2BD2A

Porcine pancreatic elastase complexed with beta-casomorphin-7 and arg-phe at ph 5.0
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-casomorphin-7
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
molecule tags Hydrolase
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd2A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd2A01
3QZQA 3HPTB 5TJXA 6GCHF 1FAKH 2H5DA 5L2ZH 3AAVA 1HJ9A 2BDAA 3SHAH 2A5KA 7ESTE 1EAXA 1KLIH 1PYTD 1UTPA 4NWLA 1GBLA 1NM6A 2FOAA 2BLWA 3ZZ7A 1DANH 3QX5H 3SV9A 4WMFA 2CJIA 3SHCH 1Y5AT 1SGPE 2G5VA 4ISHH 1GBHA 3GOVB 3KGPA 3E1XB 4FU7A 1C1NA 2HOBA 4JZIA 1XKAC 1ACBE 4NIWA 1ZRKA 2Y5FA 3PB1E 1GMHF 2J92A 2Z9LA 5ESTE 1ANBA 3RU4D 4WY3A 1G3BA 3BG4B 1OX1A 1HAOH 3VB4A 3PO1B 2FI3E 3D23A 1TBRH 3EA8A 2HPQH 2ZU1A 1RIWB 1GVKB 1K1JA 3M3TA 1RTFB 1DM4B 2FODA 4X8TH 1P2NA 1K1NA 1PFXC 1EP5A 1DWEH 1P9SA 2UUJB 2XBWA 4I8LA 1FAXA 2TGTA 3B9FH 1CVWH 3KNXA 3F9FA 1PQ8A 4GCHF 1CGHA 4YESB 4D9QA 3N7OA 1DLEA 6CHAB 3SQHE 4ABJA 3B8JA 1OKXA 1HGTH 3K9XB 1EP6A 1B0FA 3LH1A 4AB9A 1AUJA 3RXJA 1YBWA 3M3VA 3BG4C 3TIUA 3PO1C 1GL0E 2FXRA 3UPEA 1Y3XA 1EZSC 3ATKA 1O2HA 3TLOA 5CMXH 4ZKSU 3AASA 5T6GA 1RIWC 2VWOA 3LGVA 1O3HA 5DG6A 5ABWA 2XWAA 2BDGA 3HK6B 1HIAB 3TGKE 2FTLE 2WV4A 3LGUA 1YF4A 1SQTA 3PMHB 3STIA 1GBMA 1S81A 4CBOA 1TB6H 2Y6TA 2ZGXH 5L6NH 2BVSH 3V13A 1MMJN 5GWZA 2QXGA 4BAHB 6CHAC 3RXPA 2TGPZ 3RM2H 5A0AE 2GZ8A 2BD5A 4B75A 1O2OA 1Y3WA 1O2TA 1K21H 3GCOA 4NSVA 3DD2H 2OBOA 1HAXB 5ESBA 8ESTE 3E0PB 5DP5A 1QA7A 3BTQE 2IOTA 3TITA 1A4WH 1YCPH 1O2PA 4ZUHA 4NSYA 3SJ8A 1C2EA 5HXFA 3ZZ9A 1QNJA 2VIPA 1O2IA 2Q6GA 3UR9A 2HNTF 3UQVA 1FIZA 2C93B 2FOMB 3IWMA 1S0QA 2XYAA 2PGBB 2OINA 4INLA 1AFQB 4Y79A 2QIQA 1GBCA 1QJ1B 3ZV9A 2NU0E 3ENSB 1BITA 2GGVB 1O3BA 3CS0A 3SI4H 3DHKH 4JYTA 1L4ZA 8KME2 2BY8X 1O3CA 2ZCHP 1O5GH 2OLGA 3S7KB 1EZUC 2F3CE 1ZTKA 1NU7B 4WH8A 5FBIA 5A8YA 1ELCA 5C1UA 4FUJA 2TGAA 2AERH 2O8WA 5FCRA 1YGCH 2Y81A 1P2KA 1O3MA 1WAYB 1QBOA 3NZIA 1RD3B 4CRBA 3BTEE 2A7JA 1QBVH 1ZPCA 1YC0A 2A2QH 2A7CA 2ZIQH 3KIDU 1WV7H 2Z9JA 1UTKA 1AFQC 3A8CA 2XC0A 2DE8A 5EW2H 1EPTB 4ABHA 8GCHG 3A80A 2GCTB 1GCDA 1TOMH 1BT7A 1H9LB 3RXBA 3VB7A 1C5SA 1NESE 1UTQA 1PYTC 2B8OH 1UHBA 5DP9A 3LH3A 3F9GA 1O5AB 1P0SH 5L2YH 1EAWA 1UTOA 2GZ9A 3RXFA 4AGJA 1GJ6A 1FMGA 1S84A 3E90B 1CHOF 1UK2A 1LPGB 2C90B 2C3SA 5DP4A 2F9BH 1A5GH 2Z6BD 3MH5A 4FUFA 3UQOA 1PPEE 3GY6A 4A1VA 2QAAA 1LQEA 3M5MA 1T32A 1G36A 4IN2A 2UUFB 2BVRH 3LPRA 2STBE 4U01A 3OX7U 5IYTA 2CXVA 1OWHA 4E06H 2ZHQH 1O2GH 2ZG0H 1BRBE 3A7WA 2F9PA 1YPGH 1L1GA 4Y0YE 2GX4A 1C2GA 1CBWB 1EPTC 1Y5UT 3ZYDA 2GCTC 5GDSH 3RMMH 2AYWA 2F9NA 2FOCA 1TQ0B 2GKVE 2H9HA 2PR3A 2A32A 5DGJA 5HM9A 1GBTA 5DKMA 1GGDB 1MZDA 1WU1A 1RFNA 1ANEA 3LGWA 4U2WA 1TGNA 4CRCA 2ZFPH 1C1WH 5DP7A 1SLVB 4JYVH 2FOFA 1T31A 3UNRA 2FYRA 3RLYH 1TX6A 2ZPQA 4IS5A 1KXFA 4I32A 1QURH 4X6MA 3BEUA 3MYWA 5GIBA 1ZSKA 2DUCA 1L1NA 2A4OA 2THFB 4D7FA 2BZAA 4VGCB 2ZCLP 4K60A 1Z71A 2Z9GA 2G52A 1PPZA 1CBWC 2ZPSA 4ASHA 4OS1A 4K2YA 2D26C 4MNWA 2ZGCA 3GY8A 1GHAG 3TJUA 1SQAA 2VWMA 4YM9A 1GGDC 1EUFA 3QDZB 4K1EA 4X6OA 4JMYA 3A87A 4ABIA 2J4IA 4CH2B 2M5TA 1FONA 4NCYA 2F83A 1O34A 1P3EA 1AHTH 2EC9H 3U69H 3SU6A 3STJA 1HJAB 4X8UH 1EPTA 2JH0D 1GBJA 4K5ZA 1DFPA 2VIDA 3U8OH 4HFPB 2TGDA 1QRXA 1PPHE 4CRAA 1YKTA 4VGCC 2P93A 5B6OA 3UIRA 5F6MA 1S82A 3V7TA 4ABDA 2QGRA 5EXMA 5AHGH 3URCA 5C67A 3OYPA 4X1NU 1W0ZU 1C9TA 1EAIA 1SLUB 1VCPA 4KP0A 4Y10E 4ABFA 1QA0A 1FV9A 3MO6A 3LC3A 1FNIA 3SV2H 1NY22 3KN2A 1C4U2 1EB1H 1A46H 2ZTXA 1P2OA 4I8JA 1BCUH 1LMWB 3GCTG 3MO9A 3A85A 4ZHMU 1HJAC 1FY8E 1MTUA 1C5UA 1P2IA 4K8BA 1EASA 1EQ9A 1JMOH 6GCHG 4UFFH 4ISNA 1W13U 1O2WA 1NRSH 2BX3A 3RXRA 3C27B 1UTJA 1O2KA 1HAZB 2H2ZA 1BIOA 2KAIB 3A7TA 5GPIB 1CA8B 5E0HA 2SFAA 3BIVH 4X1PU 3SZNA 3ZVAA 1LVMA 2ANYA 4GPGA 1O37A 4MPWA 4NZLA 1O32A 4BTUB 1DXWA 1N6XA 1D6RA 2R2MB 1GJ4H 1KXCA 1SGIB 5HM2A 2XNIA 3RXEA 2HNTC 5A8ZA 3SQEE 4GHQA 4XBCA 4YOIA 2QCYA 6LPRA 1YPMH 5JPMH 1P9UA 1GWAA 1SOTA 1T8MA 2SGEE 1C5MD 2ODPA 1SGNE 2CV3A 2BYAX 3UNSA 1TABE 3GISB 1ZSLA 3FVFB 4INKA 4KTCA 1DWDH 4IW4E 5F8TA 1PJPA 1G3CA 1LVOA 3EA7A 2BZ6H 3TH3H 1QJ7B 1O5EH 1V2TT 2XTTB 2V3OH 1E36B 5A2MH 1NRQH 1NRNH 1KTSB 2TBSA 1HAIH 2TRMA 4IMZA 7KMEH 4DURA 1GMDG 3RXMA 2BOKA 4YOJA 5LPFA 4FXGH 3S69A 1ZRBA 3WY8A 2XC5A 1TMUH 1Y3YA 1T8NA 4AGKA 1GJ8B 2VVCA 4Y7BA 3SI3H 1ELEE 1LCYA 1O2ZA 1ZPZA 8GCHF 3MU8A 4DIHH 1PPGE 2BDYA 4IC6A 3RU4T 3SNEA 4E05H 2VWNA 1A2CH 3HK3B 1UMAH 2XW9A 3BV9B 1P8VC 4LZ1H 5FAHA 3T2NA 3VB3A 1AD8H 3EDXB 1GI1A 2ZGJA 3T28A 2CHAB 5L30H 5DP6A 4MQAA 4FUDA 1F0RA 1SGFA 1UCYE 2G4TA 2PW8H 5DJ7A 4FUGA 3JZ2B 4F4OC 3PMAB 1S83A 1K22H 5C20A 1E37B 4A7IB 3RUOA 3Q77A 1HXFH 2EA3A 1XVOA 2ZA5A 3A7XA 4LK4A 2KAIA 5C1YA 1WSSH 3PTNA 2ZQ2A 3MH7A 1O2XA 1O3AA 2BD3A 4WXVA 4SGBE 1FZZA 1EZXC 1IQJA 3RXVA 3V3MA 2A7HA 1G3EA 1LQDB 5T6FA 2TIOA 3GYMA 1OWDA 3PLBA 1BBRK 1CT0E 2FOBA 4DCDA 3P70B 4A6LA 1QBNA 2FWWA 3MH6A 1MTSA 1K1MA 2CHAC 2ZWLH 1NRPH 1GG6B 4ISIH 3T5FH 1TAWA 2I6QA 3SU4A 1SB1H 4UFDH 1GI4A 1T8LA 2R0LA 2GZ7A 1GL1A 1NFXA 4AG1A 1PPCE 2PKSB 1XUKA 1A3BH 1VZQH 5A0BA 2G4UA 1JOUB 2UUKB 1C2DA 1GHAF 