2BD2A

Porcine pancreatic elastase complexed with beta-casomorphin-7 and arg-phe at ph 5.0
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-casomorphin-7
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
molecule tags Hydrolase
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd2A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd2A01
4JCNA 4CRCA 2O8MA 2GDDA 2ZPRA 2TBSA 1P10A 3TNSA 4JK5A 3K2UA 5LPFA 3QLPH 1VITG 3UWJH 4NA9H 3TJVA 5DPAA 3SJOA 2TPIZ 1SGYE 1QJ7B 1JXPA 1O37A 3VB5A 1RTKA 2ANWA 2J95A 2R0LA 2RA3A 2SFAA 2H2ZA 1L1NA 2HOBA 3D65E 1FN6A 3K6YA 2ZIQH 1TAWA 2NU4E 1HJAB 1A3BH 1AI8H 3UUZA 3MH6A 3ITIA 1NM6A 1O2LA 3A85A 1O2IA 1RXPA 1AHTH 1E34B 3PMHB 3H7OA 5T3HA 3SORA 5EQQA 1PFXC 1E38B 2HPQH 3ZYEA 4JMYA 2FOHA 4I32A 5JBAS 5A0CA 2H9EH 4YO9A 1P04A 3M7TA 4D9RA 2F83A 2PTCE 3SJ9A 4DG4A 1AFQB 2HNTC 3JZ2B 1W10U 1DUEA 1D3TB 1HJ9A 3IG6B 3EGKH 1PPGE 1C1PA 5L6NH 1F5KU 4ZUHA 4TY6A 5DP8A 3V12A 1C2HA 4BXSA 4Y79A 7LPRA 4Y0ZE 4MNXA 1A0HB 4MPVA 1QRZA 4CRDA 3UREA 5ETXA 1O3GA 3A7ZA 1ZTLA 1A7SA 1XXDA 1TNKA 1AE5A 1GHYH 2OC7A 5L2ZH 1P05A 3VXFH 5T6FA 4DW2U 1AVGH 2Z9LA 3CS0A 5E0JA 1ZHRA 3KL6A 2QXIA 1Q3XA 2Z9JA 1IAUA 1LVYA 3ZZ7A 1QY6A 1BUIA 2BDHA 1YCPH 2OC0A 4ABAA 5LPRA 2GX4A 2GP9B 4X2VA 5GDSH 2BVXH 3V0XA 2ZFPH 4JZEH 3F9EA 3RMNH 1HAZB 1SC8U 1L1GA 1DOJA 2EI6A 1WOFA 4CREA 2BDAA 3M35A 3MU1A 3PMAB 2FWWA 2YNBA 1TGSZ 3NXPA 3DHKH 2BDYA 1MQ5A 4AFUA 1D4PB 1DDJA 2G5NA 2QYIA 2ZFQH 4BTUB 2XXLA 3MU5A 1NY22 1XUGA 4ISOA 3NUMA 1ZSJA 4YTAA 5FXLA 3R0FA 2BD8A 1C5SA 1EJMA 2ZGJA 3TJNA 1OOKB 1CHGA 3VPKA 2ZDMA 5IYTA 3FP7E 3SNCA 4JYVH 1CGHA 1P03A 5DP5A 1X7AC 3DT0H 2BXUH 4KP0A 1GVKB 6ESTA 1GCTB 4NA7A 4F4OC 1S85A 1CVWH 1Z8RA 1EOLA 2AMPA 3C27B 1AB9C 3KGPA 1L2EA 1HNEE 2HGTH 1O35A 4Q7YA 1GI8B 2P94A 1GBAA 3B23B 1GI9B 3A87A 3HATH 1T4VH 5DKMA 4BTTB 3S7KB 2G55A 4YESB 4DVAU 1A0JA 2R3YA 1XVMA 3SUFA 3P8GA 5DGJA 3SGQE 1BHXF 5E0HA 1ABJH 1D3PB 2I6SA 2UUJB 4ZKRU 3S7HB 3V3MA 1HXFH 2R2MB 2Z3CA 2V0BA 2Y6TA 1KDQB 4LK4A 1OP8A 1GHAG 4AFSA 4XOJA 1O3KA 1O36A 1CA0B 1V2UT 2VWLA 3KIDU 4MPWA 4AGKA 1ZGVA 1ESBA 1DPOA 1MTWA 1A1RA 2P8OC 2F9PA 1TGCA 1NN6A 3SU5A 1SVPA 2FIRH 3F1SB 3T5FH 3RXBA 1BDAA 2IOTA 4X2XA 4X2YA 1QB1A 2OLGA 3SI4H 1G9IE 1HAXB 3MU4A 1WSSH 3EA9A 4WJG2 1THRH 2V3OH 2A4QA 3RXDA 1N8OB 1ANEA 4TWWA 3FANA 1EAUA 1ELDE 1LVOA 4TPYA 1ZMLA 1P9UA 5DO4H 2PKAB 5LPEA 4AFZA 4PROA 4I31A 3BG8A 4WMDA 5FPYA 6CHAC 1SGTA 4CBOA 1C1OA 3SNBA 4K69A 1BTWA 1ZRKA 4D9QA 1Y5AT 2W3IA 4O3UA 2J34A 5EGMA 4O03A 4ESTE 1Z6JH 1PPCE 1YPEH 4I8KA 1V2JT 1UVSH 1C5VA 2RA0A 1O5EH 1SGCA 3KEEA 2BOHB 2BLVA 1PPFE 4MG3A 2PKSC 1HDTH 4XBDA 1UCYH 1D6RA 1ELEE 1ELGA 2ANKH 3LIWA 1VITH 1UHBB 2CV3A 2J2UA 2G52A 1CHOG 4Y0YE 2SGAA 2OQ5A 2DE9A 4WVPE 5JB8S 2BM2A 4Y8XA 1QA0A 4Q2KA 1BT7A 3RM2H 4IC6A 2VIQA 2A4GA 1GBCA 3SHAH 3QO6A 1THPB 1MKWH 4ABJA 1TRYA 4GUXA 1ELBA 1ELAA 2ASUB 3ZZDA 1K1IA 4MPXA 4UEHH 1RTFB 3E8LA 4D8NA 3O8CA 5CMXH 3SV8A 1D6WA 4K1TA 1DWBH 2RDLA 1ZMNA 2XBVA 4Y8ZA 2KAIA 1O2HA 4JYUH 2TRMA 1JBUH 3T25A 2NU3E 1QTFA 4XDEA 5HMAA 2FOMB 4NIVA 2G5VA 3RXCA 1KLIH 1B7XB 1ELCA 3TLOA 1DLEA 1FDPA 1TBRH 2STAE 1GDUA 5A2MH 1ANBA 1QL9A 2F9VA 1SL3A 2XW9A 3NCLA 1BTZA 1TALA 1GI6A 4LXBH 2IPHA 3QWCH 1IQEA 5AFZH 5FBEA 1S83A 2VGCC 1FY4A 4X8UH 3Q76A 3HKJB 4O97A 3MMGA 1LKAA 1VCPA 1V2ST 4OS1A 2ZPQA 3DUXH 1ELVA 3PWCA 1O2NA 3M61U 3TJOA 2OUAA 3UFAA 2DE8A 1C5ZB 3Q00A 4WF8A 3U8OH 3ODDA 1GJAB 1EB1H 1BJUA 4B76A 2AIQA 1XUHA 1EPTA 2Z9GA 1K1PA 2ZFFH 5C5OA 1C5RA 1ZZZA 3A83A 2A1DB 2QY0B 1RGQA 1A3EH 1J14A 1KY9A 2Z9KA 1NU9A 4Y7BA 3U98H 4UDWH 1BRAA 5HM9A 2H6MA 4CR9A 3TK5A 3M37A 4YOGA 1GBJA 1HAIH 5AVDA 2GMTB 1G3EA 2I6QA 5LGOA 2G51A 1TB6H 1CT2E 1ESAA 3MTYA 4ZKSU 2NWNA 2IN2A 4TY7A 1W0ZU 3BEFB 1FY3A 1GBBA 1JIMA 1W7GH 2GCHF 3UIRA 4IS5A 1OKXA 1C1UH 1V2LT 4HGCA 1SGFG 1PYTD 3ATLA 3M5NA 4R8TB 5FAHA 1O3HA 1GI0A 3BTTE 2Z7FE 3NK8A 3MI4A 3VGCC 1IQMA 1SGEE 4FUBA 1AB9B 2SGDE 3HPTB 2YOLA 2FX4A 2JETC 1O2SA 3A88A 1YPJH 2BXTH 4K1SA 3M5OA 1IQKA 2GD4B 2AMQA 3PYHA 2BY7X 1AFQC 2ODYB 4ABEA 1DM4B 3MWIU 5K0HA 2XRCA 4UE7H 3E3TA 3VB4A 1AUTC 1HIAB 3UR9A 3MH5A 4ZROA 3SBKA 5TCCA 1C2EA 2VVCA 1KTTB 1QGFA 1RIWC 3TIUA 3RMOH 1A5IA 1VGCC 3MH7A 4KGAA 3A7VA 5E8EH 3OYPA 2C8YB 2C90B 2YNAA 4K5ZA 4K8YA 4KTUA 3SQEE 3VXEH 3TGKE 4I8LA 2GT7A 5FX6A 2BX4A 4FU8A 3MH4A 2ANMH 1P8VC 1O2XA 1C4V2 2FM2A 2VIDA 2P8OB 1TQ7B 1XUFA 4BTIB 1KIGH 2CGAA 2BDGA 2BVSH 3QUMP 3D49H 2ZI2H 2H5CA 1K22H 2QXGA 3SUGA 1KLTA 1LMWB 4OS2A 1QBNA 2UUKB 1TRNA 1TABE 1ELTA 4BNRA 3GY4A 2ZCKP 2PGQB 5PTPA 1SQOA 5AHGH 2QC2A 6CHAB 1N6YA 3RXKA 5IDKA 1TPAE 1NRQH 4AOQA 3NPSA 1S6FA 4NCYA 2J94A 4CH2B 2OTVA 2Z94A 1CGJE 1LPGB 3LOXA 1IHTH 3RXIA 2DUCA 8KME2 4OS6A 1P11E 3UR6A 2Q1JA 1XXFA 1LKBA 1B0EA 1H8IH 1C1WH 3LH1A 4CHAC 1C5XB 3QN7A 3T29A 1AE8H 3U69H 4UFEH 1MH0A 5DP6A 3P95A 2BD4A 2A2QH 2BLQA 1TPOA 5H4IB 2ALPA 1TIOA 1AQ7A 3E16B 3RXVA 2SNVA 1NTPA 2VU8E 4THNH 3SJIA 1DFPA 5BPEA 3RXFA 4CR5A 2ZDAH 1C5UA 1VZQH 4X0WU 3RP2A 3L3TA 3BTME 1C5OH 1YPGH 3P17H 4KKDA 4BXWA 1PQAA 1MU8B 4X8VH 3RXRA 1A2CH 1GMDG 4HTCH 2ZFSA 3NWUA 3RMLH 1YLDA 2ZC9H 3A8CA 3A82A 1NFYA 1OWEA 2EI7A 