2BD7A

Porcine pancreatic elastase complexed with beta-casomorphin-7 and arg-phe at ph 5.0 (50 min soak)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords beta-casomorphin-7
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd7A01
1GG6C 1T31A 1FV9A 1FN6A 3SJ9A 2BY9X 2AERH 3NCLA 2EI8A 1OSSA 2EI7A 3BF6H 2OXSA 3MNSA 4DIIH 5HMAA 3QUMP 4J1YA 2ZZUH 1XUHA 1GBTA 2BD4A 1O3AA 2P3UB 2NU4E 2ODPA 4JYUH 1P05A 3KQCA 4UFEH 3T27A 3T5FH 1DWDH 1WYKA 3GDVA 4F49A 3PV4A 1YGCH 3RLWH 4X8TH 1TIOA 3KHVA 1WSSH 1OP0A 1FIWA 1J17T 4R8TB 3T62A 2P59A 2GDEH 3EE0B 2CHAC 1HIAB 3ZVCA 1KXDA 4BAMB 1W10U 1TYNA 3LGVA 4Q80A 1BMMH 2GCHG 1MCVA 4YESB 1EZUC 1XM1A 1GHXH 3M5MA 1G37A 5C5NA 5JBTA 1H9HE 1O35A 2BD9A 5E2PA 1C2IA 1AY6H 1O3KA 1YPEH 2XBVA 1IQHA 3HPTB 1AFQB 4UDWH 4NG9H 3P6ZB 4I8GA 2Q6GA 2VIOA 5DK1A 4X2YA 1CHGA 2W7UA 2Q6FA 4ISHH 3A89A 1WAYB 4MNYA 3UWIA 1C2DA 1A4WH 2QXIA 4A5TS 3EYDA 6LPRA 2WV5A 1CHOF 2B5TB 3HK6B 2BY8X 1BHXB 1MZDA 3MI4A 4Y8ZA 3BV9B 3M61U 5C67A 1O3CA 1C1UH 3URCA 1GGDC 1O2UA 5F8ZA 1AB9C 1PYTC 1NFUA 1G36A 2A31A 3SBKA 4AG2A 3GISB 2GT8A 3M5OA 2TPIZ 1GHBF 3EDXB 4GSOA 2Y5GA 3ZZ7A 1VGCC 1P2OA 2D8WA 1Y3WA 4ABDA 5C1XA 2PSYA 5C5OA 1EB1H 1S0RA 1O2XA 1C2GA 1HPGA 1EUFA 2HRVA 1KXAA 3Q00A 2B7DH 4NCYA 1BDAA 1Z8IB 1OKXA 1RFNA 5EQSA 1VCWA 1A0LA 2ALPA 1BBRK 4YOJA 3GCHC 1O2OA 1L2EA 1UJ1A 1D6WA 1HAHH 4ISOA 4YOIA 3V0XA 1BTYA 1W7XH 1NRRH 5H4IB 1MTUA 3VB5A 4Y79A 5CHAC 3SU1A 3BTEE 1BBRE 1NTPA 3RM2H 1FNIA 1BITA 1O2GH 2ZP0H 1GI9B 2BY7X 2BX4A 1DSUA 1O34A 3UOPA 2ZHWH 1KTSB 1W2KH 4Z0KA 5DP4A 1YPLH 1P2IA 5FPSA 1K21H 1CBWB 4HI3A 1DFPA 1W3CA 1A61H 1OYTH 4IN1A 3TJNA 1W0YH 1BTXA 3BIUH 3ODFA 2ANKH 1MKWH 3D49H 1ZTJA 1F0UA 2ZPSA 1NROH 1FLEE 1O3IA 3BTQE 4A1VA 3AW0A 4BOHA 1YCPH 3O8DA 4I8KA 3CS7A 1A1RA 1AQ7A 1ZR0A 4ZH8A 1W14U 3ZVAA 3B9FH 1TGTA 1GMCF 1JIRA 2QC2A 1A46H 3GY7A 4CBNA 3BIVH 2Y7ZA 5FPTA 1O32A 4BAQB 1J16A 1TOMH 2BVXH 3TITA 1ZHMA 2AMQA 1AVXA 1FY3A 2DE9A 1QL7A 1O3NA 3Q3KA 1HUTH 1T8OA 3GY5A 4IMZA 1FPCH 1E38B 4JK5A 1HAGE 3SI3H 2ZGXH 1EPTB 3T29A 4Q7YA 1W8BH 1TBQH 3BEIB 5DP8A 1TA6A 5AF9H 1QJ1B 2VNTA 2HPQH 2B9LA 2VWOA 3UPEA 5DKMA 4B2AA 1AB9B 4DT7B 1SI5H 2YNAA 1TNLA 4YOGA 5AFYH 1HJ8A 3DA9B 2F3CE 3BTFE 1O3FA 1G2MA 1GBKA 1KXBA 2XBXA 4O3UA 3ZZ6A 1AUTC 1S84A 1SLWB 2GCHF 1AZZA 1OPHB 4DW2U 1UCYE 1OP2A 3NUMA 1GHZA 2J95A 5JB9S 1GHBG 2IPHA 4D7FA 2OQ5A 2ZGHA 2VGCB 2F9NA 3A84A 3E91A 5FHTA 2A4GA 2SGQE 3A8DA 1AVWA 5DP3A 1GJ8B 3OU0A 1MMJN 5DO4H 3L33A 5G4BA 2ZA5A 1O2VA 4B2CA 1MKWK 1ZRBA 2FPZA 1DWCH 5K7RA 1LQEA 5T6GA 1W13U 1NT1A 1B0EA 2FOAA 3SU0A 2FOFA 4OGXA 1AWFH 5L30H 1GBBA 3DUXH 3P8GA 3PWBA 3MMGA 1LQDB 3U9AH 2SFAA 1IQKA 1O3JA 1UTKA 2ZFTA 4IC5A 4CRFA 4MDSA 1O3OA 2WYJA 2IN2A 1EJNA 2ZQ1A 5JB8S 2XC0A 3T26A 2ZDLA 4MTBA 2ZCLP 3T28A 2ZPQA 1C2HA 1B0FA 1TGNA 4TPIZ 1P2KA 3OYPA 1V2WT 2ZIQH 3FZDA 4Y11E 2ZDVH 4A1TA 3A87A 2STBE 1KDQA 1Q3XA 1EXFA 2R0LA 5SGAE 1BBRH 2GZ9A 2UWLA 4CH2B 1M9UA 3VGCB 1QBVH 3S7HB 1LHDH 3OTJE 2A32A 1P57B 1UVSH 3DT0H 1DICA 1TONA 2J34A 4IBLH 1DOJA 1N6XA 2VVVA 1J8AA 2RA0A 2BQ6B 3UREA 4SGAE 1DS2E 4X8SH 1BRUP 2O8MA 1RJXB 2OBOA 1ESBA 5C1YA 3UR9A 2UWPA 1GVLA 1LKAA 1DSTA 2Y81A 1VJ9U 4IS5A 3PMBB 1Z8RA 5JBAS 1HAXB 1ORFA 2A5IA 1QR3E 1GPZA 2VH6A 2PUXB 4FVDA 1DM4B 1P02A 1CSOE 1DX5M 1O2SA 3E0PB 3ZZ5A 1HAZB 1DWBH 3CENA 4Y0YE 3PROA 2A45B 1RTKA 1A3BH 1AIXH 1YCPM 1PPZA 2P95A 2Z3CA 4Z6AH 2ZCKP 1C1NA 1MD7A 4VGCC 3LH3A 2ZPRA 4DJZB 4K5ZA 5AHGH 2WPJS 5C2ZA 2XTTB 2AIPA 1HFDA 2Y5HA 1GL0E 1G9IE 4I32A 1O3PB 4CR9A 3LONA 1JRSA 1Y8TA 3TH4H 3A7TA 3RXSA 1AU8A 4B73A 1FY4A 1WOFA 3DHKH 1ZPBA 9ESTA 2R2WU 1C5TA 2VH0A 3V12A 2H9EH 2GCTC 3S9CA 4HFPB 3U8OH 3I78A 5DP7A 2VB0A 1L1GA 3ZYEA 1TA2A 1ZHPA 1O2PA 1E34B 3U8RH 1LO6A 3SU6A 3NXPA 3E0NB 3M3SA 1SSXA 4O3TA 2PR3A 3SNDA 3M37A 1P9SA 1PPGE 1C5ZB 1W12U 2P8OC 4NWLA 1JWTA 1NM6A 2VVCA 1AVGH 1UCYK 3OY5U 1K1MA 4XSKU 1P09A 4JZFH 1IQFA 2FYQA 1CGIE 1D3PB 1O5FH 1DVAH 2HPPH 1GBHA 3SHAH 1ZOMA 2QA9E 3HGPA 3TK9A 3GDUA 1QA7A 3SV8A 1O3BA 1N1LA 3QK1A 3UUZA 1XMNB 1CQQA 3SNAA 1ELGA 1DDJA 4BXSA 2FMJA 3S7KB 4CRGA 1K1OA 2GT7A 3TNSA 1AN1E 4NZQA 1HB0B 4LZ4B 1SGEE 3RP2A 2V6NA 3HATH 1ZTKA 2I6SA 3RXRA 4YT6H 2THFB 1O5BB 1XX9A 4E7RG 1XVMA 3E90B 4DY7B 4K3JA 1QB9A 4RSPA 4CRCA 2F91A 3VGCC 2C8XB 3BTWE 2QXGA 2H2ZA 1ABJH 5EQRA 1ZSJA 4Y8YA 3STIA 1N6YA 5FX5A 5F6MA 7LPRA 4FUCA 1YM0A 1V2TT 1NFWA 2O8WA 4AYVB 4DOQA 1HCGA 1KDQB 4BNRA 2PV9B 1Y3YA 1P06A 1SVPA 5T6FA 2ZU2A 1NU9A 1QGFA 3LJJA 1EJAA 8LPRA 5LGOA 4DCDA 3ATIA 3E6PH 3DFJA 1SLXB 9LPRA 2ZGJA 1C9PA 1CA0C 2P3FH 2AH4X 1Z8GA 5CHAB 1QA0A 2ZGCA 1GBAA 8KME2 1P9UA 2BVRH 1TNJA 1K1IA 2A4RA 4YTAA 1D4PB 1MKXH 3URDA 2FI4E 4Y7AA 3SJ8A 3U1JB 2BDCA 1GBIA 2UUYA 2G51A 2OTVA 1C2MA 4FUIA 1C2JA 1O2ZA 