 5FR3A 4TXVB 4GKNB 3JYCA 4XBMA 2ERJB 1SY6H 3QDJB 1E42A 2Z7YA 4I4WA 3DXAD 1QBMH 4N0YH 5FO2A 5KS9F 4G7RB 2UX6A 2C7UA 3TIEA 4KVCH 2YPKB 1EX0A 3PQYE 4G7QB 4LSSH 1IUZA 1QSEB 5E1GA 3O3AB 5HPMB 4YHPA 3T3MB 4W6WB 5KOMC 4EI5A 3IFNL 4NYLB 4TVSa 3LZFH 4U6YB 3ZMEA 4E9XA 2GCYA 3CZEA 4JFOB 1NCAL 2CUAA 4TF4A 4HIXL 2YBRA 5F7HA 2YPLA 2BY0A 2ID5A 5DHVB 5HI3D 4CC1A 4PJIA 2NY5L 1R34A 1YNKH 3L6FA 4JN1H 1UH3A 3OKLA 2LR4A 3S36X 1CK0L 2WW8A 3D30A 3EH5B 4L9LB 4AV0A 1CE6A 1MXDA 4ZX6A 3DYOA 5DJ8A 5IF0B 4F27A 3QNZA 2KT6A 1OY3B 4FHBD 3UP6A 4PLOB 1WTGT 4ZNEA 2DMCA 1A4JA 1L7IH 1OAUL 3PABA 5I1JH 1RU9H 3C6EA 3S6CA 3BP4B 2Q7NA 1ZK9A 4X6DE 4X6BB 1Q1JL 2XNAB 1I8AA 3X1NA 4KO9A 5DC2A 5F6HI 3FUKA 4HWUA 2O30A 5CU9A 4NNPL 4HS6B 5D7SL 5B8CC 3SDDC 1AZNA 4IDLA 5T33H 1R24B 2LABA 4EJ1C 3Q6FA 2R15A 3GHBH 2EO1A 4QF1A 4P2QB 4P5TB 2N1KA 2NQ3A 1KXVA 1TZOA 1TG8A 4L0PB 5TH2B 3V5DA 1VA9A 4GAAA 4M48H 4N0CD 5HGBA 3ROLB 2LU4A 4DEPB 2E7DA 1HXYB 5KW9L 4G8FA 4YDIH 3MRHA 4DN4L 2H6UA 4HCRH 4JPKL 4XOCA 4AVKA 1UB5A 3QQ3B 1Y0LB 1KIUB 3RWCB 3VGAC 4APQA 3WIFA 2WUCL 4MQ7B 2JELH 4IDJL 2AGJL 4ODXA 1HZHH 1B0RB 2B0SL 3GXMA 1QBLL 4Q7DA 5F9AC 1PLAA 4I18C 4NAMA 1U8IA 3WIHA 2Z4TA 4J3VA 2V7NB 4O2EA 4BZ2H 4EF3A 4NIKB 4KJQD 1SXBA 4S1DC 2KDYA 5E08L 3CUPB 4DH2A 43C9A 4CSSA 4NQUA 2OL3L 1L0YA 2GJZA 4RSVA 4U7MA 3THMH 2XFGB 1EANA 2CIIA 3ISRA 1NANH 2R27A 3V2AR 1QSEE 3GTNA 5B38G 5JW5B 3DUSA 2IC2A 2J7LA 1ORQA 1PKQE 4M8VA 1MAKA 3SY0A 5EZOL 2EUVA 4XCNA 2JKXA 1N5AB 1YJDH 3TGXA 2YA1A 1LEGA 2O93L 3GSXA 3LOWA 2XN2A 4L4VB 3ZYZA 1DVFC 3BJLA 3C75A 3A0OA 4KKLD 4BE6A 3H0TA 3OPZL 1F1AA 4PLJC 4EXKA 4LDLB 3ULVC 3TL5A 1FLRH 4M6OL 4M1GL 5DF0A 1J5OL 4ESKA 4UV7H 3U6RA 2NDFA 5LNGA 3DX7B 4LSUL 2DQ6A 3H1ZA 1G9NH 2VMFA 3HBQA 4WI8A 5H8DA 4YEEA 4WDIB 5AZ2L 2P3YA 4KFMA 2NY6D 4XAWH 3VE0B 2VZUA 1NAKL 5KYXB 2R23B 2FWSA 2VITA 3VX0A 1WG3A 3FQXB 3QR1A 1PEZA 2AEWA 5BUAA 5CBEA 4M1CD 4KAQH 3ZTNH 2EUZA 4QOKD 2IALB 3QCUH 2BDNL 4KK6D 2K9UA 3EZJB 3Q2LA 4HT1L 4KRNA 2NR6A 4Y4FD 1P1ZA 4TRPL 1TKWA 2E9WA 2XCMC 1KXTA 2ZP0T 2P8LB 4KKAC 4XNYH 2BXZA 1OXYA 4BFIA 3VDAA 5FDWA 2R4SH 5ITFB 4WJ5B 3RP1A 2NY2D 1B2WL 1JHLH 3NEXA 3LNHA 3KEDA 5HDLA 3GZKA 3OG6B 4NM4L 1JNLL 1A6ZB 4NFDA 4Y1AD 4ILDA 4UTBA 1ROCA 2G9HA 1S7VA 3D25A 1JFHA 3AG1B 4JBSA 5HJDA 1FC1A 3EFFB 1BW8A 3O8XD 5D96C 1T1XA 2CCLA 5C0BE 2YPVH 1GYAA 3BN9D 3PNWB 1XR9A 2X4OB 5F7MC 1ONQA 1S7SA 4WUKH 5C7ZA 2OTUB 1FE8L 1U3JA 1B4JL 5F7LB 5A43C 4QRBA 1G87A 1L3NA 1BQKA 4KJPD 1U8MA 2FBJH 1EEZA 5ALBH 3J7HA 4NX0A 5IG7A 4I0CC 4OGZA 5G4OA 3WGVB 3NTCH 1KTJA 5E8PA 1WBXB 2X4UA 2VUOA 2MQGA 1ZVSA 2LVCA 3OZ9L 3L3IB 1GYWA 1G7MB 1BFTA 3D85B 1M05B 1ACZA 5FOJA 3BUYB 1U33A 4YSEA 4UQBA 5D2LE 3IAQA 4ODSL 5AUMA 2XQ0A 5F8RC 5GGRA 4M61A 1SMOA 4X6CF 2YD6A 3CX5K 3OR7B 1F3JA 1WVZA 3KWWA 1HL4A 4RMQA 5EG6C 2OKMA 3B1UA 3U2SB 4W9EC 3LKSA 5IM7B 2LLLA 3FSOA 1QKZL 1M6OB 3OHXB 5I8KL 1J9RA 1NBVL 3WEBA 3QYNA 3NK3A 1QAWA 4YHLL 5ID0A 5LUMA 2AXFA 1J5DA 4PS7A 2JJUA 1K8DB 3CFCH 3W5MA 5AVYB 2A6KA 2CGZA 2QR0A 2CO6B 4FQIL 4C59B 2F7IA 3IE9A 4OZIA 3V0WH 5IOKA 1E9PB 1H8OA 3BVDB 4P4KD 4S10A 4WTQA 4XCEA 1CT8A 3D69A 3L5XH 2X12A 4UQAA 4E41E 2OSLA 4F7MB 3IFLL 1COBA 3EF4A 3WFDL 1DLHB 1XTMA 3DUUA 1T21A 1WHOA 1HXMA 3JVFC 2VXVH 4YSCA 4AENB 5GGTL 3P2DA 1WICA 2H47C 1S7UB 3DA0A 5DVNA 1JBJA 4L29B 1KJ3L 3PXLA 3TASA 1IM9D 3P2BA 3HC0A 3COOA 1NJ9A 1ETJA 4F9PA 1MWAB 4U1GB 3TXAA 4M5SA 4HWNA 4PJ9D 1MIML 1OWRM 5EOCL 3EGSB 4JM2C 3F6LA 4IMLB 1KLGB 1I1RA 3ECVA 3GXNA 3K1DA 1P9MC 4EDXB 1HQ4B 3DIFA 3DX6A 5F96H 1A3ZA 4U33A 4ZTPL 4BK5C 1W8OA 1QLEL 2G3MA 5EC2B 5KVGH 6PCYA 1H15A 1R3KB 5AB9A 3RUGB 5JNYA 1HYSC 1AGEA 4YDKL 1X9RA 3MLPA 1U36A 1BVNP 1WA2X 5CZXD 5DYOB 3GMLA 1HKLL 2YJLA 1PLGL 3UCRA 4H88L 8CGTA 3MLYL 4H0HB 4FNLH 3QNYA 3QSKB 4XRCA 2BM3A 2JWYA 4BZ1A 2N0MA 3KH4A 3WENA 2WLNA 4F7PA 1BD2B 1DUYB 1MLCB 3FTGB 5DQJB 1SJHB 5IBTL 1MJ7H 5I1HL 3UTZB 3EJRA 3ZIYA 3KCPB 4OCWL 4YGVA 2AQTA 5L2KE 5K33A 5HVFB 