3ATIA 2PUQH 1NO9H 1XUFA 1ZJDA 1KYNA 2FS9A 4BAMB 2ZHEH 2P3TB 3SNDA 2FPZA 4X1QU 2GCHG 1OXGA 2FZZA 1CT4E 3E8LA 1GG6C 1UCYK 2RDLA 1DICA 1NROH 3FP7E 3M35A 1O5DH 3SNAA 2GT8A 4O3TA 1AVWA 3KQBA 1TALA 1GI9B 1L2EA 2PWXA 1UTMA 3MI4A 3OU0A 1S85A 3L6PA 4B2AA 2PKSC 2NWNA 5EQQA 2A45B 1IOEA 2Q6FA 3DT0H 4BXWA 1SGTA 3ODDA 1C4Y2 4AORA 1P03A 1NFYA 1G30B 1FUJA 1DE7H 4FUCA 3A7YA 1K1LA 3OSYA 1GI3A 2B5TB 4NFFA 3NKKA 1ETSH 1FY4A 1AVXA 4JK6A 1CGIE 1O35A 1HLTH 1MTVA 3P8NA 3U8TH 5JBAS 2GV7A 5E0GA 3SNCA 1DWCH 4I33A 3RXCA 3GCTF 4UONA 2B9LA 5JBCS 1WCZA 2UWLA 4AOQA 4ZKOU 4YOGA 1P57B 1AB9B 1P01A 1IQMA 1Z1JA 1RGQA 2XBYA 1TNKA 1O3EA 2WUBA 2Z7FE 3KQEA 4Y11E 5F8XA 1AVGH 1MKWK 2ZF0H 2VJ1A 4HTCH 1THPB 1YYY1 1OSSA 5DP3A 3MTYA 4DW2U 3UR6A 1QRWA 2H5CA 2BXTH 4UFGH 5PTPA 1U6QA 1JIRA 2Q6DA 4R0IA 3E0NB 2O8LA 3FFGA 2SGFE 5FPSA 3RP2A 5IDKA 3S9BA 1JWTA 1SQOA 1FY5A 1GI8B 3PM3A 2P94A 4ISLA 1D3PB 3BTTE 1F92A 2VH6A 5C5OA 1LVYA 1VR1H 4AYVB 3VFEA 1FY1A 1UVOA 1LKBA 1AB9C 1NT1A 1JIMA 3V0XA 2ZFQH 4D76A 1H9IE 1UVPA 1S6HA 4JZFH 2OP9A 3SNBA 5C1XA 2QN5T 1A5IA 1BZXE 3GCNA 1DY9A 5FPTA 1TYNA 1C2MA 4ZKRU 4H42U 4MTBA 2J95A 5HGGA 1O3NA 4E7NA 4TPIZ 5AFYH 3S7HB 3LT3A 4JZEH 1TMTH 1J16A 3SJOA 1DT2A 2A0QB 4D7GA 2ASUB 3LJOA 1CHGA 2BD7A 5JDUB 1O3OA 1NU9A 1C1TA 1GMDF 3ODFA 3EE0B 4NIYA 3BTME 2VVUA 3A81A 1Z6EA 1Z8RA 1G37A 1OS8A 4X8VH 1TLDA 5K7RA 3QLPH 1G32B 1GBDA 2PHBA 3GY5A 3TVJB 5JB8S 1FXYA 2H1UA 1PQ5A 4K69A 1AWHB 1V2RT 2GP9B 3FZZA 1OYQA 1A0HB 1ANCA 1SSXA 3PWBA 3RMOH 1HAPH 1BHXF 1HYLA 1C5ZB 4NIVA 4XOJA 3SN8A 1F5KU 2ZDKA 1IQNA 2RA3A 1UHBB 1A61H 3GYLB 3GY3A 2VWLA 4XDEA 4AFSA 5FX6A 5LGOA 2O8TA 3I78A 1RTKA 1T7CA 3A88A 1GDNA 4YZUA 3KQCA 4WXIA 4XBBA 1LPZB 4I31A 2JKHA 4ABBA 1KXBA 1HUTH 1IAUA 1Q3XA 1QTFA 2FLBH 1ELTA 2QC2A 2Y82A 2BM2A 2ZEBA 4BAOB 1GI5A 4JCNA 5JBBS 3K65B 1DXPA 3HGPA 3M7UA 2SNWA 2F9UA 4Y76A 1MCVA 2AGIX 4ZAEA 1C5YB 2CF8H 2BY5X 2ZTYA 1C1MA 3A89A 1EAUA 1YP9A 4KGAA 1H9HE 1QFKH 4YO9A 4IMQA 4MPXA 1BUIA 1XXFA 1XXDA 1ID5H 3NXPA 2HALA 1CE5A 4FU8A 3LKWA 1EZQA 2PGQB 2OBQA 3ELAH 1C2IA 2ZGBH 1MU8B 4GLYA 3ZVCA 1XMNB 2P95A 3SU1A 1EJMA 1C1PA 3M5OA 3O8BA 1TPOA 1Z8GA 3F1SB 3LGIA 4X1SU 2V0BA 2BY6X 5AVDA 1ABIH 3FP6E 3SV6A 5A0CA 4X1RU 3QUMP 2GCHF 4KKDA 4RKJB 3EGKH 1QL7A 2XBVA 3ESTA 5JBTA 1HXEH 2FLRH 3MU0A 1TBZH 4WH6A 1V2PT 4ABAA 2SNVA 1YPKH 3QGJA 2ZGHA 1Q2WA 3KL6A 2BVXH 3LGYA 4Q80A 1EOLA 1TGTA 3ZVDA 2R3UA 1PQAA 3LONA 1HPGA 2ZDVH 3TPIZ 1JRSA 4X2WA 4ESTE 1CA0B 2B0FA 2WPLS 4DG4A 1O2NA 1FPCH 1YLCA 1B0EA 3ZZ3A 3OTJE 1ZTLA 1PPBH 2CGAA 3L33A 2FESH 1TNHA 1E34B 1LHCH 1K1OA 3E16B 2BDCA 3SU2A 1W2KH 4O97A 3UREA 1E38B 3BN9A 1AGJA 3PTBA 3SV8A 5K0HA 2P16A 2ZFSA 3UWIA 4KTUA 3SOSA 4A1TA 4CRFA 4MVNA 1MH0A 1V6DA 1T4UH 1O39A 3M7TA 1UK3A 1BTZA 1YPEH 3KQDA 1HFDA 1ARCA 3EAJA 5HYOA 1MTWA 1QY6A 1BTUA 2ODYB 1OWEA 4U30A 8LPRA 4NZQA 3BTHE 4ISOA 1OP0A 1ZTJA 5T6DA 1DLKB 3ZYEA 3MH4A 1CA0C 4Y8YA 3T62A 2ZU3A 3P92A 4Y71A 1YCPK 1HRTH 2SGQE 4HI3A 3IITA 5HMAA 4AYYB 4Z6AH 3BG8A 1NRRH 2OCVB 1MQ6A 4QT8C 1ESBA 1NN6A 4SGAE 3A86A 1EJAA 4H6SB 3K2UA 3SJ9A 1T8OA 3MO3A 2Z9IA 1S0RA 4NIXA 1N6YA 2LNCA 2Z9KA 1HAVB 2D1JA 1D3TB 3S9AA 5EXNA 4FUIA 2ZFTA 3QWCH 4IC5A 2VNTA 1P04A 3M36A 2BQ7B 5EQSA 2XC4A 2ZDMA 2OC1A 1ZGVA 1O3KA 1LHEH 1SGCA 2VINA 2EI7A 4LXBH 3SU0A 3M37A 2QXIA 2BY9X 1BHXB 2WINI 4WWYA 2AGEX 5TCCA 1O3GA 3NUMA 4I8HA 1MAYA 1MU6B 3H7TA 2BQ6B 1IQHA 4CR5A 4FU9A 4B1TA 2VB0A 2CF9H 3IG6B 2QY0B 1V2JT 1V2VT 5E2OA 4BNRA 1UO6A 4FVDA 3RC5A 5TCAA 3M5NA 1D3QB 4BXSA 1WQSA 1XKBC 5EPNA 5F03A 2G00A 1K28D 4U32A 1L4DA 1LVBA 2FP7B 2PSXA 3FZDA 1EX3A 4BTIB 1ZR0A 1K1PA 3HKJB 2BX4A 1BQYA 1ELBA 1GI0A 2ANKH 4DT7B 1E0FD 1RJXB 2V3HH 3A7VA 2GD4B 4DVAU 1BTWA 1C5QA 4ZHLU 2VH0A 3SUFA 1P10A 5FBEA 1G3DA 4YTAA 2IPHA 3TK9A 1UTLM 2NU4E 3PLKA 1N8OB 1SGRE 1IQLA 1MKXK 4BTTB 2P3FH 1SPJA 1UJ1A 4YLUA 3RM0H 3SGAE 3TNSA 1KXEA 9LPRA 3SV7A 5AF9H 2GTBA 2Y7XA 1J17T 2VU8E 2P59A 4ZROA 3TH4H 3ATWA 3R3GB 1WYKA 1AWFH 1HAVA 2WYJA 1D6WA 2EI6A 2F9VA 5GXPA 2GT7A 3MU4A 2XCNA 3M61U 1VCWA 1OOKB 1Z6JH 2HPPH 2QF0A 4NA8A 3BTDE 1S5SA 1TBQH 1C2JA 1QJ6B 1BBRH 5FXLA 2P8OB 2FO9A 6ESTA 1N8OC 4THNH 3OY5U 2ZDLA 2W5EA 3TK5A 4CH8B 7GCHG 2UWOA 1BRUP 2ZO3H 4UFEH 1EOJA 2BMGB 2Q1JA 2O9QA 4CHAB 1H4WA 3BSQA 4WF8A 1GMCF 4YT7H 1HNEE 3UOUA 1O0DH 2YNAA 1VITH 3ZZAA 1MTNB 3CP7A 1DSTA 1BMNH 1O2RA 2FEQH 5LPEA 3RXSA 2ZCKP 2ZTZA 3QZRA 1DX5M 1MBMA 4XFQA 1C9PA 3A7ZA 3BEFB 5EU8A 3F9HA 3NCLA 2P8OC 4OS6A 3W94A 4NA9H 5AFZH 2PLXA 2D2DA 2BY7X 2B7DH 1IHTH 3LDXH 5CHAB 1QCPA 1UCYH 2O8UA 4Q7ZA 3OY6U 3RXAA 1JBUH 2ZPRA 1HV7A 2GDDA 1YCPM 1LDTT 3UUZA 5BRRE 3Q3YA 1EKBB 5ETXA 4CHAC 3SORA 1YPHC 4TY7A 2PTNA 1O2UA 4MLFB 2A5IA 1SLWB 2A2XH 4PROA 3TK6A 2OTVA 3QK1A 4KTSA 2HNTE 1GJ5H 1EATA 1C5PA 1MTNC 2W7UA 1E35B 1TA6A 2XBXA 2HGTH 1TWXB 3ZVFA 1OYTH 4MPVA 1ZGIA 2AMPA 1RS0A 3MNXA 3I29A 2G55A 5A09A 3LIWA 4ZXXH 1VITG 1O3JA 1MAXA 3DFLA 2DE9A 3ZZBA 3GICB 3F68H 1YM0A 5CHAC 1AFEH 5I25A 3URDA 3NPSA 4E7RG 5EOKA 4TPYA 1HAYB 3SUDA 4AX9H 1F2SE 1V2UT 3KCGH 1P2MA 2OQUA 4WMEA 1GBEA 2FS8A 1SGFG 2PKAB 4TWWA 1ELGA 1MKWH 1AKSA 1CQQA 3FANA 4K1TA 1TX7A 3LGTA 1V2MT 1YLDA 3GDVA 1CT2E 