2BD3A

Porcine pancreatic elastase complexed with beta-casomorphin-7 and lys-ala-nh2 at ph 5.0
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-casomorphin-7
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd3A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd3A01
2ALPA 2QY0B 4FVBA 1P2IA 3UTUH 1GI0A 3QDZB 4GSOA 1ZYOA 1ARBA 2ZWLH 1NRNH 2G52A 1MH0A 1O2OA 2Y5GA 1L1NA 1O2YA 1SQAA 1E35B 3PO1B 1OKXA 1UTPA 4B74A 1HAIH 5DJ7A 3SJOA 2QAAA 1ZHMA 4X6MA 1O3CA 1O2TA 1UTMA 4JZIA 1K1LA 1TNLA 4VGCB 4U30A 2G51A 1SI5H 2ANYA 5DO4H 3SUEA 1BMLA 1THRH 2HGTH 5DP3A 2F9BH 1BTUA 4Y6DA 1HAHH 3HK6B 3SBKA 1A3BH 2A0QB 2VIDA 4OS1A 2ZU1A 1XVOA 2CF8H 1TMUH 1V2LT 2GKVE 2W5EA 1LHCH 1FXYA 2GTBA 2FOEA 4INKA 4MG3A 4OS2A 1C2IA 2ZFFH 1DY9A 4IN2A 4KTSA 4ZKRU 2BX4A 1AGJA 1G37A 7ESTE 3V13A 4JYTA 2Q6FA 1HGTH 1V2OT 4NWLA 4WJG2 3TNTA 4ZHMU 3OTJE 1N8OB 2BDBA 1P9UA 1GCTB 4XE4A 8GCHF 3RXHA 2ZFPH 1DXPA 1EAUA 2ZF0H 3FP7E 3SO3A 1LHEH 2OXSA 3PLBA 1GBJA 4JMYA 2PKAB 2FOMB 1AU8A 2R3YA 3RMMH 3MH5A 1O3EA 2FTLE 1T4VH 3RU4D 1ELDE 3EE0B 3UNRA 3GY4A 5CHAC 3RUOA 3R0FA 1G3CA 2XBVA 1CHOF 1D3PB 1AFEH 1F0TA 1AKSA 2BX3A 1E38B 3GYLB 1WAYB 2XWBI 2H2ZA 3HATH 1CGIE 1PPGE 4LXBH 2PGBB 1V2NT 1LQEA 1G36A 1YC0A 3ZZ4A 1W2KH 4TPIZ 1DSTA 3M5MA 3T62A 1C1QA 2OTVA 3ZVFA 4D9QA 1C1WH 2VVCA 2BDIA 2UWOA 2GVFA 3BN9A 3BG8A 3VB6A 1DX5M 1YGCH 4HZHA 2A32A 1GBBA 2QF3A 1EKBB 2ZP0H 1VCWA 1WV7H 2OC7A 1GGDC 4MNVA 1ZLRA 2BY9X 1TB6H 1D3TB 1BJVA 5DP8A 4SGBE 2BY5X 1P10A 1OYQA 2BY7X 3SHAH 1FIZA 1P57B 4WXVA 4U32A 1O3AA 1O3PB 1ZOMA 4WMFA 1TA6A 1YCPK 1C5QA 1OWJA 1BBRE 2FODA 1DITH 7KMEH 1G3EA 3AAVA 3JZ1B 5AFYH 3T2NA 1PQ5A 1Y3WA 2ZFRH 2QGRA 4Y76A 2EEKA 1W0YH 2P59A 1SOTA 1G2MA 1GBFA 2CGAA 2ZZUH 3K2UA 5GPIB 4H42U 1VR1H 4FUDA 5CE1A 3TK9A 1O39A 3ODDA 1E36B 2B5TB 3RXCA 3H7TA 4FUHA 1IQMA 4GAWA 1DS2E 1YPJH 2P8OB 3OY5U 2V3HH 4E06H 1AVWA 3E91A 1U6QA 1TLDA 1GBIA 1GG6C 3A7YA 3EDXB 2W26A 3SORA 2FIRH 2ZCHP 2BD4A 1J17T 3F9HA 1QBOA 4CRFA 1O2ZA 1GI3A 1MTNC 1P2NA 1MD7A 1KLTA 1EJMA 3LH3A 1ETTH 5L6NH 1GPZA 7GCHF 3MO9A 4FUBA 1S6HA 5IYTA 2DUCA 3ZZ5A 1GDQA 2BVRH 2VVVA 4WH8A 2GCTB 4Y71A 3RXTA 1DE7H 4BTTB 3ATLA 1THPB 3SU5A 1QB6A 4E7RG 3BEIB 5EXNA 3SJ8A 3I77A 2R3UA 1Y5AT 3M3SA 3ZVCA 1OPHB 1GVKB 1QHRB 1XM1A 1WOFA 2O9QA 1MMJN 3B23B 1GBMA 1GMDG 1N6XA 1MCVA 4RSPA 1TAWA 3KHVA 1RGQA 3UWJH 4DCDA 1UVOA 2VIWA 2C8ZB 1UCYE 1NRPH 2HNTF 3W94A 2GT8A 2FOBA 1LVYA 1RTFB 3M3TA 2PUXB 3RXOA 2UUYA 3T27A 2ZA5A 3RMNH 3RXPA 4YZUA 3I78A 4K8BA 3K6ZA 2AIQA 4ISLA 4CHAC 3GY3A 1CE5A 1NFWA 1AWFH 4XDEA 2ILNA 3KGPA 5EQSA 5F8TA 1W0ZU 1IQLA 1O5BB 4AGKA 3TH3H 3ZYDA 1A4WH 1BHXB 1FIWA 1GJ6A 3IITA 3ZZ8A 1TNHA 3VB5A 3SI3H 2GCHG 2ZDMA 5A0BA 1C5SA 2HPPH 2ZQ1A 3VPKA 1GBEA 1DWBH 3ATMA 4O03A 1O2KA 3GDSA 1HDTH 5HM9A 2QA9E 1FN8A 1GI9B 1ABIH 3F68H 4Y7BA 1AI8H 4PROA 1GMDF 1O2SA 1CBWC 8ESTE 1ZSLA 1KTSB 1O36A 2BLVA 2V3OH 2WYJA 3ZZBA 4AX9H 4CRCA 1ZHRA 2FX4A 1AIXH 1EUFA 4OS4A 2H9HA 3RDZA 2RDLA 1W14U 5HYOA 4I8GA 1GI7B 4KTUA 5EW1H 3ZZAA 1UTJA 1IQNA 2NU2E 4X2XA 1KYNA 1O5AB 2ZECA 2BMGB 4Z0KA 5AHGH 1BRUP 5CHAB 2OQ5A 1SGRE 3NZIA 2GMTC 3HKJB 1DUAA 1QQ4A 1QTFA 3BG4C 1IQEA 3QGJA 4K3JA 1LHGH 2Q6DA 1D3QB 1GMCG 2FX6A 4YOJA 2AMDA 3PMHB 1SLUB 1GJBB 2ZGHA 2ZU5A 3MU1A 1V2ST 2GCHF 1QRZA 1C5TA 3JZ2B 1CQQA 2G5VA 3FP6E 1AKSB 4MNYA 5DP4A 5E2OA 3F9FA 2TGAA 2Z3CA 1MU8B 4AORA 2FI5E 1DSUA 1OWEA 2ZU4A 1NS3A 1K9OE 4IMQA 1DVAH 4RKJB 5EG4A 3PV4A 2J34A 5A8XA 3FZDA 1GGDB 3P92A 2F9OA 2CMYA 1FZZA 1G30B 5T3HA 1WTGH 2ZGJA 1UJ1A 4AN7A 2AGGX 1EJAA 1F0UA 1LHDH 6ESTA 2RG3A 1P06A 1BT7A 1PPCE 3MWIU 5DPAA 5BRRE 1C4Y2 3SGAE 1XXFA 5HXFA 3AAUA 1ZMLA 4B2BA 2ZU3A 1QY6A 1SGCA 5EXLA 1W12U 4YO9A 1ANEA 4AOQA 1O30A 3Q3XA 3SU6A 2OP9A 3MH4A 2XNIA 1HRTH 3EA9A 5A0AE 3UFAA 1UTOA 1J9CH 1GMCF 1HAPH 1S84A 2BXTH 1TPAE 2ASUB 1MTWA 2I6QA 3ELAH 1FQ3A 3M5OA 5TJXA 2AS9A 2HWLB 1GG6B 1A5GH 2WYGA 2O8WA 3S69A 1F92A 2HNTE 3QO6A 4Z6AH 1P03A 2GV7A 3E0NB 1MTNB 2PTNA 3RXDA 2B7DH 4IW4E 1N1LA 4I32A 3TNSA 4JZDH 1TRYA 1LPZB 1SGNE 2DE9A 3R3GB 3KEEA 2QC2A 2OCVB 3BIUH 4TWYA 1FJSA 1BITA 1VJAU 2ZKSA 1IQGA 3PLKA 4A1VA 2A2QH 3ZZ6A 2NU0E 3E0PB 4X1QU 3DD2H 2XCNA 5B6OA 1GJ4H 4CRDA 3LGVA 1Y8TA 4YESB 3UOPA 5EPYA 1INCA 1XUGA 1JBUH 1NY22 2ZO3H 2BD8A 1GJ7B 2WPHS 3BIVH 1QL7A 4OGYA 3SJIA 3QZQA 3SU3A 1QL8A 1JRSA 4FUIA 1CVWH 1W11U 1JMOH 1H9HE 3K65B 2OLGA 4B2CA 3AASA 1FY3A 2IJOB 3RC6A 4XBBA 1ETSH 2GX4A 3VEQB 1GHAF 2J92A 1QR3E 2YOLA 2ZI2H 2A1DB 4ZAEA 4X0WU 2PUQH 2GV6A 2BB4A 2V6NA 5C2ZA 2Q6GA 4BAMB 4UFDH 3MNXA 3ZVBA 2ODQA 5JPMH 1OSSA 3BTKE 5ABWA 3A8BA 2ZTYA 2ANKH 3QK1A 4MLFB 1QL9A 3KQDA 4JYVH 2ZHQH 2VWNA 3RM2H 1T4UH 1GCDA 1GI5A 1YYY1 2BVXH 3BTGE 1G3DA 4MPXA 1Y3UA 1UMAH 2FLRH 2H9EH 2J38A 1O5DH 5HGGA 2CV3A 3QN7A 2IOTA 4I8KA 3O8DA 1T8NA 1Z6EA 1O3NA 2C4FH 1GL0E 1ELBA 1V2QT 2VH6A 5E8EH 2Y7XA 3M36A 3O8BA 1J16A 3A84A 1C2EA 2VH0A 4THNH 2XWAA 1CBWB 2SGFE 4WMDA 1XX9A 1JIMA 1DDJA 3A88A 4K1SA 3RXIA 1THSH 4NWKA 8LPRA 3NKKA 3A7ZA 4MVNA 3BTEE 1FLEE 2F3CE 5PTPA 2RCEA 1W3CA 3D65E 3EGKH 1LKAA 1CHGA 1CGHA 3GCOA 1Y59T 2F9UA 1ETRH 2HPQH 1ELVA 2GMTB 1TFXA 3U8RH 3GCTG 3A8CA 1O2WA 4UE7H 2F83A 