3QAZB 1AO7B 2FX8H 3CZSA 3DX2A 1PZUB 1M4KA 5AOJA 5D9SB 4LHUA 5T5FL 4Z23A 5D1ZD 1F3DH 1TQVA 3I9GL 1E50A 4CW1B 3VFRA 4NQDB 1Y18A 1N68A 1E43A 4NO5A 3NH7H 2YAMA 5IVXA 4LF3B 3R7RA 4RA3A 3TCXA 1ZT4A 3HNVH 5D2NB 1WJ3A 1OSZB 4KJQC 1BFOA 4P2YA 1FBIH 4KQ3L 3TO2A 4Y4HD 3E8VA 2XTJD 3O9WA 5F3HB 3DJTA 3DPBB 3N2JA 4XXWA 3W38A 3OWEA 2WK2A 2K1MA 1G0YR 2R51A 4XCFL 2OAAA 1TNNA 2VZOA 2VC2H 3TTYA 6FABH 5B3NA 1NGPH 4GW1A 3QWRD 4GYBA 2AXWA 1AY1H 2ARJB 3QH3A 1P7QB 1BQHG 5LN8A 4HFWA 1EVTC 3B5TA 5TK2A 1G84A 1KB5B 4AJ0A 4QO1A 3IDJA 4G59C 1A66A 2DJ4A 4J27A 1T6VN 4FA8A 5BO1H 3SD5A 4AYSA 4QY8A 1AQDA 2FWOA 3ARDA 2CKBL 5BW7C 5I1IH 1AQ8A 3FOLA 2DQEH 3FTVA 4N2KA 1CBJA 3C5ZB 4UZGA 3RPKA 4QAWA 2OLDA 3JTSB 2E6JA 3CFQA 2DMKA 3QIUA 3U48A 1XCQB 4PQXA 5J9PA 1E2VA 1FPTL 2I26N 2YZ1A 4NKIL 3CVBA 3KPRB 4KPHH 5D7LA 4EE2A 1E0OB 1VKXB 1PZ3A 4I8DA 4QKXB 2NY6C 4HPYL 1MI5E 2ZYSA 1T22A 3OF6D 3QRFM 4PJDB 4PPTA 5DZLA 1MFUA 2HJLA 4PGZA 3NPSC 3KS0J 3LZRA 3CSYB 1FV1B 4WHDA 5DJ6A 3IE4A 4AW4A 4BFOA 4M1CC 3UACA 4FXLA 4NJAH 3M1OA 7PAZA 2P80D 3TBTA 4KK6C 2HT4D 4X9YA 4Y4FC 4JFEE 1JWSB 3M17B 4PV9A 3SYQA 5ITBL 4ATWA 15C8L 3T0EC 1MVFA 2NYYC 2DLIA 5KYUA 2ETWA 1GR7A 2VLKA 5TQ0H 4UU9B 1BD2E 2CJUH 2OCCB 5JHDD 1V7ML 4GKOA 1P84J 2P24B 2WZ5A 5ENWA 3KXFE 1TJGH 1PDKA 1CD9B 4C8XA 1HNFA 4LLVB 3F83A 3OKKA 1CF8H 3CMOH 1T66D 4WFEE 4ODUA 1IGYA 4CDGC 5EU7C 1HOCB 1OGTB 3DVGB 3DHPA 4NQED 5EZPA 3G5YB 3I9PA 1QA9B 1SY6L 3KBHE 2PYED 1QBML 2QQKL 3O8XC 4MD0B 4G1MB 5IV2B 3JV4B 4PJ7E 2AAVA 5FO7A 5D2NE 2CA4A 2KDGA 2O6PA 3LHPH 4PB9L 1T89A 4EVNA 2XU9A 1CLOH 4WGWB 3LZFL 2NW2B 3WXWL 4KJPC 4MB4A 4PGCA 2AAAA 3I84A 2GIXA 2IPUK 2Q2EB 2P5ED 2VXTH 1IAKB 4D7BA 2NXZB 2GHZA 2IQAB 1QRNB 3BYYA 3PWJB 5DZVA 4I77H 5SX5H 3KL3A 5FIEA 3N1FC 3D3VA 2VDNL 2FCBA 3F58H 5FM5O 3NABL 5E5RB 1WGVA 4Z7QF 3BVWA 3T9WA 2ZX9A 3FJTA 3L95B 3QI9B 2WXIA 5I1JL 1RU9L 5B1BB 5IQ9A 5D5ME 5EBWA 4Y7MA 4JG0L 3DRTA 3ZSTA 3R1GH 4OCYH 2NNXA 4DTGL 4X6FA 5KSAB 4GP5B 4JDVA 3UTTA 1IGCL 2WN3A 3GMQA 3IJEB 1KPUB 1OE3A 4M43L 5TE6H 3ZKND 1AFVH 3FYEB 2DQCH 4MAYB 4GW4B 2CBQA 4NGHH 1JV2B 4LRNL 1FFRA 4PJBF 1YY9D 1F90L 5AOZA 4AM0A 3BIKA 1AZBA 2IG2L 3QFJD 5CR1A 1XGYH 5FUCE 2C3VB 3KPSD 3BGMB 2DQFA 3K2UH 4BYHA 4M48L 1BVOA 3T2NH 4L37A 2ZKWA 3LRSB 1W0WB 4HCRL 3MRIB 1GXEA 2XUWA 4WFFE 3GTVA 1ZLVH 2FJGA 2AJYH 3HG1D 2FGWH 5AOKA 1KYUA 2JQMA 1YHPA 3X3GH 2FO1A 1HZHL 3RY6A 2OW6A 3ALXA 5LQBL 3HNSL 2OMYB 3F3HA 4N2NA 4GMTL 3C6LB 1HL9A 5AWNH 4L0ZA 1GHFH 4PJHA 1QUPA 4NC0B 5ADPL 5D7HA 3HMXH 3LY6A 1Z9NA 3WLWD 4PJ9C 3EOAA 3CVHA 3NP4A 4WFHE 4F37K 1NQBA 5AD0A 3X12B 1GKEA 1YDPB 3K8LA 3AREB 3ILPA 1U91B 2HMIC 1IBFA 3KYNB 1FNEA 4LIQE 3CFKB 2WZ6A 1IC5H 4NNYA 1S7WA 5HYSG 4QYAA 1XCTA 3CN0A 3PP3K 3UO8B 2MJWA 2GUOB 2IWEA 3LKPB 4U6HA 3UG5A 1A3LL 3RPIA 4ADJA 5KJRL 1FG2B 1CFTB 1UCBH 3BH9A 2IH9A 3PGCB 4OKVB 2IFGA 4TLTA 4XMXA 4YN3A 4XXDA 2CO7B 1T7VA 1YJDL 4HQQL 1WAEA 3HS8A 2CLZB 2JI3A 2JQZA 2I07B 4OT1L 4PH8A 3U0PA 1A6VH 4K73A 1K4DA 5DVOA 1N64H 3E2HB 4JO4H 4YVNA 2G2RA 2H1PH 3D05A 1E5AA 1CLCA 1IC7L 1DN0A 3ARGA 3FQWB 3TO4B 2X3BA 3IF1A 4N9GB 1GKOA 4UV7L 5ELIA 3IWVA 4OTXL 1G1KA 3CDYA 5D1ZC 5G5DB 4NQQA 3WEOA 3K6NA 3FB8B 3K4AA 3DJRA 4NENB 3DVNA 3IJ8A 3U30B 3VFPB 3F5WA 4JDTL 5FPIA 1JGUL 2H6OA 1O7DE 2I27N 2V2TB 5JW3H 4PV1C 2E6QA 2EVGA 4ZUTB 3OWRA 3WKNA 5IJVA 3MODL 4KI5D 1NUDA 3RB5A 5L7XL 2P5EE 2YKLH 2XX1A 2XTJC 4OGAD 1T03L 2E7LA 5I5MA 5J12B 4Z9KB 2N0KA 1KZYA 5DS2A 5LBSA 2DQTL 2E27L 4HIQA 5K1NA 4L1SA 4ZPTB 5DRZB 3U46A 3D39A 1CICD 3HC2A 4U6TA 5MERA 2PR4H 3SQOH 1I8LC 3UO1H 4TUOA 5EUOF 4MNHB 4WZ9A 1Z2KA 2QVMA 5IFJB 3G6JF 2Z93B 4HG4K 1TCRA 2OX5B 5ERWA 4HF5L 2VLRA 2WO4A 2ZXEB 1KPVA 4NJ9H 4JJHA 2HFGH 1KT2B 4GSQA 3CC5A 1KSRA 3FU7A 4AY0A 1FHGA 4KK5D 5C0AD 4S0SD 3V6FB 4BDVA 4KROC 3NA4A 1G9MC 3IETA 4X5XB 1UXMA 3F7LA 1UD6A 1SJVA 1C12B 2JJTA 1XSOA 3A67L 4HBQA 4K3DL 5LCVA 1J8KA 5HP5A 4QTIH 1P7KB 4A38A 3WAJA 1E4XI 2IPKA 4N0FB 2J1YA 4OM0H 2G3ZA 