1HAGE 1SGDE 1UTNA 3PMBB 5JYIA 1QB9A 2FX6A 2H6MA 4B71A 1H8DH 2ALPA 3VXEH 2GDEH 1K2I1 2STAE 3ZZ5A 1P11E 4CR9A 1Y3VA 5E0JA 1LHDH 4B2BA 1NFWA 2FMJA 4JZDH 1QB1A 1ORFA 2BTCE 1IQFA 3RC4A 2A4GA 1ZMJA 2W7SA 3VB5A 3ZVBA 3EA9A 1OWKA 1P3CA 1L1JA 1ZMNA 3ZV8A 3S9CA 2VIVA 3QGNB 3B23B 1NC6A 3PV4A 1OPHB 1XX9A 4B76A 1F0UA 1AN1E 1G2LA 1A7SA 3A8BA 1W12U 5DK1A 1IHSH 3AVZA 1O2LA 1F7ZA 1ZZZA 2AEIH 3FAOA 2R3YA 3L3TA 4AN7A 1B5GH 1V2ST 4ZXYH 5LH8A 1DITH 2PV9B 3O8RA 2G51A 1A0LA 3I77A 3M7QA 3W95A 4DIIH 3O8DA 1NS3A 1O3PB 2BD2A 3KF2A 1GJCB 3MU1A 1Z1IA 3RXGA 1FJSA 1C5NH 2BB4A 4YLQH 4NA7A 1NZQH 1GBIA 2IN2A 4HZHA 4O3UA 1GHWH 5BPEA 3K6YA 1C1OA 2FYQA 1CO7E 3ATLA 3UFAA 4H4FA 1ZYOA 1KDQA 1LTOA 4ZHAA 3KHVA 4TYDA 1YPLH 1DUAA 1SI5H 1UVSH 4I8GA 1SL3A 2A5AA 4B2CA 3SJIA 1O2VA 1TX8A 2PKAA 3A8AA 1GHZA 5A8XA 1OP2A 3HGNA 1DDJA 2HLCA 1C5VA 1AE5A 1XUIA 1GJAB 3AW0A 4JYUH 3DA9B 4O9VA 2R9PA 1P09A 2EI8A 4K3JA 1D3DB 4X2VA 1KLJH 2ESTE 3P8GA 1ANDA 1FN8A 2BLQA 1EJNA 1ELDE 2SGDE 1ELVA 3UY9A 2CN0H 1C1RA 1TPSA 5EODA 1AQ7A 4MDSA 1FN6A 7GCHF 1MD8A 2BQWB 2FI4E 1TRYA 1BDAA 1ABJH 2BDIA 2AGGX 2ZFFH 2AIPA 4CRDA 1H1BA 1VCQA 2RCEA 3PROA 4I7YH 2OQ5A 1TRMA 4H6TA 3SU3A 5C2ZA 1V3XA 3RC6A 4MPUA 2FTMA 1FI8A 2HRVA 1BOQA 2BDHA 3F9EA 1AU8A 5T3HA 1C1UH 2BLVA 4GUXA 4BOHA 3KEEA 1AZ8A 4UEHH 4CREA 2WPJS 1C5RA 3GY4A 2Y5HA 3ZZDA 3RXKA 1BTHH 4WMDA 4JZ1A 3ITIA 2GVFA 3FP8E 3NWUA 1K1IA 1QRZA 1BMLA 2G8TA 4A92A 5DPAA 2JH6D 1V2QT 4Y6DA 3SO3A 5FCKA 1O3IA 1SOZA 2QV1A 1VJAU 3MWIU 2H9EH 2QF3A 3PMJA 1X7AC 4ZMAH 1SLXB 5F8ZA 1XM1A 3HKIB 1HCGA 3K6ZA 1SFQB 2Y80A 2HWLB 1A1RA 4AFUA 1V2LT 4YT6H 2AFQB 4KELA 1D4PB 2VIWA 2J9NA 5G4BA 3A8DA 1KY9A 3RXUA 1DWBH 1SHHB 1DSUA 4X6NA 3T26A 2GMTB 4XSKU 1LO6A 1VITF 5EPYA 1W10U 3TGJE 2O8MA 1KLTA 4MNVA 4B73A 2BLOA 4OS7A 3BIUH 3BTFE 2W3KA 4GSOA 4DY7B 1GI6A 1G9IE 1TONA 3RXHA 1QB6A 4Z0KA 1K9OE 1MQ5A 4OS4A 3AW1A 3SJKA 1C5TA 3VB6A 4TWYA 4AFZA 1Y5BT 1GI7B 1GHYH 3D62A 5H4IB 1KIGH 2A4RA 2WUCA 3RLWH 2OC0A 2XRCA 3T29A 2V35A 1LKAA 1UK4A 1C2FA 2GMTC 2GV6A 3MNSA 1SVPA 1TOCB 4OS2A 4A5TS 4HGCA 1QL8A 2WPIS 1WTHD 1GVZA 3E6PH 3ZZ8A 2ANMH 2F9OA 1GMCG 1P2JA 4OS5A 4JK5A 4CBNA 2OC7A 1FIWA 2W3IA 4XE4A 1O3LA 2I6SA 4B74A 3E3TA 1O2SA 3RXDA 5FX5A 1XUJA 3ATMA 4BAKB 1AE8H 5EQRA 3BTKE 2IJOB 4GHTA 1WOFA 2AS9A 5I46H 3Q76A 1C4V2 1LHFH 2A31A 2PTCE 1C5OH 1TNIA 1EB2A 2ZU2A 5EW1H 3LOXA 1GVLA 2A4QA 2ANWA 1ZLRA 3MNCA 4WJG2 1GBFA 3U9AH 3SU5A 1CGJE 1PQ7A 1ARBA 1FDPA 1ZOMA 4J1YA 3RXIA 4LZ4B 3MU5A 2ZNKH 1HIAA 5E2PA 1O36A 1LHGH 4NWKA 3U8RH 3DUXH 1AUTC 1FLEE 1LPKB 1H8IH 1GDUA 1BTPA 1GHBG 2PSYA 4XBDA 1IQGA 1THSH 4BANB 1HJ8A 2BOHB 1P2QA 3TGIE 1TMBH 1TQ7B 2G5NA 3A82A 1O30A 3Q3KA 2WV5A 2UUYA 4AZ2B 1GHXH 5GCHF 3GDUA 5CE1A 3ZZ6A 4ZH8A 4NFEA 2WPKS 4IGDA 4F49A 1MD7A 1TA2A 3TNTA 3BTWE 1TIOA 3P8FA 3RMNH 1TRNA 1B7XB 3MMGA 1GJDB 1RTLA 1TNLA 4FUBA 4MNXA 1DOJA 5EXLA 1SMFE 1MKXH 1T4VH 3HATH 3PYHA 3U1JB 1AO5A 1BMMH 2J38A 4BAQB 3RXQA 3MFJA 1ZHPA 1ESAA 2Z3DA 1C2HA 3GDSA 1AZZA 1ZSJA 2P3UB 4ABEA 2ODQA 2C8ZB 3RXTA 2R2WU 4ZKNU 1OWIA 1BA8B 2C8YB 5DP8A 1SGQE 2SGAA 2ZC9H 3JZ1B 4DOQA 2C4FH 3T27A 1SHYA 1P06A 3BEIB 1G2MA 1HAHH 1GJBB 3LU9B 4X0WU 1WTGH 2ULLA 1ZPBA 2BD9A 3NK8A 1RRKA 3LJJA 1C5WB 3UTUH 3M3SA 4UDWH 3RU4E 1THRH 1IQIA 1UVTH 1F5RA 1F5LA 3QN7A 1CU1A 1W0YH 2RG3A 2XXLA 1ELAA 2AMQA 1W3CA 4Q7YA 2AIQA 4D8NA 3CENA 2EEKA 1JRTA 2J34A 1Z7KA 1TNGA 1N1LA 1BB0B 5C5NA 3EYDA 1P12E 3VXFH 2D8WA 3D65E 2NU3E 2BXUH 2LPRA 2V6NA 2K1QA 2ZDNA 2YNBA 7LPRA 1DPOA 2OD3B 5FHTA 2BDBA 1O5BB 2VGCB 3MNBA 4K1SA 4K8YA 4I8KA 1W7GH 2F91A 1O38A 1ELFA 2ZU5A 1SFIA 1O2YA 4RN6A 2J94A 2BD4A 1W8BH 4Y8XA 1KTTB 4X6PA 3S0NA 1F0TA 3D49H 2ILNA 2VIQA 3TU7H 3P95A 1J14A 4FUEA 1NPMA 2FDAA 4INHA 1CSOE 1SG8B 3SUGA 1ZJKA 3TH2H 1TPAE 3QO6A 4UD9H 4X2YA 5JB9S 2J2UA 1O33A 3M5LA 1DS2E 5GJ4B 1C5XB 1BMAA 2AMDA 1MZAA 3GY7A 1GCTB 1C5LH 1C2KA 4WVPE 1AKSB 4R8TB 3ZZCA 2NU1E 1J9CH 4DJZB 2VGCC 3GCHB 4TY6A 1FPHH 1BTXA 3CS7A 2OC8A 3A84A 2HVXA 1BTYA 2QXJA 4FUHA 2FOHA 1C1SA 5LPRA 2VVVA 1GMHG 2Y5GA 1C1QA 1O5CB 2OXSA 2PUXB 1KSNA 1GJ7B 1IQEA 2G81E 3VGCB 2CMYA 1VGCB 3F6UH 1Y3UA 1BBRE 1WUNH 1QL9A 2WPHS 4M7GA 1MBQA 1ZHRA 4J2YB 1Y8TA 2C8WB 1GCTC 2QA9E 3QTVH 3TJOA 2WYGA 1SGYE 2C8XB 3G01A 4LOYH 3GCHC 1A5HA 3BTGE 4GCHG 1QQUA 2SGPE 3QTOH 5E8EH 1SGEE 4RKOB 2VIOA 3A83A 3GY2A 1UVUH 1C1VH 1TGCA 4AG2A 2Z94A 1V2KT 1KXAA 1QIXB 1ETTH 3V12A 1AIXH 3VGCC 3Q3XA 1VGCC 3O8CA 2FIRH 5C3NA 4DGJA 3SUEA 1QR3E 1HB0B 1HDTH 2ZKSA 4GAWA 1ESTA 5J4QA 4A1XA 1O3FA 1XUHA 3E91A 4AFQA 3VEQB 3SBKA 4Q2KA 1GHBF 1GBKA 2ZHFH 3MHWU 1GBBA 1TPPA 2Z3CA 5SGAE 1SR5C 4RSPA 3RXOA 3AAUA 2ZECA 4NGAH 1FQ3A 4Y0ZE 9ESTA 3UWJH 1KDQB 1MCTA 2ZI2H 2BD8A 3C1KA 3PLPA 4Q7XA 2YOLA 3P8OA 1GI2A 2NU2E 1Z8IB 1W14U 4AB8A 2H9TH 1J8AA 2FX4A 1Y59T 3VPKA 4CRGA 1O2QA 3H7OA 1F0SA 1JXPA 3RXLA 1XVMA 1P02A 1AI8H 2Z3EA 1BRAA 3ZVEA 4O03A 1TGBA 3DFJA 1PPFE 1WBGB 1QQ4A 1TGSZ 1GHVH 1J15A 1DY8A 2AH4X 1OP8A 3LC5A 3UNQA 1NTPA 1Q31A 1V2NT 1L0ZA 2TPIZ 2Y7ZA 3P6ZB 2ZHDA 3U1IB 1QGFA 1DVAH 3MOCA 2W26A 4GVUA 2A1DB 1INCA 3EQ0H 1GDQA 2XCFA 1O3DA 3Q00A 2WPMS 4MNYA 4X8SH 1O2MA 2FM2A 3ZVGA 1SBWA 1YPHE 1GJ9B 3SW2B 1S6FA 3UOPA 4MG3A 2ZFRH 4OGXA 2JETB 4IN1A 2R0KA 3TJNA 1QHRB 1GPZA 1BJVA 4Y8ZA 2ZP0H 5EGMA 2FI5E 3SGBE 3U98H 1V2OT 2XWBI 2ZQ1A 2QXHA 5EG4A 3ZZ4A 1EXFA 1W11U 2ZHWH 1XUGA 3TJVA 1A3EH 1BJUA 1NFUA 2ALVA 1RXPA 2ZDAH 4ABGA 1VJ9U 2FOGA 2ZZUH 2ZU4A 3H5CB 1C2LA 1O2JA 1SC8U 1O5FH 3PWCA 3SGQE 5J4SA 1ZHMA 4NG9H 1Z8JB 1GBAA 2UWPA 1AY6H 4FVBA 4X2XA 5FPYA 3T25A 1IQKA 1O31A 1YPJH 3P17H 1AMHA 4D9RA 4Y7AA 1DUEA 1P05A 3RDZA 2JETC 1TNJA 4UE7H 1V2WT 1CHOG 2PFEA 1A0JA 3R0FA 5DO4H 2FOEA 1OWJA 1BRCE 1M9UA 1TFXA 2BHGA 2OUAA 2JH5D 4OGYA 1MUEB 3BF6H 1ETRH 1ZMLA 1TE0A 1WQVH 2RA0A 3RMLH 1FY3A 1W7XH 2QYIA 4IBLH 1D9IA 1HBTH 1KXDA 5GCHG