5A09A 3BG4B 1C9PA 1MKWK 1ZZZA 1KLJH 2H1UA 3PWCA 2FI3E 2FYRA 2IN2A 5T6DA 1C5ZB 4FUCA 1YF4A 1LVOA 1YP9A 1HAZB 4JZFH 4E05H 4XBCA 3RC5A 2AGIX 2BD2A 1JOUB 1E34B 2HVXA 2B9LA 4HGCA 9LPRA 1UK4A 2Y82A 5C1UA 3C27B 2WV4A 1P04A 1FONA 2WPKS 4X1RU 1NRQH 1V2MT 3F6UH 1IQKA 1IQJA 1ELGA 4Q2KA 1XVMA 3Q00A 1E0FD 4YLQH 2OUAA 5E0JA 1HAXB 1QA7A 2BLWA 2BQWB 2RA0A 3SGQE 3U98H 5EQQA 1S82A 2P16A 1EAXA 2NWNA 1IHSH 1GHXH 2ZPRA 1HAOH 1KIGH 3RLWH 1P2MA 4FU7A 2FO9A 3ZVAA 1O3DA 1WSSH 1BTXA 1HNEE 1O0DH 1SBWA 1F5LA 2BOKA 3GCTF 1G2LA 4X1PU 1B7XB 4U01A 3ZVGA 1BTZA 1ZSKA 2AMQA 1KY9A 1FY5A 3GY6A 4LZ1H 1RFNA 2GDEH 2AFQB 1GHBF 1UVTH 2QCYA 1T8OA 2SFAA 4ABBA 5A8YA 2BDCA 1DANH 3RXAA 2EI7A 1GJAB 4ZXYH 1TOCB 1A5IA 3MO6A 4Y0YE 4ABAA 1MTVA 2F9NA 3LPRA 4AYVB 2XC0A 3E16B 5IDKA 1IOEA 6GCHG 4IC6A 1FNIA 3SV7A 2FS9A 3SNDA 4DURA 4MDSA 4AFSA 3AVZA 1DWEH 4BXWA 2FPZA 4RN6A 3VXEH 1WBGB 3BTWE 2SGAA 5DG6A 3URCA 1K1OA 1ZGVA 5LPRA 4NG9H 1GHVH 3ZV8A 1X7AC 1HJ8A 5JB9S 1UTLM 4YOGA 2FOHA 3FANA 4DOQA 2FOFA 3Q76A 1QRWA 3PTNA 1GDUA 4A5TS 3SI4H 2W3KA 5FX5A 1UTKA 3MU4A 1BQYA 1C1TA 1P3CA 4YOIA 5EOKA 1UK2A 4R8TB 3QGNB 1ELFA 3BF6H 5JBCS 1TBZH 4BAQB 2TRMA 5F6MA 1SLWB 1A1RA 4F4OC 3RXBA 2OC1A 1P8VC 4TY7A 1P2KA 4GCHG 5E2PA 5J4QA 1PYTD 3S9AA 2UWLA 3DA9B 4JYUH 1TABE 2BZ6H 2VWOA 1EJNA 5HMAA 3V7TA 2SGPE 1HB0B 1P2QA 3LT3A 1C5VA 2RA3A 1O32A 2YNBA 1P01A 2BM2A 3OSYA 3LC3A 3SNAA 1EP5A 1UK3A 2V0BA 3MHWU 1HLTH 1P2OA 4CRGA 1XXDA 3Q3KA 2W7SA 3RM0H 2AIPA 3RXSA 3UR9A 4CRAA 2B0FA 3E6PH 1LVBA 1C5WB 3MU0A 1DXWA 1EB1H 1MKWH 5LPEA 2BQ7B 1DICA 1DWDH 3ZV9A 1P05A 1SHYA 3B8JA 3M3VA 3TK6A 1V3XA 3SUDA 4FVDA 1C2MA 2BD7A 4UFGH 1T7CA 2ZDVH 3GOVB 4GPGA 3EA8A 1FPCH 3DUXH 4KKDA 4A7IB 3PWBA 3BEFB 3T26A 5C1XA 1S6FA 1SQOA 1BB0B 3LGYA 1BCUH 2QN5T 1P3EA 1O3IA 1PYTC 4FU9A 5GXPA 3SU1A 1ZTJA 1FDPA 3U1JB 1CT2E 1A0HB 4JK6A 4CH2B 5G4BA 4A92A 3TIUA 1BZXE 2JETB 5E0GA 3FFGA 1RS0A 1LHFH 3MO3A 1K1PA 4MNXA 5L2ZH 3TVJB 1Z7KA 3DHKH 1SFQB 4AB9A 1AN1E 2AH4X 4K60A 2A4GA 2Y80A 1SGPE 1SG8B 2HNTC 1GHYH 1H9IE 1ZRKA 1H8DH 1FMGA 2J95A 2BLOA 4MTBA 2R2WU 2W7UA 3RLYH 2PFEA 2J9NA 1LDTT 1BTYA 2ODYB 3V3MA 1TGTA 1A0LA 2C90B 3GCNA 2ZFSA 2A2XH 1BDAA 3D49H 1QGFA 5AF9H 1LO6A 3RXMA 3UPEA 3P8GA 4NIVA 1TQ7B 1WU1A 3KQBA 4GVUA 2G5NA 1F0RA 4FUJA 1PPHE 3T28A 2STAE 2EC9H 1L1GA 1VITH 5ESBA 1EP6A 2XBYA 1FPHH 4K2YA 1YKTA 2SGQE 2XYAA 3UWIA 3NCLA 1LPKB 2ZGXH 2O8LA 5T6GA 4K69A 2Z6BD 1P2JA 1L4DA 2V35A 3K9XB 3TITA 2C8XB 4ABHA 4YT6H 2I6SA 1KLIH 1GI6A 1CA0C 1O33A 1AZ8A 2ZEBA 5GCHG 2C8WB 2J94A 3L33A 3URDA 4K1EA 4YTAA 2ZDAH 3MOCA 1GJDB 1YPHE 4KTCA 1YM0A 1SFIA 1TGBA 1HBTH 1HV7A 1C5NH 4X8TH 1MD8A 1DOJA 1GMHG 5TCCA 1AD8H 2FOCA 1C5LH 2Z3EA 1NPMA 3NPSA 3UQVA 3G01A 3H7OA 1ZPCA 1C1PA 1BMMH 1NM6A 3N7OA 4O3UA 4O9VA 2SGEE 3PTBA 2F9PA 5FX6A 1LQDB 4O3TA 5C3NA 4F49A 1SLXB 2D2DA 1MZDA 4ABIA 2HLCA 2O8TA 3IG6B 2TPIZ 3QTVH 1ZSJA 4ISHH 4Y8ZA 2CF9H 3A8DA 1GDNA 2OBOA 4X6OA 1AB9C 3HGNA 3KCGH 1RXPA 1C9TA 4TY6A 5AVDA 3FP8E 2ZHDA 1KXFA 1V6DA 1BOQA 2TBSA 4HI3A 1NRSH 4OS6A 5GCHF 1C1RA 3ZZ9A 1FAXA 1TPOA 1XKAC 2WPJS 4X8UH 3PLPA 1UCYK 3HPTB 1S5SA 1O5GH 3GY5A 3MNSA 1SL3A 1SGFA 2FMJA 3LU9B 1BIOA 3GISB 2R0LA 4BTIB 1C4V2 5C5OA 1C1OA 5E0HA 2VWMA 2WUBA 2PWXA 1D6RA 1W10U 1YBWA 3TU7H 3V0XA 4WH6A 3P6ZB 4KP0A 3ZZDA 3HK3B 2SNVA 2PHBA 3BEUA 2QXJA 2A5KA 2ZFTA 2VIPA 3PB1E 1TNIA 3S0NA 4IN1A 2G8TA 1FN6A 1O3FA 3P8FA 2VIVA 1BA8B 1PQ8A 2ZPQA 3B9FH 1A61H 3M61U 1LCYA 1BUIA 3KN2A 1V2JT 1NFUA 1O34A 4UEHH 2ZHWH 1GWAA 4Q7ZA 1XUHA 4ZH8A 4ABEA 1TNKA 3BTDE 5BPEA 4JCNA 1K1IA 4Y79A 1AHTH 1O2HA 4JK5A 3RU4E 1NU7B 2D1JA 5F8XA 2ANMH 3A87A 1SVPA 4YLUA 1AVXA 1EOJA 3ATKA 1BBRH 1NFXA 1NTPA 4ABJA 2P94A 4ABDA 1Q31A 2BY8X 1DFPA 3ZZ7A 1EATA 2NU1E 1V2WT 3E90B 3CENA 2JH5D 5FCKA 2FI4E 1EPTA 1P0SH 2CJIA 2ZHFH 5FPSA 2B8OH 3M35A 4LOYH 3UR6A 4A6LA 4KGAA 3NWUA 1O2XA 4DW2U 5K0HA 4WVPE 1YPLH 1LPGB 1QJ1B 1Y3YA 4LZ4B 1F7ZA 3CP7A 5EPNA 1XUFA 1L4ZA 1FV9A 1O2JA 2G4TA 3TPIZ 1H1BA 4X1SU 1QIXB 4GHQA 5L2YH 4D7FA 1K1NA 1IQIA 4B1TA 1EPTC 1WTHD 2PR3A 1ZMNA 2AMPA 5JBTA 3V12A 3SW2B 5JYIA 3S7HB 1GBKA 4HTCH 4J2YB 1PPBH 1NFYA 4AGJA 2G55A 1AMHA 1D6WA 4I7YH 1MBQA 3TGJE 1GHWH 1SGQE 3P70B 1EZUC 1WCZA 3MMGA 4NIYA 5LPFA 5EW2H 4I8LA 1YPEH 5FPYA 1IAUA 1GVLA 1QB1A 1L1JA 1C5OH 2QIQA 2Z3DA 3D23A 1ELTA 5F03A 2BDGA 3OYPA 1DLEA 3MYWA 2OC8A 1Y5BT 4OS5A 1CA8B 1HJ9A 1SGEE 1AZZA 5T6FA 2P3TB 4ZHLU 5LGOA 3A83A 1Z8JB 2TGPZ 5SGAE 1KXCA 1T31A 1BJUA 1P02A 2LPRA 1PPFE 4FUGA 5EU8A 2BHGA 1IHTH 4IBLH 4I8HA 1GI1A 1MZAA 1AFQC 3D62A 2A7CA 1TIOA 4AFQA 3O8CA 1CA0B 1WQSA 3F1SB 3UREA 4X2YA 5A8ZA 5HM2A 1A0JA 1UCYH 1CU1A 3LOXA 5C5NA 1YPMH 5DGJA 2ZGCA 4RKOB 2XTTB 2GZ7A 4NZQA 1TE0A 2F91A 2OD3B 4I31A 3ITIA 1QB9A 3A7VA 1Z1IA 3RP2A 4CREA 1A3EH 4J1YA 2Z9LA 2Z9IA 1P9SA 1MQ6A 2JETC 2QXHA 3M37A 2W3IA 1WUNH 2H5DA 3T25A 3Q77A 1PQAA 2XXLA 4B76A 4YM9A 1OOKB 2EI8A 1EQ9A 1AO5A 4ESTE 1DY8A 1B0EA 4MQAA 4MNWA 1TX7A 3NXPA 2VIOA 1WYKA 2PW8H 4Y11E 1AB9B 1OWDA 2G81E 3IWMA 4BTUB 3U1IB 2C8YB 1KSNA 5EQRA 3GYMA 1ACBE 5A2MH 3LDXH 3P17H 4K1TA 3ZVEA 3P8NA 4DY7B 5C20A 2K1QA 1OP8A 3M5LA 1O3JA 1G3BA 1OWHA 3VGCC 1HAVA 3ATWA 3LGUA 