3SUDA 4ABFA 2FOCA 2Y7XA 3KF2A 1GHBF 1L4DA 1RFNA 1Y59T 2ZO3H 1CA8B 1FPHH 1DWEH 1ETSH 1HJ8A 3AW1A 3OX7U 4WXVA 1AO5A 3DD2H 1QR3E 3RU4E 1AUJA 2ZKSA 2GKVE 1K1NA 1VJAU 3GYLB 1IQGA 2XC0A 3A89A 3GICB 2BD3A 2FOBA 2GVFA 4VGCC 5GWZA 4YLUA 5C3NA 1ZHMA 1W11U 3EDXB 1EASA 1YBWA 1D3QB 1O3JA 4X1SU 2XCNA 3BTDE 4ZH8A 3SO3A 3GY5A 3BEUA 2Z9IA 1EB2A 2GT8A 2A5KA 4IMQA 5C1UA 1V2NT 4UFFH 1DS2E 1O2QA 3NZIA 1S0RA 5FHTA 1FMGA 1UTPA 5EQSA 1AVXA 4YZUA 1BHXB 2AGIX 2UUFB 5FCKA 4ZAEA 1THSH 3E6PH 2ZZUH 2XBWA 2D8WA 2WPJS 1GJ4H 1UCYK 3ZZ6A 2SNWA 3TK6A 2GZ9A 4K60A 1FAKH 3RC6A 2JH5D 2PHBA 2ZGBH 1UTQA 1WQVH 1CGIE 4NSYA 3DFJA 2Q6FA 3CP7A 1HLTH 1FN8A 3PTNA 3LT3A 1MKWK 1O2OA 2ILNA 1TRMA 5ESBA 5JBCS 3TK9A 2FODA 1TGTA 2VNTA 1UCYE 2AERH 1QA7A 2ZGHA 1F2SE 3BTFE 1B5GH 3ZV9A 1ZJKA 3VGCB 1SLXB 5JB9S 4XBCA 2ULLA 2TGTA 3SHCH 3ZVBA 4AZ2B 2JETB 1BRBE 1SFIA 1EZUC 1O2WA 4FUEA 1BIOA 1AU8A 3PV4A 1HAVB 4X6MA 1WQSA 1CT0E 4RKOB 4GHQA 1QB6A 2PGBB 3BTEE 4AFQA 3P92A 5FBIA 1DUAA 1YKTA 1MTVA 1XUJA 2A31A 2XC4A 1DLKB 1O30A 3EAJA 3RXUA 4X1RU 3MO9A 9LPRA 1RIWB 1ANCA 1DWDH 7ESTE 2BOKA 3SV9A 1VGCB 5DG6A 1GBEA 1G3DA 2ZF0H 5GCHG 1OS8A 4YT7H 1JOUB 1LPZB 2OBOA 1YC0A 3F6UH 1ANDA 4FU7A 1BRCE 1DT2A 1BTUA 1K1OA 4JYTA 4MDSA 3T28A 1O3IA 1DSTA 3I77A 4BANB 1BITA 3RXJA 1O2MA 8ESTE 2FS8A 4IW4E 1GJ9B 2FI5E 1NRPH 4MNWA 3A80A 4FUFA 3RUOA 3RU4T 4ABIA 3RXMA 3AW0A 1TQ0B 2PLXA 2O8WA 4OS5A 4NSVA 4HZHA 3BTGE 1QRWA 5C20A 1TNJA 1GMCF 2BDCA 1OX1A 2XC5A 2ZG0H 1AVWA 1J15A 2FS9A 2BD9A 2WPLS 2ZU1A 1BCUH 1FXYA 2G4UA 3OTJE 4A1XA 4E7RG 1LPKB 2HLCA 1A46H 2A32A 3FAOA 1NPMA 4Q80A 3LJOA 2AEIH 1O2GH 1GJ8B 1G32B 3G01A 1C1QA 2AMDA 1CBWB 2GMTC 2HNTE 3UY9A 1T4UH 4R0IA 4BAHB 5CHAC 4ZHAA 3RXPA 1FLEE 1W13U 1PYTC 2Y5GA 3GCNA 1C9TA 1KTSB 1WUNH 3BEIB 4B71A 2ZU2A 2ZFTA 5A8XA 1F0TA 4ISNA 4DGJA 1TX6A 1Y3VA 4CHAB 1GVZA 3TU7H 4FUCA 2FX6A 3AVZA 4XSKU 5E2OA 1RRKA 3URCA 4U01A 2J38A 1PPEE 3GY3A 3PO1B 1WU1A 1FPCH 1SQAA 3TPIZ 3ZV8A 3L6PA 1HRTH 1EJNA 7KMEH 1EATA 4FVDA 1LQEA 2ANYA 2Z6BD 1CT4E 2W7UA 5EPNA 3OY6U 1KXBA 8LPRA 2A7CA 2ZU5A 1F5LA 3W95A 1BTYA 2BQ6B 6GCHF 4E06H 2A5IA 1BOQA 1O2VA 2EC9H 1AKSA 3V13A 2GZ7A 2A5AA 4B2AA 3LGYA 1GCDA 2GTBA 3WY8A 4B1TA 5J4SA 2FP7B 1HAYB 4I8JA 3H7TA 3Q3YA 2BDBA 2A4RA 1GI1A 2FDAA 1VJ9U 3D62A 1AD8H 2CXVA 4Q7XA 2HPPH 1DSUA 3STJA 1U6QA 2BDIA 1T8NA 1HGTH 1Y8TA 4GLYA 3PTBA 5EXLA 2QF0A 2UWPA 2P95A 1G2MA 1V2MT 1P3EA 2VH0A 3D23A 3SUEA 4MNVA 2G8TA 4VGCB 4B2BA 1LHGH 5FPSA 2QXHA 3GY8A 4I8GA 3VFEA 3MNSA 4K3JA 1C5WB 1K9OE 2H1UA 3SV2H 3T2NA 2O8UA 3MU0A 1UVOA 5AFYH 2ZTXA 3ZVAA 1GBFA 4GHTA 4E7NA 5HYOA 3LJJA 3OU0A 3LONA 1LVMA 3SJKA 2ZCHP 3ZZ4A 2PUXB 5K7RA 2BZAA 3ZVEA 1DVAH 2CJIA 5EU8A 2AFQB 1CE5A 2BVRH 3ZZ8A 1BZXE 2NU2E 2BLWA 1C2KA 2WPKS 4MLFB 2ZQ1A 1LHCH 2O8TA 3TNTA 5C1XA 2A45B 1V6DA 1DXWA 3PB1E 3S9CA 2P16A 4GCHF 2XYAA 2Y81A 1GBTA 3VB7A 3UNSA 1WV7H 1O2YA 2RG3A 2JKHA 1TBQH 1GHVH 2FXRA 1T31A 4DOQA 1FAXA 2ZWLH 1EPTC 1OPHB 1LTOA 1TPPA 1O5CB 1NRNH 1UK4A 2LNCA 1MKXH 1AWFH 1HCGA 1ZGIA 1P2MA 2PW8H 3SU0A 1QQUA 1DANH 1C1SA 2FI4E 2P93A 5F8XA 1TNGA 1A0LA 1TMUH 1P2KA 3ZZCA 4SGBE 3GCOA 1IQNA 4INKA 4UFGH 2C93B 1XX9A 1WYKA 3MO3A 3F9GA 1EP6A 1SMFE 1F0RA 1ORFA 3UQOA 3GCTF 2WV4A 4OGXA 1JIRA 1GGDB 1GDQA 1GBMA 2ZNKH 1C1TA 1NROH 4DCDA 3EYDA 1LHFH 4INLA 4AYVB 2P3FH 2Z3DA 1KXCA 1SOZA 1O2PA 3RM0H 2ODPA 4JK6A 4ZHLU 5EQRA 3GCHC 1DX5M 4JZFH 1BB0B 2G81E 1BBRH 3GISB 3O8BA 4DT7B 1P12E 5F6MA 1LDTT 1TFXA 4CRAA 1D9IA 4I7YH 4X8TH 1W2KH 2OP9A 1SHHB 1EZQA 2VIPA 1O3OA 4UONA 2V3HH 4IGDA 1AY6H 1SGDE 1DICA 1YM0A 3RXEA 1UTLM 3K65B 1AIXH 1Y3UA 4IC5A 4ZHMU 2CF8H 1F0UA 2CHAC 1QJ1B 3MFJA 5EOKA 3M3SA 4BOHA 4DY7B 1QNJA 1S81A 4JZDH 3SGAE 1ETRH 1ZLRA 1W7XH 5DJ7A 1E37B 1HFDA 2IJOB 1DY9A 5FX5A 5GIBA 3RLWH 3SV7A 7GCHF 3KCGH 3MYWA 4E05H 3KN2A 3U9AH 1AWHB 1GJDB 1ZSLA 3A8BA 5CHAB 1O5FH 2OC8A 1C5TA 5DP3A 1TA6A 1W12U 4A6LA 1LVBA 1QURH 1L4ZA 4INHA 1UMAH 1SQTA 1V2VT 2C4FH 1OSSA 2A7HA 3K9XB 3M3VA 4K2YA 6GCHG 4LZ4B 3UQVA 4Y10E 3A8DA 3M7UA 4BAMB 1UO6A 2GV6A 4K8BA 4SGAE 2THFB 1O5BB 2P3TB 1ZYOA 1MZAA 1QBVH 4NIWA 1C1VH 4ABBA 2ZQ2A 1UTNA 1VCQA 3UPEA 3AAVA 1MTUA 4TYDA 1S5SA 1XMNB 1XKAC 2QA9E 3UTUH 1S0QA 1MD7A 3M5LA 5DP4A 1ZTKA 2AIPA 2ZGXH 2BHGA 1VITF 2CN0H 2FTLE 3LPRA 5EW2H 1T8OA 1WTGH 4Y76A 1OYQA 1IQIA 2ZHFH 3PLKA 2SGEE 4X2WA 1J17T 1HAHH 3T62A 2ZP0H 3SN8A 2Y7ZA 1K1LA 1FNIA 1TX8A 3LU9B 2BX3A 1JMOH 1TX7A 1P06A 3M5MA 4DIHH 1QJ6B 2UWOA 1YCPM 3AAUA 1Y3YA 1YCPK 4NIYA 1TNHA 1FJSA 1GG6B 4NGAH 3RC5A 1H4WA 1W3CA 2PWXA 1GMHF 1QL7A 5SGAE 1YPHC 1FZZA 2FEQH 2WV5A 5A0BA 2UUYA 4DURA 2ZHEH 1NESE 3PM3A 1GJBB 1NFWA 4F49A 1TPSA 1KXDA 5FCRA 2KAIB 2D2DA 2BY5X 1O31A 4MTBA 2PUQH 4I33A 1LHEH 1P0SH 4BAQB 2C8WB 1ZTJA 4B2CA 2FO9A 1HYLA 4Y6DA 3IITA 2JH0D 1CBWC 1O3PB 2G4TA 4JZIA 1C5YB 3CS7A 3TGJE 3RXQA 1G30B 1O34A 1JRTA 1ACBE 3ZVCA 2ZU3A 4OS7A 2FOEA 3SU6A 4Y8YA 3QTVH 1YP9A 3BTKE 3ZZBA 4TWYA 3TH4H 1KYNA 3BSQA 3E90B 1C2JA 1YPMH 2G00A 2HWLB 3QZQA 2XBXA 5F8ZA 3TITA 3T26A 2XCFA 1EJAA 1FY8E 3MNBA 3ZZ5A 4X1PU 3PO1C 1EPTB 3SU3A 3MNCA 1WTHD 1K1JA 2OCVB 3M3TA 1G3CA 1DY8A 1HBTH 4GAWA 2F3CE 3VB3A 1TOCB 2FPZA 2ZECA 1YPHE 4FUHA 1F7ZA 