2OC1A 1TX8A 1O2QA 5FXLA 2ZF0H 2GV6A 3SO3A 3TH3H 3ATWA 3ENSB 2PSXA 3ZZ8A 3KN2A 3LGWA 1SGRE 1EOLA 4ABGA 2ZC9H 3SNBA 1IQNA 1MQ6A 1KTTB 2XRCA 5LH8A 1UTNA 3L3TA 1C1PA 1TGCA 1XUFA 1BRAA 4Q2KA 1ELDE 3HKIB 1VITH 1UVUH 3MU5A 3SU5A 2JH5D 3F9GA 3GY8A 1ZSLA 3JZ2B 1OS8A 2BD7A 1DLEA 1O2KA 1UVPA 1V2ST 1E0FD 1EAIA 4FVBA 1GI4A 2UUKB 1ZJDA 4K8YA 2BVSH 1S0QA 2SNVA 1SQAA 3RU4E 3S9AA 3NKKA 1YC0A 2FTLE 1O38A 1MAXA 2BLWA 1CVWH 1ESTA 3RC6A 4MLFB 2ZDAH 2FO9A 1QJ7B 2SGDE 2W3KA 1V2VT 4X2XA 5F03A 2BHGA 2TGAA 1P2JA 2QXJA 2SGEE 3SJKA 1HAYB 1XVOA 1V6DA 3MH6A 4IGDA 4OS6A 1VCQA 1TGSZ 2ZFRH 2ZNKH 4X6NA 8ESTE 1RIWB 1SGYE 3U1IB 3ZVDA 1Q31A 4KTCA 2VIVA 4GCHF 3VFEA 1ZGVA 1E37B 4INHA 2A5KA 1OX1A 1EPTC 4NFEA 1WTHD 1K1NA 2PHBA 1Q2WA 2G52A 4ABBA 4LOYH 5EOKA 1O2MA 1O39A 1O3HA 3ZV9A 4TY7A 3B23B 1LPGB 5JDUB 1A5HA 2GZ7A 2WPHS 1TX6A 1P12E 1AKSA 1SGFA 4X1QU 4H4FA 1YP9A 3SORA 3LGTA 2VIWA 1SGNE 4HTCH 4TWYA 4X8UH 3M36A 1ZTLA 1V2RT 4K1EA 3TU7H 2A0QB 5A09A 1ETRH 1FPHH 4MG3A 2VJ1A 1K1PA 4ZHAA 3UR6A 4JZEH 4B2BA 4BTIB 5A0AE 5EW2H 3LJOA 3DFLA 2ESTE 3FP6E 5J4SA 1INCA 3K9XB 1YKTA 3TJVA 2HLCA 3LIWA 3MFJA 2BLOA 1QBNA 3RLYH 2XCNA 5L2YH 1C5PA 3RMLH 2ZDNA 2NU0E 3NWUA 1G30B 1P0SH 2OC0A 1H9IE 4FUBA 2RDLA 4WMEA 2XC5A 3NPSA 1SQTA 1GI8B 1HBTH 2FOBA 3Q3YA 4YZUA 1DANH 2XWAA 1NRSH 5DP9A 1S81A 4XFQA 1TPPA 1GJAB 4ZUHA 3F9FA 1V2OT 1IQGA 1CHOG 3ELAH 1HAVA 3KL6A 5LPEA 4O03A 1QB6A 3SN8A 1OWKA 4XDEA 4ZHLU 3VB3A 4WXVA 1TPSA 1Y3UA 1Y3XA 1MTSA 1C4V2 1O2NA 2W5EA 3F9EA 1O2IA 2JH6D 1SGPE 2Z3DA 1UO6A 2BY5X 2J94A 2NU2E 1RTLA 4I31A 3P95A 1LVYA 2BQWB 4I7YH 1EPTA 4CBOA 1O3EA 2Z9IA 1L4DA 4M7GA 2AGIX 2WPLS 1O3DA 4CREA 3A7ZA 1DY8A 4K1SA 2PTCE 1ZMJA 3TGKE 5A0BA 1DITH 4D8NA 5L6NH 2BDHA 1UTJA 1XUIA 5DJ7A 2BOHB 4AGJA 1Z71A 4UEHH 1GMDF 1K22H 6CHAC 1V2JT 2CMYA 2W26A 1TBRH 1ZGIA 2FZZA 3RM0H 4A92A 5A8ZA 2AS9A 1G2LA 3RXJA 4E7NA 1FONA 2BOKA 4B1TA 1BJVA 3SHCH 4LZ1H 4X2VA 3MYWA 5GDSH 1XKBC 1U6QA 1QNJA 2QF3A 2BDYA 3RC5A 3RXOA 1THPB 4X1SU 1GJ5H 1AKSB 2M5TA 3GYLB 1FIZA 2J4IA 1ID5H 1A5GH 1SHHB 2FM2A 1VITF 4H6SB 1PQAA 2P94A 1CGHA 4ZKNU 1GDUA 1RXPA 3LH1A 1O2WA 3FAOA 4BAOB 3A81A 1IHSH 3A7VA 4X1RU 3SW2B 3M5NA 1EB2A 2ZCHP 1NS3A 4AORA 5IDKA 1QRWA 3MOCA 1LMWB 1RGQA 3I77A 4GHQA 1YPGH 1W0ZU 1GI1A 4ZMAH 3RXIA 2QF0A 2QV1A 1O5DH 2Y82A 3O8RA 1YYY1 5JPMH 1YPHC 2ZFSA 1J15A 1JIMA 4KELA 4ZKOU 1BIOA 4X1NU 1GI6A 4AG1A 5ESTE 1KIGH 3M7UA 1NRPH 4UFGH 6GCHF 3O8CA 1NC6A 3SUFA 1SB1H 2BQ7B 4ASHA 3PWCA 1H4WA 5I25A 3RXAA 1SL3A 2A4OA 3BTTE 1P2MA 5TCAA 3TJOA 4JMYA 1IHTH 1S82A 1GJCB 3T2NA 4WH8A 3LT3A 1W7GH 2ZU4A 1T4VH 1VITG 1S6HA 1ANDA 1GMCG 2PKAB 4IW4E 2FP7B 2UWOA 3S69A 3RU4T 1SGQE 3C1KA 3EA7A 2C8YB 3BTGE 5BRRE 3EAJA 3A83A 1G32B 4BTTB 4KP0A 5A8XA 3MO9A 1QL9A 3W95A 2CF8H 4U30A 3GYMA 2W3IA 1ELFA 4ZKRU 5FPYA 1EX3A 1BTUA 1C5YB 1YF4A 2KAIB 1LHFH 2BYAX 5HM2A 4CR5A 3MNXA 4NWKA 4OGYA 4YLQH 3E8LA 5F8XA 4LXBH 1EP5A 3P8FA 3NZIA 3P17H 3FVFB 1MU6B 1GI2A 2EI6A 2V0BA 4Q7ZA 3ZZ9A 2WPIS 2WINI 1F0SA 4AN7A 3HKJB 3TGJE 2ILNA 3GCTG 1GVZA 1GBJA 1BB0B 1ESAA 1UMAH 1GJBB 1YLCA 7KMEH 1O33A 3VB6A 1H8IH 3IWMA 1TNKA 5I46H 1FQ3A 3STJA 6ESTA 1C5SA 4XBBA 1UK2A 2XW9A 1C1WH 3UNRA 3QTOH 1TABE 1FMGA 1Y59T 1UTQA 1GBMA 4ABHA 5K0HA 1DT2A 1QL8A 1PQ8A 2FESH 3KQDA 2FEQH 2GD4B 1LHCH 4I8HA 3M7TA 1HRTH 3RXCA 2F9VA 1RS0A 2JETC 4CRDA 5AVDA 1SOTA 4DIHH 4WVPE 1F7ZA 1KXFA 2P3TB 4NA7A 2Q6DA 2YOLA 4XBCA 1CO7E 2BZAA 2A5AA 1GJ7B 4PROA 2FLBH 2LNCA 5C20A 3QGJA 3TJUA 3GY4A 1ELTA 1FZZA 2BXUH 2JETB 1C1TA 1ZZZA 5BPEA 3PO1B 3BEFB 5E0HA 1MKXK 2BX3A 4ZHMU 3VB4A 1A5IA 1IQLA 1DXPA 2J9NA 3RXQA 1GDQA 1UVTH 1AGJA 2QN5T 1XXDA 1NU7B 1EATA 2GGVB 3A8AA 8GCHF 1D3DB 2CF9H 1C1VH 4HZHA 4MNXA 4O9VA 2RA3A 1LVOA 4ABJA 4ZKSU 4BANB 1THSH 4GPGA 3ZZDA 3BTKE 1L4ZA 1DY9A 2A2QH 3PO1C 1O31A 2XWBI 2I6QA 1OYQA 3ATKA 1LHEH 1EAUA 4IN2A 1OP8A 1AO5A 1CT4E 2AEIH 1O36A 1B5GH 1ETSH 2OP9A 5A0CA 1Y5UT 2B8OH 2YNBA 2FS8A 3FP8E 2PGBB 1PQ5A 5GWZA 1XXFA 4WXIA 5HGGA 2FOMB 2Z9KA 5T6DA 5TCCA 1TE0A 3P70B 1T8MA 1C5RA 3F9HA 2STAE 3BN9A 4U32A 4CHAC 1FDPA 2ZHQH 1P2NA 1O2YA 3LDXH 2ZO3H 3SZNA 4ISLA 1TNIA 3AAUA 3ZV8A 4RN6A 3VXEH 1B7XB 3PTNA 1WQVH 5ESBA 1LPZB 5EPNA 1HXEH 2XNIA 1DPOA 1GBEA 2FI5E 1BTHH 1UK4A 1MTVA 1C1RA 3MNCA 1C1MA 1SPJA 2PLXA 3M3TA 3RXGA 1F5KU 4OS5A 1MBQA 1EP6A 2BDBA 2VIDA 2XBYA 2H1UA 2R2MB 4D7GA 1HJ9A 3V13A 2BD5A 3A7WA 4DVAU 3QWCH 2BZ6H 1YPHE 1TOCB 5LPFA 1FUJA 5JYIA 1GMDG 3M35A 2ANYA 2ZTXA 4JYVH 3E1XB 4NSYA 4FU9A 3UQOA 1HJAB 1TRMA 2H6MA 4BAHB 4NSVA 5CE1A 1TWXB 3VEQB 1FXYA 1HXFH 1QRXA 3K6YA 4Y71A 4D9RA 1SLUB 4RKJB 1FY1A 5E0JA 3VB7A 2BMGB 2ANWA 1DWEH 1ARCA 1VJAU 3BSQA 2Y5FA 1PPCE 3KNXA 2HNTF 1GI5A 1C5OH 4WMDA 3BG4C 2ZECA 4E06H 3RC4A 2BD8A 2A2XH 4Y10E 1MTNC 1PPBH 3SU4A 4U2WA 