2J2UA 1C5MD 1KDQA 3TH4H 4UD9H 4BOHA 1QA0A 1B0FA 1YLDA 1ESTA 1VGCC 1SC8U 3U9AH 4CR5A 2WV5A 1Z6JH 3BTME 3OU0A 4BNRA 2BVSH 4MPUA 4JZEH 5H4IB 4R0IA 1O5FH 1YPKH 1RJXB 1XKBC 5L30H 2A4QA 1AUJA 5FHTA 2A45B 2ALVA 3MU5A 2ZCKP 2GZ9A 3DFLA 4FUEA 2TGTA 1ARCA 1O35A 3FVFB 1TPSA 1NN6A 1QRXA 4K5ZA 2Y5HA 1SR5C 1W7XH 3LKWA 5DP7A 1HAYB 3TGKE 1G32B 1S0QA 3DT0H 3KL6A 3UIRA 2BQ6B 2ZGBH 5DP9A 1VJ9U 4NIWA 4Q7YA 1XMNB 4Y8XA 1D3DB 3AW0A 1SGTA 1FI8A 2O8UA 5C1YA 1HIAB 3T29A 1BTPA 2Z7FE 1VZQH 4B71A 3S7KB 1IQFA 4Y7AA 5FBEA 8GCHG 1J8AA 3ZVDA 1HYLA 1C2KA 3SGBE 1Z8GA 4UDWH 2VWLA 4NA9H 1YPHC 1H4WA 1JRTA 2H6MA 1PFXC 1PQ7A 5C67A 1OXGA 2AYWA 2ZQ2A 4A1TA 2PGQB 1CHOG 1EASA 5GWZA 4ZKNU 1TNGA 2XBXA 2PV9B 4NFEA 1ZTKA 3SUFA 3S9BA 4BAHB 2GP9B 3VB3A 4GLYA 1CO7E 2FTMA 2EA3A 2C93B 1V2UT 3A7WA 1O5EH 3BTQE 3MH7A 3SNCA 3UOUA 4X6PA 4ISIH 3BTTE 4INHA 1AY6H 5GIBA 2VVUA 3L3TA 1O2LA 2J4IA 1SGYE 2XCFA 1OWKA 1EPTB 2OQUA 4IMZA 1Z71A 1MKXH 1Q3XA 4D76A 1SGDE 2TGDA 1O31A 1M9UA 1VCQA 2VNTA 2FP7B 1EZQA 3MTYA 1O2GH 1SSXA 1ELAA 1YLCA 3SJKA 1TONA 1D9IA 2PTCE 1C1MA 4ZXXH 4NCYA 3NK8A 3SN8A 2YNAA 3A7TA 4B2AA 2C3SA 2FS8A 3GY8A 1F0SA 1J14A 4FU8A 3E3TA 3TLOA 2LNCA 2D8WA 3QX5H 4DG4A 3M7TA 2G4UA 2CN0H 2JKHA 1TWXB 3SUGA 1CSOE 1SOZA 2ZU2A 4MPVA 2FDAA 4CBNA 1P09A 1BTHH 2XRCA 1AE5A 1SB1H 1C1SA 2NU3E 1BHXF 4ABGA 2HALA 1O2MA 3GDUA 6GCHF 1OP0A 1D4PB 4ZROA 1MAYA 4TWWA 2Z9JA 4WF8A 2R2MB 1HXFH 1SGIB 4KELA 1TNJA 5DKMA 4Q7XA 2UUFB 4BAKB 1AFQB 1HJAC 3P8OA 5EODA 1F2SE 1GJ9B 3VB4A 5GDSH 1W13U 2CHAC 1O2UA 3UQOA 2NU4E 6CHAB 1DLKB 3RXEA 1ABJH 3RXFA 7GCHG 1O3MA 3W95A 3TH2H 4K8YA 3SV8A 3RXQA 1GL1A 1ZPZA 2PLXA 1GBTA 3Q3YA 1EZSC 2IPHA 2XW9A 3PMAB 3MI4A 2KAIA 1K1MA 4D8NA 4DIHH 3EQ0H 2SNWA 3F9EA 1HXEH 4WXIA 2P3UB 1Y3XA 1G9IE 1HUTH 4D9RA 1A46H 4IC5A 4CR9A 4GCHF 1S0RA 1O2VA 1CGJE 1O2PA 1S83A 2FOGA 2VINA 1JXPA 1NU9A 3LH1A 2BDYA 1F5KU 4BXSA 5ETXA 2GD4B 1NC6A 3FAOA 4NSYA 3E8LA 5LH8A 1QJ7B 3GCHC 1RTKA 1P12E 1E37B 2ULLA 4MPWA 1GJ5H 3DFJA 4IS5A 1UO6A 1C1NA 2BOHB 4AFZA 1ZPBA 3TJVA 1A7SA 1UHBA 3SJ9A 4ZMAH 2ZDNA 1OX1A 4ZKSU 1OS8A 3QZRA 3VGCB 1UVSH 1DUEA 1NRRH 3ENSB 4M7GA 1NROH 4QT8C 1RRKA 4XFQA 2PSYA 4FXGH 1VGCB 1C5UA 1YCPM 2VGCB 1A5HA 3EA7A 2ZNKH 2ZFQH 1YPGH 1PPEE 2ANWA 3BV9B 1BBRK 4FUFA 3PROA 3VB7A 1KXDA 3HKIB 1HAVB 1ZGIA 3PYHA 1C5RA 3TJUA 1KDQB 1C2DA 3MH6A 1EX3A 1QFKH 4H4FA 2P3FH 3M7QA 1V2RT 4YT7H 4TYDA 2ZDLA 3SNEA 2BD3A 1W8BH 1SMFE 3RMOH 4X6NA 3KF2A 2BD9A 1V2KT 1QURH 1LVMA 1T32A 1O3LA 2H5CA 3ODFA 1WQVH 1BMNH 1LTOA 2WPIS 2HOBA 1C2GA 1PPZA 2Z94A 1F5RA 4WWYA 1ANBA 4I8JA 3SV9A 3E1XB 1O2NA 2BLQA 2ZTZA 4AZ2B 3A85A 1O3BA 4ZUHA 4GHTA 4NA8A 1QNJA 1SPJA 2OINA 3A7XA 1V2VT 1TX8A 2FLBH 1EOLA 3K6YA 3OX7U 1UVPA 2QXGA 1QCPA 2VJ1A 1QJ6B 1AQ7A 2OBQA 2EI6A 4GUXA 1V2TT 1AWHB 1J15A 1Z8RA 3C1KA 1RTLA 2BD5A 5FBIA 3CS7A 4ZKOU 3U69H 4OGXA 3EYDA 4IGDA 3MNBA 1MCTA 1P11E 3GY2A 1RIWC 5TCAA 4NGAH 1FY4A 3P95A 4Y8YA 1JWTA 1FAKH 3ZZCA 1A2CH 3BSQA 4UFFH 2THFB 1K2I1 2ZC9H 1L2EA 2AEIH 1S81A 1RD3B 1TOMH 3TGIE 2VU8E 4UONA 1BMAA 3CS0A 3QTOH 3UNSA 2ZG0H 3SNBA 2PKSC 2FWWA 3FZZA 5F8ZA 1UTQA 2ZHEH 1ELCA 2Y5FA 3KIDU 1YCPH 4AG2A 3VFEA 2ESTE 1QBVH 1GBDA 1O3KA 3KQEA 1MUEB 3RXUA 1Y3VA 1GMHF 1GVZA 2JH0D 2VB0A 2Y81A 1TQ0B 2M5TA 5JBAS 1MBMA 2FEQH 1ZHPA 3MFJA 1T8MA 2PSXA 2A4RA 4U2WA 4DVAU 1VITG 2BDHA 3GICB 1TALA 4DGJA 1ESAA 1MQ5A 3O8RA 4LK4A 1PJPA 1HIAA 3GDVA 3GY7A 1C2LA 1CT0E 1TGNA 1AUTC 9ESTA 2H9TH 1TMTH 2CXVA 1BRBE 1ZR0A 2UUJB 3A89A 5J4SA 1C2JA 3BTHE 3SU2A 1HJAB 1NESE 2Z9GA 3RXLA 1SGFG 2DE8A 3LJOA 5FAHA 1L0ZA 3M5NA 2CHAB 1DT2A 4ABFA 1FY1A 1NZQH 1K1JA 4DT7B 1TRMA 1GBLA 1KXBA 3H5CB 4Y0ZE 1N6YA 4H6TA 2WPLS 2AERH 5FPTA 3RXRA 4XBDA 2VIQA 1AVGH 1O37A 3PO1C 5EXMA 4AYYB 2ODPA 2ZDKA 4I33A 3LONA 2UUKB 1DPOA 4AG1A 2WINI 4VGCC 2A7HA 4Q80A 3T5FH 3BTFE 4NZLA 3ZYEA 2SGDE 4BANB 3QUMP 1TRNA 3SOSA 1TA2A 1MAXA 1MTUA 3SU4A 3STIA 2GGVB 1VITF 1O2IA 3TJOA 2KAIB 3PM3A 4CBOA 1C5YB 2Y6TA 2A5IA 3TJNA 1ZTLA 1UTNA 3LGWA 3GCHB 3U8OH 1H9LB 1Y5UT 2QV1A 5JDUB 1MU6B 1HPGA 1B5GH 1GHAG 5ESTE 2FYQA 2PKAA 3OY6U 3L6PA 3LGTA 5FXLA 3NUMA 2QXIA 1XUIA 3F9GA 4ISOA 4X8VH 3ZZ3A 1MTSA 5DK1A 4NSVA 1K22H 3I29A 1N8OC 3SV6A 1QQUA 4TPYA 2A5AA 4DJZB 1UVUH 1GCTC 3A82A 5DP5A 3RMLH 1OYTH 4HFPB 3EAJA 2BYAX 3TK5A 5FCRA 1HFDA 2WUCA 4E7NA 2ZTXA 4X1NU 2R9PA 4B75A 3RU4T 1GJCB 4NA7A 4XOJA 2O8MA 1UHBB 1O3OA 1QBNA 1Q2WA 1DWCH 2F9VA 3SV2H 1Z8IB 2HRVA 1OWIA 4AFUA 1GBCA 2R0KA 1SLVB 4X8SH 3WY8A 3KQCA 2GDDA 2BDAA 1C1VH 6LPRA 1HAGE 3S9CA 1O3GA 2BTCE 2ZPSA 4D7GA 1GI2A 4JZ1A 3LC5A 1EB2A 3RXGA 1ZMJA 1C4U2 1Z1JA 1ANDA 3RXVA 2G00A 1VCPA 1TMBH 3VXFH 2XC5A 3LGIA 3PMJA 3LIWA 3MNCA 5I25A 3UY9A 4NIXA 2AGEX 2QF0A 4H6SB 2STBE 6CHAC 1GI4A 1MKXK 1ZRBA 2GZ8A 2JH6D 3LJJA 1GBHA 1GBAA 1SHHB 4Y10E 1O5CB 2P93A 2FZZA 2A31A 1IQHA 1C2HA 1ESBA 1GI8B 1KXEA 1ELEE 3AW1A 3SHCH 1BRAA 2WPMS 4NFFA 4WY3A 4B73A 3SQEE 4UFEH 2A4OA 3U8TH 3ESTA 1AE8H 4CHAB 2D26C 7LPRA 1C2FA 3RXJA 2BZAA 5AFZH 8KME2 5I46H 4CH8B 1TGCA 1FUJA 2FESH 1O3HA 1DM4B 1S85A 3A86A 3SQHE 1RIWB 3A81A 1GHZA 3QWCH 1BRCE 2UWPA 1TYNA 2QYIA 3QLPH 2XBWA 1ID5H 1ANCA 1ZJKA 1XUJA 2BY6X 4SGAE 1V2PT 2P8OC 2Z9KA 5JBBS 1C5PA 3STJA 2TIOA 4ZHAA 1NT1A 1T8LA 1O2RA 1W7GH 1O38A 1LKBA 1TX6A 3A80A 3HGPA 1GJ8B 3MU8A 4CRBA 2Q1JA 5DP6A 2FXRA 4INLA 5GJ4B 2PKSB 1OP2A 1C5XB 1TBRH 5K7RA 2FM2A 1SQTA 4XSKU 1KTTB 2VGCC 2P95A 1CT4E 1EZXC 4ISNA 1LMWB 2OC0A 5EGMA 4WMEA 5CMXH 2XC4A 1O2QA 2GCTC 3SU0A 2FOAA 1TGSZ 1EAWA 1K21H 4O97A 5JB8S 4OS7A 1FY8E 1H8IH 1GHBG 1XUKA 4X2WA 1ZJDA 2A7JA 2ZCLP 3PMBB 4X2VA 2BXUH 3A8AA 3M7UA 2GT7A 1EAIA 1K28D 2ZIQH 4ASHA 1KXAA 3UNQA 4BAOB 5A0CA 3ATIA 1TBQH 3SZNA 1JIRA 1HCGA 4A1XA 3RC4A 3UUZA 3RXKA 1ORFA 2Y7ZA 1C1UH 1NO9H 1EXFA 4DIIH 1TPPA 4AB8A 3KNXA 1BTWA