1IARB 2GITA 3FUHA 2DD8L 2DWDA 4W9IC 3ZXAC 1YEIH 2EIZB 1XGQB 3PPSA 4G1EA 1PJ9A 3G08A 4GQRA 3QEGH 3ATAA 3MV8B 3IDUA 5JPNA 5FGCE 4X7SH 2AXGB 3NG5A 3JWNG 3QUXD 2J6WA 3KM2A 1MFBH 3RL2B 1AXSA 1YNTB 3EADA 1NMAH 4NKMB 3RDTB 2DM7A 5CUSH 1KGUA 4WWKC 5HVHB 2CDFB 2R39A 4HKBA 1FQ9C 3WFHB 3QXWA 5IFHL 1U3HC 4JZNA 4J23A 2A9DA 3V5KA 1NC2A 1F8TH 3DRQB 4LCIH 2AJUH 1A1MB 4L5FE 1TQCC 5DZOA 4G9FB 2QKIA 1T66C 3FZUD 1T3FB 3R8BB 3TTSA 2YFOA 1AHKA 3VXNB 3EGXA 3ULUL 3L5WA 4OI9A 1D5ZA 3KJ6L 1U93B 3JWNH 3OJ2C 1E90A 3NACH 3RGHA 3F12B 3WDHA 4HEPA 2P1YA 4AEIH 4Z3IA 4YE4L 2XXCB 3UZVB 5JYMA 4OJFL 1S7RA 3LS5L 1D9KD 1RUKH 3AGVA 3RE0A 4IGBA 2ADYA 2J6EH 4AYID 1Q0YH 5KJ4A 3QUKB 2X1PA 1OZUA 1R0AH 2N4IA 2R2BA 1K5NB 4NQSA 3RGVB 4Z1PA 1CDUA 5DJ2A 3CSFA 3J27A 2JK5A 3V6BR 4FADA 2VXVL 2OMBA 4AGNA 2R8SH 3CZKA 1A8ZA 3TCLA 1AD0A 5IUSA 5B22A 1NBCA 4BFKA 5J6HB 4MDJB 4F7CA 2B9BA 5JDJA 1N6UA 1WDAA 2G5BA 4RMWA 3B7RL 4L3AA 1EMTH 2IXQA 2A9BA 2GSGA 4QJ5B 3BVUA 3RZCD 2RH0A 1UB6B 2WN2A 3VWKA 2YRBA 1GGIL 1A7NL 3TBYA 3LJ3A 1JF6A 1EA9C 2PW1B 2GT9B 3KYOA 5C0GB 4KTEL 2VZ3A 4R4BA 3RVWD 3WJMA 1WFMA 1Y6KR 2XV6B 4J6RL 4KI5E 3CZGA 4LCCA 3HJEA 3BAYA 2ZXDA 3QUYD 1OGAA 5DD3H 3ZKNC 2N3JA 2EDHA 4JLRA 3I9AA 2EEFA 5CZVH 3QJQB 1CC3A 1IM3D 2ALAA 1YY9C 1EAPB 4G8GB 3PY9A 2VMCA 2K9FB 4FNLL 3LZQA 3G7TA 4H7VA 1JPST 4B9CA 5CIPA 1CTOA 2WYHA 3HKZA 3U25A 1Q9LA 3T4AB 2Q10A 1SN2A 4OCNC 5E7BA 4YSPA 1OAKH 1QUNA 1FYTA 1W80A 5I1KH 2FX8L 3H3BC 4RMTA 3WUWB 4Q9QH 1DVSA 1FNGB 3RFZC 4JX0A 3N40P 3ARUA 1QBAA 2ATPB 2E75C 2FB4L 2ZONA 3EYSH 1I8KA 3HNVL 1EHNA 1GIGL 4HOZA 4FEMA 3JXAA 3U1SH 1T4WA 3KR3L 1J1PH 3G6DH 3L81A 2C4XA 3S5YA 4FFWC 3O6ML 1KIQB 4EO5A 5A7EA 2DYSB 1QWHA 4P46C 1HH9B 1NEZB 4Y1SA 3QZWG 3JT2A 4NNXB 4DZ8B 5AENA 5C0JA 3CC1A 4LSRH 4CUCA 4Z7OE 1CVSC 1WD9A 3FSAA 4BSWA 2DKMA 5HHOB 2LTQB 4WW2B 3S3DB 1KN4H 1HEHC 3WN5B 3NCYS 1YMHA 2NTFB 4RMVA 1JPGA 4HCFA 1W9XA 2CBMA 3MV11 3FT4B 1HSBB 1KG0A 4PWGA 4UQIM 2ZSWA 3OGCA 4Y5YA 2OQJB 3GEWB 1JTPA 4RQQA 4DWHA 2YUVA 3INUL 4DPAX 3QS3A 4X4YA 3FB5B 5E6IC 3UBFA 3EYQC 1S9VA 5BRPA 2ZKXA 4MMXC 2Q2LA 1GYVA 3MX0B 3B5HA 4HW6A 4HUMB 2Y1AA 3M88A 1C9SA 2HRLA 2I69A 4N2CA 4XVSL 3KE0A 1MLBA 3HE6A 3A24A 4Z7WE 1NCUA 1WBYA 3IDMB 4OI8A 2X2YA 2YOCA 3PCYA 1T0PB 1BX2A 3MJ8B 4M5TA 2H41A 3PS6A 4PY8J 4GBXC 4KTYA 1A1OB 3U9WA 1AQKH 1BVNT 4NERA 4KX9A 1H8LA 2VDOB 3MRMB 3NA9L 5GZND 5FYKH 1UYWL 2VH5H 3HI1A 4G8GE 4L18A 4JRXA 4XE0A 1DVYA 3O6LH 4YBLB 2O6DA 4F2MA 2PCFA 4OLEA 2X6AA 1UWYA 2CJUL 4G42A 1J5CA 1M2VA 2ENPA 4WU7B 4IS6A 2J4WL 1CL7I 1WA1X 4JRLA 2MQ0A 4MNQD 4KXZI 1LEIA 1PFCA 1TJGL 3ROOB 4MB5A 2AVFA 1TPXC 1CGYA 2XTLA 3GZPA 4D7PA 4AQOA 4PS8A 5C8JB 5H2BA 1MEXH 1U8PB 1LILA 4R0LC 3A6BH 1YMMD 1EFXA 5AKRA 3KLDA 1KWKA 1H3UA 2B1AH 1JCKA 5FGBA 4RFEB 3MLZL 2R1YB 4XC1H 4KK5C 3QDGE 1ZXQA 4P2RB 1ML0A 1X6LA 3GNMH 2E7BA 2EE2A 2E8ZA 3R7QA 4NZTH 4XOAA 3LPOA 3RIAF 4EN3B 3V8CA 4YR6A 5GS0H 4Y2DA 2BMKA 2VL5B 4ZUWB 3BH4A 3SKMB 4DGIH 3US0A 2PABA 4QRRE 4G8AC 4OCRL 3O4LB 5HHOE 2IGLA 4OZGF 2VXTL 2XQYA 1DLFH 1NUFA 3IK2A 2FIKB 4OAWB 2ZXCA 4KTDL 2YRLA 3BIAX 1H5BC 3WY4A 5ACZA 1UQSA 3N1GC 1XEDA 3QG7H 2BP0A 3F58L 3V6OE 5I5IA 1J88A 1FRGL 1I9EA 3DMMB 3PWUA 3PXHA 3WKYA 4WFGE 4HIJB 1MG3C 2AFNA 2XOTA 2VM3A 3BD4A 1GPOH 4NO0A 4Y2OB 3MUJA 2ZOUA 5T1LD 1F6LL 4UYPA 4HUUB 1RUPL 2UUDK 1D5IH 1UADC 1F13A 3STBA 4TQPA 4MS8D 3O41A 4U1MA 1RIHL 1JYVA 5TE6L 4YL9A 1QWUA 3L9RB 4RRPM 1J8HD 4TTDD 4X99B 1THCA 1IGJA 5IHZB 3FZUC 3T4YB 4ELMF 2X87A 4YDVA 3GTTA 2R4RH 3PQYA 4A2EA 4B41A 5INCB 3HBPA 4JFDB 4PJFE 2K4AA 3HZKA 2WSDA 3QR2A 2EYSA 5FC9A 2YSTA 4A7GF 3UTSB 4J3OG 4NFBA 2GC7C 1A4CA 2VE6A 1D9KC 1U2CA 3K6IA 4XP5L 4IOFC 3L16A 3IGLA 4Y19B 4K23H 2HLAA 1KFGA 2BFGA 1RJZA 5BZZA 3C60B 3D4YA 4P9HL 5AALA 2YMOA 5DD5L 4ZMNA 2E74C 5KBDA 4AGLA 4R3SB 4MRBA 3LKNA 2XIIA 2AJYL 3BYTA 3QIWB 3EH3B 5K9OB 1JI1A 3NIFB 4ZFOB 1BG1A 1RZ7L 1ZANL 1GHFL 3RZCC 2J2ZB 4X6DA 4YXKL 2P48B 4J3OH 5IVZA 5D7IB 5A2JH 