3V7TA 1QRZA 2ULLA 2VWLA 5L2ZH 3GOVB 1FJSA 2BY6X 3MU8A 3RXBA 3D65E 1CGJE 1V3XA 2R3YA 3SGAE 3GICB 4NGAH 2ODYB 2Z9JA 3A7YA 7ESTE 2KAIA 2FDAA 3SJIA 1S85A 4OS1A 2BM2A 3F6UH 2G4TA 4OS2A 1BA8B 5ETXA 3ZVEA 2PFEA 3A82A 4ABEA 1FY5A 4JYTA 3BTME 2G8TA 1C1SA 2CN0H 3K2UA 3A86A 2PW8H 1O5EH 2JKHA 1KSNA 1L1JA 1ZSKA 2PKAA 3A88A 2D1JA 1AFEH 5EG4A 3S0NA 3RU4D 1GMHF 2FXRA 2TRMA 3RXHA 5DP5A 1SFQB 1SBWA 2O8LA 1GI3A 4OS7A 1P3CA 4LK4A 1XUJA 5JBCS 3PMJA 3D23A 2CHAB 3ATMA 2A4QA 1IQEA 2VWNA 2TGDA 3SV2H 2Z94A 4WMFA 1F5LA 1FI8A 1LTOA 1NFXA 1H1BA 1QB1A 2ZGBH 3SNEA 2F83A 1X7AC 3KQEA 1KXCA 1KYNA 1P2QA 2SGAA 1PJPA 1WQSA 1A2CH 1TALA 3G01A 3RXTA 1GCDA 1P8VC 3K65B 4WF8A 2O8TA 4UONA 1Z7KA 1C5UA 2PWXA 1GJ6A 1QQUA 1VZQH 1Z1IA 3QO6A 3CS0A 1SGTA 1YPMH 1N8OB 3UOUA 3GCHB 2GVFA 3ESTA 1EAXA 3L6PA 1MTWA 1C5XB 1T4UH 1IQJA 1QY6A 1YPKH 2LPRA 2ZFQH 3MH5A 4ABAA 2SGFE 4XBDA 2CGAA 3LU9B 5C3NA 3ZYDA 1N8OC 2WV4A 4GAWA 2WYGA 3A7XA 2QYIA 1F92A 1TPAE 2FTMA 3RMMH 1G3CA 1K28D 4KTSA 4OS4A 1GCTB 1ZJKA 4K69A 2ZKSA 3UWJH 4CH8B 3TNTA 2EC9H 1FAXA 3LGUA 1WUNH 4A7IB 4AFUA 4CRBA 1A0JA 3AVZA 1O37A 3JZ1B 3LOXA 1LCYA 5FX6A 2GMTB 1ZLRA 2HOBA 1SOZA 2AGEX 5CMXH 2C8ZB 2O9QA 2XYAA 1MCTA 1QHRB 1SG8B 4WY3A 2ODQA 3SI4H 2ALVA 1O2TA 2CXVA 3OY6U 2QGRA 4DGJA 1T32A 2XC4A 2FOEA 5GPIB 1NESE 1QFKH 2PKSC 3UY9A 3SU2A 1GWAA 2ZTYA 1E36B 1TRYA 3SGQE 2EA3A 3K6ZA 2Y6TA 1C4U2 4K2YA 1NY22 1BMNH 1GL1A 1MAYA 2TIOA 1O3MA 5PTPA 2Z3EA 1IQMA 1C5VA 2VIPA 1FAKH 2AIQA 5DPAA 4AGKA 1HLTH 1V2UT 3E3TA 4JZDH 1K9OE 1GJDB 3BTHE 1GJ9B 3UFAA 4TYDA 3I29A 1P01A 1P3EA 4AB8A 1QJ6B 2HALA 1OXGA 2A7HA 1TMUH 2D2DA 2W7SA 5HYOA 1BTPA 1LVBA 3ZZBA 5A2MH 3MU4A 2BDGA 2SGPE 5GXPA 3FZZA 3BG8A 1UCYH 3ZZ3A 5FCRA 2FI3E 1Z1JA 4JZIA 1BCUH 3GCOA 1D3QB 1ZHRA 1O5AB 3UTUH 3H7TA 2BB4A 2G00A 4FXGH 1O30A 1GJ4H 2TGPZ 2ZU5A 1F0RA 1AWHB 3N7OA 3QTVH 3RXVA 3TH2H 1S6FA 3RUOA 2ZDMA 4AB9A 2ZDKA 1NFYA 2R3UA 3RXLA 2R9PA 5E0GA 2TBSA 1A3EH 1P11E 1ZMNA 3LPRA 1PPFE 4NIYA 4X1PU 4Y8XA 1Z8JB 2Y7XA 4FU8A 1AD8H 1CA8B 3OSYA 1WU1A 1RIWC 1BJUA 4GUXA 1EASA 4RKOB 1AE5A 1SLVB 1GHVH 1C2LA 3P8OA 4DG4A 2BXTH 3ODDA 4FUEA 1C2FA 2G4UA 4HGCA 4WJG2 4B74A 4KTUA 2ZFFH 1BMAA 1ACBE 2Z6BD 3LGIA 1PQ7A 1GHAG 2WPKS 3ZZAA 1WCZA 3EGKH 1DUEA 2QAAA 2WPMS 1JOUB 1SMFE 1NPMA 4AOQA 1A7SA 1HYLA 4AFQA 4FUGA 3A85A 2G5NA 1BZXE 4ZXYH 3O8BA 1Z6JH 4MNVA 2DE8A 4ISNA 3GY3A 2DUCA 1SC8U 1C4Y2 3SV7A 2RG3A 4NZLA 4ABFA 4Y6DA 1C9TA 2PKSB 1BOQA 1TNHA 1PFXC 1SGDE 5TJXA 2UUJB 3KGPA 1EKBB 4I8LA 4YM9A 2Z9GA 2SNWA 2IJOB 1ZPCA 5FBIA 1GHWH 1AI8H 3UIRA 3TGIE 4MPVA 4YLUA 3R0FA 1PPEE 1FY8E 1XUGA 3W94A 1BT7A 2VIQA 1O5CB 5AFZH 3HGNA 3FANA 1TAWA 4WH6A 2Z9LA 2BDIA 2AYWA 2BLQA 5EU8A 4MPWA 3SQEE 1P10A 2FYRA 3RDZA 3LGYA 1NRQH 2OBQA 4NIWA 1Y5BT 2FODA 3GY2A 1GDNA 4MQAA 2C8WB 2HVXA 1WTGH 3KQBA 3RMNH 1EZQA 1EJMA 1LVMA 1ZPZA 3SQHE 1H8DH 2ZU1A 3ZVBA 2ZI2H 3BTDE 3U69H 3WY8A 5GCHF 1MH0A 1O2RA 3EA9A 3QDZB 1PYTD 2C93B 1CA0B 2C3SA 1UTOA 3TIUA 4AX9H 4O97A 3TK6A 1C5WB 3SV6A 2OLGA 2C90B 1XKAC 2ZHEH 3SUDA 1CBWC 1D3TB 2OCVB 1T8NA 1O2JA 1YLDA 3RMOH 4D76A 1OWDA 1BUIA 1ZYOA 5IYTA 3SGBE 1P04A 3LKWA 3PMHB 4Q7XA 1AE8H 1O0DH 1O3GA 1UHBB 1TPOA 5J4QA 1Y3VA 1TQ7B 4X6OA 3QZQA 2OUAA 3M3VA 1CT2E 2J92A 4J2YB 2WUCA 2XCFA 4E05H 2GZ8A 2F9OA 3KCGH 3PM3A 1A0HB 3OX7U 3M7QA 3MO3A 1BTWA 3Q3XA 1C1QA 4JZ1A 4KKDA 1V2QT 3AW1A 4INKA 4Y0ZE 1O5GH 2FS9A 2WUBA 1SR5C 3GDSA 4CHAB 2NWNA 1KXEA 3P8NA 4KGAA 1UTLM 1QQ4A 1BRBE 1T8LA 1V2KT 4NA9H 5EXMA 1C2EA 2XXLA 4NFFA 5A8YA 4BAKB 1VGCB 1C5QA 3EQ0H 2ZHDA 3RXFA 1YBWA 2FX6A 1K1JA 1AFQC 1LDTT 3ZZCA 4MVNA 1F2SE 1UTMA 1JBUH 2OC8A 2V3HH 3LC3A 1C5NH 3PLKA 4ZXXH 5DG6A 5EXLA 3MO6A 1BRCE 3GY6A 1RD3B 3IG6B 3PMAB 1CT0E 2NU1E 4AYYB 1SGCA 1S5SA 4AFZA 1AUJA 4TY6A 1NO9H 1JXPA 5FBEA 1F5RA 2QIQA 3RXUA 3UNSA 4ISIH 1ZMLA 5EXNA 1EOJA 4NIVA 4X8VH 4AZ2B 2QY0B 4FUDA 5JBBS 3UQVA 1THRH 2TGTA 4CRAA 1G3DA 1TMBH 1ANBA 2H9HA 2OC7A 2UUFB 4R0IA 5FAHA 2ZQ2A 3KEEA 5GJ4B 2CV3A 4IMQA 2ZHFH 1ANCA 4TWWA 1VCPA 3VPKA 3SUGA 3QX5H 1P03A 4H6TA 1DUAA 4UE7H 5DP6A 4QT8C 1ANEA 1TNGA 2ZU3A 4UD9H 3MH7A 4K8BA 2GP9B 2R0KA 1SGIB 2ZTZA 2V3OH 4X0WU 5T3HA 1V2PT 1GGDB 3Q76A 4FU7A 3SOSA 7GCHG 1TLDA 1QURH 1TX7A 3Q77A 4FUFA 3DD2H 1XUKA 2ZG0H 1CE5A 2J38A 1K1LA 3SNCA 1MUEB 4SGBE 4F4OC 4B75A 4Y7BA 1L1NA 2FOGA 1BMLA 5GCHG 3VXFH 2QXHA 2HNTC 1QTFA 3A8BA 5EODA 1V2MT 4Y76A 4XE4A 1MU8B 3TPIZ 1GVKB 1MQ5A 1HV7A 1OWHA 1SQOA 4INLA 1ELVA 4MPXA 2ZWLH 1YCPK 1Z6EA 3LC5A 1LPKB 4A1XA 2OD3B 4ZAEA 2Q1JA 2FOHA 4B71A 2PGQB 1MTNB 6GCHG 1ZRKA 2OQUA 3E16B 1SHYA 1AHTH 5FCKA 3C27B 3M5LA 4I33A 2A1DB 2D26C 1ELBA 3MNBA 3ZZ4A 1TRNA 4FUHA 3GCTF 3PTBA 3TK5A 4BXWA 1W11U 4K60A 4A6LA 3SJOA 4D9QA 3U98H 5GIBA 5DGJA 1C1OA 2CJIA 4XOJA 2AGGX 1DXWA 4NIXA 4JK6A 1ELCA 