chains in the Genus database with same CATH superfamily
2ALPA 2QY0B 4FVBA 1P2IA 3UTUH 1GI0A 3QDZB 4GSOA 1ZYOA 1ARBA 2ZWLH 1NRNH 1E1QD 2G52A 1MH0A 1O2OA 2Y5GA 1L1NA 1O2YA 1SQAA 1E35B 3PO1B 1OKXA 1UTPA 2V7QD 1HAIH 4B74A 5DJ7A 3SJOA 2QAAA 1ZHMA 4X6MA 1O3CA 1O2TA 1UTMA 4JZIA 1K1LA 1TNLA 4VGCB 4U30A 2G51A 1SI5H 2ANYA 5DO4H 3SUEA 1BMLA 1THRH 2HGTH 5DP3A 2F9BH 1BTUA 4Y6DA 4HG6A 1HAHH 3HK6B 3SBKA 1A3BH 2A0QB 2VIDA 4OS1A 2ZU1A 1XVOA 5C0TA 2CF8H 1TMUH 1V2LT 2GKVE 2W5EA 1LHCH 1FXYA 2GTBA 2FOEA 4INKA 4MG3A 4OS2A 1C2IA 2ZFFH 1DY9A 4IN2A 4KTSA 4ZKRU 2BX4A 1AGJA 1G37A 7ESTE 3V13A 4JYTA 2Q6FA 1HGTH 1V2OT 4NWLA 4WJG2 3TNTA 4ZHMU 1BMFD 3OTJE 1N8OB 2BDBA 1P9UA 1GCTB 4XE4A 8GCHF 3RXHA 2ZFPH 1DXPA 1EAUA 2ZF0H 3FP7E 3SO3A 2QF4A 1LHEH 2OXSA 3PLBA 1GBJA 4JMYA 2PKAB 2FOMB 1AU8A 2R3YA 3RMMH 3MH5A 1O3EA 2FTLE 1T4VH 3RU4D 1ELDE 3EE0B 3UNRA 3GY4A 5CHAC 2KCOA 3RUOA 2L6OA 3R0FA 1G3CA 2XBVA 1CHOF 1D3PB 1AFEH 1F0TA 1AKSA 2BX3A 1E38B 3GYLB 1WAYB 2XWBI 2H2ZA 3HATH 1CGIE 1PPGE 4LXBH 2PGBB 1V2NT 1LQEA 1G36A 1YC0A 3ZZ4A 1W2KH 4TPIZ 1DSTA 3M5MA 3T62A 1C1QA 2OTVA 3ZVFA 4D9QA 1C1WH 2VVCA 2BDIA 2UWOA 2GVFA 3BN9A 3BG8A 3VB6A 1DX5M 1YGCH 4HZHA 2A32A 1GBBA 2QF3A 1EKBB 2ZP0H 1VCWA 3MQKC 1WV7H 2OC7A 1GGDC 4MNVA 2LP6A 1ZLRA 2BY9X 1TB6H 1D3TB 1BJVA 2LELA 5DP8A 4SGBE 2BY5X 1P10A 1OYQA 2BY7X 3SHAH 1FIZA 1P57B 4WXVA 4U32A 1O3AA 1O3PB 1ZOMA 4WMFA 1TA6A 1YCPK 1C5QA 1OWJA 1BBRE 2FODA 1DITH 7KMEH 1G3EA 3AAVA 3JZ1B 4FOUC 5AFYH 3T2NA 1PQ5A 1Y3WA 2ZFRH 2QGRA 4Y76A 2EEKA 1W0YH 2P59A 1SOTA 1G2MA 1GBFA 2CGAA 2ZZUH 3K2UA 5GPIB 4H42U 1VR1H 4FUDA 5CE1A 3TK9A 1O39A 3ODDA 1E36B 2B5TB 3RXCA 3H7TA 4FUHA 1IQMA 3DCLA 1DS2E 1YPJH 4GAWA 2P8OB 3OY5U 2V3HH 4E06H 1AVWA 3E91A 1U6QA 1TLDA 1GBIA 1GG6C 3A7YA 3EDXB 2W26A 3SORA 2FIRH 2ZCHP 2BD4A 1J17T 3F9HA 1QBOA 2KFWA 4CRFA 1O2ZA 1GI3A 1MTNC 1P2NA 1MD7A 1KLTA 1EJMA 3LH3A 1ETTH 5L6NH 1GPZA 7GCHF 3MO9A 4B6FA 4FUBA 1S6HA 5IYTA 2DUCA 3ZZ5A 1GDQA 2BVRH 2VVVA 4WH8A 2GCTB 4Y71A 3RXTA 1DE7H 4BTTB 3ATLA 1THPB 3SU5A 1QB6A 1W0JD 4E7RG 3BEIB 5EXNA 3SJ8A 3I77A 2R3UA 1Y5AT 3M3SA 3ZVCA 1OPHB 1GVKB 1QHRB 1XM1A 1WOFA 2O9QA 1MMJN 3B23B 1GBMA 1GMDG 1N6XA 1MCVA 4RSPA 1TAWA 3FO8D 3KHVA 1RGQA 3UWJH 4DCDA 1UVOA 2VIWA 2C8ZB 1UCYE 1NRPH 2HNTF 3W94A 2GT8A 2FOBA 3DSGA 1LVYA 1RTFB 3M3TA 2GJGA 2PUXB 3RXOA 2UUYA 3T27A 2ZA5A 3RMNH 3RXPA 4YZUA 3I78A 4K8BA 3K6ZA 2AIQA 4ISLA 4CHAC 3GY3A 1CE5A 1NFWA 1AWFH 4XDEA 2ILNA 3KGPA 5EQSA 5F8TA 1W0ZU 1IQLA 1O5BB 4AGKA 3TH3H 3ZYDA 1A4WH 1BHXB 1FIWA 1GJ6A 3IITA 3ZZ8A 1TNHA 3VB5A 3SI3H 2GCHG 2ZDMA 5A0BA 1C5SA 2HPPH 2ZQ1A 4RI0A 3VPKA 1GBEA 1DWBH 3ATMA 4O03A 1O2KA 3GDSA 1HDTH 5HM9A 1NBME 2QA9E 4F48B 1FN8A 1GI9B 1ABIH 3F68H 1E1RD 4Y7BA 1AI8H 4PROA 1GMDF 1SKYE 1O2SA 1CBWC 4OM9A 8ESTE 1ZSLA 1KTSB 1O36A 2BLVA 2V3OH 2WYJA 3ZZBA 4AX9H 4CRCA 4I86A 1ZHRA 2FX4A 1AIXH 1EUFA 4OS4A 2H9HA 3RDZA 2RDLA 1W14U 5HYOA 4I8GA 1GI7B 4KTUA 5EW1H 3ZZAA 1UTJA 1IQNA 2NU2E 4X2XA 1KYNA 1O5AB 2ZECA 2BMGB 4Z0KA 5AHGH 1BRUP 5CHAB 2OQ5A 1SGRE 3NZIA 2GMTC 3HKJB 1DUAA 1QQ4A 1QTFA 3BG4C 1IQEA 3QGJA 4K3JA 1LHGH 2Q6DA 1D3QB 1GMCG 2FX6A 4YOJA 2AMDA 2W6JD 3PMHB 1SLUB 1GJBB 2ZGHA 2ZU5A 4ZCNA 3SZEA 3MU1A 1V2ST 2GCHF 1QRZA 1C5TA 3JZ2B 1CQQA 2G5VA 3FP6E 1AKSB 4MNYA 5DP4A 5E2OA 3F9FA 2TGAA 2Z3CA 1MU8B 4AORA 2FI5E 1DSUA 1OWEA 2ZU4A 1NS3A 1K9OE 4IMQA 1DVAH 4RKJB 5EG4A 3PV4A 2J34A 5A8XA 3FZDA 1GGDB 3P92A 2F9OA 2CMYA 1FZZA 1G30B 5T3HA 1WTGH 2ZGJA 1UJ1A 4AN7A 2AGGX 1EJAA 1F0UA 1LHDH 6ESTA 2RG3A 1P06A 1BT7A 1PPCE 2KCAA 3MWIU 5DPAA 5BRRE 1C4Y2 3FOAA 3SGAE 1YY3A 1XXFA 5HXFA 3AAUA 1ZMLA 4B2BA 2ZU3A 1QY6A 1SGCA 5EXLA 1W12U 4YO9A 1ANEA 4AOQA 1O30A 3Q3XA 3SU6A 2OP9A 3MH4A 2XNIA 1HRTH 3EA9A 5A0AE 3UFAA 1UTOA 1J9CH 1GMCF 2OK5A 1HAPH 1S84A 2BXTH 1TPAE 2ASUB 1MTWA 2I6QA 3ELAH 1FQ3A 3M5OA 5TJXA 2AS9A 2HWLB 1GG6B 1A5GH 2WYGA 2O8WA 3S69A 1F92A 2HNTE 3QO6A 4Z6AH 1P03A 2GV7A 3E0NB 1MTNB 2PTNA 3RXDA 2B7DH 4IW4E 1N1LA 4I32A 3TNSA 4JZDH 1TRYA 1LPZB 1SGNE 2DE9A 3R3GB 3KEEA 2QC2A 2OCVB 3BIUH 4TWYA 1FJSA 1BITA 1VJAU 2ZKSA 1IQGA 3PLKA 4A1VA 2A2QH 4P00A 2IJD1 3ZZ6A 2NU0E 3E0PB 5HIZA 4X1QU 3DD2H 2XCNA 5B6OA 1GJ4H 4CRDA 3LGVA 1Y8TA 3F0OA 4YESB 3UOPA 5EPYA 1INCA 1XUGA 1JBUH 1NY22 2ZO3H 2BD8A 1GJ7B 2WPHS 3BIVH 1QL7A 4OGYA 3SJIA 3QZQA 3SU3A 1QL8A 1JRSA 4FUIA 1CVWH 1W11U 1JMOH 3KQ5A 1H9HE 3K65B 2OLGA 4B2CA 3AASA 1FY3A 2IJOB 3RC6A 4XBBA 1ETSH 2GX4A 3VEQB 1GHAF 2J92A 1QR3E 2YOLA 2ZI2H 2A1DB 4ZAEA 4X0WU 2PUQH 3F2FA 2GV6A 2BB4A 2V6NA 5C2ZA 5C0UA 2Q6GA 4BAMB 