1I4FA 2CXGA 3EJZD 1O6SB 3W39B 2VDKB 3HVNA 3V95A 1UEMA 3IKKA 3IGKA 2XZAH 5JR1H 5TQ2H 1QFPA 9CGTA 2P28B 1IFRA 4HZLB 3Q13A 4YUEH 3TNMB 4DP9X 2DN7A 2G60L 5EORH 3GSRA 3M86A 4AK1A 1QX1A 1U8JA 3OC8A 2BS9A 1QTYT 4P2OA 4JY6A 1OZTG 3EFDH 1HHGB 5CEZH 1JP5A 4XHQA 2H9GA 2IBZX 2DL2A 3JTBA 3LMJH 1NGYA 4Q6IB 2DYPD 5DRWA 5D1ZI 4NO3A 3EDEA 3QIBD 5TDOB 1YYMH 4YPGA 1ZA3A 2R29A 3OKYA 4CC0A 5KG9A 1ZCRA 1HH6A 2MPAL 3ZK0A 4ZOAA 5DUPL 3ARFD 5T1DH 1RUQH 3WJJA 4EOWL 1FO0B 3FH8A 4D9RD 4HIIA 4MXVE 3O6KL 2WKOF 4TPRH 4P57B 1EDQA 5ETUA 5C0IA 3VI4B 1S3KH 3K74B 1FFTB 2D7PA 5C08E 5C3LD 5IW3A 3UGEA 3FFCD 5CILH 1N6QL 4R97C 2MNJB 2Q86B 4DGYH 2KBGA 1N9PA 1NCJA 1T20B 3FQ4A 4JG1L 4YSSA 5L9DL 2YPKA 2NY5C 3MBEA 2PO6A 4R7XA 1QSEA 3T2QA 3DV4A 5EU4A 4ZYKA 1XCXA 3PGDB 3FBQA 4AIXA 4NYLA 1PKQA 3ZSSA 3UTSE 1QBBA 4QIRA 2HPOA 3QR0A 3LZOA 4JFOA 2Q8BL 3NCBB 4Q0XL 3HI5L 3L4VA 4IYKA 1X7SA 4P4RA 5DHVA 2GJ6D 1D6VH 1MAMH 5HGHA 4XXCA 2PW2B 4R26L 1GZHA 4XN8A 2WQ8A 3SQOL 1FJ1A 2XN9E 3UO1L 4XBPA 1BQUA 3X1EA 2FEEI 4G11A 3BQVA 3ZE2E 4C4UA 1J8SA 1INQB 5JIHA 5IF0A 2F15A 2QGCA 2NY4C 3J2PA 2ESVE 4Z0XA 4P5MB 4ZOBA 3U36B 1NMBL 2BS71 2WCSA 4C83A 4N2FA 1FNSL 4X6BA 2OFQA 2VQUA 2XNAA 1OL0A 2V5YA 3RWFB 3SDDB 4TYUA 3FO2B 3SO3C 5B8CB 2OMUB 1AD9A 4PG2C 5D7IE 4HWBA 4WK0B 1D5BA 4ZO7A 3KPMB 1IEAB 3WTXA 1DQTA 1XIWD 1R24A 2QGBA 4S1QL 4JY5L 5C6PB 2PP7A 3FF7A 6CGTA 3MJ9L 4OM0L 5A2KH 4ADIA 1KBBA 1T4KA 5FW6A 4P5TA 4AE0A 1EERB 3PL6C 3VG0L 3EH4B 3V7AE 2P8MB 2VN4A 3QJFB 5BVPL 3CVIH 4U4IA 2OCJA 2MOVA 4HKZA 5FFOA 3VGAB 1I3GH 1MFBL 2KLTA 2VLMD 2FD6L 5HD8D 1NMAL 4U05A 2AV7B 1LP9E 5CUSL 4HKXB 5ICZB 5E24E 2I9LA 3ABGA 3QQ3A 1Y0LA 2GW5A 4OCMC 1DQMH 1WRFA 3QZNA 1DBBH 3B34A 3KHOA 3G9VA 4I18B 3VACA 4JZJA 2CXKA 5ISZE 5I1DB 1A6TB 3APNA 1RUAL 4O9HL 2BXYA 1MXGA 4FQQB 3AQZA 2YXWA 2GJRA 2P5WD 3RY4A 2W0FB 5KBNC 3VU2A 5C0BA 1JHKL 2IMMA 2V7NA 4BFBD 3H42H 2XN0A 3VI4E 1ZHNB 1E9OA 3TC9A 8PAZA 2YAQA 5AZUA 1GY1A 1MVUB 3V4VA 4DK6A 3GKWL 5I1EH 4AEIL 4XVJH 1YEDB 1JDAA 3F7VB 1JF5A 3QC6X 5GS2D 2BC4A 4TSAH 1GSMA 3SJVB 4W68A 2VABB 4X6EB 5I75C 4HIEB 4FQXD 4GFXA 4GXVH 1DVFB 3L3KA 3CDCA 5A6LA 3QEQB 1IO4C 1T0MB 1UEYA 3UTQB 2PTVA 5AW9B 4PJIF 1W0YT 1EMTL 4MD5B 5D2LA 5EIQA 4NAQA 3LEXA 2WZ0A 3VXUD 4GRWH 2IOOA 4LHUG 1YYLH 1UZ6F 2I5YL 4JAMB 2XQBL 3VTMA 3VW3L 3SKOB 2X4RB 2HJFB 3I02B 2J55A 3ZOAA 2A6IB 1B4RA 4R2GD 4BZ1H 1BIIB 1NCCL 3K71B 4QXGH 3NJXA 1L7TH 3KLQA 3IFOA 4DGVL 3PDDA 1AJ7H 1A7RL 1UWEL 1Q9KB 1XL4A 5D1XD 4WEEA 1WV7T 2BHUA 4I9WE 1T2QL 3GBML 1QFWH 2ZUWA 2IGFH 4GAYB 2ED6A 4E41A 1RZKH 5EOTA 5AVSB 5IB5A 2B59B 1SM3L 3AITA 3Q1SH 1QFWM 1SHSA 3F85A 3BCDA 4WO0A 5CGYC 1RZPA 2CA3A 1CFQB 2R1WA 1MZZA 3QXAA 5K9QI 3C8HA 1OAKL 4I1PA 1OSPH 5ITFA 4WJ5A 1XH3A 2HB0A 4Z7UB 2BVTA 4PYGA 2NY7L 1QW9A 1Y1DA 2W9DH 4K5OA 5D96B 1JPSL 1B90A 1F18A 4BFEA 2Y22A 1S3RA 5AG9A 3EYSL 3TEXA 3PJNA 2CDEB 3VMPA 2XPYA 3PDGA 4LL4A 3U1SL 1NPUA 4N5EC 2EXWD 3NJHA 4LE8A 4Z77B 3BVNA 2KI6A 1KELH 3DIVA 3MUUA 3QO1A 4XNQA 3PNWA 2BVPA 3L9EA 3QG6B 1BGXL 4P59L 3RNQB 4WTWA 5C0EA 3V52L 3WTVA 2AKRB 1HINH 3OKEA 1TFPA 4NHUB 2Y69B 4OLVH 4ICWA 2VZSA 1JGEB 1JK9B 2YKKA 1FVEA 1KN4L 3FU0A 4X8XA 4ODBD 5IBUG 1UA6H 4J3OF 2HKHH 5IQLA 1W8EA 2MCPL 1S5IH 1WBXA 2YMTA 3QIBC 3F6JA 3TEZA 5L2KA 4M6NL 4Q4IA 3IGAB 4K94L 4KDTA 3L3IA 2IOMA 5A2AA 2YBGA 4TKWA 1ETZB 3D85A 4AI7A 3FQ2A 1WWBX 3NJJA 1A5FL 1P7BA 3BUYA 3ULVE 3FB7B 5AEAA 7TAAA 1V5JA 3WV0A 3ARFC 4XP9L 1YQVL 3AT0A 3BO8B 2GEEA 1DVTA 3BZEB 1HEZB 4H0LC 4QRSB 3P69A 3GKZA 3N55A 1UXWB 2MNWA 2J56A 3DXAB 1FZJB 3OHXA 2BNQD 2VRAA 1CE1H 4L1BA 2E4TA 1QD0A 1V7NL 3BVXA 4PEEA 2YK1H 2ED9A 4NCC1 3RKPA 5DJCB 2BSSB 4LRIA 1XBDA 3DECA 3QXVA 2CO6A 3WE6B 1B0GB 4NLHA 1ES0B 2Z31D 3H53A 3O6LL 4PN6A 1MIEH 3Q2CA 3D87B 5C07D 4F7MA 1U8OB 2LLNA 4DK5A 3PYCA 2VM4A 2X9WA 4ZMZA 1GGCH 1JWUB 2R9HD 2EO9A 3DGDA 3EBGA 4K5MA 3PWPD 5E8DL 3KWVA 1GZPA 2G2NA 3GSVA 3QARA 4ZTEA 4I0PD 3MRFB 4MJIB 4L29A 4UIKL 2EH7H 1X5YA 1MFDH 