5GPIB 3E0PB 3GY2A 5J4QA 4FXGH 3V7TA 1RD3B 2H9TH 3A84A 4AGJA 3SZNA 1ZSKA 2WINI 1C5LH 4ABDA 4NIXA 1V2TT 1HAOH 1O3AA 4Z6AH 1BMMH 1GHWH 1QQ4A 2Q6DA 4WH8A 1EAXA 5A09A 1F92A 1HV7A 2BQWB 3KHVA 1YPLH 4WY3A 2PSXA 1FI8A 1MD8A 1YPKH 1K21H 3JZ1B 1EX3A 1V2OT 2ZPSA 3GCHB 1G36A 1Z1IA 3L33A 2TIOA 5C5NA 3MO6A 1OWIA 1BTXA 4XE4A 1TMTH 4ZKNU 1P01A 4WMFA 2AGEX 3SU1A 3SI3H 1ID5H 5C67A 1L1JA 1KXAA 1C1RA 1GBHA 1VCWA 3SOSA 3QK1A 4GPGA 1JWTA 2CHAB 3KNXA 3LC3A 1TGNA 2FLRH 2GCHG 1BMNH 1IQJA 3ZVDA 2TGAA 2BQ7B 4AORA 2VJ1A 1HPGA 3RXGA 1TLDA 1GWAA 1TA2A 3U8RH 2FMJA 4J1YA 4TPIZ 3BV9B 4FUDA 4X8SH 4Y11E 1GHAF 2JH6D 3DFLA 1MAYA 1XVOA 5HGGA 1OWHA 4I8HA 2WPIS 1UVUH 1AZ8A 1J8AA 2ZEBA 4AYYB 1K2I1 1FONA 1C2IA 2WUBA 3E1XB 1ZPCA 3H5CB 2HVXA 1SLUB 3ATMA 1MKXK 2STBE 4AN7A 1BTPA 1VR1H 1AN1E 1O3LA 1SGNE 1UK2A 4X6NA 2W5EA 2OD3B 2QF3A 1V2RT 3Q3KA 5E0GA 1GVLA 2BY8X 4NG9H 1ZOMA 2QN5T 1GJ6A 5JYIA 1IOEA 5L30H 1KDQA 1AGJA 4A5TS 5CE1A 2BZ6H 1NZQH 1P2QA 1NFXA 3GY6A 2O9QA 4WH6A 1GMHG 2GDEH 2SGQE 1GHXH 1OWKA 2J4IA 4KTCA 3FZZA 2EA3A 2XNIA 5TJXA 1SOTA 4Y71A 1LO6A 4FUGA 3BTWE 1BBRK 1GBKA 4X6PA 1UTKA 3U8TH 1P3CA 1P2NA 1GHZA 1GGDC 1EUFA 2GZ8A 1ZMJA 4LZ1H 2UWLA 3BG4C 1MTSA 2SGPE 3SNEA 3UOPA 2NU0E 3MHWU 1FIZA 3MU8A 4NFEA 4YOIA 1SR5C 3A81A 3M36A 1CHOF 4U30A 1O3BA 1JRSA 3LGIA 3A7TA 3KQEA 1TGBA 2PKAA 1O2JA 4XBBA 2C8ZB 5JDUB 1EZSC 3MOCA 3A7YA 1QCPA 1BBRE 1ARBA 1DITH 3EQ0H 2GCTB 1IQFA 3AASA 3ATWA 3T27A 2XBYA 1XUIA 3VB6A 2WUCA 1GDNA 1BMAA 4IMZA 5JBBS 2ZTZA 1DE7H 1S6HA 3I78A 1K28D 5A0AE 2B5TB 1GI2A 3PMJA 1NRSH 1Y5BT 1E35B 2QAAA 3B8JA 2A7JA 3SW2B 1NU7B 2V6NA 1TNLA 2RCEA 1FQ3A 1OP0A 1G37A 1O3DA 1UHBA 4NWKA 1V2WT 1SGIB 1PPBH 1V2QT 2BD7A 4Q7ZA 1C5MD 3W94A 1C5NH 5HM2A 1EXFA 3BTQE 1H8DH 3TVJB 1MTNB 1W8BH 3NKKA 1E36B 1HAPH 3LDXH 4YLQH 2R3UA 3TH3H 3E0NB 2BD5A 4WXIA 1L0ZA 3O8RA 2QIQA 3MNXA 3OY5U 3UWIA 1BMLA 1WCZA 1ESTA 1EP5A 5T6GA 2FLBH 1GHBG 1T8MA 3BN9A 1C4Y2 1GI3A 1GJ7B 1GJCB 3HKIB 3LGWA 1Z7KA 2OBQA 4U2WA 3RU4D 3S0NA 3SNDA 2V35A 1TONA 1KSNA 1MCVA 2HRVA 4FUJA 1SBWA 4NFFA 1IQLA 4X6OA 2F91A 4X1QU 1Z8GA 3FVFB 5FPTA 1GPZA 1EZXC 4ZMAH 1O3FA 5GJ4B 3QGNB 1C5PA 3B9FH 1O2KA 1UTMA 4UFDH 1QB9A 1P9SA 5DP7A 3GDUA 4RN6A 1Z6EA 3GDSA 4DIIH 2P3UB 2EEKA 5EXMA 1D3DB 1TE0A 3I29A 3PLPA 4ZKOU 1GG6C 2VIOA 3Q77A 1O2TA 1NT1A 1ABIH 2XWBI 1O2UA 1V2PT 2PTNA 1WAYB 3DA9B 4MNYA 4IBLH 5E2PA 2A0QB 1W0YH 2J92A 1UVPA 2CMYA 2M5TA 1YF4A 3GDVA 1CQQA 2FOGA 1QL8A 2GV7A 1NFUA 3S9BA 3ESTA 3HK6B 4UD9H 1EAIA 3UNRA 2R9PA 5GXPA 4RKJB 1MU6B 3N7OA 2BLOA 1TMBH 1ZPBA 1P09A 2TGPZ 1O5GH 2FZZA 2H5DA 2QCYA 2BY9X 4RSPA 4AX9H 3RMMH 5BRRE 4NZLA 1GI5A 4CRGA 1MQ6A 3EE0B 3O8DA 2FYQA 2ZA5A 1Z1JA 1O33A 2ZGCA 4D7GA 1A5GH 1GBLA 1ZJDA 3ENSB 4X1NU 5EG4A 4O3TA 2VWNA 2B7DH 1C2GA 1C2MA 2VIWA 1FY1A 4U32A 1BTHH 1Z8IB 5B6OA 1O5DH 4ISIH 2C8XB 3LH3A 2B9LA 1PQ7A 1EQ9A 5EW1H 1NRRH 2BTCE 3QX5H 5EXNA 1MBMA 5C1YA 4ABGA 1PQ8A 1V3XA 2VB0A 3P8NA 1FV9A 3RXTA 3PWBA 1HIAA 1Z71A 1C9PA 2FOAA 1GI4A 1Y3XA 4J2YB 1J16A 1AZZA 1HB0B 4GVUA 1Y3WA 3VEQB 2D1JA 4MPUA 4Y7AA 3GY7A 1NO9H 2WPHS 1Y5UT 3P8OA 1T8LA 4LOYH 3TGIE 1GBDA 2WYGA 1SLWB 1O32A 2F9NA 2K1QA 1ZR0A 3K6ZA 3PLBA 3A7XA 3QDZB 1UTJA 4ISLA 2ZDVH 2B8OH 3EA7A 1HXEH 2ZDNA 1O3MA 4B75A 4QT8C 3E91A 2GGVB 2ZU4A 4CBNA 1P02A 2BMGB 2OC1A 2OQUA 1OWDA 1MMJN 1CU1A 1DXPA 1O5AB 2FOFA 2QXJA 1GMCG 3GOVB 3BG4B 1E0FD 4MVNA 3ZYDA 1EKBB 1GL0E 1RTLA 3BF6H 1UK3A 1HUTH 2WYJA 1SSXA 1QBOA 1C4U2 5ESTE 8GCHF 1GJ5H 3UOUA 1C2DA 1MZDA 3IWMA 2BYAX 1SB1H 1P2JA 3LGTA 2Q6GA 1ARCA 1EAWA 3ODFA 2C3SA 1J9CH 3U1JB 1B0FA 1QRXA 4NZQA 1QIXB 3HGNA 2EI8A 1IQHA 2A4OA 1AKSB 4DJZB 4BAOB 3LKWA 5LH8A 1GMDF 2BD2A 1RJXB 1BQYA 3UNQA 5JPMH 1SFQB 4ISHH 4A7IB 1SHYA 2Y82A 5HXFA 1BA8B 1AMHA 3QTOH 3ZZ3A 4ABHA 2AS9A 4A1TA 2VVVA 2QV1A 4Z0KA 1TBZH 3STIA 5EPYA 1KLJH 1QFKH 2Y5FA 3CENA 1UVTH 3BIUH 3C1KA 1DWCH 4WMEA 1INCA 2PR3A 1BRUP 3PROA 3S9AA 1UTOA 1O39A 4YOJA 3RXSA 1LQDB 4AG2A 3Q3XA 2VH6A 5L2YH 5C2ZA 2HALA 3RXLA 3P8FA 5F03A 3URDA 4YT6H 3EA8A 2A2XH 4H4FA 1T32A 3A86A 1NS3A 1O3NA 4H6TA 4D7FA 3M7QA 6LPRA 1C2LA 2FTMA 1ELFA 3SGBE 3OSYA 2PV9B 1HJAC 3ATIA 1EOJA 2VIVA 4IN2A 5I25A 1C1NA 1TYNA 2FI3E 1ZPZA 1O2RA 4ZXYH 5A8ZA 3FP8E 5I46H 1FIWA 3A7WA 1N1LA 3ZVFA 5A8YA 9ESTA 3F9FA 3HK3B 1N6XA 2XTTB 1TOMH 2Y80A 3SQHE 1Z8JB 1MUEB 5DK1A 2ZCLP 1UJ1A 3ZZ9A 2ZDKA 1A4WH 1GBIA 2FYRA 1SPJA 4M7GA 1CSOE 1H9IE 5AF9H 1Q31A 2R0KA 4CRFA 1Q2WA 1PJPA 1V2KT 2ZFRH 1P57B 2AGGX 3ELAH 2ZDLA 3RXHA 4AG1A 3ATKA 2O8LA 2GCTC 4FU9A 3SJ8A 1YYY1 1XKBC 2VINA 1FY5A 4GCHG 3SNAA 1SGFA 4MQAA 2FESH 4NA8A 2OINA 1PPHE 4H6SB 5EODA 2ZTYA 4HFPB 4D76A 4FVBA 1C2FA 5JBTA 4B73A 5TCAA 2W3KA 1QHRB 5F8TA 1O38A 1BJVA 1F0SA 1SGRE 2ESTE 1YLCA 2WPMS 5GCHF 4YM9A 1RS0A 3P70B 4FUIA 2J9NA 1HAGE 3FP6E 3RXAA 1LCYA 1MTNC 3QZRA 4AB8A 1WBGB 3A8AA 3BTHE 2HNTF 1XUKA 3RLYH 4JZ1A 2F9UA 1ZRBA 1SGPE 1LHDH 3R3GB 1HAVA 3SU4A 3RXOA 3FFGA 1S84A 3U1IB 3GYMA 1XM1A 1A61H 1IHSH 3TJUA 1OP2A 3LGUA 4HI3A 3GCTG 2ZHDA 4KTSA 1S82A 1H1BA 3KQBA 4OGYA 5ABWA 1P2IA 1SGQE 4ZXXH 1SLVB 1OXGA 4K1EA 3SU2A 3SV6A 2OXSA 2PKSB 4AB9A 1G3BA 1GCTC 3P6ZB 2ZHQH 2NU1E 4NWLA 1KXEA 4IN1A 3FZDA 2PSYA 4CRBA 2H9HA 8GCHG 1A5HA 2Z3EA 1O0DH 4A1VA 2CF9H 1MAXA 2ZHWH 4CH8B 4WWYA 1TWXB 2F9BH 5G4BA 1O3CA 1H9HE 3F68H 3ZZAA 2TGDA 2W26A 3LGVA 4XFQA 1GL1A 4BAKB 4H42U 1PQ5A 2BY6X 3F9HA 1K1MA 3TH2H 3PMBB 1CO7E 2VWMA 2SGFE 4KELA 4O9VA 1H9LB 2W7SA 1M9UA 1ETTH 1O3EA 4A92A 2LPRA 5DP9A 7GCHG 1C1MA 2BB4A 1KXFA 1C5QA 2VVUA 3RC4A 1CA0C 2XWAA 4OS4A 2Y5HA 1SI5H 1OWJA 2D26C 2ODQA 3KQCA 1MCTA 5T6DA 1P2OA 1MBQA 2PFEA 2R2WU 1NC6A 1ZHPA 3S69A 2F9OA 1G2LA 3RDZA 2AH4X 1O2ZA 1FUJA 2AYWA 1GI7B 1SG8B 4GSOA 3ZVGA 1TNIA 2VGCB 1YGCH 1W14U 2VWOA 3QGJA 3BIVH 2QGRA 2P59A 1N8OC 3KQDA 1AFEH 3LC5A 1PPZA 1T7CA 4ASHA 4B74A 2B0FA 1F5RA 1OYTH 3HGPA 2ALVA