1G3EA 1O2LA 2G5VA 5EPYA 3MTYA 2ASUB 1IAUA 3SU3A 1HAOH 1MBMA 3ATLA 1ELAA 1GMHG 3EA8A 3RXKA 2QCYA 1EZXC 4MNWA 1GHYH 2F9UA 8GCHG 2XBWA 1EQ9A 3ZVFA 3FP7E 5ABWA 1KY9A 4WWYA 1RTFB 3T25A 3KF2A 1F0TA 3HK3B 2BD3A 2FIRH 1BHXF 3QZRA 4MPUA 1ELEE 3TVJB 3PYHA 1VR1H 1QCPA 1PPHE 3BEUA 1CU1A 3S9BA 3PLPA 4UFDH 1MZAA 1OWEA 1GHAF 1ETTH 2NU3E 5HXFA 1EAWA 2H5CA 3H5CB 4GLYA 1HIAA 5EQQA 3H7OA 1D9IA 1HGTH 2BTCE 5LPRA 1JRTA 4I8JA 2BDAA 4X6PA 5C1UA 2BD2A 4THNH 2GTBA 1C2KA 3F1SB 5F8TA 1KLJH 1JMOH 4ABIA 1WV7H 4B76A 1KLIH 1GCTC 2G81E 3IITA 1C5LH 4K1TA 2FX4A 3RXEA 4FUJA 1HAVB 1BQYA 2VVUA 1FN8A 3U8TH 1E35B 2AFQB 1LHGH 1BTZA 1SFIA 1DLKB 3A80A 2ZFPH 1RRKA 1LKBA 2JH0D 3P92A 4U01A 2P8OB 1AZ8A 4YT7H 2IOTA 4UFFH 4GVUA 3MU1A 2AMPA 4ESTE 3QGNB 7GCHF 3B8JA 2BLVA 2HGTH 5EGMA 1V2LT 1HAIH 1V2NT 2GKVE 2Y80A 3MWIU 2O8UA 1WBGB 2RCEA 1S83A 2GCTB 1NZQH 2PTNA 2OINA 1K2I1 1J14A 1GBFA 2Z7FE 2H5DA 1D6RA 2HWLB 6CHAB 3CP7A 1J9CH 4X6MA 2PUQH 1O2HA 1TMTH 1GBDA 3KIDU 1TB6H 2K1QA 3TLOA 1OOKB 1QIXB 3RXDA 2AMDA 1SGFG 3RXPA 3QLPH 1GG6B 1AMHA 1QBOA 4IC6A 1YPJH 1MD8A 4X2WA 3UNQA 1HAPH 1ARBA 4VGCB 1NRNH 2B0FA 2FWWA 4ZROA 3ZVGA 2V35A 1KLTA 4H42U 2EEKA 3ITIA 5HM9A 1TGBA 1Y5AT 2P93A 1OWJA 1TFXA 3PB1E 3PLBA 1GBLA 1GBCA 4JCNA 3QN7A 3FFGA 1T7CA 2VINA 4YO9A 3SUEA 3SV9A 3RXMA 3D62A 3R3GB 3V3MA 1C5MD 3MHWU 2VWMA 3BG4B 4AFSA 1TBZH 2A7JA 1UK3A 5E8EH 4TPYA 1EZSC 1HNEE 1UHBA 2HNTE 3F68H 1GI0A 2GMTC 2GX4A 2VU8E 3GCNA 1TQ0B 4NA8A 1IQIA 1L0ZA 4GHTA 3AASA 5B6OA 1GI7B 1UVOA 2ANMH 1IOEA 2ZEBA 1H9LB 2GV7A 2VGCC 2C4FH 2F9PA 3A8CA 3NK8A 2P16A 2A7CA 2GDDA 5E2OA 2J2UA 1HJAC 5EW1H 3AAVA 4DURA 1NN6A 2G55A 2F9BH 1DE7H 3MH4A 3MU0A 2H9TH 1G3BA 1UTPA 1OWIA 2FOCA 4GCHG 1O3LA 2FLRH 1HDTH 4BTUB 1ABIH
chains in the Genus database with same CATH superfamily
1GG6C 1T31A 1FV9A 1FN6A 3SJ9A 2BY9X 2AERH 3NCLA 2EI8A 1OSSA 2EI7A 3DSGA 3BF6H 2OXSA 3MNSA 4DIIH 5HMAA 3QUMP 4J1YA 2ZZUH 1XUHA 1GBTA 2BD4A 5IK2D 1O3AA 2P3UB 2NU4E 2ODPA 4JYUH 3ZIAD 1P05A 3KQCA 4UFEH 3T27A 3T5FH 1DWDH 1WYKA 3GDVA 4F49A 3PV4A 1YGCH 3RLWH 4X8TH 1TIOA 3KHVA 1WSSH 1OP0A 1FIWA 1J17T 4R8TB 3T62A 2P59A 4XRNA 2GDEH 3EE0B 2CHAC 1HIAB 3ZVCA 1KXDA 4BAMB 1W10U 1TYNA 3LGVA 4Q80A 1BMMH 2GCHG 1MCVA 4YESB 3PRDA 1EZUC 1XM1A 1GHXH 3M5MA 1G37A 5C5NA 5JBTA 1H9HE 1O35A 2BD9A 5E2PA 5C94A 1C2IA 1AY6H 1VKYA 1O3KA 1YPEH 2XBVA 1IQHA 3HPTB 1AFQB 4UDWH 4NG9H 3P6ZB 4I8GA 2Q6GA 3F3BA 2VIOA 5DK1A 4X2YA 1CHGA 1OHHD 2LELA 2W7UA 2Q6FA 4ISHH 3A89A 1WAYB 4MNYA 3UWIA 1C2DA 1A4WH 2QXIA 4A5TS 3EYDA 4ASUD 6LPRA 2WV5A 1CHOF 2B5TB 3HK6B 2BY8X 1BHXB 1MZDA 3MI4A 3U28C 4Y8ZA 3BV9B 3M61U 5C67A 1O3CA 1C1UH 3URCA 1GGDC 1O2UA 5F8ZA 1AB9C 1PYTC 1NFUA 1G36A 2A31A 3SBKA 4AG2A 3GISB 2GT8A 3M5OA 2TPIZ 1GHBF 3EDXB 4GSOA 2Y5GA 3ZZ7A 1VGCC 3N99A 1P2OA 2D8WA 1Y3WA 4ABDA 5C1XA 2PSYA 5C5OA 1EB1H 1S0RA 1O2XA 1C2GA 1HPGA 1EUFA 2HRVA 1KXAA 3Q00A 2B7DH 3OAAD 4NCYA 1BDAA 1Z8IB 1OKXA 1RFNA 5EQSA 1VCWA 1A0LA 2ALPA 1BBRK 4YOJA 3GCHC 1O2OA 1L2EA 1UJ1A 1D6WA 1HAHH 4ISOA 4YOIA 3V0XA 1BTYA 1W7XH 1NRRH 5H4IB 1MTUA 3VB5A 4Y79A 5CHAC 3SU1A 3BTEE 1BBRE 1NTPA 3RM2H 1FNIA 1BITA 1O2GH 2ZP0H 1GI9B 2BY7X 2BX4A 1DSUA 1O34A 3UOPA 2ZHWH 1KTSB 2W6ID 3N7DA 1W2KH 2J97A 4Z0KA 5DP4A 1YPLH 1P2IA 5FPSA 1K21H 1CBWB 4HI3A 1DFPA 1W3CA 1S6LA 1A61H 1OYTH 4IN1A 3TJNA 1W0YH 1BTXA 2J98B 3BIUH 3ODFA 2ANKH 1MKWH 3D49H 1ZTJA 1F0UA 2ZPSA 1NROH 1FLEE 1O3IA 3BTQE 4A1VA 3AW0A 4BOHA 1YCPH 3O8DA 4I8KA 3CS7A 1A1RA 1AQ7A 1ZR0A 4ZH8A 1W14U 3ZVAA 3B9FH 1TGTA 1GMCF 1JIRA 2QC2A 1A46H 3GY7A 4CBNA 3BIVH 2Y7ZA 5FPTA 1O32A 4BAQB 1J16A 1TOMH 2BVXH 3TITA 1ZHMA 2AMQA 1FY3A 1AVXA 2DE9A 1QL7A 1O3NA 1YLNA 3Q3KA 1HUTH 1T8OA 3GY5A 4IMZA 1FPCH 1E38B 4JK5A 1HAGE 3SI3H 2ZGXH 1EPTB 3T29A 4Q7YA 1W8BH 1TBQH 3BEIB 5DP8A 1TA6A 5AF9H 1QJ1B 1WDIA 2VNTA 2HPQH 2B9LA 2VWOA 3UPEA 5DKMA 4B2AA 1AB9B 4DT7B 1SI5H 2YNAA 1TNLA 4YOGA 5AFYH 1HJ8A 3DA9B 2F3CE 3BTFE 1O3FA 1G2MA 1GBKA 1KXBA 2XBXA 4O3UA 3ZZ6A 1AUTC 3AK5A 1S84A 1SLWB 2K8IA 2GCHF 1AZZA 5DN6D 3WWFA 1OPHB 4DW2U 1UCYE 2EY4C 1OP2A 3NUMA 1GHZA 2J95A 5JB9S 1GHBG 2IPHA 4D7FA 2OQ5A 2ZGHA 1E1RD 2VGCB 2F9NA 3A84A 3E91A 5FHTA 2A4GA 2SGQE 3A8DA 1AVWA 5DP3A 1GJ8B 3OU0A 1MMJN 5DO4H 3L33A 5G4BA 2ZA5A 1O2VA 4B2CA 1MKWK 3UB0A 1ZRBA 4ACBA 2FPZA 1DWCH 5K7RA 1LQEA 5T6GA 1W13U 1NT1A 2W6JD 1B0EA 2FOAA 3SU0A 2FOFA 4OGXA 1AWFH 5L30H 1GBBA 3DUXH 3P8GA 3PWBA 3MMGA 1LQDB 3U9AH 2SFAA 1IQKA 1O3JA 1UTKA 2ZFTA 4IC5A 3F0OA 4CRFA 4MDSA 1O3OA 2WYJA 2IN2A 1EJNA 2ZQ1A 5JB8S 2XC0A 3NRLA 3T26A 2ZDLA 4MTBA 2ZCLP 3T28A 2ZPQA 1C2HA 1B0FA 1TGNA 4TPIZ 1P2KA 2OK5A 3OYPA 1V2WT 2V7QD 2ZIQH 3FZDA 4Y11E 2ZDVH 4A1TA 3A87A 5C17A 2STBE 1KDQA 1Q3XA 1EXFA 2R0LA 5SGAE 1BBRH 2GZ9A 2UWLA 4CH2B 1M9UA 3OFND 