4UFDH 3MNXA 3ZVBA 2ODQA 5JPMH 1OSSA 3BTKE 5ABWA 4RT0A 3A8BA 2ZTYA 2ANKH 3QK1A 4MLFB 1QL9A 3KQDA 4JYVH 2ZHQH 2VWNA 3RM2H 3DSPA 1T4UH 1GCDA 1GI5A 1YYY1 2BVXH 3BTGE 4FETA 1G3DA 4MPXA 1Y3UA 1UMAH 2FLRH 3F2HA 2H9EH 2J38A 1O5DH 5HGGA 2CV3A 3QN7A 2IOTA 4I8KA 3O8DA 1T8NA 1Z6EA 1O3NA 2C4FH 1GL0E 1ELBA 1V2QT 2VH6A 5E8EH 2Y7XA 3M36A 3O8BA 1J16A 3A84A 1C2EA 2VH0A 4THNH 2XWAA 1CBWB 2SGFE 4WMDA 1XX9A 1JIMA 1DDJA 3A88A 4K1SA 3RXIA 1THSH 4NWKA 8LPRA 3NKKA 3A7ZA 4MVNA 3BTEE 1FLEE 2KZ4A 2F3CE 3OE7D 5PTPA 2RCEA 1W3CA 3D65E 3EGKH 1LKAA 1CHGA 1CGHA 3GCOA 1Y59T 2F9UA 1ETRH 2HPQH 1ELVA 2GMTB 1TFXA 3U8RH 3GCTG 3A8CA 1O2WA 4UE7H 2F83A 4Q63A 5A09A 3BG4B 1C9PA 1MKWK 1ZZZA 1KLJH 2H1UA 3PWCA 2FI3E 2FYRA 2IN2A 5T6DA 1C5ZB 3OEED 4FUCA 1YF4A 1LVOA 1YP9A 1HAZB 4JZFH 4E05H 4XBCA 3RC5A 2AGIX 2BD2A 1JOUB 1E34B 2HVXA 2B9LA 4HGCA 9LPRA 1UK4A 2Y82A 5C1UA 3C27B 2WV4A 1P04A 1FONA 2WPKS 4X1RU 3WWBA 1NRQH 1V2MT 3F6UH 1IQKA 1IQJA 2YMSD 1ELGA 4Q2KA 2XOKD 1XVMA 3Q00A 1E0FD 4YLQH 2OUAA 5E0JA 1HAXB 1QA7A 2BLWA 2BQWB 2RA0A 3SGQE 3U98H 5EQQA 1S82A 2P16A 1EAXA 2NWNA 1IHSH 1GHXH 2ZPRA 1HAOH 2KCYA 1KIGH 3RLWH 1H8HD 1P2MA 4FU7A 2FO9A 3ZVAA 1O3DA 1WSSH 1BTXA 1HNEE 1O0DH 1SBWA 1F5LA 2BOKA 3GCTF 1G2LA 4X1PU 1B7XB 4U01A 3ZVGA 1BTZA 1ZSKA 2AMQA 1KY9A 2WHXA 1FY5A 3GY6A 4LZ1H 1RFNA 2GDEH 2AFQB 2VBCA 1GHBF 1UVTH 2QCYA 1T8OA 2SFAA 4ABBA 5CDFE 5A8YA 2BDCA 1DANH 3RXAA 2EI7A 1GJAB 4ZXYH 1TOCB 1A5IA 3MO6A 4Y0YE 4ABAA 1MTVA 2F9NA 3LPRA 4AYVB 2XC0A 2YMSC 3E16B 5IDKA 1IOEA 6GCHG 4IC6A 1FNIA 3SV7A 1COWD 2FS9A 3SNDA 4DURA 4MDSA 4AFSA 3AVZA 1DWEH 4BXWA 2FPZA 4RN6A 3VXEH 1WBGB 3BTWE 2SGAA 5DG6A 3URCA 1K1OA 1ZGVA 5LPRA 4NG9H 1GHVH 3ZV8A 1X7AC 1HJ8A 5JB9S 1UTLM 4YOGA 2FOHA 3FANA 4DOQA 2QF5A 2FOFA 3Q76A 1QRWA 3PTNA 1GDUA 4A5TS 3SI4H 2W3KA 5FX5A 1UTKA 3MU4A 1BQYA 1C1TA 1P3CA 3CNRA 3OTPA 4YOIA 5EOKA 1UK2A 4R8TB 3QGNB 1ELFA 3BF6H 5JBCS 1TBZH 4BAQB 2TRMA 5F6MA 1SLWB 1A1RA 3DSOA 4F4OC 3RXBA 2OC1A 1P8VC 4TY7A 1P2KA 4GCHG 5E2PA 4ACBA 2IPQX 5J4QA 1H8ED 4Q4LA 1PYTD 3S9AA 2UWLA 3DA9B 4JYUH 1VKYA 1TABE 2BZ6H 2VWOA 1EJNA 5HMAA 3V7TA 2SGPE 1HB0B 1P2QA 3LT3A 1C5VA 2RA3A 1O32A 2YNBA 1P01A 2BM2A 3OSYA 3LC3A 3SNAA 1EP5A 1UK3A 2V0BA 5HKKD 3MHWU 1HLTH 1P2OA 4CRGA 1XXDA 3PRBA 3Q3KA 2W7SA 3RM0H 2AIPA 3RXSA 3UR9A 4CRAA 2B0FA 3E6PH 1LVBA 1C5WB 1MABB 3MU0A 1DXWA 1EB1H 1MKWH 5LPEA 2BQ7B 3PV2A 1DICA 1DWDH 3ZV9A 1P05A 1SHYA 2F4LA 3B8JA 3M3VA 3TK6A 1V3XA 3SUDA 4FVDA 1C2MA 2BD7A 4UFGH 1T7CA 2ZDVH 3GOVB 4GPGA 3EA8A 1FPCH 3DUXH 4KKDA 4A7IB 3PWBA 3BEFB 3T26A 5C1XA 1S6FA 1SQOA 1BB0B 3LGYA 1BCUH 2QN5T 1P3EA 1O3IA 1PYTC 4FU9A 5GXPA 3SU1A 1ZTJA 1FDPA 3U1JB 1CT2E 1A0HB 4JK6A 4CH2B 5G4BA 4A92A 3TIUA 1BZXE 2JETB 5E0GA 3FFGA 3W1EA 1RS0A 1LHFH 3MO3A 1K1PA 4MNXA 5L2ZH 3TVJB 1Z7KA 3DHKH 4XRNA 1SFQB 4AB9A 1AN1E 2AH4X 4K60A 2A4GA 2JJ2D 2Y80A 1SGPE 1SG8B 2HNTC 1GHYH 1H9IE 5B6LA 1ZRKA 1H8DH 1FMGA 2J95A 2BLOA 4MTBA 2R2WU 2W7UA 3RLYH 2PFEA 2J9NA 1LDTT 1BTYA 2ODYB 3V3MA 2K8IA 1TGTA 1A0LA 2C90B 3GCNA 2ZFSA 2A2XH 1UW7A 1BDAA 3D49H 1QGFA 5AF9H 1LO6A 3RXMA 3UPEA 3P8GA 1WDIA 4NIVA 1TQ7B 1WU1A 3KQBA 4GVUA 2G5NA 1F0RA 4FUJA 1PPHE 3T28A 2STAE 2EC9H 1L1GA 2WPDD 1VITH 5ESBA 1EP6A 2XBYA 1FPHH 4K2YA 2M2AA 1YKTA 2SGQE 2XYAA 3UWIA 3NCLA 1LPKB 2ZGXH 5KEDA 2O8LA 1QZ8A 5T6GA 4K69A 2Z6BD 1P2JA 4DT4A 1L4DA 3GS9A 2V35A 3K9XB 3TITA 2C8XB 4ABHA 4YT6H 2I6SA 1KLIH 1GI6A 1CA0C 1O33A 1AZ8A 2ZEBA 5GCHG 2C8WB 2J94A 3L33A 3URDA 4K1EA 4YTAA 2ZDAH 3MOCA 1GJDB 1YPHE 4KTCA 1YM0A 1SFIA 1TGBA 1HBTH 1HV7A 1C5NH 2WZQA 4X8TH 1MD8A 1DOJA 1GMHG 5TCCA 1AD8H 2FOCA 1C5LH 2Z3EA 1NPMA 3NPSA 3UQVA 3G01A 3H7OA 1ZPCA 1C1PA 1BMMH 1NM6A 3N7OA 4O3UA 4O9VA 2SGEE 3PTBA 2F9PA 5FX6A 1LQDB 4O3TA 5C3NA 2RFKC 4F49A 1SLXB 2D2DA 2YMSB 1MZDA 4ABIA 2HLCA 2O8TA 3IG6B 2TPIZ 3QTVH 1ZSJA 4ISHH 4Y8ZA 2CF9H 3A8DA 1GDNA 1SQRA 2OBOA 4X6OA 1AB9C 3HGNA 3KCGH 1RXPA 1C9TA 4TY6A 5AVDA 3FP8E 2ZHDA 1KXFA 1V6DA 1BOQA 3F3BA 2TBSA 4HI3A 1NRSH 4OS6A 5GCHF 1C1RA 3ZZ9A 1FAXA 1TPOA 1XKAC 2WPJS 4X8UH 3PLPA 1UCYK 3HPTB 1S5SA 1O5GH 3GY5A 3MNSA 1SL3A 4YXWD 1SGFA 2WV9A 2FMJA 3LU9B 1BIOA 3GISB 2R0LA 4BTIB 1C4V2 5C5OA 1C1OA 5E0HA 2VWMA 2WUBA 2PWXA 1D6RA 1W10U 1YBWA 3TU7H 3V0XA 1YWUA 3P6ZB 4KP0A 4WH6A 3ZZDA 5F53A 3HK3B 2SNVA 2PHBA 3BEUA 2QXJA 2A5KA 2ZFTA 2VIPA 2RDEA 1TNIA 3PB1E 3S0NA 4IN1A 3OFND 2G8TA 1FN6A 1O3FA 3P8FA 2VIVA 1BA8B 1PQ8A 2ZPQA 4ASUD 3B9FH 1A61H 3M61U 1LCYA 1BUIA 4TSFD 3KN2A 1V2JT 1NFUA 1O34A 4UEHH 2ZHWH 1GWAA 4Q7ZA 1XUHA 4ZH8A 4ABEA 1TNKA 3BTDE 3EE7A 5BPEA 4JCNA 1K1IA 4Y79A 1AHTH 1O2HA 4JK5A 5KGOA 3RU4E 1NU7B 2D1JA 5F8XA 2ANMH 4M9FA 3A87A 1SVPA 4YLUA 1AVXA 1EOJA 3ATKA 1BBRH 1NFXA 1NTPA 4ABJA 2P94A 4ABDA 1Q31A 2BY8X 1DFPA 3ZZ7A 1EATA 2NU1E 1V2WT 3E90B 3CENA 2JH5D 5FCKA 2FI4E 1EPTA 1P0SH 2CJIA 2ZHFH 5FPSA 2B8OH 3M35A 4LOYH 3UR6A 4A6LA 4KGAA 3NWUA 1O2XA 4DW2U 5K0HA 4WVPE 1YPLH 1LPGB 1QJ1B 1Y3YA 4LZ4B 1F7ZA 3CP7A 5EPNA 1XUFA 1L4ZA 1FV9A 1O2JA 2G4TA 3TPIZ 1H1BA 4X1SU 1QIXB 4GHQA 5L2YH 4D7FA 1K1NA 1IQIA 4TT3D 4B1TA 1EPTC 1WTHD 2PR3A 1ZMNA 3PRDA 2AMPA 5JBTA 3V12A 3SW2B 5JYIA 3S7HB 5CHBA 1GBKA 4HTCH 4J2YB 