chains in the Genus database with same CATH superfamily
3QZQA 3HPTB 5TJXA 6GCHF 1FAKH 2H5DA 5L2ZH 3AAVA 1HJ9A 2BDAA 3SHAH 2A5KA 2JDID 7ESTE 1EAXA 1KLIH 1PYTD 1UTPA 4NWLA 1GBLA 2M2AA 1NM6A 2FOAA 2BLWA 3ZZ7A 1DANH 3QX5H 4ACBA 3SV9A 4WMFA 2CJIA 3SHCH 1Y5AT 1SGPE 2G5VA 4ISHH 1GBHA 3GOVB 3KGPA 3E1XB 4FU7A 1C1NA 2HOBA 4JZIA 1XKAC 1ACBE 4NIWA 1ZRKA 2Y5FA 3PB1E 1GMHF 2J92A 2Z9LA 5ESTE 1ANBA 3RU4D 4WY3A 1G3BA 3BG4B 1OX1A 1HAOH 3VB4A 3PO1B 2FI3E 3D23A 1TBRH 3EA8A 2HPQH 2ZU1A 1RIWB 1GVKB 1K1JA 3M3TA 1RTFB 1DM4B 2FODA 4X8TH 1P2NA 1K1NA 1PFXC 1EP5A 1DWEH 1P9SA 2UUJB 2XBWA 4I8LA 1FAXA 2TGTA 3B9FH 1CVWH 3KNXA 3F9FA 1PQ8A 4GCHF 1CGHA 1UW7A 4YESB 4D9QA 3N7OA 1DLEA 6CHAB 3SQHE 4ABJA 3B8JA 1OKXA 1HGTH 3K9XB 1EP6A 1B0FA 3LH1A 4AB9A 2V3MA 1AUJA 3RXJA 1YBWA 3M3VA 3BG4C 3KYGA 3TIUA 3PO1C 1GL0E 2FXRA 3UPEA 1Y3XA 1EZSC 1YWUA 1O2HA 3ATKA 3TLOA 4ZKSU 5CMXH 3AASA 5T6GA 1RIWC 2VWOA 3LGVA 1O3HA 5DG6A 5ABWA 2XWAA 2BDGA 3HK6B 1HIAB 3TGKE 2FTLE 2WV4A 3LGUA 1YF4A 1SQTA 3PMHB 3STIA 1GBMA 1S81A 2V7QD 4CBOA 1TB6H 2Y6TA 2ZGXH 5DN6D 5L6NH 2BVSH 3V13A 1MMJN 5GWZA 2QXGA 4BAHB 6CHAC 3RXPA 2TGPZ 3RM2H 5A0AE 2GZ8A 2BD5A 4B75A 1O2OA 1Y3WA 1O2TA 1K21H 3GCOA 4NSVA 3DD2H 2OBOA 1HAXB 5ESBA 8ESTE 3E0PB 5DP5A 1QA7A 3BTQE 2IOTA 3TITA 1A4WH 1YCPH 1O2PA 3DSPA 4ZUHA 4NSYA 3SJ8A 1C2EA 5HXFA 3ZZ9A 1QNJA 2EQNA 2HLDD 1O2IA 2VIPA 2Q6GA 3UR9A 2HNTF 3UQVA 1FIZA 2C93B 2FOMB 3IWMA 1S0QA 2XYAA 2PGBB 3PRBA 2OINA 3FO8D 4INLA 4F48B 1AFQB 4Y79A 2QIQA 1GBCA 1QJ1B 3ZV9A 2NU0E 3ENSB 1BITA 2GGVB 1O3BA 3CS0A 3SI4H 3DHKH 4JYTA 1COWD 1L4ZA 8KME2 2BY8X 1O3CA 2ZCHP 1O5GH 2OLGA 3S7KB 1EZUC 2F3CE 1ZTKA 1NU7B 4WH8A 5FBIA 5A8YA 1ELCA 5C1UA 4FUJA 2TGAA 2AERH 2O8WA 5FCRA 1YGCH 2Y81A 1P2KA 1O3MA 1WAYB 1QBOA 2KCAA 3NZIA 1RD3B 4CRBA 3BTEE 2A7JA 1QBVH 1ZPCA 1YC0A 2A2QH 2A7CA 2ZIQH 3KIDU 1WV7H 2Z9JA 3OEED 1UTKA 2XNDD 1AFQC 3A8CA 2XC0A 2DE8A 5EW2H 1EPTB 4ABHA 8GCHG 2QF4A 2GCTB 3A80A 1GCDA 1TOMH 1BT7A 1H9LB 3RXBA 3VB7A 1C5SA 2HVYB 1NESE 1UTQA 1PYTC 2B8OH 1UHBA 5DP9A 3LH3A 3F9GA 1O5AB 1P0SH 5L2YH 1EAWA 1UTOA 2GZ9A 2WZQA 3RXFA 4AGJA 1GJ6A 5C94A 1FMGA 1S84A 3E90B 1CHOF 1UK2A 1LPGB 2C90B 2C3SA 4TSFD 5FL7D 5DP4A 2F9BH 1A5GH 2Z6BD 3MH5A 4FUFA 3UQOA 3OTPA 1OHHD 1PPEE 3GY6A 4A1VA 2QAAA 1LQEA 3M5MA 1T32A 1G36A 4IN2A 2UUFB 2BVRH 3LPRA 2STBE 4U01A 3OX7U 2WPDD 2CXVA 5IYTA 1OWHA 4E06H 2ZHQH 1O2GH 2ZG0H 1BRBE 3A7WA 2F9PA 1YPGH 1L1GA 4Y0YE 2GX4A 1C2GA 1CBWB 1EPTC 1Y5UT 3ZYDA 2GCTC 5GDSH 3RMMH 2AYWA 2F9NA 2FOCA 4XD7D 1TQ0B 2GKVE 2H9HA 2PR3A 2A32A 5DGJA 5HM9A 1GBTA 4RI0A 5DKMA 1GGDB 1MZDA 1WU1A 1RFNA 1MABB 1ANEA 3LGWA 4U2WA 1TGNA 4CRCA 2ZFPH 2KFWA 1C1WH 5DP7A 1SLVB 4JYVH 2FOFA 1T31A 3UNRA 2FYRA 3RLYH 1TX6A 2ZPQA 4IS5A 1KXFA 4I32A 1QURH 4X6MA 3BEUA 3MYWA 5GIBA 1ZSKA 2DUCA 1L1NA 2A4OA 2THFB 4D7FA 2BZAA 4VGCB 2ZCLP 4K60A 1Z71A 2Z9GA 2G52A 1PPZA 1CBWC 2ZPSA 3OFND 4ASHA 4OS1A 2XOKD 4K2YA 2D26C 4MNWA 2ZGCA 3GY8A 1GHAG 3PV2A 3TJUA 1SQAA 2VWMA 3OE7D 1GGDC 4YM9A 1EUFA 3QDZB 4K1EA 4X6OA 4JMYA 2WSSD 3A87A 4ABIA 2J4IA 4CH2B 2M5TA 1FONA 4NCYA 2F83A 1O34A 1P3EA 1AHTH 2EC9H 3U69H 3SU6A 3STJA 1HJAB 4X8UH 1EPTA 2JIZD 2JH0D 1K0HA 1GBJA 4K5ZA 1DFPA 2VIDA 3U8OH 4HFPB 2TGDA 1QRXA 1PPHE 4CRAA 1YKTA 4VGCC 2P93A 4P00A 5B6OA 3UIRA 5F6MA 1S82A 3V7TA 4ABDA 2QGRA 5EXMA 5AHGH 3URCA 5C67A 3OYPA 4X1NU 1FX0B 1W0ZU 1C9TA 1EAIA 1SLUB 1VCPA 4KP0A 4Y10E 4ABFA 1QA0A 1FV9A 3MO6A 3LC3A 1FNIA 3SV2H 1NY22 3KN2A 1C4U2 1EB1H 1A46H 2ZTXA 1P2OA 4I8JA 1BCUH 1LMWB 3GCTG 3MO9A 3A85A 4ZHMU 1HJAC 1FY8E 1MTUA 1C5UA 1P2IA 4K8BA 1EASA 1EQ9A 1JMOH 6GCHG 4UFFH 4ISNA 1W13U 1O2WA 1NRSH 2BX3A 3RXRA 3C27B 1UTJA 1O2KA 1HAZB 2H2ZA 1BIOA 2KAIB 3A7TA 5GPIB 1CA8B 5E0HA 2SFAA 3BIVH 4X1PU 3SZNA 3ZVAA 3F2HA 1LVMA 2ANYA 4GPGA 1O37A 4MPWA 4NZLA 1O32A 4BTUB 1DXWA 1N6XA 1D6RA 2R2MB 1GJ4H 1KXCA 1SGIB 5HM2A 2XNIA 3RXEA 2HNTC 5A8ZA 3SQEE 4GHQA 4XBCA 4YOIA 2QCYA 6LPRA 1YPMH 5JPMH 1P9UA 1GWAA 1SOTA 1T8MA 2SGEE 1C5MD 2ODPA 1SGNE 2CV3A 2BYAX 3UNSA 1TABE 3GISB 1ZSLA 3FVFB 4INKA 4KTCA 1DWDH 4IW4E 5F8TA 1PJPA 1G3CA 1LVOA 3EA7A 2BZ6H 3PRDA 3TH3H 1QJ7B 5T1VA 1O5EH 1W0JD 1V2TT 2IPQX 2XTTB 2V3OH 1E36B 5A2MH 1NRQH 1NRNH 1KTSB 2TBSA 1HAIH 2TRMA 4IMZA 7KMEH 4DURA 1GMDG 3RXMA 2BOKA 4YOJA 5LPFA 4FXGH 3S69A 1ZRBA 3WY8A 2XC5A 1TMUH 1Y3YA 1T8NA 4AGKA 1GJ8B 2VVCA 4Y7BA 3SI3H 1ELEE 1LCYA 1O2ZA 1ZPZA 8GCHF 3MU8A 4DIHH 1PPGE 2BDYA 4IC6A 3RU4T 3SNEA 4E05H 2F43B 2GJGA 2VWNA 1A2CH 3HK3B 1UMAH 2XW9A 3BV9B 1P8VC 4LZ1H 