3VGCB 1QBVH 3S7HB 1LHDH 3OTJE 2A32A 1P57B 1UVSH 3DT0H 1DICA 1TONA 2J34A 4IBLH 1DOJA 1N6XA 2VVVA 1J8AA 2RA0A 2BQ6B 3UREA 4SGAE 1DS2E 4X8SH 1BRUP 2O8MA 1RJXB 2OBOA 1ESBA 5C1YA 3UR9A 2UWPA 1GVLA 1LKAA 1DSTA 2Y81A 1VJ9U 4IS5A 3PMBB 1Z8RA 2JJ2D 5JBAS 1HAXB 1ORFA 2A5IA 1QR3E 1GPZA 2VH6A 2PUXB 4FVDA 1DM4B 1P02A 1CSOE 1DX5M 1O2SA 3E0PB 3ZZ5A 1HAZB 1DWBH 3CENA 4Y0YE 3PROA 2A45B 1RTKA 1A3BH 1AIXH 1YCPM 1YY3A 1PPZA 2P95A 2Z3CA 2PP6A 4Z6AH 2ZCKP 1C1NA 1MD7A 4VGCC 3LH3A 2ZPRA 4DJZB 4K5ZA 3FOAA 2KCYA 5AHGH 2WPJS 5C2ZA 2XTTB 2AIPA 1HFDA 2Y5HA 1GL0E 3CNRA 1G9IE 4I32A 1O3PB 4CR9A 3LONA 1JRSA 1Y8TA 3TH4H 3A7TA 3RXSA 1AU8A 3OEED 4B73A 1FX0B 1FY4A 1WOFA 3DHKH 1ZPBA 9ESTA 2R2WU 1C5TA 2VH0A 3V12A 3FKSD 2H9EH 2GCTC 3S9CA 4HFPB 3U8OH 3I78A 5DP7A 2VB0A 1L1GA 3ZYEA 1TA2A 1ZHPA 1O2PA 1E34B 3U8RH 1LO6A 3SU6A 3NXPA 3E0NB 3M3SA 1SSXA 4O3TA 3KQ5A 2PR3A 4RI0A 3SNDA 2WHXA 3M37A 1P9SA 1PPGE 1C5ZB 1W12U 2P8OC 4NWLA 1JWTA 1NM6A 2VVCA 4XD7D 1AVGH 1UCYK 3OY5U 1K1MA 4XSKU 1P09A 4JZFH 1IQFA 2FYQA 1CGIE 1D3PB 1O5FH 1DVAH 2HPPH 1GBHA 3SHAH 1ZOMA 2QA9E 3HGPA 3TK9A 3GDUA 1QA7A 3SV8A 1O3BA 1N1LA 3QK1A 3UUZA 1XMNB 1CQQA 3SNAA 3UAIC 1ELGA 1DDJA 4BXSA 2FMJA 3S7KB 4CRGA 1K1OA 2GT7A 3TNSA 1AN1E 4NZQA 1HB0B 4LZ4B 1SGEE 3RP2A 2V6NA 2VBCA 3HATH 1ZTKA 2I6SA 3RXRA 4YT6H 2THFB 1O5BB 1XX9A 4E7RG 1XVMA 3E90B 4DY7B 4K3JA 1QB9A 4RSPA 4CRCA 2F91A 2KZ4A 3VGCC 2C8XB 3BTWE 2QXGA 2H2ZA 1ABJH 5EQRA 4TSFD 1ZSJA 4Y8YA 3STIA 1N6YA 5FX5A 5F6MA 7LPRA 4FUCA 1YM0A 1V2TT 1NFWA 2O8WA 4AYVB 4DOQA 1HCGA 1KDQB 4BNRA 2PV9B 1Y3YA 1P06A 1SVPA 5T6FA 2ZU2A 1NU9A 1QGFA 3LJJA 1EJAA 8LPRA 5LGOA 4DCDA 3ATIA 3E6PH 3DFJA 1SLXB 9LPRA 2ZGJA 1C9PA 1CA0C 2P3FH 2AH4X 1Z8GA 5CHAB 1QA0A 2ZGCA 1GBAA 8KME2 1P9UA 2BVRH 1TNJA 1K1IA 2A4RA 4YTAA 1D4PB 1MKXH 3URDA 2FI4E 4Y7AA 3SJ8A 3U1JB 2BDCA 1GBIA 2UUYA 2G51A 2OTVA 1C2MA 4FUIA 1C2JA 2IPQX 1O2ZA 2OC1A 1TX8A 1O2QA 5FXLA 2ZF0H 2GV6A 3SO3A 3TH3H 2JDID 3ATWA 3ENSB 2PSXA 3ZZ8A 3KN2A 3LGWA 1SGRE 1EOLA 3H09A 4ABGA 2ZC9H 3SNBA 1IQNA 1MQ6A 1KTTB 2XRCA 5LH8A 1UTNA 3L3TA 1C1PA 1TGCA 1XUFA 1BRAA 4Q2KA 1ELDE 3HKIB 2J98A 1VITH 3F2GA 1UVUH 3MU5A 3SU5A 2JH5D 3F9GA 3GY8A 1ZSLA 3JZ2B 1OS8A 2BD7A 1DLEA 1O2KA 1UVPA 1V2ST 1E0FD 1EAIA 4FVBA 1GI4A 2UUKB 1ZJDA 3FO8D 4K8YA 2BVSH 1S0QA 2SNVA 1SQAA 3RU4E 3S9AA 3NKKA 1YC0A 2FTLE 1O38A 1MAXA 2BLWA 1CVWH 1ESTA 3RC6A 4MLFB 2ZDAH 2FO9A 1QJ7B 2SGDE 2W3KA 1V2VT 4X2XA 1NBMD 5F03A 2BHGA 2TGAA 1P2JA 2QXJA 2SGEE 3SJKA 1HAYB 1XVOA 1V6DA 3MH6A 2L6OA 4IGDA 4OS6A 1VCQA 1TGSZ 2ZFRH 2ZNKH 4X6NA 8ESTE 1RIWB 1SGYE 3U1IB 3ZVDA 1Q31A 4KTCA 2VIVA 4GCHF 3VFEA 1ZGVA 1E37B 4INHA 2A5KA 1OX1A 1EPTC 4NFEA 1WTHD 1K1NA 2PHBA 1Q2WA 2G52A 4ABBA 4LOYH 5EOKA 1O2MA 1O39A 1O3HA 3ZV9A 4TY7A 3B23B 1LPGB 5JDUB 1A5HA 2GZ7A 2WPHS 1TX6A 1P12E 1AKSA 1SGFA 4X1QU 4H4FA 1YP9A 3SORA 3LGTA 2VIWA 1SGNE 4HTCH 4TWYA 4X8UH 3M36A 1ZTLA 1V2RT 4K1EA 3TU7H 2A0QB 5A09A 1ETRH 1FPHH 4MG3A 2VJ1A 1K1PA 4ZHAA 3UR6A 4JZEH 4B2BA 4BTIB 5A0AE 5EW2H 3LJOA 3DFLA 2ESTE 3FP6E 5J4SA 1INCA 3K9XB 1YKTA 4OM9A 5T1VA 3TJVA 4P02A 2HLCA 3LIWA 3MFJA 2BLOA 1QBNA 3RLYH 2XCNA 5L2YH 1C5PA 3RMLH 2ZDNA 2NU0E 3NWUA 1G30B 1P0SH 2OC0A 1H9IE 4FUBA 2RDLA 4WMEA 2XC5A 3NPSA 3KYFA 1SQTA 1GI8B 1HBTH 2FOBA 3Q3YA 4YZUA 1DANH 2XWAA 1NRSH 2QF5A 5DP9A 1S81A 4XFQA 1TPPA 3SYJA 1GJAB 4ZUHA 3F9FA 1V2OT 1IQGA 1CHOG 3ELAH 1HAVA 3KL6A 5LPEA 4O03A 1QB6A 3SN8A 1OWKA 4XDEA 4ZHLU 3VB3A 4WXVA 1TPSA 1Y3UA 1Y3XA 1MTSA 1C4V2 2KCPA 1O2NA 2W5EA 3F9EA 3WW7A 1O2IA 2JH6D 1SGPE 2Z3DA 1UO6A 2BY5X 2J94A 2NU2E 1MABB 1RTLA 2GJGA 4I31A 3P95A 4B6EA 1LVYA 2BQWB 4I7YH 1EPTA 4CBOA 1O3EA 2Z9IA 1L4DA 4M7GA 2AGIX 2WPLS 1O3DA 4CREA 3A7ZA 1DY8A 4K1SA 2PTCE 1ZMJA 3TGKE 5A0BA 1DITH 3WWBA 4D8NA 5L6NH 2BDHA 1UTJA 1XUIA 2KCAA 5DJ7A 2BOHB 4AGJA 1Z71A 4UEHH 1GMDF 1K22H 6CHAC 1V2JT 2CMYA 4B6FA 1E1QD 2W26A 1TBRH 1ZGIA 2FZZA 3RM0H 4A92A 5A8ZA 2AS9A 1G2LA 3RXJA 4E7NA 1FONA 2BOKA 4B1TA 1BJVA 3SHCH 4LZ1H 4X2VA 3MYWA 5GDSH 1XKBC 1U6QA 1QNJA 2QF3A 2BDYA 3RC5A 3RXOA 1THPB 4X1SU 1GJ5H 1AKSB 2M5TA 3GYLB 1FIZA 2J4IA 1ID5H 1A5GH 1SHHB 2FM2A 1VITF 4H6SB 1PQAA 2P94A 1CGHA 4ZKNU 1GDUA 1RXPA 2CK3D 3LH1A 1O2WA 3FAOA 4BAOB 3A81A 1IHSH 3A7VA 4X1RU 3SW2B 3M5NA 1EB2A 2ZCHP 1NS3A 4AORA 5CDFE 5IDKA 1QRWA 3MOCA 4Q63A 1LMWB 3VG8A 1RGQA 3I77A 4GHQA 1YPGH 1W0ZU 1GI1A 4ZMAH 3RXIA 2QF0A 2QV1A 1O5DH 2Y82A 3O8RA 1YYY1 5JPMH 1YPHC 2ZFSA 1J15A 1JIMA 4KELA 4ZKOU 5EJLA 1BIOA 4X1NU 1GI6A 4AG1A 2QF4A 5ESTE 1KIGH 3M7UA 1NRPH 4UFGH 6GCHF 3O8CA 1NC6A 3SUFA 1SB1H 2BQ7B 4ASHA 3PWCA 1H4WA 5I25A 3RXAA 1SL3A 2A4OA 3BTTE 1P2MA 5TCAA 3TJOA 4JMYA 1IHTH 1S82A 1GJCB 3T2NA 4WH8A 3LT3A 1W7GH 2ZU4A 1T4VH 1VITG 1S6HA 1ANDA 1GMCG 2PKAB 4IW4E 2FP7B 2UWOA 3S69A 