4PRHB 4JM2B 3RU8H 3IDNB 4N4YB 4DP4X 3A6BL 4AKOA 1MWAA 3UYOD 2GHWB 4X7TA 2L7QA 1X5HA 1CLYH 3I6GB 4K4KA 3EOYG 4LPWA 1KLGA 1YEKH 4AWJC 1TJIH 3AG3B 4FP8L 4W1TA 5A3IC 1UJ3C 3D06A 3I50H 5E03A 3VYOA 1MI5A 5IQ7L 4LASL 5EC2A 5DGRA 3FO1B 4BH7A 4QPEA 1LDSA 3DO7B 3S37X 1R3KA 2YGOA 3S8WA 1XIWC 4ONGH 4FG6D 4DUWA 4XP6H 1GGYA 3LVTA 5DYOA 3L8QA 4BJLA 3NSFA 4JFEA 2XWTB 4N6RA 3H9SD 1DLFL 1BDYA 3JZYA 5C7XH 2PXYD 3LXUX 2ZKHL 4AIEA 5IP4A 3HTLX 1BD2A 3QG7L 4F1ZA 4W9LC 2O5ZH 3OXRB 5DQJA 1SJHA 4MLSA 5EN2A 5K9KB 3UTZA 3KXFA 4PJ8C 4KVPA 3KCPA 1TLKA 3MRNB 3ARBC 4GEJA 3IS0X 5F70A 1TIUA 2BOLA 1OE1A 1ZLWK 2LU5A 1NBYB 4WUUD 4JKMA 3ZE1E 2HA1A 1XX9C 2HCZX 2NX5D 4ZSOB 2ZUSA 1ZT1B 5ESQB 3DHMA 1ECYA 4XN7A 4N8VB 4Z7IA 4JHVA 1T1YB 4PJ7A 2R4RL 2DQHL 4LSVL 4UOW0 5D2NA 2AQ1A 4Z6AT 1E6OH 5JA9A 1UD8A 4CKVX 2F53D 1CD1B 3MSPA 5F3HA 3G5WA 4P3DA 3DPBA 4PRBB 5AZEL 3DOIA 4Q9CA 2OR8A 4I89A 1H0DB 3UIZA 4FQCH 3WIHL 3ASNB 5C97A 1P6WA 1INEL 5GRJL 4JCMA 3CBKB 2BSBA 4AEFA 2WCPA 1VGEH 2VXQL 4ORGA 3CVHH 2IDUA 3VXSE 1BAWA 4HUWB 3GBLA 3CHPA 5DUML 4QT5A 3Q48A 4FJZA 4QLRA 3GSNH 3DSFL 4MJIE 4ZAKD 1E27A 3NFPB 4BELD 3TF7C 2YEVB 2XETA 4PRHE 4R4FL 4G8EA 1YRKA 1A3QA 5MEOB 1HXKA 2BVUA 4HD9A 2IANE 2NY6B 2XZAL 5HYQA 3G04A 3L4UA 1OGSA 2XJLA 1ET5A 4YUEL 1JGVH 2JNZA 3VB9A 4R2GC 3NPSB 4GINA 3AU0A 4PB0H 2OYLA 1X5KA 1XZWA 1GL4B 4UTCA 3ML9A 4MDIB 4Y4FB 5BXFB 5KSUB 2AV1A 5HHNA 3EFDL 4GRWF 3O81A 5AKTA 5ECGA 4OV5B 1OANA 3O11B 1F3DJ 1NCNA 4U1SA 4YHMH 2YUXA 3AY4C 5CSZA 3M17A 1KLUB 4G6JH 3AY2A 4RWYL 1NAMB 1RURH 2JTDA 4KKQA 4LMQE 4PRDB 3LN4A 3SDAD 2OYMA 3T2PA 4JQVA 3MDJA 2L7EA 4IRZA 3D51A 1HE7A 5T1DL 3FH5A 3VH8A 1RUQL 1BPVA 3HG5A 1FNHA 1DVXA 4TPRL 3TH2T 4LLVA 1F4YL 3HOGA 1S3KL 2VDQH 4QMEA 3O8XB 2QLYA 1OGTA 5CILL 4FXKC 3ZDYF 1P5UC 3OJDA 3MYJA 1GS8A 1KCBA 4RH4A 5ESAB 1D5MA 1WF5A 3P4OA 5FO9B 3WL9B 2XWRA 2PCYA 4PJAE 3BE1H 5DHMC 1NICA 5IVXF 5LBSH 4G1MA 3F65A 5E8OA 2Y72A 4BBWA 2EXWC 5IV2A 3P02A 5F7EH 2D0FA 2WLLA 4Z78B 3LEVL 3VGGA 5DQDH 1PSKH 3PUUA 5AKVA 4BRJA 1OW0A 3MLXH 1IC4L 1L5GB 4YBHA 2VKXA 5E2UL 1QATA 3MQIA 5I17B 2EDTA 1E4KC 4M6MH 2ZNWA 2OZ4A 3MRQA 4UTBL 3VDCA 1GZQA 3HC3L 4LHQB 3DO3A 4L2YA 5SWZD 1NIFA 1FNAA 2WINA 3CDZB 3LRHA 2IAMD 2MCAA 2QGDA 4JFXB 2O5NA 3KPOB 4V1DB 2DTMH 2X4NB 2MH4A 5EPMA 4C57C 5LCVH 3QK0A 4KQ4H 2FEDC 3PIQA 5D7KE 2B5IC 1QI3A 5KBLA 4BWUA 3K91A 3PE9A 4JFFB 4UMGA 1ZIAA 4DO6A 3I6LD 2CBOA 3PP4H 4J7RA 4M4RB 5TDNB 3UGXA 4TUKH 1L9TA 2DQDH 2B4CH 3QI9A 2WOBA 5GISH 4LL1A 1E67A 1Q0XL 3E1F1 3B9KD 3SBPA 3MUY1 3QQ4B 5HYJD 4GG6E 2FO8A 4D8PA 4RAUB 4M7LL 5IB3A 3IJEA 1NDMB 1KPUA 2WNXA 3OJMB 1SDAB 2ZX7A 2D03H 4JPIB 5GSRB 1QPXA 2BZDA 2V3EA 4HEPG 2P5EA 4YC2C 2GAZB 4P4KB 3MGOB 4B27A 1YNLH 2WGXA 4QYOB 4JANB 4L8SC 4ZO9A 3NP3A 4CVXA 2DM2A 3K46A 2Y23A 3CVIL 3N9GL 1L3WA 1E8ZA 3T0EE 3TA3C 5D7JD 2H5UA 2BP8A 2Z31C 3LRSA 5D8JL 1DEDA 1W0WA 1DANU 4XVTH 3MRIA 4LLYB 1IM9B 2BCKB 1IL1B 1DBBL 1CFNB 4B9FA 2EVHA 1H8NA 3RTQD 1CGWA 4UV4H 4LO9A 1IIKA 3FRPA 4NAJA 3NJFA 3SPHA 2FK9A 1R5VB 1EXUA 2ITDB 2OMYA 1SZNA 4PJ9B 1F4HA 1UD2A 1GC1L 4QWWC 2YGNA 3MJ6A 1DQQB 2Y3NA 2IAAC 3W9EB 3KJ4C 1U4EA 4OSUH 3HI6H 3Q8BA 4JCLA 1JCVA 5HHXH 2WYIA 2E9GA 2EDLA 5FYKU 3WFEL 1KB9J 1SYVB 3VGEA 2VIRB 3POHA 4ZMAT 1YJDC 4X5RA 3OB0H 4B9JA 2H45A 1J10A 2WXGA 3KYNA 5CJOH 1KY7A 4ODHL 3CFKA 2W60A 1YQ2A 3QGVA 4UTAA 4Z3EA 3OTTA 2XT1B 1S7QB 2X6UA 3S5ZA 2WZPA 4FG6C 5CBAA 3NAAL 2FX7H 2NZIA 1JWMB 4M93C 5CEYA 1CFTA 2W59A 1UM5L 4OKVA 5EUKB 1H6UA 3JTTB 1U2HA 2VLJB 3MACL 3SDCA 4FX5A 4Q6KA 4PJGF 4H25B 3ZZLA 4HX1A 3GM8A 3OLEA 2EINB 3CLEL 4MXWH 4V1DE 3K6DA 3UXFA 1YG9A 5D1ZB 1DQLL 3IXTB 1WC7B 4FTVD 3TO4A 4JFFE 1JJUA 2AVGA 1ZLDA 4N9GA 4FYQA 3ZYJA 4OLWL 3FTUA 5D71L 2R2EB 5F6IC 5K9JH 3FB8A 5HHPB 1IT9H 4KZDH 4WLCA 1CQKA 4BZ1L 4QXGL 2RBLA 3E9UA 4AYEC 1L7TL 2VRKA 1N4XL 3L4WA 1FL6A 2XTJB 1TVBB 3ECBA 4BFRA 4YXLL 1AJ7L 3D8MA 4FFVD 1UM6L 3IYLW 4FN0A 4ZUTA 3BLKA 3T0DA 1SPDA 4PTTB 3ILDA 4Y9GA 1ZGLA 