1PPBH 1NFYA 4AGJA 2G55A 1AMHA 1D6WA 5DN6D 4I7YH 1MBQA 3TGJE 1GHWH 1SGQE 3P70B 4Z1MD 1EZUC 1WCZA 3MMGA 4NIYA 5LPFA 5EW2H 4I8LA 1YPEH 5FPYA 1IAUA 1GVLA 1QB1A 1L1JA 3VG8A 1C5OH 2QIQA 5EJ1A 2Z3DA 3D23A 3UAIC 1ELTA 5F03A 2BDGA 3OYPA 1DLEA 3MYWA 2OC8A 1Y5BT 4OS5A 1CA8B 1HJ9A 1SGEE 1AZZA 5T6FA 2P3TB 4ZHLU 5LGOA 3A83A 1Z8JB 2TGPZ 5SGAE 1KXCA 1T31A 1BJUA 1P02A 2LPRA 1PPFE 4FUGA 5EU8A 2BHGA 1IHTH 4IBLH 4I8HA 1GI1A 1MZAA 1AFQC 3D62A 2A7CA 1TIOA 4AFQA 3O8CA 1CA0B 1WQSA 3F1SB 3UREA 4X2YA 3ZIAD 5A8ZA 5HM2A 1A0JA 1UCYH 1CU1A 3LOXA 5C5NA 1YPMH 5DGJA 2ZGCA 4RKOB 2XTTB 2GZ7A 4NZQA 1TE0A 2F91A 2OD3B 4I31A 3ITIA 1QB9A 3A7VA 1Z1IA 3RP2A 4CREA 1A3EH 4J1YA 2Z9LA 2Z9IA 1P9SA 1MQ6A 2JETC 2QXHA 3M37A 2W3IA 2KCPA 1WUNH 2H5DA 3T25A 3Q77A 1PQAA 2XXLA 4B76A 4YM9A 1OOKB 2EI8A 1EQ9A 1AO5A 4ESTE 1DY8A 1B0EA 4MQAA 4MNWA 1TX7A 3NXPA 2VIOA 1WYKA 2J5UA 2PW8H 4Y11E 1AB9B 1OWDA 2G81E 3IWMA 4BTUB 3U1IB 2C8YB 1KSNA 5EQRA 3GYMA 1ACBE 5A2MH 3LDXH 3P17H 4K1TA 3ZVEA 1E79D 3P8NA 4DY7B 5C20A 2K1QA 1OP8A 2CK3D 3M5LA 1O3JA 1G3BA 1OWHA 3VGCC 1HAVA 3ATWA 4B6EA 3LGUA 2EY4C 2J2UA 1C5MD 1KDQA 3TH4H 4UD9H 4BOHA 1QA0A 1B0FA 1YLDA 1ESTA 1VGCC 1SC8U 3U9AH 4CR5A 2WV5A 1Z6JH 3BTME 3OU0A 4BNRA 2BVSH 4MPUA 4JZEH 2V3MA 1WXRA 5H4IB 4R0IA 1O5FH 1YPKH 2KR7A 2J98B 3H09A 1RJXB 1XKBC 5L30H 2A4QA 1AUJA 5FHTA 2A45B 2ALVA 3MU5A 2ZCKP 2GZ9A 3DFLA 4FUEA 2TGTA 1ARCA 1O35A 3FVFB 1TPSA 5KECA 1NN6A 1QRXA 4K5ZA 1NBMD 2Y5HA 1SR5C 1W7XH 3LKWA 5DP7A 1HAYB 3TGKE 1G32B 1S0QA 3DT0H 3KL6A 3UIRA 2BQ6B 2ZGBH 5DP9A 1VJ9U 4NIWA 4Q7YA 1XMNB 4Y8XA 1D3DB 3AW0A 1SGTA 1FI8A 2O8UA 5C1YA 1HIAB 3T29A 1BTPA 2Z7FE 1VZQH 4B71A 3S7KB 1IQFA 4Y7AA 5FBEA 8GCHG 1J8AA 3ZVDA 1HYLA 1C2KA 3SGBE 1Z8GA 4UDWH 2VWLA 4NA9H 1YPHC 1H4WA 1JRTA 2H6MA 1PFXC 1PQ7A 5C67A 1OXGA 2AYWA 2ZQ2A 4A1TA 2PGQB 1CHOG 1EASA 5GWZA 4ZKNU 1TNGA 2XBXA 2PV9B 4NFEA 1ZTKA 3SUFA 3S9BA 4BAHB 2GP9B 3VB3A 4GLYA 1CO7E 2FTMA 2EA3A 2C93B 1V2UT 3A7WA 1O5EH 3BTQE 3MH7A 3SNCA 3UOUA 4X6PA 4ISIH 3BTTE 4INHA 1AY6H 5GIBA 2VVUA 3L3TA 1O2LA 2J4IA 1SGYE 2XCFA 4P02A 1OWKA 1EPTB 2OQUA 4IMZA 1Z71A 1MKXH 1Q3XA 4D76A 5EJLA 1SGDE 2TGDA 2XNDD 1O31A 1M9UA 1VCQA 2VNTA 3WWFA 2FP7B 1EZQA 3MTYA 1O2GH 1SSXA 1ELAA 1YLCA 3SJKA 1TONA 1D9IA 2PTCE 5FL7D 2EQNA 1C1MA 4ZXXH 4NCYA 3NK8A 3SN8A 2YNAA 3A7TA 4B2AA 2C3SA 2FS8A 3GY8A 1F0SA 1J14A 4FU8A 3E3TA 3TLOA 2LNCA 2HLDD 2D8WA 3QX5H 4DG4A 3OEHD 3M7TA 2G4UA 2CN0H 2JKHA 1TWXB 3SUGA 1CSOE 1SOZA 2ZU2A 5EJZA 4MPVA 2FDAA 4CBNA 1P09A 1BTHH 2XRCA 1AE5A 1SB1H 1C1SA 3NRLA 2NU3E 1BHXF 4ABGA 2HALA 1O2MA 3GDUA 6GCHF 1OP0A 1D4PB 4ZROA 1MAYA 4TWWA 2Z9JA 4WF8A 5EIYA 2R2MB 1HXFH 1SGIB 4KELA 1TNJA 5DKMA 4Q7XA 2UUFB 4BAKB 1AFQB 1HJAC 3P8OA 5EODA 1F2SE 1GJ9B 3VB4A 5GDSH 1W13U 2CHAC 1O2UA 3UQOA 2NU4E 6CHAB 1DLKB 3RXEA 1ABJH 3RXFA 7GCHG 1O3MA 3W95A 3TH2H 4K8YA 3SV8A 3RXQA 1GL1A 1ZPZA 2PLXA 1GBTA 3Q3YA 1EZSC 2IPHA 2QE7D 2XW9A 3PMAB 3MI4A 2KAIA 1K1MA 4D8NA 4DIHH 3EQ0H 2SNWA 3U28C 3F9EA 1HXEH 4WXIA 2P3UB 1Y3XA 1G9IE 1HUTH 4D9RA 1A46H 4IC5A 5T1VA 4CR9A 4GCHF 1S0RA 1O2VA 1CGJE 1O2PA 1S83A 2FOGA 2VINA 3AK5A 1JXPA 1NU9A 3WW7A 3LH1A 2BDYA 1F5KU 4BXSA 5ETXA 2GD4B 1NC6A 3FAOA 4NSYA 3E8LA 5LH8A 1QJ7B 3GCHC 1RTKA 1P12E 1E37B 2ULLA 4MPWA 1GJ5H 3DFJA 4IS5A 1W0KD 1UO6A 1C1NA 2HVYB 2BOHB 4AFZA 1ZPBA 5HIYA 2PP6A 3TJVA 1A7SA 1UHBA 3SJ9A 4ZMAH 2ZDNA 1OX1A 4ZKSU 1OS8A 3QZRA 3VGCB 1UVSH 1DUEA 1NRRH 3ENSB 4M7GA 1NROH 4QT8C 1RRKA 4XFQA 2PSYA 4FXGH 1VGCB 1C5UA 1YCPM 2VGCB 1A5HA 3EA7A 2ZNKH 1EFRD 2ZFQH 1YPGH 1PPEE 2ANWA 3BV9B 1BBRK 4FUFA 3PROA 3VB7A 1KXDA 3HKIB 1HAVB 1ZGIA 3PYHA 1C5RA 3TJUA 1KDQB 1C2DA 3MH6A 1EX3A 1QFKH 4H4FA 2P3FH 3M7QA 1V2RT 4YT7H 4TYDA 2ZDLA 3SNEA 2BD3A 1W8BH 1SMFE 3RMOH 4X6NA 3KF2A 2BD9A 1V2KT 1QURH 1LVMA 1T32A 1O3LA 2H5CA 3ODFA 1WQVH 3SYJA 5GNDA 1BMNH 1LTOA 2WPIS 2HOBA 1C2GA 1PPZA 2Z94A 1F5RA 4RT1A 4WWYA 1ANBA 4I8JA 3SV9A 3E1XB 1O2NA 2BLQA 2ZTZA 4AZ2B 3A85A 1O3BA 4ZUHA 4GHTA 4NA8A 1QNJA 1SPJA 2OINA 3A7XA 1V2VT 3OAAD 1TX8A 2FLBH 1EOLA 3K6YA 3OX7U 1UVPA 2QXGA 1QCPA 2VJ1A 1QJ6B 1AQ7A 2OBQA 2EI6A 4GUXA 1V2TT 1AWHB 1J15A 1Z8RA 3C1KA 1RTLA 2BD5A 5FBIA 3CS7A 4ZKOU 3U69H 4OGXA 3EYDA 4IGDA 3MNBA 1MCTA 1P11E 3GY2A 1RIWC 5TCAA 3UB0A 4NGAH 1FY4A 3P95A 4Y8YA 1JWTA 1FAKH 3ZZCA 1A2CH 3BSQA 4UFFH 2THFB 1K2I1 2ZC9H 1L2EA 2AEIH 1S81A 1RD3B 1TOMH 3TGIE 2VU8E 4UONA 1BMAA 3CS0A 3QTOH 3UNSA 2ZG0H 3SNBA 2J98A 2PKSC 2FWWA 3FZZA 5F8ZA 1UTQA 2ZHEH 1ELCA 2Y5FA 3KIDU 1YCPH 4AG2A 3VFEA 2ESTE 1QBVH 1GBDA 1O3KA 3KQEA 1MUEB 5C17A 3RXUA 1Y3VA 1GMHF 1GVZA 2JH0D 2VB0A 2Y81A 1TQ0B 2M5TA 5JBAS 1MBMA 2FEQH 1ZHPA 3MFJA 1T8MA 2PSXA 2A4RA 4U2WA 4DVAU 1VITG 3KYGA 2BDHA 2JJ1D 3GICB 1TALA 4DGJA 1ESAA 1MQ5A 3O8RA 4LK4A 5DSFA 1PJPA 1HIAA 3GDVA 3GY7A 1C2LA 1CT0E 1TGNA 1AUTC 9ESTA 2H9TH 1TMTH 2CXVA 1S6LA 1BRBE 1ZR0A 2UUJB 3A89A 5J4SA 1C2JA 2J97A 3BTHE 3SU2A 3F2GA 1HJAB 1NESE 2Z9GA 3RXLA 1SGFG 2DE8A 3N7DA 3LJOA 5FAHA 1L0ZA 3M5NA 2CHAB 1DT2A 4ABFA 1FY1A 1NZQH 3KYFA 3F0PA 1K1JA 4DT7B 1TRMA 1GBLA 1KXBA 3H5CB 4Y0ZE 1N6YA 4H6TA 2WPLS 2AERH 5FPTA 3RXRA 4XBDA 2VIQA 1AVGH 1O37A 3PO1C 5EXMA 4AYYB 2ODPA 2ZDKA 4I33A 