5FAHA 3T2NA 3VB3A 1AD8H 3EDXB 1GI1A 2ZGJA 3T28A 2CHAB 5L30H 5DP6A 4MQAA 4FUDA 1F0RA 1SGFA 1UCYE 2G4TA 2PW8H 5DJ7A 4FUGA 3JZ2B 4F4OC 3PMAB 1S83A 1K22H 5C20A 1E37B 4A7IB 3RUOA 3Q77A 1HXFH 2EA3A 1XVOA 5C17A 2ZA5A 3A7XA 4LK4A 2KAIA 5C1YA 1WSSH 3PTNA 2ZQ2A 3MH7A 1O2XA 1O3AA 2BD3A 4WXVA 4SGBE 1FZZA 1EZXC 1IQJA 3RXVA 3V3MA 2A7HA 1G3EA 1LQDB 5T6FA 2TIOA 3GYMA 1OWDA 3PLBA 1BBRK 1CT0E 2FOBA 4DCDA 3P70B 4A6LA 1QBNA 2FWWA 3MH6A 1MTSA 1K1MA 2CHAC 2ZWLH 1NRPH 1GG6B 4ISIH 3T5FH 1TAWA 2I6QA 3SU4A 1SB1H 4UFDH 1GI4A 1T8LA 2R0LA 2GZ7A 1GL1A 1E1RD 3CNRA 1NFXA 4AG1A 1PPCE 2PKSB 1XUKA 1A3BH 1VZQH 5A0BA 2G4UA 1JOUB 2UUKB 1C2DA 1GHAF 3ATIA 2PUQH 1NO9H 1XUFA 1ZJDA 2PP6A 1KYNA 2FS9A 4BAMB 2ZHEH 2P3TB 3SNDA 2FPZA 4X1QU 2GCHG 1OXGA 2FZZA 1E79D 1CT4E 3E8LA 2RDEA 1GG6C 1UCYK 2RDLA 1DICA 1NROH 3FP7E 3M35A 1O5DH 3SNAA 2GT8A 4O3TA 1AVWA 3KQBA 1TALA 1GI9B 1L2EA 2PWXA 1UTMA 3MI4A 3OU0A 1S85A 3L6PA 4B2AA 2PKSC 2NWNA 5EQQA 2A45B 1IOEA 2Q6FA 3DT0H 4BXWA 1SGTA 3ODDA 1C4Y2 4AORA 1P03A 1NFYA 1G30B 1FUJA 1DE7H 4FUCA 3A7YA 1K1LA 3OSYA 1GI3A 2B5TB 4NFFA 3NKKA 1ETSH 1FY4A 1AVXA 4RT1A 4JK6A 1CGIE 1O35A 1HLTH 1MTVA 3P8NA 3U8TH 5JBAS 2GV7A 5E0GA 3SNCA 1DWCH 4I33A 3RXCA 3GCTF 4UONA 2B9LA 5JBCS 1WCZA 2UWLA 4AOQA 4ZKOU 4YOGA 1P57B 1AB9B 1P01A 1IQMA 1Z1JA 1RGQA 2XBYA 1TNKA 1O3EA 2WUBA 2Z7FE 3KQEA 4Y11E 5F8XA 1AVGH 1MKWK 2ZF0H 2VJ1A 4HTCH 1BMFD 1THPB 1YYY1 1OSSA 5DP3A 3MTYA 4DW2U 3UR6A 1QRWA 2H5CA 2BXTH 4UFGH 5PTPA 1U6QA 1JIRA 2Q6DA 4R0IA 3E0NB 2O8LA 3FFGA 2SGFE 5FPSA 3RP2A 5IDKA 3S9BA 1JWTA 1SQOA 1FY5A 1GI8B 3PM3A 2P94A 4ISLA 1D3PB 3BTTE 1F92A 2VH6A 5C5OA 1LVYA 1VR1H 4AYVB 3VFEA 1FY1A 1UVOA 1LKBA 1AB9C 1NT1A 1JIMA 1QZ8A 2ZFQH 3V0XA 1EFRD 4D76A 1H9IE 1UVPA 1S6HA 4JZFH 3DSGA 2OP9A 3SNBA 5C1XA 2QN5T 1A5IA 1BZXE 3GCNA 1DY9A 5FPTA 1TYNA 1C2MA 4ZKRU 4H42U 4MTBA 2J95A 5HGGA 1O3NA 4E7NA 4TPIZ 5AFYH 3S7HB 3LT3A 4JZEH 1TMTH 1J16A 3SJOA 1DT2A 2A0QB 4D7GA 2ASUB 3LJOA 1CHGA 2BD7A 5JDUB 1O3OA 1NU9A 1C1TA 1GMDF 3ODFA 3EE0B 4NIYA 3BTME 2VVUA 3A81A 1Z6EA 1Z8RA 3H09A 3SZEA 1G37A 1OS8A 4X8VH 1TLDA 5K7RA 3QLPH 1G32B 1GBDA 2PHBA 3GY5A 3TVJB 5JB8S 1FXYA 2H1UA 1PQ5A 4K69A 1AWHB 1V2RT 2GP9B 3FZZA 5CHBA 1OYQA 1A0HB 1ANCA 1SSXA 3PWBA 3RMOH 1HAPH 1BHXF 1HYLA 1C5ZB 4NIVA 4XOJA 3SN8A 1F5KU 4YXWD 2ZDKA 1IQNA 2KX4A 2RA3A 1UHBB 1A61H 3GYLB 3GY3A 2VWLA 4XDEA 4AFSA 5FX6A 2J98A 2O8TA 5LGOA 3I78A 1RTKA 1T7CA 3A88A 1GDNA 4YZUA 3KQCA 4WXIA 4XBBA 1LPZB 4I31A 2JKHA 4ABBA 1KXBA 1HUTH 1IAUA 1Q3XA 1QTFA 2FLBH 1ELTA 2QC2A 2Y82A 2BM2A 2ZEBA 4F55A 4BAOB 5HKKD 1GI5A 4JCNA 5JBBS 3K65B 1DXPA 3HGPA 3M7UA 2SNWA 2F9UA 4Y76A 1MCVA 2AGIX 4ZAEA 1C5YB 2CF8H 2BY5X 2ZTYA 1C1MA 3A89A 1EAUA 1YP9A 4KGAA 1H9HE 1QFKH 4YO9A 4IMQA 3OAAD 4MPXA 1BUIA 3W1EA 1XXFA 1XXDA 1ID5H 2K8IA 3NXPA 2HALA 1CE5A 2JJ2D 4FU8A 3LKWA 1EZQA 2PGQB 2OBQA 3ELAH 1C2IA 2ZGBH 1MU8B 4GLYA 2JJ1D 3ZVCA 1XMNB 2P95A 4P02A 3SU1A 1WXRA 3FN8A 1EJMA 1C1PA 3M5OA 3O8BA 1TPOA 1Z8GA 3F1SB 3LGIA 4X1SU 2V0BA 2BY6X 5AVDA 1ABIH 3FP6E 3SV6A 5A0CA 4X1RU 3QUMP 2GCHF 4KKDA 4RKJB 3EGKH 1QL7A 2XBVA 3ESTA 5JBTA 1HXEH 2FLRH 3MU0A 1TBZH 4WH6A 3N7DA 1V2PT 4ABAA 2SNVA 1YPKH 3QGJA 2ZGHA 1Q2WA 3KL6A 2BVXH 3LGYA 4Q80A 1EOLA 1TGTA 3ZVDA 2R3UA 1PQAA 3LONA 1HPGA 2ZDVH 3TPIZ 1JRSA 4X2WA 4ESTE 1CA0B 2B0FA 2WPLS 4DG4A 1O2NA 1FPCH 1YLCA 1B0EA 3ZZ3A 3OTJE 1ZTLA 1PPBH 2CGAA 3L33A 2FESH 1TNHA 1E34B 1NBME 1LHCH 1K1OA 3E16B 2BDCA 3SU2A 1W2KH 4O97A 3UREA 1E38B 3BN9A 1AGJA 3GS9A 3PTBA 3SV8A 5K0HA 2P16A 2ZFSA 3UWIA 4KTUA 3SOSA 4A1TA 4CRFA 4MVNA 1MH0A 1V6DA 1T4UH 1O39A 3M7TA 1UK3A 1BTZA 1YPEH 3KQDA 1HFDA 1ARCA 3EAJA 5HYOA 1MTWA 1QY6A 1BTUA 2KCOA 2YMSD 2ODYB 1OWEA 4U30A 8LPRA 4NZQA 3BTHE 4ISOA 1OP0A 1ZTJA 5T6DA 1DLKB 3ZYEA 3MH4A 5KGOA 1CA0C 4Y8YA 3T62A 2ZU3A 3P92A 1W0KD 4Y71A 1YCPK 1HRTH 2SGQE 4HI3A 3IITA 5HMAA 4AYYB 4Z6AH 3BG8A 1NRRH 4B6FA 2OCVB 1MQ6A 4QT8C 1ESBA 3WWFA 1NN6A 4SGAE 3A86A 1EJAA 4H6SB 3K2UA 3SJ9A 2W6ID 1T8OA 3MO3A 2Z9IA 1S0RA 4NIXA 1N6YA 2LNCA 2Z9KA 5B6LA 1HAVB 2D1JA 1D3TB 3S9AA 5EXNA 4FUIA 2ZFTA 3QWCH 4IC5A 2VNTA 1P04A 3M36A 2BQ7B 5EQSA 2XC4A 2ZDMA 1ZGVA 2OC1A 1O3KA 1LHEH 1SGCA 4I86A 2VINA 2EI7A 4LXBH 3SU0A 3M37A 2QXIA 2BY9X 1BHXB 2WINI 4WWYA 2AGEX 5TCCA 1O3GA 3NUMA 4I8HA 1MAYA 1MU6B 3H7TA 2BQ6B 1IQHA 4CR5A 4FU9A 4B1TA 2VB0A 2CF9H 3IG6B 2QY0B 1V2JT 1V2VT 5E2OA 4BNRA 1UO6A 4FVDA 3RC5A 5TCAA 3M5NA 1D3QB 4BXSA 1WQSA 1XKBC 5EPNA 5F03A 2G00A 1K28D 4U32A 1L4DA 1LVBA 2FP7B 2PSXA 3FZDA 1EX3A 4BTIB 1ZR0A 1K1PA 3HKJB 2BX4A 1BQYA 1ELBA 1GI0A 2ANKH 3AK5A 4DT7B 1E0FD 1RJXB 2V3HH 3A7VA 2GD4B 4DVAU 1BTWA 1C5QA 4ZHLU 2VH0A 3SUFA 1P10A 5FBEA 1G3DA 4YTAA 3F0OA 5EJ1A 2IPHA 3TK9A 1UTLM 2NU4E 3PLKA 3F0PA 1N8OB 1SGRE 2LELA 5IK2D 1IQLA 1MKXK 4BTTB 2P3FH 1SPJA 1UJ1A 4YLUA 3RM0H 3SGAE 3TNSA 1KXEA 9LPRA 3SV7A 5AF9H 2GTBA 2Y7XA 1J17T 2VU8E 2P59A 4ZROA 3TH4H 3ATWA 3R3GB 1WYKA 1AWFH 1HAVA 2WYJA 1D6WA 2EI6A 2F9VA 5GXPA 2GT7A 3MU4A 2XCNA 3M61U 1VCWA 1OOKB 1Z6JH 2HPPH 2QF0A 2YMSB 4NA8A 2QE7D 3BTDE 1S5SA 1TBQH 1C2JA 1QJ6B 1BBRH 5FXLA 2P8OB 2FO9A 6ESTA 1N8OC 4THNH 3OY5U 2ZDLA 4ZCNA 2W5EA 3TK5A 4CH8B 7GCHG 2UWOA 1BRUP 