2IGFL 4K3GA 4CNIA 3PXJA 4HS3A 5CINH 1VRSA 4EEEA 1KBKA 2WC7A 2HKAA 5ID1A 1CIUA 3UBGA 4B9IA 3AG4B 1RSFA 2B7DT 2YAFA 4KRPC 1TTUA 2XFXA 1WO2A 1QG3A 2H3XC 3IJHB 4FQLH 3ZQXA 1NOLA 4H8VA 4HGWB 4CADB 5IJBC 4JKLA 5KVGE 2R2CA 2VISA 1VERA 1LE5B 1NMCC 4JHAL 5DHYB 1H8SA 5CN2A 5AW6B 3GLDA 4ZXBD 3WS6A 5IMMA 2W9DL 2V9QA 3HHSB 1FLTX 4GG8B 4MNHA 3RYMA 5C0CD 5DEGA 1XB3A 3DDGA 5DD6B 4FG4A 4FOMA 1HAUA 4YHKH 5F7AA 3OMZA 4KROB 2EIKB 1FVCA 4O4YL 3RX5A 4K0OA 4LLQB 2BZCA 5EU3B 1A7QH 5J6GB 3PJLA 4DP7X 5L4MA 2HZHA 5I30L 4OI7A 1HU8A 1YEFL 5I1LB 4PJHF 1FG9C 4YX2H 5FYLL 2NW3A 2R0KH 3QPQD 2IBGA 4P23C 1P7KA 4WSJA 1P4LA 2NYKA 1PNCA 4N0FA 2X05A 3S88L 2AABL 3WFBL 1Z5LA 4AEHL 2EIMB 3U4KA 4CA4A 3ZDZB 5CD5C 3U7YH 3HZMA 2LAAA 1VZGA 3ZDXE 3CDFA 1XGQA 1NWPA 1BJMA 2WJ5A 2R0LL 3IMTA 3DURB 2DEXX 1S5IL 4RBPH 2AXGA 4WWKB 5JHLA 4EN2A 5JHDB 3MREB 2VLJE 3RL2A 1U3HB 4MA3A 1PZ5A 1YNTA 12E8H 1CFSB 1P4BL 1NOFA 4FDWA 4RGND 3VXTB 1OM3L 4Z76A 3VD0A 4IBWA 3ULUC 3WFHA 1TQCB 2V33A 3VXOB 4ZMVA 2I7OA 3D08A 1RK1A 5SX4I 3WJLA 4U31A 4J8QA 1J0IA 3MJWA 4LP4A 4ZW7A 3DRQA 4NQEB 5JXAL 1A1MA 1KJVA 4IRJC 3CFDA 2KQNA 2PYEB 3UTPE 1T3FA 4J5VA 1B3IA 4YJZL 3NQKA 1SVZA 3TIDB 3ZHLA 3VFOA 3FHEA 2YK1L 4IIQA 3EO9L 3GO1H 3U7WL 2PP8A 2QVIA 2IWFA 4M5YH 4XR8C 5I6PA 1AI1L 1S78D 2XQYG 1GGCL 3CCHA 2HTLC 1K6QH 4PHXA 2A9MH 5B7EA 1JNNL 3GUTA 2CU9A 3QUZD 1CLZL 4V2BA 4FFZH 1LM8V 3FUMA 2IAMC 3WXVL 3BKJH 2EH8H 4HJUA 1G4MA 2D4DA 1NPJA 3E1ZA 5SV3A 2MTAA 3T3PB 2X7LA 1MFDL 3JV0A 3VUAA 4L8CB 4OZHE 4UT9L 4WSGA 3QHFL 1TZHB 7FABH 1ZWIB 3EDDA 3FQYA 4FS0A 3G6AB 4HFUH 4R7VA 2GTZB 2PW1A 2GT9A 3B9KC 3N3EA 5C0GA 2G2PA 4Z7WA 1XGRA 4KMQA 3I50L 4FA7B 5F7YC 1BBJB 3LPGA 4Q89A 4ALAL 5JXED 4CMMB 5AYUL 4MLIA 3T8XB 1UVQA 2AP2A 1ZV9A 4AITA 2C1PB 3L3HB 5MEPB 3TYGH 3QZLA 5EC1B 4Y4KA 3RKDC 3DX8A 1KTKE 3DC0A 4G8GA 1B4TA 2JJSC 4XAKD 4BV1A 4DP8X 1IAIH 4MCYB 2B77A 4WO4A 1KDIA 2NLJA 3GM0A 3JV6A 4YHIB 5EU6B 3MA7B 1YEEH 1EWHA 1Z66A 1IAIM 2BHFA 1LD9A 1K5WA 2O5ZL 1R3HB 3D5OF 3OM3B 4HJTA 2ZG2A 4WNJA 3HAEH 5D7JC 2ZF8A 3WNJA 3VTAA 5E5MB 1J87A 4JVPA 3RFZB 4JFYB 3EBHA 3VJ6B 1UACL 3BSZA 2BNUB 3C2SA 4PJCE 4DKEH 3RTQC 1AG6A 3WUWA 2BY3A 3VYPA 3GRGA 2ZUUA 1I9IH 4WHTA 1S9KC 1S7XB 2ATPA 3ATFA 2CD0A 3NBNA 4QRUA 5JQIB 5HGAA 4P46B 2Y5TB 3QDGA 4FKKA 5J11C 2AJXL 5DC0A 1GMEA 1AKJD 3O2WH 5F7DA 1E6OL 3O6FD 4OF3A 3F7PC 4L4TE 2H0PA 4YXHL 1JYXA 1HH9A 1NEZA 1S8DB 3QQ9C 1S9YB 1C08B 4DZ8A 4QRRA 5IMLB 4JRYD 2E86A 3LX9A 5HHOA 5E1AA 3UBXI 1KCUH 3P0VH 1DVUA 1JZ4A 4IKKA 2OI9B 4HKJB 1CDIA 4N22A 1VDGA 4X4XA 4J8RA 4XMPH 5ICXB 2F5AH 4RISL 4NT6B 5E6IB 1EEQA 3V6OA 1VGEL 2OQJA 1OAZL 2EC9T 1MPAH 4XPFH 1M7DB 4C4KT 5CJQH 1IKOP 4MMXB 5GZOA 1EBPA 5IQMA 1AS6A 2WLYA 1ZY9A 5SWQB 3S8GB 1KIRA 5EH1A 2JKLA 1UXLA 5HVGB 3VFWA 2W0KA 2D0HA 5SWSE 1RVFL 3AM8A 4UQ2B 1A7OL 4LKCA 1DVQA 2BOCB 3GSUA 5GRZA 5BV7L 5KVDE 3UZEC 4GUOA 3S36H 3GJFA 3JZ7A 7CGTA 3CFEA 1QNIA 5GRUL 4GBXB 4WU5B 1NCHA 3K0WA 4OZ4B 4PJFA 1C5CL 3HMWH 4UDTB 2R29H 1VLXA 3ZR6A 1IEHA 4OFYA 5AB1A 3RWEB 2EIEA 1OAQL 4MKTA 1ROWA 2YAEA 4UOW1 5D1QE 1NKOA 1F6AA 3HS0B 5HDBF 4G6FD 5FB8A 3C5SA 4LQFH 1AHWC 1RURL 1I9JL 3QUMA 4WTZA 4AG4H 1W2KT 2XPZA 5EU6E 2DIBA 1IAOB 4QHUB 3NIDF 1IX2A 3DI2B 1TPXB 3MI6A 3UZQA 2KZKA 4R90H 2NUPB 3DGGB 3QORA 4UIMB 4YSUA 2EAEA 2V9UA 4R0LB 2J8UB 3CZJA 2C9SA 1U8KB 2AJVL 4K2UL 3RX8A 2SODB 1OE2A 3KH3A 4EKXA 2LFGA 5C8JA 3F01A 3VTTA 3VVWA 1BJ1J 1U8PA 2WXJA 4XNDA 5C0AB 1TETH 3WUZA 4BQ8A 1EO7A 3C09C 5LBSL 1ED3B 4KOCA 6PAZA 4JO1L 4MJ6A 5DHVH 3V5HA 3ZRCC 4GEIA 1PSKL 1U6AH 2A6DB 1DDTA 2R0WH 3MLXL 3QPQC 4GP4B 4XAKE 4JS7A 2CMRH 3BT0A 2W80C 1N2RB 1RZJH 1SVBA 2Z3FA 4LCWB 4XN5A 2BP3A 1PBYA 4K71C 4XN2A 3BUTA 3BW9A 3O4LA 4N0UE 1H5BB 1I9RH 3QUXB 3FU5A 1BQLH 2FIKA 3MOAH 2YSSB 3IDXL 3BSHA 4XNUL 4OF5A 3G5VB 4OJEH 4ZMOA 5LCVL 5CEXB 1IVTA 1MCCA 4H5SA 1EFQA 2X70A 1HAWA 3PP4L 5IW6B 4HIJA 3CVCA 2OCFD 2B4CL 1KACB 4LP8A 2ZD0A 4HJJL 4L3ED 4Y2OA 4X98A 5LJYH 5C08A 2HH0L 