3LONA 2UUKB 1DPOA 4AG1A 2WINI 4VGCC 2A7HA 4Q80A 3T5FH 3BTFE 4NZLA 3ZYEA 2SGDE 4BANB 3QUMP 1TRNA 3SOSA 1TA2A 1MAXA 1MTUA 3SU4A 3STIA 2GGVB 1VITF 1KMHB 1O2IA 3TJOA 2KAIB 3PM3A 4CBOA 1C5YB 2Y6TA 2A5IA 3TJNA 1ZTLA 1UTNA 3LGWA 3GCHB 3U8OH 1H9LB 1Y5UT 2QV1A 5JDUB 1MU6B 1HPGA 1B5GH 1GHAG 5ESTE 2FYQA 2PKAA 3OY6U 2AHME 3L6PA 3LGTA 5FXLA 3NUMA 2QXIA 1XUIA 3F9GA 3PV5A 4ISOA 4X8VH 3ZZ3A 2KX4A 1MTSA 5DK1A 4NSVA 1K22H 3I29A 1N8OC 3SV6A 1QQUA 4TPYA 2A5AA 4DJZB 2KM0A 1UVUH 1GCTC 2W6ID 3A82A 5DP5A 3RMLH 1OYTH 4HFPB 3EAJA 2BYAX 3TK5A 5FCRA 1HFDA 2WUCA 4E7NA 2ZTXA 4X1NU 2R9PA 4B75A 3RU4T 1GJCB 4NA7A 4XOJA 2O8MA 1UHBB 1O3OA 1QBNA 1Q2WA 1DWCH 2F9VA 3SV2H 1Z8IB 2HRVA 1OWIA 4AFUA 1GBCA 2R0KA 3FKSD 1SLVB 4X8SH 3WY8A 3KQCA 2GDDA 2BDAA 1C1VH 6LPRA 1HAGE 3S9CA 1O3GA 2BTCE 2ZPSA 4D7GA 1GI2A 4JZ1A 3LC5A 1EB2A 3RXGA 1ZMJA 1C4U2 1Z1JA 1ANDA 3N7EA 3RXVA 2JDID 2G00A 1VCPA 1TMBH 3VXFH 2XC5A 3LGIA 3PMJA 3LIWA 3MNCA 5I25A 3UY9A 4NIXA 2AGEX 2QF0A 4H6SB 2STBE 6CHAC 1GI4A 1MKXK 1ZRBA 2GZ8A 2JH6D 3LJJA 1GBHA 1GBAA 1SHHB 4Y10E 1O5CB 2P93A 2FZZA 2A31A 1IQHA 1C2HA 1ESBA 1GI8B 1KXEA 1ELEE 3AW1A 3SHCH 1BRAA 2WPMS 5IK2D 4NFFA 4WY3A 4B73A 3SQEE 4UFEH 2A4OA 3U8TH 3ESTA 1AE8H 1K0HA 4CHAB 2D26C 7LPRA 1C2FA 1FX0B 3RXJA 2WSSD 2BZAA 5AFZH 8KME2 2JIZD 4CH8B 5I46H 1TGCA 1FUJA 2FESH 1O3HA 1DM4B 1S85A 3A86A 3SQHE 1RIWB 3A81A 1GHZA 2K0QA 3QWCH 1BRCE 2UWPA 1TYNA 2QYIA 3FN8A 3QLPH 2XBWA 1ID5H 1ANCA 1ZJKA 1XUJA 2BY6X 1OHHD 4SGAE 1V2PT 2P8OC 2Z9KA 5JBBS 1C5PA 1YLNA 2TIOA 3STJA 4ZHAA 1NT1A 1T8LA 1O2RA 1W7GH 1O38A 1LKBA 1TX6A 3A80A 3HGPA 1GJ8B 3MU8A 4AC9A 4CRBA 2Q1JA 5DP6A 2FXRA 4F55A 4INLA 5GJ4B 2PKSB 1OP2A 1C5XB 1TBRH 5K7RA 2FM2A 1SQTA 4XSKU 1KTTB 2VGCC 2P95A 1CT4E 1EZXC 4ISNA 1LMWB 2OC0A 5EGMA 4WMEA 5CMXH 2XC4A 1O2QA 2GCTC 3SU0A 3N99A 2FOAA 1TGSZ 1EAWA 1K21H 4O97A 5JB8S 4OS7A 4ACAA 1FY8E 4XD7D 1H8IH 1GHBG 1XUKA 4X2WA 1ZJDA 2A7JA 2ZCLP 5C94A 3PMBB 4X2VA 2BXUH 3A8AA 3M7UA 2GT7A 1EAIA 1K28D 2ZIQH 4ASHA 1KXAA 3UNQA 2F43B 4BAOB 5A0CA 3ATIA 1TBQH 3SZNA 1JIRA 1HCGA 4A1XA 3RC4A 3UUZA 3RXKA 1ORFA 2Y7ZA 1C1UH 1NO9H 1EXFA 4DIIH 1TPPA 2L74A 4AB8A 3KNXA 1BTWA
chains in the Genus database with same CATH topology
2ALPA 2QY0B 4FVBA 1P2IA 3UTUH 1GI0A 3QDZB 4GSOA 1ZYOA 1ARBA 2ZWLH 1NRNH 2G52A 1MH0A 1O2OA 2Y5GA 1L1NA 1O2YA 1SQAA 1E35B 3PO1B 1OKXA 1UTPA 4B74A 1HAIH 5DJ7A 3SJOA 2QAAA 1ZHMA 4X6MA 1O3CA 1O2TA 1UTMA 4JZIA 1K1LA 1TNLA 4VGCB 4U30A 2G51A 1SI5H 2ANYA 5DO4H 3SUEA 1BMLA 1THRH 2HGTH 5DP3A 2F9BH 1BTUA 4Y6DA 1HAHH 3HK6B 3SBKA 1A3BH 2A0QB 2VIDA 4OS1A 2ZU1A 1XVOA 2CF8H 1TMUH 1V2LT 2GKVE 2W5EA 1LHCH 1FXYA 2GTBA 2FOEA 4INKA 4MG3A 4OS2A 1C2IA 2ZFFH 1DY9A 4IN2A 4KTSA 4ZKRU 2BX4A 1AGJA 1G37A 7ESTE 3V13A 4JYTA 2Q6FA 1HGTH 1V2OT 4NWLA 4WJG2 3TNTA 4ZHMU 3OTJE 1N8OB 2BDBA 1P9UA 1GCTB 4XE4A 8GCHF 3RXHA 2ZFPH 1DXPA 1EAUA 2ZF0H 3FP7E 3SO3A 1LHEH 2OXSA 3PLBA 1GBJA 4JMYA 2PKAB 2FOMB 1AU8A 2R3YA 3RMMH 3MH5A 1O3EA 2FTLE 1T4VH 3RU4D 1ELDE 3EE0B 3UNRA 3GY4A 5CHAC 3RUOA 3R0FA 1G3CA 2XBVA 1CHOF 1D3PB 1AFEH 1F0TA 1AKSA 2BX3A 1E38B 3GYLB 1WAYB 2XWBI 2H2ZA 3HATH 1CGIE 1PPGE 4LXBH 2PGBB 1V2NT 1LQEA 1G36A 1YC0A 3ZZ4A 1W2KH 4TPIZ 1DSTA 3M5MA 3T62A 1C1QA 2OTVA 3ZVFA 4D9QA 1C1WH 2VVCA 2BDIA 2UWOA 2GVFA 3BN9A 3BG8A 3VB6A 1DX5M 1YGCH 4HZHA 2A32A 1GBBA 2QF3A 1EKBB 2ZP0H 1VCWA 1WV7H 2OC7A 1GGDC 4MNVA 1ZLRA 2BY9X 1TB6H 1D3TB 1BJVA 5DP8A 4SGBE 2BY5X 1P10A 1OYQA 2BY7X 3SHAH 1FIZA 1P57B 4WXVA 4U32A 1O3AA 1O3PB 1ZOMA 4WMFA 1TA6A 1YCPK 1C5QA 1OWJA 1BBRE 2FODA 1DITH 7KMEH 1G3EA 3AAVA 3JZ1B 5AFYH 3T2NA 1PQ5A 1Y3WA 2ZFRH 2QGRA 4Y76A 2EEKA 1W0YH 2P59A 1SOTA 1G2MA 1GBFA 2CGAA 2ZZUH 3K2UA 5GPIB 4H42U 1VR1H 4FUDA 5CE1A 3TK9A 1O39A 3ODDA 1E36B 2B5TB 3RXCA 3H7TA 4FUHA 1IQMA 4GAWA 1DS2E 1YPJH 2P8OB 3OY5U 2V3HH 4E06H 1AVWA 3E91A 1U6QA 1TLDA 1GBIA 1GG6C 3A7YA 3EDXB 2W26A 3SORA 2FIRH 2ZCHP 2BD4A 1J17T 3F9HA 1QBOA 4CRFA 1O2ZA 1GI3A 1MTNC 1P2NA 1MD7A 1KLTA 1EJMA 3LH3A 1ETTH 5L6NH 1GPZA 7GCHF 3MO9A 4FUBA 1S6HA 5IYTA 2DUCA 3ZZ5A 1GDQA 2BVRH 2VVVA 4WH8A 2GCTB 4Y71A 3RXTA 1DE7H 4BTTB 3ATLA 1THPB 3SU5A 1QB6A 4E7RG 3BEIB 5EXNA 3SJ8A 3I77A 2R3UA 1Y5AT 3M3SA 3ZVCA 1OPHB 1GVKB 1QHRB 1XM1A 1WOFA 2O9QA 1MMJN 3B23B 1GBMA 1GMDG 1N6XA 1MCVA 4RSPA 1TAWA 3KHVA 1RGQA 3UWJH 4DCDA 1UVOA 2VIWA 2C8ZB 1UCYE 1NRPH 2HNTF 3W94A 2GT8A 2FOBA 1LVYA 1RTFB 3M3TA 2PUXB 3RXOA 2UUYA 3T27A 2ZA5A 3RMNH 3RXPA 4YZUA 3I78A 4K8BA 3K6ZA 2AIQA 4ISLA 4CHAC 3GY3A 1CE5A 1NFWA 1AWFH 4XDEA 2ILNA 3KGPA 5EQSA 5F8TA 1W0ZU 1IQLA 1O5BB 4AGKA 3TH3H 3ZYDA 1A4WH 1BHXB 1FIWA 1GJ6A 3IITA 3ZZ8A 1TNHA 3VB5A 3SI3H 2GCHG 2ZDMA 5A0BA 1C5SA 2HPPH 2ZQ1A 3VPKA 1GBEA 1DWBH 3ATMA 4O03A 1O2KA 3GDSA 1HDTH 5HM9A 2QA9E 1FN8A 1GI9B 1ABIH 3F68H 4Y7BA 1AI8H 4PROA 1GMDF 1O2SA 1CBWC 8ESTE 1ZSLA 1KTSB 1O36A 2BLVA 2V3OH 2WYJA 3ZZBA 4AX9H 4CRCA 1ZHRA 2FX4A 1AIXH 1EUFA 4OS4A 2H9HA 3RDZA 2RDLA 1W14U 5HYOA 4I8GA 1GI7B 4KTUA 5EW1H 3ZZAA 1UTJA 1IQNA 2NU2E 4X2XA 1KYNA 1O5AB 2ZECA 2BMGB 4Z0KA 5AHGH 1BRUP 5CHAB 2OQ5A 1SGRE 3NZIA 2GMTC 3HKJB 1DUAA 1QQ4A 1QTFA 3BG4C 1IQEA 3QGJA 4K3JA 1LHGH 2Q6DA 1D3QB 1GMCG 2FX6A 