2ZO3H 4UFEH 1EOJA 2BMGB 2Q1JA 2O9QA 4CHAB 1H4WA 3BSQA 4WF8A 1GMCF 4YT7H 1HNEE 3UOUA 1O0DH 2YNAA 1VITH 3ZZAA 1MTNB 3CP7A 1DSTA 1BMNH 1O2RA 2FEQH 5LPEA 3F2GA 3RXSA 2ZCKP 2ZTZA 2YMSC 3QZRA 1DX5M 1MBMA 4XFQA 1C9PA 3A7ZA 3BEFB 5EU8A 3F9HA 3NCLA 2P8OC 4OS6A 3W94A 4NA9H 5AFZH 3MQKC 2PLXA 5EJZA 2D2DA 2BY7X 2B7DH 1IHTH 3LDXH 5CHAB 1QCPA 1UCYH 2O8UA 4Q7ZA 3OY6U 3RXAA 1JBUH 2ZPRA 1HV7A 2GDDA 1YCPM 1LDTT 3UUZA 5BRRE 3Q3YA 1EKBB 5ETXA 5EJLA 5DSFA 4CHAC 4XRNA 3SORA 1YPHC 4TY7A 2PTNA 1O2UA 4MLFB 2A5IA 1SLWB 2A2XH 4PROA 3TK6A 2OTVA 3QK1A 4KTSA 2HNTE 1GJ5H 1EATA 1C5PA 1MTNC 2W7UA 3U28C 2AHME 1E35B 1TA6A 2XBXA 2HGTH 1TWXB 4M9FA 3ZVFA 2IJD1 1OYTH 4MPVA 1ZGIA 2AMPA 1RS0A 3MNXA 3I29A 2G55A 3WWBA 5A09A 3LIWA 4ZXXH 1VITG 1O3JA 1MAXA 3DFLA 2DE9A 3ZZBA 3GICB 3F68H 1YM0A 5CHAC 1AFEH 5I25A 3URDA 3NPSA 4E7RG 5EOKA 4TPYA 1HAYB 3SUDA 4AX9H 1F2SE 1V2UT 3KCGH 1P2MA 2OQUA 4WMEA 1GBEA 2FS8A 1SGFG 2PKAB 4TWWA 1ELGA 1MKWH 1AKSA 1CQQA 2F4LA 3FANA 4K1TA 1TX7A 5KEDA 3LGTA 1V2MT 1YLDA 3GDVA 1CT2E 1HAGE 1SGDE 1UTNA 3PMBB 5JYIA 1QB9A 2FX6A 2H6MA 4B71A 1H8DH 2ALPA 3VXEH 2GDEH 1K2I1 2L6OA 2STAE 3ZZ5A 1P11E 4CR9A 1Y3VA 5E0JA 1LHDH 4B2BA 1NFWA 2FMJA 4JZDH 1QB1A 1ORFA 2BTCE 1IQFA 3RC4A 2A4GA 1ZMJA 2W7SA 3VB5A 3ZVBA 3EA9A 1OWKA 1P3CA 3VG8A 1L1JA 4FOUC 2KCPA 1NBMD 1ZMNA 3ZV8A 3S9CA 2VIVA 3KQ5A 3QGNB 3B23B 1NC6A 3PV4A 1OPHB 1XX9A 2VBCA 1F0UA 1AN1E 4B76A 1G2LA 1A7SA 3A8BA 1W12U 5DK1A 1IHSH 3AVZA 1O2LA 1F7ZA 1ZZZA 2AEIH 3FAOA 2R3YA 3L3TA 4AN7A 1B5GH 1V2ST 4ZXYH 5LH8A 1DITH 3NRLA 2PV9B 3O8RA 2G51A 1A0LA 3I77A 3M7QA 3W95A 4DIIH 3O8DA 1NS3A 1O3PB 2BD2A 3KF2A 1GJCB 3MU1A 1Z1IA 3RXGA 1FJSA 5GNDA 1C5NH 2BB4A 4YLQH 4NA7A 1NZQH 1GBIA 2IN2A 4HZHA 4O3UA 5F53A 1GHWH 4FETA 5BPEA 3K6YA 1C1OA 2FYQA 2J98B 1CO7E 3ATLA 3UFAA 4H4FA 1ZYOA 1KDQA 1LTOA 4ZHAA 2OK5A 3KHVA 4TYDA 1YPLH 1DUAA 1SI5H 1UVSH 4I8GA 1SL3A 2A5AA 4B2CA 3SJIA 2KCYA 2J5UA 1O2VA 1TX8A 2PKAA 3A8AA 1GHZA 5A8XA 4Z1MD 1OP2A 5HIYA 3HGNA 1DDJA 2HLCA 1C5VA 1AE5A 1XUIA 4B6EA 1GJAB 3AW0A 4JYUH 3DA9B 2W6JD 4O9VA 2R9PA 1P09A 2EI8A 4K3JA 1D3DB 4X2VA 1KLJH 2ESTE 3P8GA 1ANDA 1SQRA 1FN8A 2BLQA 1EJNA 1ELDE 2SGDE 1ELVA 3UY9A 2CN0H 1C1RA 1TPSA 5EODA 1AQ7A 4MDSA 1FN6A 7GCHF 1MD8A 2BQWB 2FI4E 1TRYA 1BDAA 1ABJH 2BDIA 2AGGX 2ZFFH 2AIPA 4CRDA 1H8HD 1H1BA 1VCQA 2RCEA 3PROA 4I7YH 2OQ5A 1TRMA 4H6TA 3SU3A 5C2ZA 1V3XA 3RC6A 4MPUA 2FTMA 1FI8A 2HRVA 1BOQA 2BDHA 3F9EA 1AU8A 5T3HA 1C1UH 2BLVA 4GUXA 4BOHA 3KEEA 1AZ8A 4UEHH 4CREA 2WPJS 1C5RA 3GY4A 2Y5HA 3KYFA 3ZZDA 3RXKA 1BTHH 4WMDA 4JZ1A 1H8ED 3ITIA 2GVFA 3FP8E 3NWUA 1K1IA 1QRZA 1BMLA 2G8TA 4A92A 5DPAA 2JH6D 1V2QT 4Y6DA 3SO3A 5FCKA 1O3IA 4Q63A 1SOZA 2QV1A 1VJAU 3MWIU 4ASUD 2H9EH 2QF3A 3PMJA 1X7AC 4ZMAH 1SLXB 5F8ZA 1XM1A 3HKIB 1HCGA 3K6ZA 1SFQB 2Y80A 2HWLB 1A1RA 4AFUA 1V2LT 4YT6H 2AFQB 4KELA 4OM9A 1D4PB 2VIWA 2J9NA 5G4BA 3A8DA 4RT0A 1KY9A 3RXUA 1DWBH 1SHHB 1DSUA 4X6NA 3T26A 2GMTB 4XSKU 1LO6A 1VITF 5EPYA 1W10U 3TGJE 2O8MA 1KLTA 4MNVA 4B73A 2BLOA 4OS7A 3BIUH 4Q4LA 3BTFE 2W3KA 4GSOA 4DY7B 1GI6A 1G9IE 3F3BA 1TONA 3RXHA 1QB6A 4Z0KA 4ACAA 1K9OE 1MQ5A 4OS4A 3AW1A 3SJKA 1C5TA 3VB6A 4TWYA 4AFZA 1Y5BT 1GI7B 1GHYH 3D62A 5H4IB 1KIGH 2A4RA 2WUCA 3RLWH 2OC0A 2XRCA 3T29A 2V35A 1LKAA 1UK4A 1C2FA 2GMTC 2GV6A 3MNSA 1SVPA 1TOCB 4OS2A 4A5TS 4HGCA 1QL8A 2WPIS 1WTHD 3EE7A 1GVZA 3E6PH 3ZZ8A 2ANMH 1WDIA 2F9OA 3F2FA 1GMCG 1P2JA 4OS5A 4JK5A 4CBNA 2OC7A 1FIWA 2W3IA 4XE4A 1O3LA 1VKYA 2I6SA 4B74A 5C0TA 3E3TA 1O2SA 3RXDA 3WW7A 4DT4A 5FX5A 1XUJA 3ATMA 4BAKB 1AE8H 5EQRA 3BTKE 2IJOB 4GHTA 1WOFA 2AS9A 5I46H 3Q76A 2WHXA 1C4V2 1LHFH 2A31A 2PTCE 1C5OH 1TNIA 1EB2A 2ZU2A 1S6LA 5EW1H 3LOXA 3FKSD 1GVLA 2CK3D 2A4QA 2ANWA 1ZLRA 3MNCA 4WJG2 1GBFA 3U9AH 3SU5A 1CGJE 1PQ7A 1ARBA 1FDPA 1ZOMA 4J1YA 3RXIA 1YLNA 4LZ4B 3MU5A 2ZNKH 2RFKC 1HIAA 5E2PA 1O36A 1LHGH 4NWKA 3PV5A 3U8RH 3DUXH 1AUTC 1FLEE 1LPKB 5HIZA 1H8IH 1GDUA 3ZIAD 1BTPA 1GHBG 2PSYA 4XBDA 1IQGA 1THSH 4BANB 1HJ8A 2BOHB 1P2QA 3TGIE 1TMBH 1TQ7B 2G5NA 3A82A 1O30A 3Q3KA 2WV5A 2UUYA 4AZ2B 1GHXH 5GCHF 3GDUA 5CE1A 3ZZ6A 4ZH8A 4NFEA 2WPKS 4IGDA 4F49A 1MD7A 1TA2A 3TNTA 3BTWE 1TIOA 2L74A 3P8FA 3RMNH 1TRNA 1B7XB 3MMGA 1GJDB 1RTLA 1TNLA 4FUBA 4MNXA 1DOJA 5EXLA 1SMFE 1MKXH 1T4VH 3HATH 3PYHA 3U1JB 1AO5A 1BMMH 2J38A 4BAQB 3RXQA 3MFJA 1ZHPA 1ESAA 2Z3DA 1C2HA 3GDSA 1AZZA 4HG6A 1ZSJA 2P3UB 4ABEA 2ODQA 2C8ZB 3RXTA 2R2WU 4ZKNU 1OWIA 1BA8B 2C8YB 5DP8A 1SGQE 2SGAA 2ZC9H 3JZ1B 4DOQA 2C4FH 3T27A 1SHYA 1P06A 3BEIB 1G2MA 1HAHH 1GJBB 3LU9B 4X0WU 1WTGH 2ULLA 1ZPBA 2KZ4A 2BD9A 3NK8A 1RRKA 3LJJA 1C5WB 3UTUH 3M3SA 4UDWH 3RU4E 1THRH 1IQIA 1UVTH 1F5RA 1F5LA 3QN7A 1CU1A 1W0YH 2RG3A 2XXLA 1ELAA 2AMQA 1W3CA 4Q7YA 2AIQA 2K0QA 4D8NA 3CENA 3N7EA 2EEKA 1JRTA 2J34A 1Z7KA 1KMHB 1TNGA 1N1LA 1BB0B 5C5NA 3EYDA 1P12E 3VXFH 2D8WA 3D65E 2NU3E 1YY3A 4AC9A 2BXUH 2LPRA 2V6NA 2K1QA 2ZDNA 2YNBA 7LPRA 1DPOA 2OD3B 1E1QD 5FHTA 5CDFE 2BDBA 1O5BB 2VGCB 3MNBA 4K1SA 4K8YA 4I8KA 1W7GH 2F91A 1O38A 1ELFA 2ZU5A 1SFIA 5KECA 1O2YA 3N99A 4RN6A 2J94A 2BD4A 1W8BH 4Y8XA 1KTTB 4X6PA 3S0NA 1F0TA 3D49H 2ILNA 2VIQA 3TU7H 3P95A 1J14A 4FUEA 2WV9A 1NPMA 2FDAA 4INHA 