3RU4T 1SGQE 3C1KA 3EA7A 2C8YB 1QZ8A 3BTGE 5BRRE 3EAJA 3A83A 1G32B 4BTTB 4KP0A 5A8XA 3MO9A 1QL9A 3W95A 2CF8H 4U30A 3GYMA 2W3IA 1ELFA 4ZKRU 5FPYA 1EX3A 1BTUA 1C5YB 1YF4A 2KAIB 1LHFH 2HLDD 2BYAX 5HM2A 4CR5A 3MNXA 4NWKA 4OGYA 4YLQH 3E8LA 3OTPA 5F8XA 4LXBH 1EP5A 3P8FA 3NZIA 3P17H 3FVFB 1MU6B 1GI2A 2YMSC 2EI6A 2V0BA 4Q7ZA 3ZZ9A 2WPIS 2WINI 1F0SA 4AN7A 3HKJB 3TGJE 2ILNA 3GCTG 1GVZA 1GBJA 5F53A 1BB0B 1ESAA 1UMAH 4Q4LA 1GJBB 1YLCA 7KMEH 1O33A 3VB6A 1H8IH 3IWMA 1TNKA 5I46H 1FQ3A 3STJA 6ESTA 1C5SA 4XBBA 1UK2A 2WV9A 2XW9A 1C1WH 5EJ1A 3UNRA 3QTOH 1TABE 1FMGA 1Y59T 1UTQA 1GBMA 4ABHA 5K0HA 1DT2A 1QL8A 1PQ8A 2FESH 5HIYA 3KQDA 2FEQH 2GD4B 1LHCH 2F43B 4FOUC 3M7TA 4I8HA 1HRTH 3RXCA 2F9VA 1RS0A 2JETC 2JIZD 4CRDA 5AVDA 1SOTA 4DIHH 4WVPE 1F7ZA 1KXFA 2P3TB 4NA7A 2Q6DA 2YOLA 4XBCA 1CO7E 2BZAA 2A5AA 1GJ7B 4PROA 2F4LA 2FLBH 2LNCA 5C20A 3QGJA 3TJUA 3GY4A 1ELTA 1FZZA 2BXUH 2JETB 1C1TA 1ZZZA 5BPEA 3PO1B 3BEFB 5E0HA 1MKXK 2BX3A 4ZHMU 3VB4A 1A5IA 1IQLA 1DXPA 2J9NA 3RXQA 1GDQA 1UVTH 1AGJA 2QN5T 1XXDA 1NU7B 1EATA 2GGVB 3A8AA 8GCHF 1D3DB 2CF9H 1C1VH 4HZHA 4MNXA 4O9VA 2RA3A 1LVOA 4ABJA 4ZKSU 4BANB 1THSH 4GPGA 3ZZDA 3BTKE 1L4ZA 1DY9A 2A2QH 1COWD 3PO1C 4YXWD 1O31A 2XWBI 2KM0A 2I6QA 1OYQA 3ATKA 1LHEH 1EAUA 4IN2A 1OP8A 1AO5A 1CT4E 4F55A 2AEIH 1O36A 1B5GH 1ETSH 2OP9A 5A0CA 1Y5UT 2B8OH 2YNBA 2FS8A 3FP8E 2PGBB 1PQ5A 5GWZA 1XXFA 4WXIA 3PV5A 5HGGA 2FOMB 2Z9KA 5T6DA 5TCCA 1TE0A 3P70B 1T8MA 1C5RA 3F9HA 2STAE 3BN9A 4U32A 4CHAC 1FDPA 2ZHQH 1P2NA 1O2YA 3LDXH 2ZO3H 3SZNA 4ISLA 1TNIA 3AAUA 3ZV8A 4RN6A 3VXEH 1B7XB 3PTNA 1WQVH 5ESBA 1LPZB 5EPNA 1HXEH 2XNIA 1DPOA 3KYGA 1GBEA 2FI5E 4ZCNA 1BTHH 1UK4A 1MTVA 1C1RA 3MNCA 1C1MA 1SPJA 2PLXA 3M3TA 3RXGA 1F5KU 4OS5A 1MBQA 1EP6A 2BDBA 2VIDA 2XBYA 2H1UA 2R2MB 4D7GA 1HJ9A 3V13A 2BD5A 3A7WA 4DVAU 3QWCH 2BZ6H 1YPHE 1TOCB 5LPFA 1FUJA 5JYIA 1GMDG 3M35A 2ANYA 2ZTXA 4JYVH 3E1XB 4NSYA 4FU9A 3UQOA 1HJAB 1TRMA 2H6MA 4BAHB 4NSVA 5CE1A 1TWXB 3VEQB 1FXYA 1HXFH 1QRXA 3K6YA 4Y71A 4D9RA 1SLUB 4RKJB 4AC9A 1FY1A 3OEHD 5E0JA 3VB7A 2BMGB 2ANWA 1DWEH 1ARCA 1VJAU 3BSQA 2Y5FA 1PPCE 3KNXA 2HNTF 1GI5A 1C5OH 4WMDA 3BG4C 2ZECA 2IJD1 4E06H 3RC4A 1BMFD 2BD8A 2A2XH 4Y10E 1MTNC 1PPBH 3SU4A 4U2WA 3V7TA 1QRZA 2ULLA 2VWLA 5L2ZH 3GOVB 2KCOA 1FJSA 2BY6X 3MU8A 4M9FA 3RXBA 3D65E 1CGJE 5DSFA 1V3XA 2R3YA 3SGAE 3GICB 4NGAH 2ODYB 2Z9JA 3A7YA 4RT0A 7ESTE 2KAIA 2FDAA 3SJIA 1S85A 4OS1A 2BM2A 3F6UH 2G4TA 4OS2A 1BA8B 5ETXA 3ZVEA 2PFEA 3A82A 4ABEA 1FY5A 4P00A 4JYTA 3BTME 2G8TA 1C1SA 2CN0H 1NBME 3K2UA 3A86A 2PW8H 1O5EH 2JKHA 1KSNA 1L1JA 1ZSKA 2PKAA 3A88A 2D1JA 1AFEH 5EG4A 3S0NA 3RU4D 1GMHF 2FXRA 2TRMA 3RXHA 5DP5A 1SFQB 1UW7A 1SKYE 1SBWA 2O8LA 1GI3A 4OS7A 1P3CA 4LK4A 1XUJA 5JBCS 3PMJA 3D23A 2CHAB 3ATMA 2A4QA 1IQEA 2VWNA 2TGDA 4ACAA 5GNDA 3SV2H 2Z94A 4WMFA 1F5LA 1FI8A 3DSPA 1LTOA 1NFXA 1H1BA 1QB1A 2ZGBH 3SNEA 2F83A 1X7AC 3KQEA 1KXCA 1KYNA 1P2QA 2SGAA 1PJPA 1WQSA 1A2CH 1TALA 3G01A 3RXTA 1GCDA 1P8VC 3K65B 4WF8A 2O8TA 4UONA 1Z7KA 1C5UA 2PWXA 1GJ6A 1QQUA 1VZQH 1Z1IA 3QO6A 3CS0A 1SGTA 1YPMH 1N8OB 3UOUA 3GCHB 2GVFA 3ESTA 1EAXA 3L6PA 1MTWA 1C5XB 1T4UH 1IQJA 1QY6A 1YPKH 2LPRA 2ZFQH 3MH5A 4ABAA 2SGFE 4XBDA 2CGAA 3LU9B 5C3NA 3ZYDA 1N8OC 2WV4A 4DT4A 4GAWA 2WYGA 3A7XA 2QYIA 1F92A 1TPAE 2XNDD 2FTMA 3RMMH 1G3CA 1K28D 4KTSA 4OS4A 1GCTB 1ZJKA 4K69A 2ZKSA 3UWJH 4CH8B 3TNTA 2EC9H 1FAXA 3LGUA 1WUNH 4A7IB 4AFUA 4CRBA 1A0JA 3AVZA 1O37A 3JZ1B 3LOXA 1LCYA 5FX6A 2XOKD 2GMTB 1ZLRA 2HOBA 1SOZA 2AGEX 5CMXH 2C8ZB 2O9QA 1MCTA 1QHRB 1SG8B 2XYAA 4WY3A 2ODQA 3SI4H 2ALVA 1O2TA 2CXVA 3OY6U 2QGRA 4DGJA 1T32A 2XC4A 2FOEA 5GPIB 1NESE 1QFKH 2PKSC 3UY9A 3SU2A 1GWAA 2ZTYA 1E36B 1TRYA 3SGQE 2EA3A 1KMHB 3K6ZA 2Y6TA 1C4U2 4K2YA 1NY22 1BMNH 1GL1A 1MAYA 2TIOA 1O3MA 5PTPA 2Z3EA 1IQMA 1C5VA 2VIPA 1FAKH 2AIQA 2EQNA 5DPAA 1HLTH 4AGKA 1V2UT 3E3TA 4JZDH 1K9OE 1GJDB 3BTHE 1GJ9B 3UFAA 4TYDA 2AHME 1P01A 1P3EA 3I29A 4AB8A 1QJ6B 2HALA 1OXGA 2A7HA 1TMUH 3F0PA 2D2DA 2W7SA 5HYOA 1BTPA 1LVBA 3ZZBA 5A2MH 3MU4A 2BDGA 2SGPE 5GXPA 3FZZA 3BG8A 1UCYH 3ZZ3A 5FCRA 2FI3E 5C0TA 1Z1JA 4JZIA 1BCUH 3GCOA 1D3QB 1ZHRA 1O5AB 3UTUH 3H7TA 2BB4A 2G00A 4FXGH 1O30A 1GJ4H 2TGPZ 2ZU5A 1F0RA 1AWHB 3N7OA 3QTVH 3RXVA 3TH2H 1S6FA 3RUOA 2ZDMA 4AB9A 2ZDKA 1NFYA 2R3UA 3RXLA 2R9PA 5E0GA 1YWUA 2TBSA 1A3EH 2M2AA 1P11E 1ZMNA 3LPRA 1PPFE 4NIYA 4X1PU 4Y8XA 1Z8JB 2Y7XA 4FU8A 3F2HA 1K0HA 1AD8H 1CA8B 3OSYA 1WU1A 1RIWC 1BJUA 4GUXA 1EASA 4RKOB 1AE5A 1SLVB 1GHVH 1C2LA 3P8OA 4DG4A 2BXTH 3ODDA 4FUEA 1C2FA 2G4UA 4HGCA 4WJG2 4B74A 4KTUA 2ZFFH 1BMAA 2WSSD 2WZQA 1ACBE 2Z6BD 3LGIA 1PQ7A 1GHAG 2WPKS 3ZZAA 1WCZA 3EGKH 1DUEA 2QAAA 2WPMS 1JOUB 1SMFE 1NPMA 4AOQA 2YMSD 1A7SA 1HYLA 4AFQA 4RT1A 4FUGA 3A85A 2G5NA 1BZXE 