chains in the Genus database with same CATH superfamily
4JCNA 4CRCA 2O8MA 2GDDA 2ZPRA 2TBSA 1P10A 3TNSA 4JK5A 3K2UA 5LPFA 3QLPH 1VITG 3UWJH 4NA9H 3TJVA 5DPAA 3SJOA 1YY3A 2TPIZ 1SGYE 1QJ7B 1JXPA 1O37A 3VB5A 1RTKA 2ANWA 2J95A 2XNDD 4M9FA 2R0LA 2RA3A 3KYFA 2SFAA 2H2ZA 1L1NA 2EQNA 2HOBA 3D65E 1FN6A 3K6YA 2ZIQH 1TAWA 2NU4E 1HJAB 1A3BH 1AI8H 3UUZA 3MH6A 3ITIA 1NM6A 1O2LA 3A85A 2QF4A 1O2IA 1RXPA 1AHTH 1E34B 3PMHB 3H7OA 5T3HA 3SORA 5EQQA 1PFXC 1E38B 2HPQH 3ZYEA 4JMYA 2FOHA 4I32A 5JBAS 5A0CA 2H9EH 4YO9A 1P04A 3M7TA 4D9RA 2F83A 2PTCE 3SJ9A 4DG4A 1AFQB 2HNTC 3JZ2B 1W10U 1DUEA 1D3TB 1HJ9A 3IG6B 3EGKH 1PPGE 1C1PA 5L6NH 1F5KU 4ZUHA 4TY6A 5DP8A 3V12A 1C2HA 4BXSA 4Y79A 7LPRA 4Y0ZE 4MNXA 1A0HB 4MPVA 1QRZA 4CRDA 3UREA 3NRLA 5ETXA 1O3GA 3A7ZA 1ZTLA 1A7SA 1XXDA 1TNKA 1AE5A 1GHYH 2OC7A 5L2ZH 1P05A 4F55A 3VXFH 5T6FA 4DW2U 3OAAD 1AVGH 2Z9LA 3CS0A 5E0JA 1ZHRA 2YMSC 3KL6A 2QXIA 1Q3XA 2Z9JA 1IAUA 1LVYA 3ZZ7A 1QY6A 1BUIA 2BDHA 1YCPH 2OC0A 4ABAA 5LPRA 2GX4A 2GP9B 4X2VA 5GDSH 2BVXH 3V0XA 2ZFPH 3F2GA 4JZEH 3F9EA 3RMNH 1HAZB 1SC8U 1L1GA 1DOJA 2EI6A 1WOFA 4CREA 2BDAA 3M35A 3MU1A 3PMAB 2FWWA 2YNBA 1TGSZ 3NXPA 3DHKH 2BDYA 1MQ5A 4AFUA 1D4PB 1DDJA 2G5NA 2QYIA 2ZFQH 4BTUB 2XXLA 3MU5A 1NY22 1XUGA 4ISOA 3NUMA 1ZSJA 4YTAA 5FXLA 3R0FA 2BD8A 1C5SA 1EJMA 2ZGJA 3TJNA 1OOKB 1CHGA 3VPKA 2ZDMA 5IYTA 3FP7E 3PV2A 4JYVH 3SNCA 1CGHA 1P03A 5DP5A 1X7AC 3DT0H 2BXUH 4KP0A 1GVKB 6ESTA 1GCTB 4NA7A 4F4OC 1S85A 1CVWH 1Z8RA 1EOLA 2AMPA 3C27B 1AB9C 3DSOA 1L2EA 3KGPA 1HNEE 2HGTH 1O35A 4Q7YA 1GI8B 2P94A 1GBAA 3B23B 1GI9B 3A87A 3HATH 1T4VH 5DKMA 4BTTB 3S7KB 2G55A 4YESB 4DVAU 1A0JA 2R3YA 1XVMA 3SUFA 3P8GA 5DGJA 1NBMD 3SGQE 1BHXF 5E0HA 1ABJH 1D3PB 2I6SA 2UUJB 4ZKRU 3S7HB 3V3MA 1HXFH 2R2MB 2Z3CA 2RFKC 2V0BA 2Y6TA 1KDQB 4LK4A 3FKSD 1OP8A 1GHAG 4AFSA 4XOJA 1O3KA 1O36A 1CA0B 1V2UT 2VWLA 3KIDU 4MPWA 4AGKA 1ZGVA 1ESBA 1DPOA 1MTWA 1A1RA 3UB0A 2P8OC 2F9PA 1TGCA 1NN6A 3SU5A 1SVPA 2FIRH 3F1SB 3T5FH 3RXBA 5EJ1A 4TSFD 2LELA 1BDAA 2IOTA 4X2XA 4X2YA 1QB1A 2OLGA 3SI4H 1G9IE 1HAXB 3MU4A 1WSSH 3EA9A 4WJG2 1THRH 2V3OH 2A4QA 3RXDA 1N8OB 1ANEA 4TWWA 3FANA 2OK5A 1EAUA 1ELDE 1LVOA 4TPYA 1ZMLA 1P9UA 5DO4H 2PKAB 5LPEA 4AFZA 4PROA 4I31A 3BG8A 4WMDA 5FPYA 6CHAC 1SGTA 4CBOA 1C1OA 3SNBA 4K69A 1BTWA 1ZRKA 4D9QA 1Y5AT 2W3IA 4O3UA 2J34A 5EGMA 4O03A 4ESTE 1Z6JH 1PPCE 1YPEH 4I8KA 1V2JT 1SKYE 1UVSH 1C5VA 2RA0A 3FOAA 1O5EH 3N7EA 1SGCA 3KEEA 2L6OA 2BOHB 2JJ2D 2BLVA 1PPFE 4MG3A 2PKSC 1HDTH 2LP6A 4XBDA 1UCYH 1D6RA 1ELEE 1ELGA 2ANKH 3LIWA 1VITH 1UHBB 2CV3A 2J2UA 2G52A 1CHOG 3MQKC 1K0HA 4Y0YE 2SGAA 1KMHB 2OQ5A 2DE9A 4WVPE 5JB8S 1BMFD 2BM2A 4Y8XA 1QA0A 4Q2KA 1BT7A 3RM2H 4IC6A 4Q63A 2VIQA 2A4GA 1GBCA 3SHAH 3QO6A 1THPB 1MKWH 4ABJA 5T1VA 1TRYA 4GUXA 1ELBA 1ELAA 2ASUB 3ZZDA 1K1IA 4MPXA 4UEHH 1RTFB 3E8LA 4D8NA 3O8CA 5CMXH 3SV8A 1D6WA 4K1TA 1DWBH 2RDLA 1ZMNA 2XBVA 4Y8ZA 2KAIA 1O2HA 4JYUH 2TRMA 1JBUH 3T25A 2NU3E 2PP6A 1QTFA 4XDEA 5HMAA 2FOMB 4NIVA 2G5VA 3RXCA 1KLIH 1B7XB 1ELCA 3TLOA 1DLEA 2V3MA 1FDPA 1TBRH 2STAE 1GDUA 5A2MH 1ANBA 1QL9A 2F9VA 1SL3A 2XW9A 3NCLA 1BTZA 1TALA 1GI6A 4LXBH 2IPHA 5F53A 3QWCH 1IQEA 5AFZH 5FBEA 1S83A 2VGCC 1FY4A 4X8UH 3DSPA 3Q76A 1W0KD 3HKJB 4O97A 3MMGA 1LKAA 1VCPA 1V2ST 2YMSB 4OS1A 2ZPQA 3DUXH 1ELVA 3PWCA 1O2NA 3M61U 3TJOA 2OUAA 1UW7A 3UFAA 2DE8A 1C5ZB 3Q00A 4WF8A 3U8OH 3ODDA 1GJAB 1EB1H 1BJUA 4B76A 2AIQA 1XUHA 1EPTA 2Z9GA 1K1PA 2ZFFH 5C5OA 1FX0B 1C5RA 1ZZZA 3A83A 2A1DB 2QY0B 1RGQA 1A3EH 1J14A 1KY9A 2Z9KA 1NU9A 4Y7BA 3U98H 4UDWH 1BRAA 5HM9A 2H6MA 4CR9A 3TK5A 3M37A 4YOGA 5C0TA 5EIYA 1GBJA 1HAIH 5AVDA 2GMTB 1G3EA 2I6QA 5LGOA 2G51A 4XD7D 1TB6H 1CT2E 1ESAA 3MTYA 4ZKSU 2NWNA 2IN2A 4TY7A 1W0ZU 3BEFB 1FY3A 1GBBA 1JIMA 1W7GH 2GCHF 3UIRA 4IS5A 1OKXA 1C1UH 1V2LT 4HGCA 1SGFG 1PYTD 3ATLA 3M5NA 4R8TB 5FAHA 1O3HA 1GI0A 3BTTE 2Z7FE 2CK3D 3NK8A 3MI4A 4ACAA 3VGCC 1IQMA 1SGEE 4FUBA 1AB9B 2SGDE 3HPTB 2YOLA 2FX4A 2JETC 1O2SA 3A88A 1YPJH 2BXTH 4K1SA 3M5OA 1IQKA 2GD4B 2AMQA 3PYHA 2BY7X 1AFQC 2ODYB 4ABEA 1DM4B 3MWIU 5K0HA 2XRCA 4UE7H 3E3TA 3VB4A 1AUTC 1HIAB 3UR9A 3MH5A 4ZROA 3SBKA 5TCCA 1C2EA 2VVCA 1KTTB 1QGFA 1RIWC 3TIUA 3RMOH 1A5IA 1VGCC 3MH7A 4KGAA 3A7VA 5E8EH 3OYPA 2C8YB 2C90B 2YNAA 4K5ZA 4K8YA 4KTUA 3SQEE 3VXEH 3TGKE 4I8LA 2GT7A 5FX6A 2BX4A 4FU8A 3MH4A 2ANMH 1P8VC 1O2XA 1C4V2 2FM2A 2VIDA 2P8OB 1TQ7B 1XUFA 4BTIB 1KIGH 2CGAA 2BDGA 2BVSH 3QUMP 2L74A 3D49H 2ZI2H 2H5CA 1K22H 2QXGA 4ACBA 3SUGA 1KLTA 1LMWB 5EJLA 4OS2A 1QBNA 