1CSOE 1SG8B 3SUGA 1ZJKA 5EIYA 3TH2H 1TPAE 3QO6A 4UD9H 4X2YA 5JB9S 2J2UA 1O33A 3M5LA 2KM0A 1DS2E 5GJ4B 1C5XB 1BMAA 2AMDA 1MZAA 3GY7A 1GCTB 1C5LH 1C2KA 4WVPE 1AKSB 4R8TB 3ZZCA 2NU1E 1J9CH 4DJZB 2VGCC 3GCHB 4TY6A 1FPHH 1BTXA 3CS7A 2OC8A 3A84A 2HVXA 1BTYA 2LP6A 2QXJA 4FUHA 2FOHA 1C1SA 5LPRA 2VVVA 1GMHG 2Y5GA 1C1QA 1O5CB 2OXSA 2PUXB 1KSNA 1GJ7B 1IQEA 2G81E 3VGCB 2CMYA 1VGCB 3F6UH 1Y3UA 1BBRE 1WUNH 1QL9A 2WPHS 4M7GA 1MBQA 1ZHRA 4J2YB 1Y8TA 2C8WB 1GCTC 2QA9E 3QTVH 3TJOA 2WYGA 1SGYE 2C8XB 3G01A 4LOYH 3GCHC 3SYJA 1A5HA 3BTGE 4GCHG 1QQUA 2SGPE 3QTOH 5E8EH 4TT3D 1SGEE 4RKOB 2VIOA 3A83A 3GY2A 1UVUH 1C1VH 1TGCA 4AG2A 2Z94A 1V2KT 1KXAA 1QIXB 1ETTH 3V12A 1AIXH 3VGCC 3Q3XA 1VGCC 3O8CA 2FIRH 5C3NA 4DGJA 3SUEA 1QR3E 1HB0B 1HDTH 2ZKSA 4GAWA 1ESTA 5J4QA 4A1XA 1O3FA 1XUHA 3E91A 4AFQA 3VEQB 3SBKA 4Q2KA 1GHBF 1GBKA 3UB0A 2KR7A 2ZHFH 3MHWU 1GBBA 1TPPA 2Z3CA 5SGAE 1SR5C 4RSPA 3RXOA 3AAUA 2ZECA 4NGAH 1FQ3A 4Y0ZE 9ESTA 3UWJH 1KDQB 1MCTA 2ZI2H 2BD8A 3C1KA 3PLPA 4Q7XA 2YOLA 3P8OA 1GI2A 2NU2E 1Z8IB 1W14U 4AB8A 2H9TH 1J8AA 2FX4A 1Y59T 3VPKA 4CRGA 5C0UA 1O2QA 3FOAA 1SKYE 3H7OA 1F0SA 3UAIC 1JXPA 3RXLA 1XVMA 1P02A 1AI8H 2Z3EA 1BRAA 3ZVEA 4O03A 1TGBA 3DFJA 1PPFE 1WBGB 2QF5A 1QQ4A 1TGSZ 1GHVH 1J15A 1DY8A 2AH4X 1OP8A 3LC5A 3UNQA 1NTPA 1Q31A 1V2NT 1L0ZA 2TPIZ 2Y7ZA 3P6ZB 2ZHDA 3U1IB 1QGFA 1DVAH 3MOCA 2W26A 4GVUA 2A1DB 1INCA 3EQ0H 1GDQA 2XCFA 1O3DA 3Q00A 2WPMS 4MNYA 4X8SH 1O2MA 2FM2A 3ZVGA 1SBWA 1YPHE 1GJ9B 3SW2B 1S6FA 3DSOA 2EY4C 3UOPA 4MG3A 2ZFRH 4OGXA 2JETB 4IN1A 2R0KA 3TJNA 1QHRB 1GPZA 1BJVA 4Y8ZA 2ZP0H 5EGMA 2FI5E 3SGBE 3U98H 1V2OT 2XWBI 2ZQ1A 2QXHA 5EG4A 3ZZ4A 1EXFA 1W11U 2ZHWH 1XUGA 3TJVA 1A3EH 1BJUA 1NFUA 2ALVA 1RXPA 2ZDAH 4ABGA 1VJ9U 2FOGA 2ZZUH 2ZU4A 3H5CB 1C2LA 1O2JA 1SC8U 1O5FH 3PWCA 3SGQE 5J4SA 1ZHMA 4NG9H 1Z8JB 1GBAA 2UWPA 1AY6H 4FVBA 4X2XA 5FPYA 3T25A 1IQKA 1O31A 1YPJH 3OEHD 3P17H 1AMHA 4D9RA 4Y7AA 1DUEA 2J97A 1P05A 3RDZA 2JETC 1TNJA 4UE7H 1V2WT 1CHOG 2PFEA 1A0JA 3DCLA 3R0FA 5DO4H 2FOEA 1OWJA 1BRCE 1M9UA 1TFXA 2BHGA 2OUAA 2JH5D 4OGYA 1MUEB 3BF6H 1ETRH 1ZMLA 1TE0A 1WQVH 2RA0A 3RMLH 1FY3A 1W7XH 2QYIA 4IBLH 1D9IA 1HBTH 1KXDA 5GCHG
chains in the Genus database with same CATH topology
3QZQA 3HPTB 5TJXA 6GCHF 1FAKH 2H5DA 5L2ZH 3AAVA 1HJ9A 2BDAA 3SHAH 2A5KA 7ESTE 1EAXA 1KLIH 1PYTD 1UTPA 4NWLA 1GBLA 1NM6A 2FOAA 2BLWA 3ZZ7A 1DANH 3QX5H 3SV9A 4WMFA 2CJIA 3SHCH 1Y5AT 1SGPE 2G5VA 4ISHH 1GBHA 3GOVB 3KGPA 3E1XB 4FU7A 1C1NA 2HOBA 4JZIA 1XKAC 1ACBE 4NIWA 1ZRKA 2Y5FA 3PB1E 1GMHF 2J92A 2Z9LA 5ESTE 1ANBA 3RU4D 4WY3A 1G3BA 3BG4B 1OX1A 1HAOH 3VB4A 3PO1B 2FI3E 3D23A 1TBRH 3EA8A 2HPQH 2ZU1A 1RIWB 1GVKB 1K1JA 3M3TA 1RTFB 1DM4B 2FODA 4X8TH 1P2NA 1K1NA 1PFXC 1EP5A 1DWEH 1P9SA 2UUJB 2XBWA 4I8LA 1FAXA 2TGTA 3B9FH 1CVWH 3KNXA 3F9FA 1PQ8A 4GCHF 1CGHA 4YESB 4D9QA 3N7OA 1DLEA 6CHAB 3SQHE 4ABJA 3B8JA 1OKXA 1HGTH 3K9XB 1EP6A 1B0FA 3LH1A 4AB9A 1AUJA 3RXJA 1YBWA 3M3VA 3BG4C 3TIUA 3PO1C 1GL0E 2FXRA 3UPEA 1Y3XA 1EZSC 3ATKA 1O2HA 3TLOA 5CMXH 4ZKSU 3AASA 5T6GA 1RIWC 2VWOA 3LGVA 1O3HA 5DG6A 5ABWA 2XWAA 2BDGA 3HK6B 1HIAB 3TGKE 2FTLE 2WV4A 3LGUA 1YF4A 1SQTA 3PMHB 3STIA 1GBMA 1S81A 4CBOA 1TB6H 2Y6TA 2ZGXH 5L6NH 2BVSH 3V13A 1MMJN 5GWZA 2QXGA 4BAHB 6CHAC 3RXPA 2TGPZ 3RM2H 5A0AE 2GZ8A 2BD5A 4B75A 1O2OA 1Y3WA 1O2TA 1K21H 3GCOA 4NSVA 3DD2H 2OBOA 1HAXB 5ESBA 8ESTE 3E0PB 5DP5A 1QA7A 3BTQE 2IOTA 3TITA 1A4WH 1YCPH 1O2PA 4ZUHA 4NSYA 3SJ8A 1C2EA 5HXFA 3ZZ9A 1QNJA 2VIPA 1O2IA 2Q6GA 3UR9A 2HNTF 3UQVA 1FIZA 2C93B 2FOMB 3IWMA 1S0QA 2XYAA 2PGBB 2OINA 4INLA 1AFQB 4Y79A 2QIQA 1GBCA 1QJ1B 3ZV9A 2NU0E 3ENSB 1BITA 2GGVB 1O3BA 3CS0A 3SI4H 3DHKH 4JYTA 1L4ZA 8KME2 2BY8X 1O3CA 2ZCHP 1O5GH 2OLGA 3S7KB 1EZUC 2F3CE 1ZTKA 1NU7B 4WH8A 5FBIA 5A8YA 1ELCA 5C1UA 4FUJA 2TGAA 2AERH 2O8WA 5FCRA 1YGCH 2Y81A 1P2KA 1O3MA 1WAYB 1QBOA 3NZIA 1RD3B 4CRBA 3BTEE 2A7JA 1QBVH 1ZPCA 1YC0A 2A2QH 2A7CA 2ZIQH 3KIDU 1WV7H 2Z9JA 1UTKA 1AFQC 3A8CA 2XC0A 2DE8A 5EW2H 1EPTB 4ABHA 8GCHG 3A80A 2GCTB 1GCDA 1TOMH 1BT7A 1H9LB 3RXBA 3VB7A 1C5SA 1NESE 1UTQA 1PYTC 2B8OH 1UHBA 5DP9A 3LH3A 3F9GA 1O5AB 1P0SH 5L2YH 1EAWA 1UTOA 2GZ9A 3RXFA 4AGJA 1GJ6A 1FMGA 1S84A 3E90B 1CHOF 1UK2A 1LPGB 2C90B 2C3SA 5DP4A 2F9BH 1A5GH 2Z6BD 3MH5A 4FUFA 3UQOA 1PPEE 3GY6A 4A1VA 2QAAA 1LQEA 3M5MA 1T32A 1G36A 4IN2A 2UUFB 2BVRH 3LPRA 2STBE 4U01A 3OX7U 5IYTA 2CXVA 1OWHA 4E06H 2ZHQH 1O2GH 2ZG0H 1BRBE 3A7WA 2F9PA 1YPGH 1L1GA 4Y0YE 2GX4A 1C2GA 1CBWB 1EPTC 1Y5UT 3ZYDA 2GCTC 5GDSH 3RMMH 2AYWA 2F9NA 2FOCA 1TQ0B 2GKVE 2H9HA 2PR3A 2A32A 5DGJA 5HM9A 1GBTA 5DKMA 1GGDB 1MZDA 1WU1A 1RFNA 1ANEA 3LGWA 4U2WA 1TGNA 4CRCA 2ZFPH 1C1WH 5DP7A 1SLVB 4JYVH 2FOFA 1T31A 3UNRA 2FYRA 3RLYH 1TX6A 2ZPQA 4IS5A 1KXFA 4I32A 1QURH 4X6MA 3BEUA 3MYWA 5GIBA 1ZSKA 2DUCA 1L1NA 2A4OA 2THFB 4D7FA 2BZAA 4VGCB 2ZCLP 4K60A 1Z71A 2Z9GA 2G52A 1PPZA 1CBWC 2ZPSA 4ASHA 4OS1A 4K2YA 2D26C 4MNWA 2ZGCA 3GY8A 1GHAG 3TJUA 1SQAA 2VWMA 4YM9A 1GGDC 1EUFA 3QDZB 4K1EA 4X6OA 4JMYA 3A87A 4ABIA 2J4IA 4CH2B 2M5TA 1FONA 4NCYA 2F83A 1O34A 1P3EA 1AHTH 2EC9H 3U69H 3SU6A 3STJA 1HJAB 4X8UH 1EPTA 2JH0D 1GBJA 4K5ZA 1DFPA 2VIDA 3U8OH 4HFPB 