4ZXYH 1EFRD 3O8BA 1Z6JH 4MNVA 3FN8A 2DE8A 4ISNA 3GY3A 4TT3D 2DUCA 1SC8U 1C4Y2 3SV7A 2RG3A 4NZLA 4ABFA 4Y6DA 1C9TA 2PKSB 1BOQA 2RDEA 1TNHA 1PFXC 1SGDE 5TJXA 2UUJB 3KGPA 1EKBB 4I8LA 4YM9A 2Z9GA 2SNWA 2IJOB 1ZPCA 5FBIA 1GHWH 1AI8H 3UIRA 5CHBA 3TGIE 4MPVA 4YLUA 3R0FA 1PPEE 1FY8E 1XUGA 3W94A 1BT7A 2VIQA 1O5CB 5AFZH 3HGNA 3FANA 1TAWA 4WH6A 2Z9LA 2BDIA 4Z1MD 2AYWA 2BLQA 3MQKC 5EU8A 4MPWA 3SQEE 1P10A 2FYRA 3RDZA 3LGYA 1NRQH 2OBQA 4NIWA 1Y5BT 2FODA 3GY2A 1GDNA 4MQAA 1SQRA 2C8WB 2HVXA 1WTGH 3KQBA 3RMNH 1EZQA 1EJMA 5B6LA 1LVMA 1ZPZA 3SQHE 1H8DH 2ZU1A 3ZVBA 2ZI2H 3BTDE 3U69H 5KEDA 3WY8A 5GCHF 1MH0A 1O2RA 3EA9A 3QDZB 1PYTD 1WXRA 2C93B 1CA0B 2C3SA 1UTOA 3TIUA 4AX9H 4O97A 3TK6A 1C5WB 3SV6A 2OLGA 2C90B 1XKAC 2ZHEH 3SUDA 1CBWC 1H8ED 1D3TB 2OCVB 1T8NA 1O2JA 2V3MA 1YLDA 3RMOH 4D76A 1OWDA 1BUIA 1ZYOA 2L74A 5IYTA 3SGBE 5HKKD 1P04A 3LKWA 3PMHB 4Q7XA 1AE8H 1O0DH 1O3GA 1UHBB 1TPOA 5J4QA 1Y3VA 1TQ7B 2K0QA 4X6OA 3QZQA 2OUAA 3M3VA 1CT2E 2J92A 5FL7D 4J2YB 2WUCA 2XCFA 4E05H 2GZ8A 2F9OA 3KCGH 3PM3A 1A0HB 3OX7U 3M7QA 3MO3A 1BTWA 3Q3XA 1C1QA 4JZ1A 4KKDA 1V2QT 3AW1A 4INKA 4Y0ZE 1O5GH 2FS9A 2WUBA 1SR5C 3GDSA 4CHAB 2NWNA 1KXEA 3P8NA 4KGAA 1UTLM 1QQ4A 3PV2A 1BRBE 1T8LA 1V2KT 4NA9H 5EXMA 3GS9A 1C2EA 2XXLA 4NFFA 5A8YA 4BAKB 1VGCB 1C5QA 3EQ0H 2ZHDA 3RXFA 1YBWA 2FX6A 2QE7D 1K1JA 1AFQC 1LDTT 3ZZCA 4MVNA 1F2SE 1UTMA 1JBUH 2OC8A 2V3HH 3LC3A 1C5NH 3PLKA 4ZXXH 5DG6A 5EXLA 3MO6A 1BRCE 3GY6A 1RD3B 3IG6B 3PMAB 1CT0E 2NU1E 4AYYB 1SGCA 1S5SA 4AFZA 1AUJA 4FETA 1NO9H 1JXPA 4TY6A 5FBEA 1F5RA 2QIQA 3RXUA 3UNSA 3F2FA 4ISIH 1ZMLA 5EXNA 1EOJA 4NIVA 4X8VH 4AZ2B 2QY0B 4FUDA 5JBBS 3UQVA 1THRH 2TGTA 3DCLA 4CRAA 1G3DA 1TMBH 3OE7D 1ANBA 2H9HA 2OC7A 2UUFB 4R0IA 5FAHA 2ZQ2A 3KEEA 5GJ4B 2CV3A 4IMQA 2KFWA 2ZHFH 1ANCA 4TWWA 1VCPA 3VPKA 3SUGA 3QX5H 1P03A 4H6TA 1DUAA 4UE7H 5DP6A 4QT8C 1ANEA 1TNGA 2ZU3A 4UD9H 3MH7A 4K8BA 2GP9B 2R0KA 1SGIB 2ZTZA 2V3OH 4X0WU 5T3HA 1V2PT 1GGDB 3Q76A 4FU7A 3SOSA 7GCHG 2WPDD 1TLDA 1QURH 1TX7A 3Q77A 4FUFA 3DD2H 5C0UA 1XUKA 2ZG0H 1CE5A 2J38A 1K1LA 3SNCA 4HG6A 1MUEB 2HVYB 4SGBE 4F4OC 4B75A 4Y7BA 1L1NA 2FOGA 1BMLA 5GCHG 3VXFH 2QXHA 2HNTC 1QTFA 3A8BA 5EODA 1V2MT 4Y76A 4XE4A 1MU8B 3TPIZ 1GVKB 1MQ5A 1HV7A 1OWHA 1SQOA 4INLA 1ELVA 4MPXA 2ZWLH 1YCPK 1Z6EA 3LC5A 1LPKB 2YMSB 4A1XA 2OD3B 4ZAEA 2Q1JA 2FOHA 4B71A 5KECA 2PGQB 1MTNB 1W0KD 1ZRKA 6GCHG 2OQUA 3E16B 1SHYA 1AHTH 2JJ1D 5FCKA 3C27B 3M5LA 4I33A 2A1DB 2D26C 1ELBA 3MNBA 3ZZ4A 1TRNA 4FUHA 3GCTF 3PTBA 3TK5A 4BXWA 1W11U 4K60A 4A6LA 3SJOA 4D9QA 3U98H 2KR7A 5GIBA 5DGJA 1C1OA 2CJIA 4XOJA 2AGGX 1DXWA 4NIXA 4JK6A 1ELCA 1G3EA 1O2LA 2G5VA 5EPYA 3MTYA 2ASUB 1IAUA 3SU3A 1HAOH 1MBMA 3ATLA 1ELAA 1GMHG 3EA8A 3EE7A 3RXKA 2QCYA 1EZXC 4MNWA 1GHYH 2F9UA 8GCHG 2XBWA 1EQ9A 3ZVFA 3FP7E 5ABWA 1KY9A 4WWYA 1RTFB 3T25A 3KF2A 1F0TA 3HK3B 2BD3A 2FIRH 2LP6A 1BHXF 3QZRA 4MPUA 1ELEE 3TVJB 3W1EA 3PYHA 1VR1H 1QCPA 1PPHE 3BEUA 1CU1A 3S9BA 3PLPA 4UFDH 1MZAA 1OWEA 1GHAF 1ETTH 2NU3E 5HXFA 1EAWA 2H5CA 3H5CB 4GLYA 1HIAA 5EQQA 3H7OA 1D9IA 1HGTH 2BTCE 5LPRA 1JRTA 3N7EA 2BDAA 4I8JA 4X6PA 5C1UA 2BD2A 4THNH 2GTBA 1C2KA 1H8HD 3F1SB 5F8TA 1KLJH 1JMOH 4ABIA 1WV7H 4B76A 1KLIH 1GCTC 2G81E 3IITA 1C5LH 4K1TA 2FX4A 3PRBA 3RXEA 4FUJA 1HAVB 1BQYA 2VVUA 1FN8A 3U8TH 1E35B 2AFQB 1LHGH 1BTZA 1SFIA 1DLKB 3A80A 2ZFPH 1RRKA 1LKBA 2JH0D 3P92A 4U01A 2P8OB 1AZ8A 4YT7H 2IOTA 2RFKC 4UFFH 4GVUA 3MU1A 2AMPA 4ESTE 3QGNB 7GCHF 3B8JA 2BLVA 2HGTH 5EGMA 1V2LT 1HAIH 1V2NT 2GKVE 2Y80A 3MWIU 2O8UA 1WBGB 2RCEA 3DSOA 3SZEA 1S83A 2GCTB 1NZQH 2PTNA 2OINA 1K2I1 1J14A 1GBFA 2Z7FE 2H5DA 1D6RA 2HWLB 6CHAB 3CP7A 1J9CH 4X6MA 2PUQH 1O2HA 1TMTH 1GBDA 3KIDU 1TB6H 2K1QA 3TLOA 1OOKB 1QIXB 3RXDA 2AMDA 1SGFG 2KX4A 3RXPA 3QLPH 5HIZA 1E79D 1GG6B 1AMHA 1QBOA 4IC6A 1YPJH 1MD8A 4X2WA 3UNQA 1HAPH 1ARBA 4VGCB 1NRNH 2B0FA 2FWWA 4ZROA 3ZVGA 2V35A 1KLTA 5EIYA 1W0JD 4H42U 2EEKA 3ITIA 5HM9A 1TGBA 1Y5AT 2P93A 1OWJA 1TFXA 3PB1E 3PLBA 4F48B 1GBLA 1GBCA 4JCNA 3QN7A 3FFGA 1T7CA 2VINA 4YO9A 3SUEA 3SV9A 3RXMA 3D62A 3R3GB 5EJZA 3V3MA 1C5MD 3MHWU 2VWMA 3BG4B 4I86A 4AFSA 1TBZH 2A7JA 1UK3A 5E8EH 4TPYA 1EZSC 1HNEE 1UHBA 2HNTE 3F68H 1GI0A 2GMTC 2J5UA 2GX4A 2VU8E 3GCNA 1TQ0B 4NA8A 1IQIA 1L0ZA 4GHTA 3AASA 5B6OA 1GI7B 1UVOA 2ANMH 1IOEA 2ZEBA 1H9LB 2GV7A 2VGCC 2C4FH 2F9PA 3A8CA 3NK8A 2P16A 2A7CA 2GDDA 5E2OA 2J2UA 1HJAC 5EW1H 3AAVA 4DURA 1NN6A 2G55A 2F9BH 1DE7H 3MH4A 3MU0A 2H9TH 5KGOA 1G3BA 1UTPA 1OWIA 2FOCA 4GCHG 1O3LA 2FLRH 1HDTH 4BTUB 1ABIH
chains in the Genus database with same CATH topology