3M46A 3RWHA 3TN0D 5E51A 4CSTA 4QXVA 1AVAA 3U9UB 3BKMH 3VX1A 4D9LL 1I8MA 4ODTL 3L54A 4AQ1A 3QJRB 1EAOA 4FHJA 2IH8A 3T4YA 1FNLA 1K8IB 4N8UA 1D9KB 1DBKH 5EEWA 1JVKA 2XZQH 4P9HC 1JHTB 1HILB 5JIPA 4N6QA 3UTSA 1MCOH 2ZYHA 1JGLH 4YBQC 4U1KA 5KJ7E 1WAAE 3GRWA 2CJTA 4NUJB 4Y19A 3MRGB 1HI6A 1XGPB 4GO6B 2WO2B 1NANI 2YWYA 5F1IA 2XN9A 4ISVA 3PDOB 5CJBA 4YQXH 2DH2A 2OM5A 5IESH 4GUPB 3QUZC 4R83A 4UDUA 5MP6H 3RZCB 3V4VH 5T3ZE 4HJ0C 5FKPB 2YARA 3VQ2C 2Z65C 3BQUD 3AS2A 2ESVA 4IK7A 1Z3GL 1FF5A 4LCYB 3I2CL 4ZFOA 4LLAA 5IVOA 4G7YH 3T2OA 2G75A 2K4WA 4LPXA 3EXLA 3G9AB 5D7IA 5LN4A 3W3BA 1O6SA 3L9YA 4F8QA 3TBWA 2FNBA 1QEWA 1V55B 3QP3A 5ALCH 1ZTXL 3FMGH 3IDGB 4W9FC 4NWTL 3X3FH 1HCFX 3MR9B 3TZVC 3VFGL 1F58H 1HCVA 4PI0A 5EOQH 4GS7C 3D0LA 1IM3B 3GFUA 2Z92A 3BWUF 3NFNB 1RJYA 5CJOL 3TNMA 4EXPX 3VI3B 1F1GA 2EYTA 1LEKB 3UAEA 2N56A 5EEYA 2HJKB 2FX7L 3WAKA 4DHLA 3DV6B 1VFAB 4OBRA 4ELKB 3AAZA 3KLHD 4MMZC 1KENL 5DJYB 3C8DA 1FFOB 3JWNE 5TDOA 3LKRB 1X5MA 1LP9A 4B9YA 2JCCE 1J11A 4BHUA 2UZYA 1EJOH 2WXLA 2Y7QB 4CU8A 5ISZA 1BA9A 3QT2A 4NPJA 4GQZA 2FO4B 1TQWA 5IB2A 5JUEL 4DEWA 4ZZKA 1J1XH 4YGAB 4YNYB 4R97B 5I9QC 4P57A 2KUTA 3BWZA 5FYKD 4A1RA 3VI4A 1ACCA 5K9JL 2L04A 2X40A 4KZDL 3QEUB 2JB6A 3S97C 1CQYA 1INDL 1GAFL 4BIKA 4MJ5B 1KEGH 3LAFA 4UNUA 2SEBB 2OMVA 2DEYX 3TV3L 2ICEC 4JM4H 4PJEB 1E6JL 3OKMB 2AEQL 2CIKA 2ZWYA 3DK0A 3GUFA 4F92B 3ESVF 2ZCLH 4O2CA 4PS3A 4KKBD 4PRNB 4Z7VE 3A21A 4PUBL 1DO6A 4EI5D 1S9XB 1QZNA 2PW2A 1ZS2A 3CXFA 2YPLD 1JXFA 2NY4B 2A74C 4L3EE 4YFDB 1WZLA 4K7PL 4NKOA 1XFPA 4OD1H 3IMWA 1TCMA 2PWHA 3SO3B 2ICWI 5L4FA 3QCVL 5GS0D 2AK1H 1A9EB 3U36A 2OMXB 4G7VL 4RLDA 3FCBA 3H2PA 3MZTA 3RA7L 3LS4L 2AZAA 1E28A 1E8YA 5D6DC 1TZAA 1Q90A 3GMOB 4X6DF 2FJHA 4K9EH 4TULH 3KVQA 1KZQA 1EDYA 2K7QA 1A7BA 1SEQH 2WQUA 4D9QE 2WO3B 5I0VA 1NCWH 1M71B 3L1FA 4IBLT 3KPMA 4MNGE 1IEAA 3PL6B 5E8NB 2XVKA 1ZK5A 8FABB 1AGBA 2VB5A 2J1XA 2ZUYA 3DROB 2P8MA 3QJFA 4ATTA 4K3HA 3W11D 4DUXA 2ATKB 4ZUUB 2G0LA 4Y9FA 1HNYA 4MNQB 1BAFL 2OV0A 3RWJA 12E8L 1SYSA 5TE4L 1U30A 3PHQB 2Q76B 3KWXA 1R19A 2X38A 3EOBB 2OL3B 1WCBB 5ANHA 1A6TA 4A66A 4APQD 1CXIA 3DTDA 5FA3A 3MBXH 4TVPH 4QHMB 1A2YB 1NLDL 3RI5F 2BNRB 1ZEAL 3ES6B 3CV5A 4WVRA 3SGJA 4HV8B 5AVUB 1PQZB 1ID5I 5I19H 2O61B 5T3XH 1DBAH 3AUVA 3T04D 1MVUA 5TPWH 3TJEH 3SZKC 5AAMC 4OIIH 4UQEA 2ZYIA 2F08A 3GO1L 3NCJL 3F7VA 4Z7NE 3W0WE 5CFHA 4PJEE 5I75B 4QXUH 4E5XA 2HSIA 5BRQA 2JKNA 4QI3A 4ZD3L 1TMCB 4MWFB 4OFKA 5AOLA 4J3OD 4B9GA 1HFUA 4HIEA 5PAZA 5ES4B 3QE5A 1MWAH 5IT2L 5E2VL 2WVVA 1DVFA 2B08A 2H2SC 2GTQA 3VVVA 1QHOA 4E9VA 2Z6FA 2EH8L 3GMNB 3I75A 5DQ9A 5JDSB 4UB0L 4TNVF 5J89A 3VM5A 3CH1B 4NPKA 5EOCJ 4MD5A 5FYKE 4MAUH 4ONHB 1ZVNA 3EDKA 7FABL 5T1LB 3DWTA 4HCGA 5DFAA 4XB8A 4R5XA 1UFUA 3AT8A 1CDHA 1OTTD 3S9DB 1WQVT 4K8RH 2COQA 1AXTL 2ZCZA 2X4RA 5IWLC 1J8HB 1UZ8B 3E3QC 5CP3A 1BMWA 1FFQA 3ESOA 5KS9B 5CXPA 2A6IA 1ZLSH 4FQPA 2OP4L 3EKCA 4N8PA 4FNRA 1VADA 3T6XA 3K71A 4LSQH 3WTWA 1MN4A 5EZLB 1JYNA 3KM1A 1NGWA 2QSTA 5B3SB 2HX9A 4OLXH 1AP2A 1HIML 3QWOB 1X7QB 5DJXA 3V0VB 3ZHFA 4S2SB 3VGDA 5BUPA 3F05A 3GI8L 4NS0A 3SBRA 2Z0BA 4C47A 5EULV 1KY6A 2VN3A 3CPLB 2B59A 3UBXA 4LNVA 2CRMA 4W6XB 3O3BA 4B50A 5FKAB 2D7OA 2NR6D 1CFQA 3GF8A 1SDDA 1SJEB 4EIGB 2HT2D 1AGDB 3AQDA 3IU4H 2QTVA 2GBUA 2KPNA 4R4NC 3ZDWA 1LHZA 3L3OC 1OAJA 3BDYL 4HU8A 1MJUH 5E56A 2JXMB 4A6YL 3BQUC 4GO8A 4PJXF 4BINA 2X4QA 1LQBC 3FF8A 4FEIA 1J0YA 1SLWA 2GB2A 4M03A 2DIJA 3VXPA 4HBCL 3MRRB 4LEEA 2BNRE 2DM3A 2MQ3A 2WMPA 4UILL 5L2JB 1QWNA 4XWOC 3Q43A 3RNQA 2FTAA 4HALA 1RZ8B 1HS6A 1SGKA 4BUGA 5I76A 1USQA 1KB5H 2A1WL 2QLVB 3AJ7A 1KCUL 5EN3A 3WKMH 3HZVB 3LZPA 4K94C 4KDVA 4UF7C 4ZFGL 4B3EA 1WFNA 2EQDA 2DYPB 3MNZB 4YLCA 3BAIA 3QIBB 5EA0H 4M1DL 3V0DA 1DQDL 1F45A 5CLYA 1ET8A 3KYKH 3C12A 4XPFL 3ARFB 5BRZB 3IGAA 2ADGB 2VKWA 3VH8G 3UJJH 3EOTH 2O26U 1WFIA 3KPNB 5J06A 2UX7A 1AIZA 5E6SB 1TSHA 3RWDA 5D2LF 3BO8A 1E5ZA 3O2VL 3FFCB 3UPAA 2QQQA 2WUBH 