2TGDA 1QRXA 1PPHE 4CRAA 1YKTA 4VGCC 2P93A 5B6OA 3UIRA 5F6MA 1S82A 3V7TA 4ABDA 2QGRA 5EXMA 5AHGH 3URCA 5C67A 3OYPA 4X1NU 1W0ZU 1C9TA 1EAIA 1SLUB 1VCPA 4KP0A 4Y10E 4ABFA 1QA0A 1FV9A 3MO6A 3LC3A 1FNIA 3SV2H 1NY22 3KN2A 1C4U2 1EB1H 1A46H 2ZTXA 1P2OA 4I8JA 1BCUH 1LMWB 3GCTG 3MO9A 3A85A 4ZHMU 1HJAC 1FY8E 1MTUA 1C5UA 1P2IA 4K8BA 1EASA 1EQ9A 1JMOH 6GCHG 4UFFH 4ISNA 1W13U 1O2WA 1NRSH 2BX3A 3RXRA 3C27B 1UTJA 1O2KA 1HAZB 2H2ZA 1BIOA 2KAIB 3A7TA 5GPIB 1CA8B 5E0HA 2SFAA 3BIVH 4X1PU 3SZNA 3ZVAA 1LVMA 2ANYA 4GPGA 1O37A 4MPWA 4NZLA 1O32A 4BTUB 1DXWA 1N6XA 1D6RA 2R2MB 1GJ4H 1KXCA 1SGIB 5HM2A 2XNIA 3RXEA 2HNTC 5A8ZA 3SQEE 4GHQA 4XBCA 4YOIA 2QCYA 6LPRA 1YPMH 5JPMH 1P9UA 1GWAA 1SOTA 1T8MA 2SGEE 1C5MD 2ODPA 1SGNE 2CV3A 2BYAX 3UNSA 1TABE 3GISB 1ZSLA 3FVFB 4INKA 4KTCA 1DWDH 4IW4E 5F8TA 1PJPA 1G3CA 1LVOA 3EA7A 2BZ6H 3TH3H 1QJ7B 1O5EH 1V2TT 2XTTB 2V3OH 1E36B 5A2MH 1NRQH 1NRNH 1KTSB 2TBSA 1HAIH 2TRMA 4IMZA 7KMEH 4DURA 1GMDG 3RXMA 2BOKA 4YOJA 5LPFA 4FXGH 3S69A 1ZRBA 3WY8A 2XC5A 1TMUH 1Y3YA 1T8NA 4AGKA 1GJ8B 2VVCA 4Y7BA 3SI3H 1ELEE 1LCYA 1O2ZA 1ZPZA 8GCHF 3MU8A 4DIHH 1PPGE 2BDYA 4IC6A 3RU4T 3SNEA 4E05H 2VWNA 1A2CH 3HK3B 1UMAH 2XW9A 3BV9B 1P8VC 4LZ1H 5FAHA 3T2NA 3VB3A 1AD8H 3EDXB 1GI1A 2ZGJA 3T28A 2CHAB 5L30H 5DP6A 4MQAA 4FUDA 1F0RA 1SGFA 1UCYE 2G4TA 2PW8H 5DJ7A 4FUGA 3JZ2B 4F4OC 3PMAB 1S83A 1K22H 5C20A 1E37B 4A7IB 3RUOA 3Q77A 1HXFH 2EA3A 1XVOA 2ZA5A 3A7XA 4LK4A 2KAIA 5C1YA 1WSSH 3PTNA 2ZQ2A 3MH7A 1O2XA 1O3AA 2BD3A 4WXVA 4SGBE 1FZZA 1EZXC 1IQJA 3RXVA 3V3MA 2A7HA 1G3EA 1LQDB 5T6FA 2TIOA 3GYMA 1OWDA 3PLBA 1BBRK 1CT0E 2FOBA 4DCDA 3P70B 4A6LA 1QBNA 2FWWA 3MH6A 1MTSA 1K1MA 2CHAC 2ZWLH 1NRPH 1GG6B 4ISIH 3T5FH 1TAWA 2I6QA 3SU4A 1SB1H 4UFDH 1GI4A 1T8LA 2R0LA 2GZ7A 1GL1A 1NFXA 4AG1A 1PPCE 2PKSB 1XUKA 1A3BH 1VZQH 5A0BA 2G4UA 1JOUB 2UUKB 1C2DA 1GHAF 3ATIA 2PUQH 1NO9H 1XUFA 1ZJDA 1KYNA 2FS9A 4BAMB 2ZHEH 2P3TB 3SNDA 2FPZA 4X1QU 2GCHG 1OXGA 2FZZA 1CT4E 3E8LA 1GG6C 1UCYK 2RDLA 1DICA 1NROH 3FP7E 3M35A 1O5DH 3SNAA 2GT8A 4O3TA 1AVWA 3KQBA 1TALA 1GI9B 1L2EA 2PWXA 1UTMA 3MI4A 3OU0A 1S85A 3L6PA 4B2AA 2PKSC 2NWNA 5EQQA 2A45B 1IOEA 2Q6FA 3DT0H 4BXWA 1SGTA 3ODDA 1C4Y2 4AORA 1P03A 1NFYA 1G30B 1FUJA 1DE7H 4FUCA 3A7YA 1K1LA 3OSYA 1GI3A 2B5TB 4NFFA 3NKKA 1ETSH 1FY4A 1AVXA 4JK6A 1CGIE 1O35A 1HLTH 1MTVA 3P8NA 3U8TH 5JBAS 2GV7A 5E0GA 3SNCA 1DWCH 4I33A 3RXCA 3GCTF 4UONA 2B9LA 5JBCS 1WCZA 2UWLA 4AOQA 4ZKOU 4YOGA 1P57B 1AB9B 1P01A 1IQMA 1Z1JA 1RGQA 2XBYA 1TNKA 1O3EA 2WUBA 2Z7FE 3KQEA 4Y11E 5F8XA 1AVGH 1MKWK 2ZF0H 2VJ1A 4HTCH 1THPB 1YYY1 1OSSA 5DP3A 3MTYA 4DW2U 3UR6A 1QRWA 2H5CA 2BXTH 4UFGH 5PTPA 1U6QA 1JIRA 2Q6DA 4R0IA 3E0NB 2O8LA 3FFGA 2SGFE 5FPSA 3RP2A 5IDKA 3S9BA 1JWTA 1SQOA 1FY5A 1GI8B 3PM3A 2P94A 4ISLA 1D3PB 3BTTE 1F92A 2VH6A 5C5OA 1LVYA 1VR1H 4AYVB 3VFEA 1FY1A 1UVOA 1LKBA 1AB9C 1NT1A 1JIMA 3V0XA 2ZFQH 4D76A 1H9IE 1UVPA 1S6HA 4JZFH 2OP9A 3SNBA 5C1XA 2QN5T 1A5IA 1BZXE 3GCNA 1DY9A 5FPTA 1TYNA 1C2MA 4ZKRU 4H42U 4MTBA 2J95A 5HGGA 1O3NA 4E7NA 4TPIZ 5AFYH 3S7HB 3LT3A 4JZEH 1TMTH 1J16A 3SJOA 1DT2A 2A0QB 4D7GA 2ASUB 3LJOA 1CHGA 2BD7A 5JDUB 1O3OA 1NU9A 1C1TA 1GMDF 3ODFA 3EE0B 4NIYA 3BTME 2VVUA 3A81A 1Z6EA 1Z8RA 1G37A 1OS8A 4X8VH 1TLDA 5K7RA 3QLPH 1G32B 1GBDA 2PHBA 3GY5A 3TVJB 5JB8S 1FXYA 2H1UA 1PQ5A 4K69A 1AWHB 1V2RT 2GP9B 3FZZA 1OYQA 1A0HB 1ANCA 1SSXA 3PWBA 3RMOH 1HAPH 1BHXF 1HYLA 1C5ZB 4NIVA 4XOJA 3SN8A 1F5KU 2ZDKA 1IQNA 2RA3A 1UHBB 1A61H 3GYLB 3GY3A 2VWLA 4XDEA 4AFSA 5FX6A 5LGOA 2O8TA 3I78A 1RTKA 1T7CA 3A88A 1GDNA 4YZUA 3KQCA 4WXIA 4XBBA 1LPZB 4I31A 2JKHA 4ABBA 1KXBA 1HUTH 1IAUA 1Q3XA 1QTFA 2FLBH 1ELTA 2QC2A 2Y82A 2BM2A 2ZEBA 4BAOB 1GI5A 4JCNA 5JBBS 3K65B 1DXPA 3HGPA 3M7UA 2SNWA 2F9UA 4Y76A 1MCVA 2AGIX 4ZAEA 1C5YB 2CF8H 2BY5X 2ZTYA 1C1MA 3A89A 1EAUA 1YP9A 4KGAA 1H9HE 1QFKH 4YO9A 4IMQA 4MPXA 1BUIA 1XXFA 1XXDA 1ID5H 3NXPA 2HALA 1CE5A 4FU8A 3LKWA 1EZQA 2PGQB 2OBQA 3ELAH 1C2IA 2ZGBH 1MU8B 4GLYA 3ZVCA 1XMNB 2P95A 3SU1A 1EJMA 1C1PA 3M5OA 3O8BA 1TPOA 1Z8GA 3F1SB 3LGIA 4X1SU 2V0BA 2BY6X 5AVDA 1ABIH 3FP6E 3SV6A 5A0CA 4X1RU 3QUMP 2GCHF 4KKDA 4RKJB 3EGKH 1QL7A 2XBVA 3ESTA 5JBTA 1HXEH 2FLRH 3MU0A 1TBZH 4WH6A 1V2PT 4ABAA 2SNVA 1YPKH 3QGJA 2ZGHA 1Q2WA 3KL6A 2BVXH 3LGYA 4Q80A 1EOLA 1TGTA 3ZVDA 2R3UA 1PQAA 3LONA 1HPGA 2ZDVH 3TPIZ 1JRSA 4X2WA 4ESTE 1CA0B 2B0FA 2WPLS 4DG4A 1O2NA 1FPCH 1YLCA 1B0EA 3ZZ3A 3OTJE 1ZTLA 1PPBH 2CGAA 3L33A 2FESH 1TNHA 1E34B 1LHCH 1K1OA 3E16B 2BDCA 3SU2A 1W2KH 4O97A 3UREA 1E38B 3BN9A 1AGJA 3PTBA 3SV8A 5K0HA 2P16A 2ZFSA 3UWIA 4KTUA 3SOSA 4A1TA 4CRFA 4MVNA 1MH0A 1V6DA 1T4UH 1O39A 3M7TA 1UK3A 1BTZA 1YPEH 3KQDA 1HFDA 1ARCA 3EAJA 5HYOA 1MTWA 1QY6A 1BTUA 2ODYB 1OWEA 4U30A 8LPRA 4NZQA 3BTHE 4ISOA 1OP0A 1ZTJA 5T6DA 1DLKB 3ZYEA 3MH4A 1CA0C 4Y8YA 3T62A 2ZU3A 3P92A 4Y71A 1YCPK 1HRTH 2SGQE 4HI3A 3IITA 5HMAA 4AYYB 4Z6AH 3BG8A 1NRRH 2OCVB 1MQ6A 4QT8C 1ESBA 1NN6A 4SGAE 3A86A 1EJAA 4H6SB 3K2UA 3SJ9A 1T8OA 3MO3A 2Z9IA 1S0RA 4NIXA 1N6YA 2LNCA 2Z9KA 1HAVB 2D1JA 1D3TB 3S9AA 5EXNA 4FUIA 2ZFTA 3QWCH 4IC5A 2VNTA 1P04A 3M36A 2BQ7B 5EQSA 2XC4A 2ZDMA 2OC1A 1ZGVA 1O3KA 1LHEH 1SGCA 2VINA 2EI7A