2UUKB 1TRNA 1TABE 1ELTA 4BNRA 3GY4A 2ZCKP 2PGQB 5PTPA 1SQOA 5AHGH 2QC2A 6CHAB 1N6YA 3RXKA 5IDKA 2KX4A 1TPAE 3SYJA 1NRQH 4AOQA 3NPSA 1S6FA 4NCYA 4FETA 2M2AA 2J94A 4CH2B 2OTVA 2Z94A 1CGJE 1LPGB 3LOXA 1IHTH 3RXIA 2DUCA 5IK2D 8KME2 4OS6A 1P11E 3UR6A 2Q1JA 1XXFA 1LKBA 1B0EA 1H8IH 1C1WH 3LH1A 4CHAC 1C5XB 3QN7A 3T29A 1AE8H 3U69H 4UFEH 1MH0A 2K0QA 5DP6A 3P95A 4P00A 2BD4A 2A2QH 2BLQA 1TPOA 5H4IB 2ALPA 1TIOA 1AQ7A 3E16B 3RXVA 2SNVA 1NTPA 2VU8E 4THNH 3SJIA 1DFPA 5BPEA 3RXFA 4CR5A 2ZDAH 1C5UA 1VZQH 4X0WU 3RP2A 3L3TA 3BTME 1C5OH 1YPGH 3P17H 4KKDA 4BXWA 1PQAA 1MU8B 4X8VH 3RXRA 1A2CH 1GMDG 4HTCH 4RT0A 5CHBA 2ZFSA 5DN6D 3NWUA 3RMLH 1YLDA 2ZC9H 3A8CA 3A82A 1NFYA 1OWEA 2EI7A 3SUDA 4ABFA 2FOCA 2Y7XA 3KF2A 1GHBF 1L4DA 1RFNA 1Y59T 2ZO3H 1CA8B 1FPHH 1DWEH 4AC9A 1ETSH 1HJ8A 3AW1A 3OX7U 4B6EA 4WXVA 1AO5A 3DD2H 1QR3E 3RU4E 1AUJA 2ZKSA 2GKVE 1K1NA 1VJAU 3GYLB 1IQGA 2XC0A 3A89A 3GICB 2BD3A 2FOBA 2GVFA 4VGCC 5GWZA 4YLUA 5C3NA 1ZHMA 1W11U 3EDXB 5C17A 1EASA 1YBWA 1D3QB 1O3JA 4X1SU 2XCNA 3BTDE 4ZH8A 3SO3A 3GY5A 3BEUA 2Z9IA 1EB2A 2GT8A 2A5KA 4IMQA 5C1UA 1V2NT 4UFFH 1NBME 1DS2E 1O2QA 3NZIA 1S0RA 5FHTA 1FMGA 1UTPA 5EQSA 1AVXA 4YZUA 1BHXB 2AGIX 5HKKD 2UUFB 5FCKA 4ZAEA 1THSH 3E6PH 2ZZUH 2XBWA 2D8WA 2WPJS 1GJ4H 1UCYK 3ZZ6A 2SNWA 3TK6A 2GZ9A 4K60A 1FAKH 3RC6A 2JH5D 2PHBA 2ZGBH 1UTQA 1WQVH 1CGIE 4NSYA 3DFJA 2Q6FA 3CP7A 1HLTH 1FN8A 3PTNA 3LT3A 1MKWK 1O2OA 2ILNA 1TRMA 5ESBA 5JBCS 3TK9A 2FODA 1TGTA 2J5UA 2VNTA 1UCYE 2WPDD 2AERH 1QA7A 2ZGHA 1F2SE 3BTFE 1B5GH 3ZV9A 1ZJKA 3VGCB 1SLXB 5JB9S 4XBCA 2ULLA 2TGTA 3SHCH 3ZVBA 4AZ2B 2JETB 1BRBE 1SFIA 1EZUC 1O2WA 5C94A 4FUEA 1BIOA 1AU8A 3PV4A 1HAVB 4X6MA 1WQSA 1CT0E 4RKOB 4GHQA 1QB6A 2PGBB 3BTEE 4AFQA 3P92A 5FBIA 1DUAA 1YKTA 1MTVA 1XUJA 2A31A 4RI0A 2XC4A 1DLKB 1O30A 3EAJA 3RXUA 4X1RU 3MO9A 9LPRA 1RIWB 1ANCA 1DWDH 7ESTE 2BOKA 3SV9A 1VGCB 5DG6A 1QZ8A 1GBEA 1G3DA 2ZF0H 5GCHG 1OS8A 4YT7H 1JOUB 1LPZB 2OBOA 1YC0A 3F6UH 1ANDA 4FU7A 1BRCE 1DT2A 1BTUA 1K1OA 4JYTA 4MDSA 3T28A 1O3IA 3N7DA 1DSTA 3I77A 4BANB 1BITA 3RXJA 1O2MA 8ESTE 2FS8A 4IW4E 1GJ9B 4B6FA 2FI5E 1NRPH 4MNWA 3A80A 4FUFA 3RUOA 3RU4T 4ABIA 3RXMA 3AW0A 1TQ0B 2PLXA 2O8WA 4OS5A 4NSVA 4HZHA 3BTGE 1QRWA 5C20A 1TNJA 1GMCF 2BDCA 1OX1A 2XC5A 2ZG0H 1AVWA 1J15A 2FS9A 1S6LA 2BD9A 2WPLS 2ZU1A 1BCUH 1FXYA 2G4UA 3OTJE 4A1XA 4E7RG 1LPKB 2HLCA 1A46H 2A32A 3FAOA 1NPMA 4Q80A 3LJOA 2AEIH 1O2GH 1GJ8B 1G32B 3G01A 1C1QA 2AMDA 1CBWB 2GMTC 2HNTE 3UY9A 1T4UH 4R0IA 4BAHB 5CHAC 4ZHAA 3RXPA 1FLEE 1W13U 1PYTC 2Y5GA 3GCNA 1C9TA 1KTSB 1WUNH 3BEIB 4B71A 2ZU2A 2ZFTA 5A8XA 1F0TA 4ISNA 4DGJA 1TX6A 1Y3VA 4CHAB 1GVZA 3TU7H 4FUCA 2FX6A 3AVZA 4XSKU 5E2OA 1RRKA 3URCA 4U01A 2J38A 1PPEE 3GY3A 3PO1B 1WU1A 1FPCH 1SQAA 3TPIZ 3ZV8A 3L6PA 1HRTH 1EJNA 7KMEH 1EATA 4FVDA 1LQEA 2ANYA 2Z6BD 1CT4E 2W7UA 5EPNA 3OY6U 1KXBA 8LPRA 3OFND 2A7CA 2ZU5A 1F5LA 3W95A 1BTYA 2BQ6B 6GCHF 4E06H 2A5IA 1BOQA 1O2VA 2EC9H 1AKSA 3V13A 2GZ7A 2A5AA 4B2AA 3LGYA 1GCDA 2GTBA 3WY8A 4B1TA 5J4SA 2FP7B 1YWUA 1HAYB 4I8JA 3H7TA 3Q3YA 2BDBA 2A4RA 1GI1A 2FDAA 4XRNA 1VJ9U 3D62A 1AD8H 2CXVA 4Q7XA 2HPPH 1DSUA 3STJA 1U6QA 2BDIA 1T8NA 1HGTH 1Y8TA 4GLYA 3PTBA 5EXLA 2QF0A 2UWPA 2P95A 1G2MA 1V2MT 1P3EA 2VH0A 3D23A 3SUEA 3FN8A 4MNVA 2G8TA 4VGCB 4B2BA 1LHGH 5FPSA 2QXHA 3GY8A 4I8GA 3VFEA 3MNSA 4K3JA 1C5WB 1K9OE 2H1UA 3SV2H 3T2NA 2O8UA 3MU0A 5HIYA 1UVOA 5AFYH 2ZTXA 3ZVAA 1GBFA 4GHTA 4E7NA 5HYOA 3LJJA 3OU0A 3LONA 1LVMA 3SJKA 5C0UA 2ZCHP 5EJZA 3ZZ4A 1COWD 2PUXB 5K7RA 2BZAA 3ZVEA 1DVAH 2CJIA 5EU8A 2AFQB 1CE5A 2BVRH 3ZZ8A 1BZXE 2NU2E 2BLWA 1C2KA 2WPKS 4MLFB 2ZQ1A 1LHCH 2O8TA 3TNTA 5C1XA 2A45B 1V6DA 1DXWA 3PB1E 5GNDA 3S9CA 2P16A 4GCHF 2XYAA 2Y81A 1GBTA 2HLDD 3VB7A 3UNSA 1WV7H 1O2YA 2RG3A 2JKHA 1TBQH 1GHVH 2FXRA 1T31A 4DOQA 1FAXA 2ZWLH 1EPTC 1OPHB 1LTOA 1TPPA 1O5CB 1NRNH 1UK4A 2LNCA 1MKXH 1AWFH 1HCGA 3EE7A 1ZGIA 1P2MA 2PW8H 3SU0A 1QQUA 1DANH 1C1SA 2FI4E 2P93A 5F8XA 1TNGA 1A0LA 1TMUH 1P2KA 3ZZCA 4SGBE 3GCOA 1IQNA 4INKA 4UFGH 2C93B 1XX9A 1WYKA 3MO3A 3F9GA 1EP6A 3UAIC 1SMFE 3PV5A 1F0RA 1ORFA 3UQOA 3GCTF 2WV4A 4OGXA 1JIRA 1GGDB 1GDQA 1GBMA 2ZNKH 1C1TA 1NROH 4DCDA 3EYDA 1LHFH 4INLA 4AYVB 2P3FH 2Z3DA 1KXCA 1SOZA 1O2PA 3RM0H 2ODPA 4JK6A 4ZHLU 5EQRA 3GCHC 1DX5M 4JZFH 1BB0B 2G81E 1BBRH 3GISB 3O8BA 4DT7B 1P12E 5F6MA 1LDTT 1W0JD 1TFXA 4CRAA 1D9IA 4I7YH 4X8TH 2J98A 2JJ1D 1W2KH 2OP9A 1SHHB 1EZQA 2VIPA 5HIZA 1O3OA 4UONA 2V3HH 4IGDA 1AY6H 1SGDE 1DICA 1YM0A 3RXEA 1UTLM 3K65B 1AIXH 1Y3UA 4IC5A 1E1QD 4ZHMU 2CF8H 4ASUD 1F0UA 2CHAC 1QJ1B 3MFJA 5EOKA 3M3SA 4BOHA 4DY7B 1QNJA 1S81A 4JZDH 3SGAE 1ETRH 1ZLRA 1W7XH 3PRDA 4F48B 5DJ7A 1E37B 1HFDA 2IJOB 1DY9A 5FX5A 5GIBA 3RLWH 3SV7A 7GCHF 3KCGH 3MYWA 4E05H 3KN2A 3U9AH 1AWHB 1GJDB 1ZSLA 3A8BA 5CHAB 1O5FH 2OC8A 1C5TA 5DP3A 1TA6A 5DSFA 1W12U 4A6LA 1LVBA 1QURH 3F2FA 1L4ZA 4INHA 1UMAH 1SQTA 1V2VT 2C4FH 1OSSA 2A7HA 3K9XB 3M3VA 4K2YA 6GCHG 4LZ4B 3UQVA 2KZ4A 4Y10E 3A8DA 3M7UA 4BAMB 1UO6A 2GV6A 4K8BA 4SGAE 2THFB 1O5BB 2P3TB 1ZYOA 1MZAA 1QBVH 4NIWA 1C1VH 4ABBA 2ZQ2A 1UTNA 1VCQA 3UPEA 3AAVA 1MTUA 4TYDA 1S5SA 3DSGA 1XMNB 1XKAC 2QA9E 3UTUH 1S0QA 1MD7A 3M5LA 