4YOJA 2AMDA 3PMHB 1SLUB 1GJBB 2ZGHA 2ZU5A 3MU1A 1V2ST 2GCHF 1QRZA 1C5TA 3JZ2B 1CQQA 2G5VA 3FP6E 1AKSB 4MNYA 5DP4A 5E2OA 3F9FA 2TGAA 2Z3CA 1MU8B 4AORA 2FI5E 1DSUA 1OWEA 2ZU4A 1NS3A 1K9OE 4IMQA 1DVAH 4RKJB 5EG4A 3PV4A 2J34A 5A8XA 3FZDA 1GGDB 3P92A 2F9OA 2CMYA 1FZZA 1G30B 5T3HA 1WTGH 2ZGJA 1UJ1A 4AN7A 2AGGX 1EJAA 1F0UA 1LHDH 6ESTA 2RG3A 1P06A 1BT7A 1PPCE 3MWIU 5DPAA 5BRRE 1C4Y2 3SGAE 1XXFA 5HXFA 3AAUA 1ZMLA 4B2BA 2ZU3A 1QY6A 1SGCA 5EXLA 1W12U 4YO9A 1ANEA 4AOQA 1O30A 3Q3XA 3SU6A 2OP9A 3MH4A 2XNIA 1HRTH 3EA9A 5A0AE 3UFAA 1UTOA 1J9CH 1GMCF 1HAPH 1S84A 2BXTH 1TPAE 2ASUB 1MTWA 2I6QA 3ELAH 1FQ3A 3M5OA 5TJXA 2AS9A 2HWLB 1GG6B 1A5GH 2WYGA 2O8WA 3S69A 1F92A 2HNTE 3QO6A 4Z6AH 1P03A 2GV7A 3E0NB 1MTNB 2PTNA 3RXDA 2B7DH 4IW4E 1N1LA 4I32A 3TNSA 4JZDH 1TRYA 1LPZB 1SGNE 2DE9A 3R3GB 3KEEA 2QC2A 2OCVB 3BIUH 4TWYA 1FJSA 1BITA 1VJAU 2ZKSA 1IQGA 3PLKA 4A1VA 2A2QH 3ZZ6A 2NU0E 3E0PB 4X1QU 3DD2H 2XCNA 5B6OA 1GJ4H 4CRDA 3LGVA 1Y8TA 4YESB 3UOPA 5EPYA 1INCA 1XUGA 1JBUH 1NY22 2ZO3H 2BD8A 1GJ7B 2WPHS 3BIVH 1QL7A 4OGYA 3SJIA 3QZQA 3SU3A 1QL8A 1JRSA 4FUIA 1CVWH 1W11U 1JMOH 1H9HE 3K65B 2OLGA 4B2CA 3AASA 1FY3A 2IJOB 3RC6A 4XBBA 1ETSH 2GX4A 3VEQB 1GHAF 2J92A 1QR3E 2YOLA 2ZI2H 2A1DB 4ZAEA 4X0WU 2PUQH 2GV6A 2BB4A 2V6NA 5C2ZA 2Q6GA 4BAMB 4UFDH 3MNXA 3ZVBA 2ODQA 5JPMH 1OSSA 3BTKE 5ABWA 3A8BA 2ZTYA 2ANKH 3QK1A 4MLFB 1QL9A 3KQDA 4JYVH 2ZHQH 2VWNA 3RM2H 1T4UH 1GCDA 1GI5A 1YYY1 2BVXH 3BTGE 1G3DA 4MPXA 1Y3UA 1UMAH 2FLRH 2H9EH 2J38A 1O5DH 5HGGA 2CV3A 3QN7A 2IOTA 4I8KA 3O8DA 1T8NA 1Z6EA 1O3NA 2C4FH 1GL0E 1ELBA 1V2QT 2VH6A 5E8EH 2Y7XA 3M36A 3O8BA 1J16A 3A84A 1C2EA 2VH0A 4THNH 2XWAA 1CBWB 2SGFE 4WMDA 1XX9A 1JIMA 1DDJA 3A88A 4K1SA 3RXIA 1THSH 4NWKA 8LPRA 3NKKA 3A7ZA 4MVNA 3BTEE 1FLEE 2F3CE 5PTPA 2RCEA 1W3CA 3D65E 3EGKH 1LKAA 1CHGA 1CGHA 3GCOA 1Y59T 2F9UA 1ETRH 2HPQH 1ELVA 2GMTB 1TFXA 3U8RH 3GCTG 3A8CA 1O2WA 4UE7H 2F83A 5A09A 3BG4B 1C9PA 1MKWK 1ZZZA 1KLJH 2H1UA 3PWCA 2FI3E 2FYRA 2IN2A 5T6DA 1C5ZB 4FUCA 1YF4A 1LVOA 1YP9A 1HAZB 4JZFH 4E05H 4XBCA 3RC5A 2AGIX 2BD2A 1JOUB 1E34B 2HVXA 2B9LA 4HGCA 9LPRA 1UK4A 2Y82A 5C1UA 3C27B 2WV4A 1P04A 1FONA 2WPKS 4X1RU 1NRQH 1V2MT 3F6UH 1IQKA 1IQJA 1ELGA 4Q2KA 1XVMA 3Q00A 1E0FD 4YLQH 2OUAA 5E0JA 1HAXB 1QA7A 2BLWA 2BQWB 2RA0A 3SGQE 3U98H 5EQQA 1S82A 2P16A 1EAXA 2NWNA 1IHSH 1GHXH 2ZPRA 1HAOH 1KIGH 3RLWH 1P2MA 4FU7A 2FO9A 3ZVAA 1O3DA 1WSSH 1BTXA 1HNEE 1O0DH 1SBWA 1F5LA 2BOKA 3GCTF 1G2LA 4X1PU 1B7XB 4U01A 3ZVGA 1BTZA 1ZSKA 2AMQA 1KY9A 1FY5A 3GY6A 4LZ1H 1RFNA 2GDEH 2AFQB 1GHBF 1UVTH 2QCYA 1T8OA 2SFAA 4ABBA 5A8YA 2BDCA 1DANH 3RXAA 2EI7A 1GJAB 4ZXYH 1TOCB 1A5IA 3MO6A 4Y0YE 4ABAA 1MTVA 2F9NA 3LPRA 4AYVB 2XC0A 3E16B 5IDKA 1IOEA 6GCHG 4IC6A 1FNIA 3SV7A 2FS9A 3SNDA 4DURA 4MDSA 4AFSA 3AVZA 1DWEH 4BXWA 2FPZA 4RN6A 3VXEH 1WBGB 3BTWE 2SGAA 5DG6A 3URCA 1K1OA 1ZGVA 5LPRA 4NG9H 1GHVH 3ZV8A 1X7AC 1HJ8A 5JB9S 1UTLM 4YOGA 2FOHA 3FANA 4DOQA 2FOFA 3Q76A 1QRWA 3PTNA 1GDUA 4A5TS 3SI4H 2W3KA 5FX5A 1UTKA 3MU4A 1BQYA 1C1TA 1P3CA 4YOIA 5EOKA 1UK2A 4R8TB 3QGNB 1ELFA 3BF6H 5JBCS 1TBZH 4BAQB 2TRMA 5F6MA 1SLWB 1A1RA 4F4OC 3RXBA 2OC1A 1P8VC 4TY7A 1P2KA 4GCHG 5E2PA 5J4QA 1PYTD 3S9AA 2UWLA 3DA9B 4JYUH 1TABE 2BZ6H 2VWOA 1EJNA 5HMAA 3V7TA 2SGPE 1HB0B 1P2QA 3LT3A 1C5VA 2RA3A 1O32A 2YNBA 1P01A 2BM2A 3OSYA 3LC3A 3SNAA 1EP5A 1UK3A 2V0BA 3MHWU 1HLTH 1P2OA 4CRGA 1XXDA 3Q3KA 2W7SA 3RM0H 2AIPA 3RXSA 3UR9A 4CRAA 2B0FA 3E6PH 1LVBA 1C5WB 3MU0A 1DXWA 1EB1H 1MKWH 5LPEA 2BQ7B 1DICA 1DWDH 3ZV9A 1P05A 1SHYA 3B8JA 3M3VA 3TK6A 1V3XA 3SUDA 4FVDA 1C2MA 2BD7A 4UFGH 1T7CA 2ZDVH 3GOVB 4GPGA 3EA8A 1FPCH 3DUXH 4KKDA 4A7IB 3PWBA 3BEFB 3T26A 5C1XA 1S6FA 1SQOA 1BB0B 3LGYA 1BCUH 2QN5T 1P3EA 1O3IA 1PYTC 4FU9A 5GXPA 3SU1A 1ZTJA 1FDPA 3U1JB 1CT2E 1A0HB 4JK6A 4CH2B 5G4BA 4A92A 3TIUA 1BZXE 2JETB 5E0GA 3FFGA 1RS0A 1LHFH 3MO3A 1K1PA 4MNXA 5L2ZH 3TVJB 1Z7KA 3DHKH 1SFQB 4AB9A 1AN1E 2AH4X 4K60A 2A4GA 2Y80A 1SGPE 1SG8B 2HNTC 1GHYH 1H9IE 1ZRKA 1H8DH 1FMGA 2J95A 2BLOA 4MTBA 2R2WU 2W7UA 3RLYH 2PFEA 2J9NA 1LDTT 1BTYA 2ODYB 3V3MA 1TGTA 1A0LA 2C90B 3GCNA 2ZFSA 2A2XH 1BDAA 3D49H 1QGFA 5AF9H 1LO6A 3RXMA 3UPEA 3P8GA 4NIVA 1TQ7B 1WU1A 3KQBA 4GVUA 2G5NA 1F0RA 4FUJA 1PPHE 3T28A 2STAE 2EC9H 1L1GA 1VITH 5ESBA 1EP6A 2XBYA 1FPHH 4K2YA 1YKTA 2SGQE 2XYAA 3UWIA 3NCLA 1LPKB 2ZGXH 2O8LA 5T6GA 4K69A 2Z6BD 1P2JA 1L4DA 2V35A 3K9XB 3TITA 2C8XB 4ABHA 4YT6H 2I6SA 1KLIH 1GI6A 1CA0C 1O33A 1AZ8A 2ZEBA 5GCHG 2C8WB 2J94A 3L33A 3URDA 4K1EA 4YTAA 2ZDAH 3MOCA 1GJDB 1YPHE 4KTCA 1YM0A 1SFIA 1TGBA 1HBTH 1HV7A 1C5NH 4X8TH 1MD8A 1DOJA 1GMHG 5TCCA 1AD8H 2FOCA 1C5LH 2Z3EA 1NPMA 3NPSA 3UQVA 3G01A 3H7OA 1ZPCA 1C1PA 1BMMH 1NM6A 3N7OA 4O3UA 4O9VA 2SGEE 3PTBA 2F9PA 5FX6A 1LQDB 4O3TA 5C3NA 4F49A 1SLXB 2D2DA 1MZDA 4ABIA 2HLCA 2O8TA 3IG6B 2TPIZ 3QTVH 1ZSJA 4ISHH 4Y8ZA 2CF9H 3A8DA 1GDNA 2OBOA 4X6OA 1AB9C 3HGNA 3KCGH 1RXPA 1C9TA 4TY6A 5AVDA 3FP8E 2ZHDA 1KXFA 1V6DA 1BOQA 2TBSA 4HI3A 1NRSH 4OS6A 5GCHF 1C1RA 3ZZ9A 1FAXA 1TPOA 1XKAC 2WPJS 4X8UH 3PLPA 1UCYK 3HPTB 1S5SA 1O5GH 3GY5A 3MNSA 1SL3A 1SGFA 2FMJA 3LU9B 1BIOA 3GISB 2R0LA 4BTIB 1C4V2 5C5OA 1C1OA 5E0HA