32C2A 2W88A 3D18A 3LIUA 4QRSA 5GJSH 3S4SB 2B15A 5DO8A 2XZCH 4QJ3B 4D0BA 1MDAA 2D3JA 5CSGA 3GMPB 4K3JH 1KLFB 2R29L 1JRHH 4YSOA 1F4WH 3KCWA 4QDGA 3GSQA 5EO9B 3BT2H 5DJCA 4I1NB 3LIZH 2ADIA 3KYMB 4HS8L 4UNTA 35C8H 4NI6A 3WE6A 3K6SB 4XBEH 1YN7B 4XO5A 1P1VA 4LQFL 1KBVA 2GJ6B 3P4MB 3E8UL 5E99L 5E2WL 4ACTA 5J1AB 4MZ2A 5F71A 1BQSA 5LGJB 5HDOA 5FLVA 4RAVB 5E94A 1XD0A 3VXSA 1IEBB 3DX3A 2X2JA 5SX5K 1QLEB 2WQRA 3EGDA 4JB9H 4MJIA 1PIFA 3D0AA 3H2QA 3HFML 1F11B 5CEZE 3K81A 4CVUA 1JL8A 4PRHA 1ZJBA 2KHAA 4AQZA 4JM2A 1E4XL 3APMA 4LARH 2E76C 2KZBA 1DYZA 5HHQA 2KKQA 1UJ3B 2IANA 2GK0B 5JQ6L 4JMXA 5ADOL 4MX7B 3Q44A 1VCBC 5DDHB 1XIWB 3DVFA 3S5LA 2O5XH 1RZJL 3B56A 1FC2D 5G4NA 1SXAA 5FF6B 1T1WB 4BZ2A 2ZAGA 1I7TB 1NEUA 4MSWB 1A6WL 3H4FA 5DU7A 1JGIA 3FCSA 4HUXB 1IKFH 3P3RA 2QADD 3S37L 3KLKA 1OOWA 3OZLA 1FVDB 3MOAL 1PZSA 5DD1H 7PCYA 3FN3A 1VENA 3AS1A 2VSCA 3N1QC 4HIHB 3W11C 4KK9C 3ARBB 3D52A 3OMAB 3OXRA 2QEJA 2ZPKH 4HWBL 3NJGA 5EV7A 1Q9WB 3FONA 5K9KA 3A4EA 5FECB 4X5WA 2C9PA 2WY3B 3DSNB 4OJDH 3SDYH 4IBUA 1HK6A 1ZLVK 2Q9OA 4JMNA 2H26B 3CIQA 3BPNC 4W6YB 4APQC 4YK4C 1G7HB 5DVPA 3MPCA 4LHUD 1ORSB 5MENB 1C5BH 4PJAA 1A0QH 1B88A 3I3EA 2EYRB 4E9WA 1AC6A 2DRUA 4HHGA 1BG9A 1XF5B 2EXYD 4ABWA 2VAAB 2VMDA 1CD1A 1ZS8B 1AGFB 2BINA 5B38A 1MCOL 4PRBA 1JNHB 1BEYH 3D4GA 4XMLH 4QHKJ 2CKBB 1R3IL 3CTTA 2DF3A 3O9WD 3WU1A 1VFUA 4N20A 1MW0A 4RMBA 3NZ8B 1KGJA 1G5AA 4KHXH 2K7PA 3MNVA 2Z8SA 2LVEA 3MRCB 1ULVA 2N7SA 5IESL 5LGHL 1J05A 2XI9A 5MP6L 3V4VL 4C58B 5FYLD 3VXUB 5BZXA 2DDQL 3KS0H 5GGVH 4HUWA 4XTRD 1WFUA 3E6FA 4X6CB 3L3DB 3NFPA 2WBJC 1FL3A 4UTAH 1X5GA 2OMTB 3N91A 2IH3A 3ARDD 4HAGA 5CMAA 1OTTC 5MEOA 3QQDB 4R2GB 5LB1A 1D2PA 4TMPA 4JY4B 4XOEA 5EFIB 2BP5M 3X3FL 2WHVA 4WJG3 2E0PA 3GZQA 3FFOA 5CN3A 2EICA 2E9BA 4CC4A 1QYGH 2APTA 1PD0A 3NZHH 1H3WM 1ZVYA 3KDMA 2HLFC 2BW4A 3QJUB 4JJ5B 1Q72L 1BM7A 5D7LD 4MDIA 5KSUA 4XODA 4LAQH 4OZIE 5E00A 2YPVA 2W94A 3QW9A 3V0HA 3T0EA 2ZT9C 4G43A 1TZIA 2VM9A 2Y7NA 4YHOH 2AJSL 2FYYA 4HULB 1KCWA 5T1MA 1NAMA 1EHXA 1EJOL 3VSUA 4JFPB 4BKLA 5I0XA 3W2DH 2X4TA 4BA0A 1BVKB 2H1XA 5DA4A 3MCKB 3TNNA 1N8OE 2JVUA 3NPZB 3Q0HA 3WNNA 4JO3H 3Q9QA 2VLKD 1J1XL 4AJVA 3HC4H 4OF0A 4FXKB 1P5UB 2VLLB 4HXBH 4WWNA 4A2HA 4NP4H 4YSTA 3S98A 4AH2A 3DNKA 5KYWA 3ML8A 5GXBB 1A4AA 3Q06A 1XHHA 1KTRL 1TFHA 5EZJB 4BH8A 4U6XB 3FB6A 4XZUB 3HNTH 4LSTL 4OIFA 5FO9A 1U95B 3NEEA 4DO4A 2Z1PA 2X09A 4M3KB 2VDNB 4Z78A 3STLA 3LRMA 4N1HB 4PJ7F 5DR5L 2Z7WA 2WXPA 2ZCLL 3HRZB 1VPOH 4H1LB 3TT3H 4X9IA 5I73C 1RFDH 2RD0A 2VERN 1DEEA 1N0LA 2GBTA 4TLSA 1R33A 1I1AA 2G4GA 2XG5B 4K3EL 2UXFA 3TOPA 2CDGA 3N06B 1GJWA 1OAXH 3NFSH 2CPUA 1FZKA 2CZNA 2B5IB 2IWKA 4LNRA 3KPOA 4F58L 4V1DA 2F7RA 2GSMB 3DOSB 1LQSR 3ENEA 3D3VD 1OCRB 3I6SA 4BZYA 4JFFA 1MZYA 4J1UA 2QSVA 1TJMA 2F1AA 3GI9H 2HFFB 2ZOOA 1RJLB 1YEHH 5D5MF 3ZO0A 5LVEA 4FXGC 2BNQB 5FO8B 4ENED 5AL0A 5I0WA 1CGUA 1FGNH 3DPDA 1NDMA 4YC2B 3REVA 3ARQA 1J18A 3OKNA 3IRCA 2P8PB 3UTTD 4DKAA 1EGJL 4L8SB 4H26A 4N2LA 5JHLH 3U4EB 5D6CA 4R84A 4LLWA 4HJIA 3QRGH 5DI8A 1EEYB 3KGSA 3MGOA 2DWXA 3CXDL 4FI7A 4QYOA 4JANA 4P48A 2Z31B 5F93C 1CDCA 4KJWD 5C07B 2X0VA 3OGOE 4G7SB 1FORH 1EHLL 1D7BA 1NGQL 5DUJA 3PWPB 4NO2A 4NP9A 1GC1C 1U8NB 4RGOH 1ZVHA 3CXHJ 3NCWA 2IQ9H 4LLYA 3NN8A 5F88B 2E3VA 1IL1A 2H4EA 1YSOA 4NZDA 3J07A 1M53A 3GEFA 4D3CL 1BXVA 3G5ZB 1W0VA 2DLHA 3KJ4B 1R5VA 2ITDA 4IU2A 5EO1B 5FEBA 1DQQA 3LZNA 5HJGA 4WI7A 5I66B 1CZ8H 1YUHB 4DQOL 1HZKA 4HIPA 5KSAC 3M6DA 2H3NB 4AL8H 4F9PC 4XZ4A 2PWEA 3K2KA 2WXNA 2DWTA 1RSYA 1L0QA 3HUJE 4RX4A 4B5ZA 1BFVH 4MCZB 1LO3H 3CHQA 4KH9A 2E4FA 4R8WH 2OA9A 2IPTH 1P53A 2FSEB 1TTGA 5F3BB 5LNDA 3H9SB 1S7QA 5GGSY 2R7EB 4PW9A 1QVOB 1JWMA 5JZ7D 2PXYB 3IVKB 2A6JA 2N59A 5EUKA 1UURA 4Y16A 2VLJA 3DTXB 1JZIA 2VLKE 4IMKC 1KN2H 4Z5RA 3RWIB 4JO2L 2BJMH 3CLFH 5EIIB 3H3PH 4MAUL 1BOGB 2UZIL 1BP3B 4R7LA 3W37A 2HLEB 2XWXA 5F6IB 3WUWG 4JR9H 2NX5B 3MUGB 5F1SA 1KJ2A 3O0RL 2A9NL 1KEML 3ETSA