5DP4A 1ZTKA 2AIPA 2ZGXH 2BHGA 1VITF 2CN0H 2FTLE 3LPRA 5EW2H 1T8OA 1WTGH 4Y76A 3U28C 1OYQA 1IQIA 1WDIA 2ZHFH 3PLKA 2SGEE 4X2WA 1J17T 1HAHH 3T62A 2ZP0H 3SN8A 2Y7ZA 1K1LA 1FNIA 1TX8A 3LU9B 2BX3A 1JMOH 1TX7A 1P06A 3M5MA 4DIHH 1QJ6B 2UWOA 1YCPM 3AAUA 5KGOA 1Y3YA 1YCPK 4NIYA 1TNHA 1FJSA 1GG6B 4NGAH 4HG6A 2KCPA 3RC5A 1H4WA 1W3CA 2PWXA 1GMHF 1QL7A 5SGAE 1YPHC 1FZZA 2FEQH 2WV5A 5A0BA 2KM0A 2UUYA 4DURA 2ZHEH 1NESE 3PM3A 1GJBB 1NFWA 4F49A 1TPSA 1KXDA 5FCRA 2KAIB 2D2DA 4Z1MD 2BY5X 1O31A 4MTBA 3H09A 2PUQH 4I33A 1LHEH 1P0SH 4BAQB 2C8WB 1ZTJA 4B2CA 2FO9A 1HYLA 4Y6DA 3IITA 2JH0D 4DT4A 1CBWC 1O3PB 2G4TA 3F0OA 4JZIA 1C5YB 3CS7A 3TGJE 1EFRD 3RXQA 1G30B 1O34A 1JRTA 1ACBE 3ZVCA 2ZU3A 4OS7A 2FOEA 3SU6A 4Y8YA 3QTVH 1YP9A 3BTKE 3ZZBA 4TWYA 3TH4H 3KYGA 1KYNA 3BSQA 3E90B 1C2JA 1YPMH 2G00A 2HWLB 3QZQA 2XBXA 5F8ZA 3TITA 3T26A 2XCFA 1EJAA 1FY8E 3MNBA 3SZEA 3ZZ5A 4X1PU 3PO1C 1EPTB 4Q4LA 2WHXA 3MNCA 3SU3A 1WTHD 1K1JA 2OCVB 3M3TA 1G3CA 1DY8A 1HBTH 4GAWA 2F3CE 3VB3A 1TOCB 2FPZA 2ZECA 1YPHE 4FUHA 1F7ZA 5GPIB 3E0PB 3GY2A 5J4QA 4FXGH 3V7TA 1RD3B 2H9TH 3A84A 4AGJA 3SZNA 1ZSKA 2WINI 1C5LH 4ABDA 4NIXA 4YXWD 1V2TT 1HAOH 1O3AA 4Z6AH 1BMMH 1GHWH 2GJGA 1QQ4A 2Q6DA 4WH8A 1EAXA 5A09A 1F92A 1HV7A 2BQWB 2W6JD 3KHVA 3OEHD 1YPLH 4WY3A 2W6ID 2PSXA 1FI8A 1MD8A 1YPKH 3KQ5A 1K21H 3JZ1B 1EX3A 1E1RD 1V2OT 2ZPSA 3GCHB 1G36A 1Z1IA 3L33A 2TIOA 5C5NA 3MO6A 1OWIA 1BTXA 4XE4A 1TMTH 4ZKNU 1P01A 4WMFA 2AGEX 3SU1A 3SI3H 1ID5H 5C67A 1L1JA 1KXAA 1C1RA 1GBHA 2WZQA 2HVYB 1VCWA 3SOSA 3QK1A 4GPGA 1JWTA 2CHAB 3KNXA 3LC3A 1TGNA 2FLRH 2GCHG 1BMNH 1IQJA 3ZVDA 2TGAA 2BQ7B 4AORA 2VJ1A 1HPGA 3RXGA 1TLDA 1GWAA 1TA2A 3U8RH 2FMJA 4J1YA 4TPIZ 3BV9B 4FUDA 4X8SH 4Y11E 1GHAF 2JH6D 3DFLA 1MAYA 1XVOA 5HGGA 1OWHA 4I8HA 2WPIS 1UVUH 1AZ8A 1J8AA 2ZEBA 4AYYB 1K2I1 1FONA 1C2IA 2WUBA 3E1XB 1ZPCA 2KCOA 3H5CB 2HVXA 1SLUB 3ATMA 1MKXK 2STBE 4AN7A 1VKYA 5CDFE 1BTPA 1VR1H 1AN1E 1O3LA 1SGNE 1UK2A 4X6NA 2W5EA 2OD3B 2QF3A 1V2RT 3Q3KA 5E0GA 1GVLA 2BY8X 4NG9H 1ZOMA 2QN5T 1GJ6A 5JYIA 1IOEA 5L30H 1KDQA 1AGJA 4A5TS 5CE1A 2V7QD 2BZ6H 1NZQH 1P2QA 1NFXA 3GY6A 2O9QA 4WH6A 1GMHG 2GDEH 2SGQE 1GHXH 1OWKA 2J4IA 4KTCA 3FZZA 2EA3A 2XNIA 5TJXA 1SOTA 4Y71A 1LO6A 4FUGA 3BTWE 1BBRK 1GBKA 4X6PA 1UTKA 3U8TH 1P3CA 1P2NA 1GHZA 1GGDC 1EUFA 2GZ8A 1ZMJA 4LZ1H 2UWLA 3BG4C 1MTSA 2SGPE 3SNEA 3UOPA 2NU0E 3MHWU 5FL7D 1FIZA 3MU8A 4NFEA 4YOIA 1SR5C 5KEDA 3A81A 3M36A 1CHOF 4TT3D 4U30A 1O3BA 1JRSA 3LGIA 3A7TA 3KQEA 1TGBA 2PKAA 1O2JA 4XBBA 2C8ZB 5JDUB 1EZSC 3MOCA 3A7YA 1QCPA 1BBRE 1ARBA 1DITH 3EQ0H 2GCTB 1IQFA 3AASA 3ATWA 3T27A 2XBYA 1XUIA 3VB6A 2WUCA 1GDNA 1BMAA 4IMZA 5JBBS 2ZTZA 1DE7H 1S6HA 3I78A 1K28D 5A0AE 2B5TB 1GI2A 3PMJA 1NRSH 1Y5BT 1E35B 1SQRA 2QAAA 3B8JA 2A7JA 3SW2B 1NU7B 2V6NA 1TNLA 2RCEA 1FQ3A 1OP0A 1G37A 1O3DA 1UHBA 4NWKA 1V2WT 1WXRA 1SGIB 1PPBH 1V2QT 2BD7A 4OM9A 4Q7ZA 1C5MD 3W94A 1C5NH 5HM2A 1EXFA 3BTQE 1H8DH 3TVJB 3VG8A 1MTNB 1W8BH 3NKKA 1E36B 1HAPH 3LDXH 4YLQH 2R3UA 3TH3H 3E0NB 2BD5A 4WXIA 1L0ZA 3O8RA 2QIQA 3MNXA 3OY5U 3UWIA 1BMLA 1WCZA 1ESTA 1EP5A 5T6GA 2FLBH 1GHBG 4P02A 1T8MA 3AK5A 3BN9A 1C4Y2 3DCLA 1GI3A 2JIZD 1GJ7B 1GJCB 2WSSD 3HKIB 3LGWA 1Z7KA 2OBQA 4U2WA 3RU4D 2F4LA 3S0NA 3SNDA 2V35A 1TONA 1KSNA 1MCVA 2HRVA 4FUJA 2K8IA 1SBWA 4NFFA 1IQLA 4X6OA 2F91A 4X1QU 1Z8GA 3FVFB 5FPTA 1GPZA 1EZXC 4ZMAH 1O3FA 5GJ4B 3QGNB 1C5PA 3B9FH 1O2KA 1UTMA 4UFDH 1QB9A 1P9SA 5DP7A 3GDUA 4RN6A 1Z6EA 3GDSA 4DIIH 2P3UB 2EEKA 5EXMA 1D3DB 1TE0A 3I29A 3PLPA 4ZKOU 1GG6C 2VIOA 3Q77A 1O2TA 1NT1A 1ABIH 2XWBI 1O2UA 1V2PT 2PTNA 2WV9A 1WAYB 3DA9B 4MNYA 4IBLH 2RDEA 5E2PA 2A0QB 1W0YH 2J92A 1UVPA 2CMYA 2M5TA 1YF4A 3GDVA 1CQQA 2FOGA 1QL8A 2GV7A 1NFUA 3S9BA 3ESTA 3HK6B 4UD9H 1EAIA 3UNRA 2R9PA 5GXPA 4RKJB 1MU6B 3N7OA 2BLOA 1TMBH 1ZPBA 1P09A 2TGPZ 1O5GH 2FZZA 2H5DA 2QCYA 2BY9X 4RSPA 4AX9H 3RMMH 5BRRE 4NZLA 1GI5A 4CRGA 1MQ6A 3EE0B 3O8DA 2VBCA 2FYQA 4I86A 2ZA5A 1Z1JA 3N99A 1O33A 2ZGCA 3F3BA 3ZIAD 1A5GH 1GBLA 1ZJDA 4D7GA 3ENSB 4X1NU 5EG4A 4O3TA 2VWNA 2B7DH 1C2GA 1C2MA 2VIWA 1FY1A 4U32A 1BTHH 1Z8IB 5B6OA 1O5DH 4ISIH 2C8XB 3LH3A 2B9LA 1PQ7A 3W1EA 1EQ9A 5EW1H 1NRRH 2BTCE 2KR7A 3QX5H 5EXNA 1MBMA 5C1YA 4ABGA 1PQ8A 1V3XA 2VB0A 3P8NA 1FV9A 3RXTA 3PWBA 1HIAA 1Z71A 1C9PA 2FOAA 1GI4A 1Y3XA 4J2YB 1J16A 1AZZA 1HB0B 4GVUA 1Y3WA 3VEQB 2D1JA 1MABB 4MPUA 4Y7AA 3GY7A 1NO9H 2WPHS 1Y5UT 3P8OA 1T8LA 4LOYH 2IPQX 3TGIE 1GBDA 2WYGA 1SLWB 1O32A 1H8ED 2F9NA 2K1QA 1ZR0A 3K6ZA 3PLBA 3A7XA 3QDZB 1UTJA 4ISLA 2ZDVH 2B8OH 3EA7A 1HXEH 2ZDNA 1O3MA 4B75A 4QT8C 3E91A 2GGVB 2ZU4A 4CBNA 1P02A 2BMGB 2OC1A 2OQUA 1OWDA 1MMJN 1CU1A 1DXPA 1O5AB 2FOFA 2QXJA 1GMCG 3GOVB 3BG4B 1E0FD 4MVNA 3ZYDA 1EKBB 1GL0E 1RTLA 3BF6H 1UK3A 1HUTH 2WYJA 1SSXA 1QBOA 1C4U2 5ESTE 8GCHF 1GJ5H 3UOUA 1C2DA 1MZDA 3IWMA 2BYAX 1SB1H 1P2JA 3LGTA 2Q6GA 1ARCA 1EAWA 3F0PA 3ODFA 2C3SA 1J9CH 2KFWA 3U1JB 1B0FA 1QRXA 4NZQA 1QIXB 3HGNA 2EI8A 1IQHA 2A4OA 2JDID 1AKSB 4DJZB 4BAOB 3LKWA 1YLNA 5LH8A 1GMDF 2BD2A 1RJXB 1BQYA 3UNQA 5JPMH 1SFQB 4ISHH 4A7IB 1SHYA 3OE7D 2Y82A 3GS9A 5HXFA 1BA8B 1AMHA 3QTOH 3ZZ3A 2KCAA 4ABHA 2AS9A 3PRBA 2QE7D 4A1TA 2VVVA 2QV1A 4Z0KA 1TBZH 3STIA 2YMSD 5EPYA 1KLJH 1QFKH 2Y5FA 3CENA 1UVTH 3BIUH 3C1KA 1DWCH 4WMEA 1INCA 2PR3A 1BRUP 3PROA 3S9AA 1UTOA 1O39A 4YOJA 3RXSA 1LQDB 4AG2A 3Q3XA 2VH6A 5L2YH 5C2ZA 2HALA 3RXLA 3P8FA 5F03A 3URDA 4YT6H 3EA8A 2A2XH 4H4FA 1T32A 3A86A 1NS3A 1O3NA 4H6TA 4D7FA 3M7QA 6LPRA 1C2LA 2F43B 2J97A 2FTMA 1ELFA 3SGBE 3OSYA 2PV9B 1HJAC 3ATIA 1EOJA 2VIVA 4IN2A 5I25A 1C1NA 1TYNA 2FI3E 1ZPZA 1O2RA 4ZXYH 5A8ZA 3FP8E 5I46H 1FIWA 3A7WA 1N1LA 3ZVFA 5A8YA 9ESTA 2XOKD 3F9FA 3HK3B 1N6XA 2XTTB 1TOMH 2Y80A 3SQHE 4RT1A 1Z8JB 1MUEB 5DK1A 2ZCLP 1UJ1A 3ZZ9A 2ZDKA 1A4WH 1GBIA 2FYRA 1SPJA 4M7GA 1CSOE 1H9IE 5AF9H 1Q31A 2R0KA 4CRFA 1Q2WA 1PJPA 1V2KT 2ZFRH 1P57B 2AGGX 3ELAH 2ZDLA 3RXHA 4AG1A 3ATKA 2O8LA 3WWFA 2GCTC 4FU9A 3SJ8A 1YYY1 1XKBC 2VINA 1FY5A 4GCHG 3SNAA 1E79D 1SGFA 4MQAA 2FESH 4NA8A 2OINA 1PPHE 4H6SB 5EODA 2ZTYA 4HFPB 4D76A 4FVBA 1C2FA 5JBTA 4B73A 5B6LA 5TCAA 4ZCNA 2W3KA 1QHRB 5F8TA 1O38A 1BJVA 1F0SA 1SGRE 2ESTE 1YLCA 2WPMS 2KCYA 5GCHF 4YM9A 1RS0A 3P70B 4FUIA 2J9NA 1HAGE 3FP6E 3RXAA 1LCYA 1MTNC 3QZRA 4FOUC 2J98B 3WWBA 4AB8A 1WBGB 3A8AA 3BTHE 2HNTF 1XUKA 3RLYH 4JZ1A 2F9UA 1ZRBA 1SGPE 1LHDH 3R3GB 1HAVA 3SU4A 3RXOA 3FFGA 1S84A 3U1IB 3GYMA 1XM1A 1A61H 1IHSH 3TJUA 1OP2A 3LGUA 4HI3A 3GCTG 2ZHDA 4KTSA 1OHHD 1H1BA 1S82A 3KQBA 4OGYA 5ABWA 1P2IA 1SGQE 4ZXXH 1SLVB 1OXGA 4K1EA 3SU2A 2AHME 3SV6A 2OXSA 2PKSB 4AB9A 1G3BA 1GCTC 3OEED 3P6ZB 2ZHQH 2NU1E 4NWLA 1H8HD 1KXEA 3FZDA 2PSYA 4IN1A 2H9HA 4CRBA 1A5HA 2Z3EA 8GCHG 1O0DH 4A1VA 2CF9H 1MAXA 2ZHWH 4CH8B 4WWYA 1TWXB 2F9BH 5G4BA 1O3CA 1H9HE 3F68H 3ZZAA 2TGDA 2W26A 3LGVA 4XFQA 2EY4C 1GL1A 4BAKB 4H42U 1PQ5A 2BY6X 3F9HA 1K1MA 3TH2H 3F2HA 3PMBB 1CO7E 2VWMA 3OTPA 2SGFE 4KELA 4O9VA 1H9LB 2W7SA 1M9UA 1ETTH 1O3EA 4A92A 2LPRA 5DP9A 2QF5A 7GCHG 1C1MA 2BB4A 3CNRA 1KXFA 1C5QA 2IJD1 2VVUA 3RC4A 1CA0C 2XWAA 4OS4A 2Y5HA 1SI5H 1OWJA 2D26C 2ODQA 3KQCA 1MCTA 5T6DA 1P2OA 1MBQA 2PFEA 2R2WU 1NC6A 1ZHPA 3S69A 2F9OA 1G2LA 3RDZA 2AH4X 1O2ZA 3WW7A 1FUJA 2AYWA 1GI7B 1SG8B 4GSOA 3ZVGA 1TNIA 2VGCB 1YGCH 1W14U 2VWOA 3QGJA 3BIVH 5KECA 2QGRA 2P59A 1N8OC 3KQDA 1AFEH 3LC5A 1PPZA 1T7CA 4ASHA 4B74A 3FO8D 2B0FA 1F5RA 1OYTH 3HGPA 2ALVA
chains in the Genus database with same CATH topology
4JCNA 4CRCA 2O8MA 2GDDA 2ZPRA 2TBSA 1P10A 3TNSA 4JK5A 3K2UA 5LPFA 3QLPH 1VITG 3UWJH 4NA9H 3TJVA 5DPAA 3SJOA 2TPIZ 1SGYE 1QJ7B 1JXPA 1O37A 3VB5A 1RTKA 2ANWA 2J95A 2R0LA 2RA3A 2SFAA 2H2ZA 1L1NA 2HOBA 3D65E 1FN6A 3K6YA 2ZIQH 1TAWA 2NU4E 1HJAB 1A3BH 1AI8H 3UUZA 3MH6A 3ITIA 1NM6A 1O2LA 3A85A 1O2IA 1RXPA 1AHTH 1E34B 3PMHB 3H7OA 5T3HA 3SORA 5EQQA 1PFXC 1E38B 2HPQH 3ZYEA 4JMYA 2FOHA 4I32A 5JBAS 5A0CA 2H9EH 4YO9A 1P04A 3M7TA 4D9RA 2F83A 2PTCE 3SJ9A 4DG4A 1AFQB 2HNTC 3JZ2B 1W10U 1DUEA 1D3TB 1HJ9A 3IG6B 3EGKH 1PPGE 1C1PA 5L6NH 1F5KU 4ZUHA 4TY6A 5DP8A 3V12A 1C2HA 4BXSA 4Y79A 7LPRA 4Y0ZE 4MNXA 1A0HB 4MPVA 1QRZA 4CRDA 3UREA 5ETXA 1O3GA 3A7ZA 1ZTLA 1A7SA 1XXDA 1TNKA 1AE5A 1GHYH 2OC7A 5L2ZH 1P05A 3VXFH 5T6FA 4DW2U 1AVGH 2Z9LA 3CS0A 5E0JA 1ZHRA 3KL6A 2QXIA 1Q3XA 2Z9JA 1IAUA 1LVYA 3ZZ7A 1QY6A 1BUIA 2BDHA 1YCPH 2OC0A 4ABAA 5LPRA 2GX4A 2GP9B 4X2VA 5GDSH 2BVXH 3V0XA 2ZFPH 4JZEH 3F9EA 3RMNH 1HAZB 1SC8U 1L1GA 1DOJA 2EI6A 1WOFA 4CREA 2BDAA 3M35A 3MU1A 3PMAB 2FWWA 2YNBA 1TGSZ 3NXPA 3DHKH 2BDYA 1MQ5A 4AFUA 1D4PB 1DDJA 2G5NA 2QYIA 2ZFQH 4BTUB 2XXLA 3MU5A 1NY22 1XUGA 4ISOA 3NUMA 1ZSJA 4YTAA 5FXLA 3R0FA 2BD8A 1C5SA 1EJMA 2ZGJA 3TJNA 1OOKB 1CHGA 3VPKA 2ZDMA 5IYTA 3FP7E 3SNCA 4JYVH 1CGHA 1P03A 5DP5A 1X7AC 3DT0H 2BXUH 4KP0A 1GVKB 6ESTA 1GCTB 4NA7A 4F4OC 1S85A 1CVWH 1Z8RA 1EOLA 2AMPA 3C27B 1AB9C 3KGPA 1L2EA 1HNEE 2HGTH 1O35A 4Q7YA 1GI8B 2P94A 1GBAA 3B23B 1GI9B 3A87A 3HATH 1T4VH 5DKMA 4BTTB 3S7KB 2G55A 4YESB 4DVAU 1A0JA 2R3YA 1XVMA 3SUFA 3P8GA 5DGJA 3SGQE 1BHXF 5E0HA 1ABJH 1D3PB 2I6SA 2UUJB 4ZKRU 3S7HB 3V3MA 1HXFH 2R2MB 2Z3CA 2V0BA 2Y6TA 1KDQB 4LK4A 1OP8A 1GHAG 4AFSA 4XOJA 1O3KA 1O36A 1CA0B 1V2UT 2VWLA 3KIDU 4MPWA 4AGKA 1ZGVA 1ESBA 1DPOA 1MTWA 1A1RA 2P8OC 2F9PA 1TGCA 1NN6A 3SU5A 1SVPA 2FIRH 3F1SB 3T5FH 3RXBA 1BDAA 2IOTA 4X2XA 4X2YA 1QB1A 2OLGA 3SI4H 1G9IE 1HAXB 3MU4A 1WSSH 3EA9A 4WJG2 1THRH 2V3OH 2A4QA 3RXDA 1N8OB 1ANEA 4TWWA 3FANA 1EAUA 1ELDE 1LVOA 4TPYA 1ZMLA 1P9UA 5DO4H 2PKAB 5LPEA 4AFZA 4PROA 4I31A 3BG8A 4WMDA 5FPYA 6CHAC 1SGTA 4CBOA 1C1OA 3SNBA 4K69A 1BTWA 1ZRKA 4D9QA 1Y5AT 2W3IA 4O3UA 2J34A 5EGMA 4O03A 4ESTE 1Z6JH 1PPCE 1YPEH 4I8KA 1V2JT 1UVSH 1C5VA 2RA0A 1O5EH 1SGCA 3KEEA 2BOHB 2BLVA 1PPFE 4MG3A 2PKSC 1HDTH 4XBDA 1UCYH 1D6RA 1ELEE 1ELGA 2ANKH 3LIWA 1VITH 1UHBB 2CV3A 2J2UA 2G52A 1CHOG 4Y0YE 2SGAA 2OQ5A 2DE9A 4WVPE 5JB8S 2BM2A 4Y8XA 1QA0A 4Q2KA 1BT7A 3RM2H 4IC6A 2VIQA 2A4GA 1GBCA 3SHAH 3QO6A 1THPB 1MKWH 4ABJA 1TRYA 4GUXA 1ELBA 1ELAA 2ASUB 3ZZDA 1K1IA 4MPXA 4UEHH 1RTFB 3E8LA 4D8NA 3O8CA 5CMXH 3SV8A 1D6WA 4K1TA 1DWBH 2RDLA 1ZMNA 2XBVA 4Y8ZA 2KAIA 1O2HA 4JYUH 2TRMA 1JBUH 3T25A 2NU3E 1QTFA 4XDEA 5HMAA 2FOMB 4NIVA 2G5VA 3RXCA 1KLIH 1B7XB 1ELCA 3TLOA 1DLEA 1FDPA 1TBRH 2STAE 1GDUA 5A2MH 1ANBA 1QL9A 2F9VA 1SL3A 2XW9A 3NCLA 1BTZA 1TALA 1GI6A 4LXBH 2IPHA 3QWCH 1IQEA 5AFZH 5FBEA 1S83A 2VGCC 1FY4A 4X8UH 3Q76A 3HKJB 4O97A 3MMGA 1LKAA 1VCPA 1V2ST 4OS1A 2ZPQA 3DUXH 1ELVA 3PWCA 1O2NA 3M61U 3TJOA 2OUAA 3UFAA 2DE8A 1C5ZB 3Q00A 4WF8A 3U8OH 3ODDA 1GJAB 1EB1H 1BJUA 4B76A 2AIQA 1XUHA 1EPTA 2Z9GA 1K1PA 2ZFFH 5C5OA 1C5RA 1ZZZA 3A83A 2A1DB 2QY0B 1RGQA 1A3EH 1J14A 1KY9A 2Z9KA 1NU9A 4Y7BA 3U98H 4UDWH 1BRAA 5HM9A 2H6MA 4CR9A 3TK5A 3M37A 4YOGA 1GBJA 1HAIH 5AVDA 2GMTB 1G3EA 2I6QA 5LGOA 2G51A 1TB6H 1CT2E 1ESAA 3MTYA 4ZKSU 2NWNA 2IN2A 4TY7A 1W0ZU 3BEFB 1FY3A 1GBBA 1JIMA 1W7GH 2GCHF 3UIRA 4IS5A 1OKXA 1C1UH 1V2LT 4HGCA 1SGFG 1PYTD 3ATLA 3M5NA 4R8TB 5FAHA 1O3HA 1GI0A 3BTTE 2Z7FE 3NK8A 3MI4A 3VGCC 1IQMA 1SGEE 4FUBA 1AB9B 2SGDE 3HPTB 2YOLA 2FX4A 2JETC 1O2SA 3A88A 1YPJH 2BXTH 4K1SA 3M5OA 1IQKA 2GD4B 2AMQA 3PYHA 2BY7X 1AFQC 2ODYB 4ABEA 1DM4B 3MWIU 5K0HA 2XRCA 4UE7H 3E3TA 3VB4A 1AUTC 1HIAB 3UR9A 3MH5A 4ZROA 3SBKA 5TCCA 1C2EA 2VVCA 1KTTB 1QGFA 1RIWC 3TIUA 3RMOH 1A5IA 1VGCC 3MH7A 4KGAA 3A7VA 5E8EH 3OYPA 2C8YB 2C90B 2YNAA 4K5ZA 4K8YA 4KTUA 3SQEE 3VXEH 3TGKE 4I8LA 2GT7A 5FX6A 2BX4A 4FU8A 3MH4A 2ANMH 1P8VC 1O2XA 1C4V2 2FM2A 2VIDA 2P8OB 1TQ7B 1XUFA 4BTIB 1KIGH 2CGAA 2BDGA 2BVSH 3QUMP 3D49H 2ZI2H 2H5CA 1K22H 2QXGA 3SUGA 1KLTA 1LMWB 4OS2A 1QBNA 2UUKB 1TRNA 1TABE 1ELTA 4BNRA 3GY4A 2ZCKP 2PGQB 5PTPA 1SQOA 5AHGH 2QC2A 6CHAB 1N6YA 3RXKA 5IDKA 1TPAE 1NRQH 4AOQA 3NPSA 1S6FA 4NCYA 2J94A 4CH2B 2OTVA 2Z94A 1CGJE 1LPGB 3LOXA 1IHTH 3RXIA 2DUCA 8KME2 4OS6A 1P11E 3UR6A 2Q1JA 1XXFA 1LKBA 1B0EA 1H8IH 1C1WH 3LH1A 4CHAC 1C5XB 3QN7A 3T29A 1AE8H 3U69H 4UFEH 1MH0A 5DP6A 3P95A 2BD4A 2A2QH 2BLQA 1TPOA 5H4IB 2ALPA 1TIOA 1AQ7A 3E16B 3RXVA 2SNVA 1NTPA 2VU8E 4THNH 3SJIA 1DFPA 5BPEA 3RXFA 4CR5A 2ZDAH 1C5UA 1VZQH 4X0WU 3RP2A 3L3TA 3BTME 1C5OH 1YPGH 3P17H 4KKDA 4BXWA 1PQAA 1MU8B 4X8VH 3RXRA 1A2CH 1GMDG 4HTCH 2ZFSA 3NWUA 3RMLH 1YLDA 2ZC9H 3A8CA 3A82A 1NFYA 1OWEA 2EI7A 3SUDA 4ABFA 2FOCA 2Y7XA 3KF2A 1GHBF 1L4DA 1RFNA 1Y59T 2ZO3H 1CA8B 1FPHH 1DWEH 1ETSH 1HJ8A 3AW1A 3OX7U 4WXVA 1AO5A 3DD2H 1QR3E 3RU4E 1AUJA 2ZKSA 2GKVE 1K1NA 1VJAU 3GYLB 1IQGA 2XC0A 3A89A 3GICB 2BD3A 2FOBA 2GVFA 4VGCC 5GWZA 4YLUA 5C3NA 1ZHMA 1W11U 3EDXB 1EASA 1YBWA 1D3QB 1O3JA 4X1SU 2XCNA 3BTDE 4ZH8A 3SO3A 3GY5A 3BEUA 2Z9IA 1EB2A 2GT8A 2A5KA 4IMQA 5C1UA 1V2NT 4UFFH 1DS2E 1O2QA 3NZIA 1S0RA 5FHTA 1FMGA 1UTPA 5EQSA 1AVXA 4YZUA 1BHXB 2AGIX 2UUFB 5FCKA 4ZAEA 1THSH 3E6PH 2ZZUH 2XBWA 2D8WA 2WPJS 1GJ4H 1UCYK 3ZZ6A 2SNWA 3TK6A 2GZ9A 4K60A 1FAKH 3RC6A 2JH5D 2PHBA 2ZGBH 1UTQA 1WQVH 1CGIE 4NSYA 3DFJA 2Q6FA 3CP7A 1HLTH 1FN8A 3PTNA 3LT3A 1MKWK 1O2OA 2ILNA 1TRMA 5ESBA 5JBCS 3TK9A 2FODA 1TGTA 2VNTA 1UCYE 2AERH 1QA7A 2ZGHA 1F2SE 3BTFE 1B5GH 3ZV9A 1ZJKA 3VGCB 1SLXB 5JB9S 4XBCA 2ULLA 2TGTA 3SHCH 3ZVBA 4AZ2B 2JETB 1BRBE 1SFIA 1EZUC 1O2WA 4FUEA 1BIOA 1AU8A 3PV4A 1HAVB 4X6MA 1WQSA 1CT0E 4RKOB 4GHQA 1QB6A 2PGBB 3BTEE 4AFQA 3P92A 5FBIA 1DUAA 1YKTA 1MTVA 1XUJA 2A31A 2XC4A 1DLKB 1O30A 3EAJA 3RXUA 4X1RU 3MO9A 9LPRA 1RIWB 1ANCA 1DWDH 7ESTE 2BOKA 3SV9A 1VGCB 5DG6A 1GBEA 1G3DA 2ZF0H 5GCHG 1OS8A 4YT7H 1JOUB 1LPZB 2OBOA 1YC0A 3F6UH 1ANDA 4FU7A 1BRCE 1DT2A 1BTUA 1K1OA 4JYTA 4MDSA 3T28A 1O3IA 1DSTA 3I77A 4BANB 1BITA 3RXJA 1O2MA 8ESTE 2FS8A 4IW4E 1GJ9B 2FI5E 1NRPH 4MNWA 3A80A 4FUFA 3RUOA 3RU4T 4ABIA 3RXMA 3AW0A 1TQ0B 2PLXA 2O8WA 4OS5A 4NSVA 4HZHA 3BTGE 1QRWA 5C20A 1TNJA 1GMCF 2BDCA 1OX1A 2XC5A 2ZG0H 1AVWA 1J15A 2FS9A 2BD9A 2WPLS 2ZU1A 1BCUH 1FXYA 2G4UA 3OTJE 4A1XA 4E7RG 1LPKB 2HLCA 1A46H 2A32A 3FAOA 1NPMA 4Q80A 3LJOA 2AEIH 1O2GH 1GJ8B 1G32B 3G01A 1C1QA 2AMDA 1CBWB 2GMTC 2HNTE 3UY9A 1T4UH 4R0IA 4BAHB 5CHAC 4ZHAA 3RXPA 1FLEE 1W13U 1PYTC 2Y5GA 3GCNA 1C9TA 1KTSB 1WUNH 3BEIB 4B71A 2ZU2A 2ZFTA 5A8XA 1F0TA 4ISNA 4DGJA 1TX6A 1Y3VA 4CHAB 1GVZA 3TU7H 4FUCA 2FX6A 3AVZA 4XSKU 5E2OA 1RRKA 3URCA 4U01A 2J38A 1PPEE 3GY3A 3PO1B 1WU1A 1FPCH 1SQAA 3TPIZ 3ZV8A 3L6PA 1HRTH 1EJNA 7KMEH 1EATA 4FVDA 1LQEA 2ANYA 2Z6BD 1CT4E 2W7UA 5EPNA 3OY6U 1KXBA 8LPRA 2A7CA 2ZU5A 1F5LA 3W95A 1BTYA 2BQ6B 6GCHF 4E06H 2A5IA 1BOQA 1O2VA 2EC9H 1AKSA 3V13A 2GZ7A 2A5AA 4B2AA 3LGYA 1GCDA 2GTBA 3WY8A 4B1TA 5J4SA 2FP7B 1HAYB 4I8JA 3H7TA 3Q3YA 2BDBA 2A4RA 1GI1A 2FDAA 1VJ9U 3D62A 1AD8H 2CXVA 4Q7XA 2HPPH 1DSUA 3STJA 1U6QA 2BDIA 1T8NA 1HGTH 1Y8TA 4GLYA 3PTBA 5EXLA 2QF0A 2UWPA 2P95A 1G2MA 1V2MT 1P3EA 2VH0A 3D23A 3SUEA 4MNVA 2G8TA 4VGCB 4B2BA 1LHGH 5FPSA 2QXHA 3GY8A 4I8GA 3VFEA 3MNSA 4K3JA 1C5WB 1K9OE 2H1UA 3SV2H 3T2NA 2O8UA 3MU0A 1UVOA 5AFYH 2ZTXA 3ZVAA 1GBFA 4GHTA 4E7NA 5HYOA 3LJJA 3OU0A 3LONA 1LVMA 3SJKA 2ZCHP 3ZZ4A 2PUXB 5K7RA 2BZAA 3ZVEA 1DVAH 2CJIA 5EU8A 2AFQB 1CE5A 2BVRH 3ZZ8A 1BZXE 2NU2E 2BLWA 1C2KA 2WPKS 4MLFB 2ZQ1A 1LHCH 2O8TA 3TNTA 5C1XA 2A45B 1V6DA 1DXWA 3PB1E 3S9CA 2P16A 4GCHF 2XYAA 2Y81A 1GBTA 3VB7A 3UNSA 1WV7H 1O2YA 2RG3A 2JKHA 1TBQH 1GHVH 2FXRA 1T31A 4DOQA 1FAXA 2ZWLH 1EPTC 1OPHB 1LTOA 1TPPA 1O5CB 1NRNH 1UK4A 2LNCA 1MKXH 1AWFH 1HCGA 1ZGIA 1P2MA 2PW8H 3SU0A 1QQUA 1DANH 1C1SA 2FI4E 2P93A 5F8XA 1TNGA 1A0LA 1TMUH 1P2KA 3ZZCA 4SGBE 3GCOA 1IQNA 4INKA 4UFGH 2C93B 1XX9A 1WYKA 3MO3A 3F9GA 1EP6A 1SMFE 1F0RA 1ORFA 3UQOA 3GCTF 2WV4A 4OGXA 1JIRA 1GGDB 1GDQA 1GBMA 2ZNKH 1C1TA 1NROH 4DCDA 3EYDA