1GG6C 1T31A 1FV9A 1FN6A 3SJ9A 2BY9X 2AERH 3NCLA 2EI8A 1OSSA 2EI7A 3BF6H 2OXSA 3MNSA 4DIIH 5HMAA 3QUMP 4J1YA 2ZZUH 1XUHA 1GBTA 2BD4A 1O3AA 2P3UB 2NU4E 2ODPA 4JYUH 1P05A 3KQCA 4UFEH 3T27A 3T5FH 1DWDH 1WYKA 3GDVA 4F49A 3PV4A 1YGCH 3RLWH 4X8TH 1TIOA 3KHVA 1WSSH 1OP0A 1FIWA 1J17T 4R8TB 3T62A 2P59A 2GDEH 3EE0B 2CHAC 1HIAB 3ZVCA 1KXDA 4BAMB 1W10U 1TYNA 3LGVA 4Q80A 1BMMH 2GCHG 1MCVA 4YESB 1EZUC 1XM1A 1GHXH 3M5MA 1G37A 5C5NA 5JBTA 1H9HE 1O35A 2BD9A 5E2PA 1C2IA 1AY6H 1O3KA 1YPEH 2XBVA 1IQHA 3HPTB 1AFQB 4UDWH 4NG9H 3P6ZB 4I8GA 2Q6GA 2VIOA 5DK1A 4X2YA 1CHGA 2W7UA 2Q6FA 4ISHH 3A89A 1WAYB 4MNYA 3UWIA 1C2DA 1A4WH 2QXIA 4A5TS 3EYDA 6LPRA 2WV5A 1CHOF 2B5TB 3HK6B 2BY8X 1BHXB 1MZDA 3MI4A 4Y8ZA 3BV9B 3M61U 5C67A 1O3CA 1C1UH 3URCA 1GGDC 1O2UA 5F8ZA 1AB9C 1PYTC 1NFUA 1G36A 2A31A 3SBKA 4AG2A 3GISB 2GT8A 3M5OA 2TPIZ 1GHBF 3EDXB 4GSOA 2Y5GA 3ZZ7A 1VGCC 1P2OA 2D8WA 1Y3WA 4ABDA 5C1XA 2PSYA 5C5OA 1EB1H 1S0RA 1O2XA 1C2GA 1HPGA 1EUFA 2HRVA 1KXAA 3Q00A 2B7DH 4NCYA 1BDAA 1Z8IB 1OKXA 1RFNA 5EQSA 1VCWA 1A0LA 2ALPA 1BBRK 4YOJA 3GCHC 1O2OA 1L2EA 1UJ1A 1D6WA 1HAHH 4ISOA 4YOIA 3V0XA 1BTYA 1W7XH 1NRRH 5H4IB 1MTUA 3VB5A 4Y79A 5CHAC 3SU1A 3BTEE 1BBRE 1NTPA 3RM2H 1FNIA 1BITA 1O2GH 2ZP0H 1GI9B 2BY7X 2BX4A 1DSUA 1O34A 3UOPA 2ZHWH 1KTSB 1W2KH 4Z0KA 5DP4A 1YPLH 1P2IA 5FPSA 1K21H 1CBWB 4HI3A 1DFPA 1W3CA 1A61H 1OYTH 4IN1A 3TJNA 1W0YH 1BTXA 3BIUH 3ODFA 2ANKH 1MKWH 3D49H 1ZTJA 1F0UA 2ZPSA 1NROH 1FLEE 1O3IA 3BTQE 4A1VA 3AW0A 4BOHA 1YCPH 3O8DA 4I8KA 3CS7A 1A1RA 1AQ7A 1ZR0A 4ZH8A 1W14U 3ZVAA 3B9FH 1TGTA 1GMCF 1JIRA 2QC2A 1A46H 3GY7A 4CBNA 3BIVH 2Y7ZA 5FPTA 1O32A 4BAQB 1J16A 1TOMH 2BVXH 3TITA 1ZHMA 2AMQA 1AVXA 1FY3A 2DE9A 1QL7A 1O3NA 3Q3KA 1HUTH 1T8OA 3GY5A 4IMZA 1FPCH 1E38B 4JK5A 1HAGE 3SI3H 2ZGXH 1EPTB 3T29A 4Q7YA 1W8BH 1TBQH 3BEIB 5DP8A 1TA6A 5AF9H 1QJ1B 2VNTA 2HPQH 2B9LA 2VWOA 3UPEA 5DKMA 4B2AA 1AB9B 4DT7B 1SI5H 2YNAA 1TNLA 4YOGA 5AFYH 1HJ8A 3DA9B 2F3CE 3BTFE 1O3FA 1G2MA 1GBKA 1KXBA 2XBXA 4O3UA 3ZZ6A 1AUTC 1S84A 1SLWB 2GCHF 1AZZA 1OPHB 4DW2U 1UCYE 1OP2A 3NUMA 1GHZA 2J95A 5JB9S 1GHBG 2IPHA 4D7FA 2OQ5A 2ZGHA 2VGCB 2F9NA 3A84A 3E91A 5FHTA 2A4GA 2SGQE 3A8DA 1AVWA 5DP3A 1GJ8B 3OU0A 1MMJN 5DO4H 3L33A 5G4BA 2ZA5A 1O2VA 4B2CA 1MKWK 1ZRBA 2FPZA 1DWCH 5K7RA 1LQEA 5T6GA 1W13U 1NT1A 1B0EA 2FOAA 3SU0A 2FOFA 4OGXA 1AWFH 5L30H 1GBBA 3DUXH 3P8GA 3PWBA 3MMGA 1LQDB 3U9AH 2SFAA 1IQKA 1O3JA 1UTKA 2ZFTA 4IC5A 4CRFA 4MDSA 1O3OA 2WYJA 2IN2A 1EJNA 2ZQ1A 5JB8S 2XC0A 3T26A 2ZDLA 4MTBA 2ZCLP 3T28A 2ZPQA 1C2HA 1B0FA 1TGNA 4TPIZ 1P2KA 3OYPA 1V2WT 2ZIQH 3FZDA 4Y11E 2ZDVH 4A1TA 3A87A 2STBE 1KDQA 1Q3XA 1EXFA 2R0LA 5SGAE 1BBRH 2GZ9A 2UWLA 4CH2B 1M9UA 3VGCB 1QBVH 3S7HB 1LHDH 3OTJE 2A32A 1P57B 1UVSH 3DT0H 1DICA 1TONA 2J34A 4IBLH 1DOJA 1N6XA 2VVVA 1J8AA 2RA0A 2BQ6B 3UREA 4SGAE 1DS2E 4X8SH 1BRUP 2O8MA 1RJXB 2OBOA 1ESBA 5C1YA 3UR9A 2UWPA 1GVLA 1LKAA 1DSTA 2Y81A 1VJ9U 4IS5A 3PMBB 1Z8RA 5JBAS 1HAXB 1ORFA 2A5IA 1QR3E 1GPZA 2VH6A 2PUXB 4FVDA 1DM4B 1P02A 1CSOE 1DX5M 1O2SA 3E0PB 3ZZ5A 1HAZB 1DWBH 3CENA 4Y0YE 3PROA 2A45B 1RTKA 1A3BH 1AIXH 1YCPM 1PPZA 2P95A 2Z3CA 4Z6AH 2ZCKP 1C1NA 1MD7A 4VGCC 3LH3A 2ZPRA 4DJZB 4K5ZA 5AHGH 2WPJS 5C2ZA 2XTTB 2AIPA 1HFDA 2Y5HA 1GL0E 1G9IE 4I32A 1O3PB 4CR9A 3LONA 1JRSA 1Y8TA 3TH4H 3A7TA 3RXSA 1AU8A 4B73A 1FY4A 1WOFA 3DHKH 1ZPBA 9ESTA 2R2WU 1C5TA 2VH0A 3V12A 2H9EH 2GCTC 3S9CA 4HFPB 3U8OH 3I78A 5DP7A 2VB0A 1L1GA 3ZYEA 1TA2A 1ZHPA 1O2PA 1E34B 3U8RH 1LO6A 3SU6A 3NXPA 3E0NB 3M3SA 1SSXA 4O3TA 2PR3A 3SNDA 3M37A 1P9SA 1PPGE 1C5ZB 1W12U 2P8OC 4NWLA 1JWTA 1NM6A 2VVCA 1AVGH 1UCYK 3OY5U 1K1MA 4XSKU 1P09A 4JZFH 1IQFA 2FYQA 1CGIE 1D3PB 1O5FH 1DVAH 2HPPH 1GBHA 3SHAH 1ZOMA 2QA9E 3HGPA 3TK9A 3GDUA 1QA7A 3SV8A 1O3BA 1N1LA 3QK1A 3UUZA 1XMNB 1CQQA 3SNAA 1ELGA 1DDJA 4BXSA 2FMJA 3S7KB 4CRGA 1K1OA 2GT7A 3TNSA 1AN1E 4NZQA 1HB0B 4LZ4B 1SGEE 3RP2A 2V6NA 3HATH 1ZTKA 2I6SA 3RXRA 4YT6H 2THFB 1O5BB 1XX9A 4E7RG 1XVMA 3E90B 4DY7B 4K3JA 1QB9A 4RSPA 4CRCA 2F91A 3VGCC 2C8XB 3BTWE 2QXGA 2H2ZA 1ABJH 5EQRA 1ZSJA 4Y8YA 3STIA 1N6YA 5FX5A 5F6MA 7LPRA 4FUCA 1YM0A 1V2TT 1NFWA 2O8WA 4AYVB 4DOQA 1HCGA 1KDQB 4BNRA 2PV9B 1Y3YA 1P06A 1SVPA 5T6FA 2ZU2A 1NU9A 1QGFA 3LJJA 1EJAA 8LPRA 5LGOA 4DCDA 3ATIA 3E6PH 3DFJA 1SLXB 9LPRA 2ZGJA 1C9PA 1CA0C 2P3FH 2AH4X 1Z8GA 5CHAB 1QA0A 2ZGCA 1GBAA 8KME2 1P9UA 2BVRH 1TNJA 1K1IA 2A4RA 4YTAA 1D4PB 1MKXH 3URDA 2FI4E 4Y7AA 3SJ8A 3U1JB 2BDCA 1GBIA 2UUYA 2G51A 2OTVA 1C2MA 4FUIA 1C2JA 1O2ZA 2OC1A 1TX8A 1O2QA 5FXLA 2ZF0H 2GV6A 3SO3A 3TH3H 3ATWA 3ENSB 2PSXA 3ZZ8A 3KN2A 3LGWA 1SGRE 1EOLA 4ABGA 2ZC9H 3SNBA 1IQNA 1MQ6A 1KTTB 2XRCA 5LH8A 1UTNA 3L3TA 1C1PA 1TGCA 1XUFA 1BRAA 4Q2KA 1ELDE 3HKIB 1VITH 1UVUH 3MU5A 3SU5A 2JH5D 3F9GA 3GY8A 1ZSLA 3JZ2B 1OS8A 2BD7A 1DLEA 1O2KA 1UVPA 1V2ST 1E0FD 1EAIA 4FVBA 1GI4A 2UUKB 1ZJDA 4K8YA 2BVSH 1S0QA 2SNVA 1SQAA 3RU4E 3S9AA 3NKKA 1YC0A 2FTLE 1O38A 1MAXA 2BLWA 1CVWH 1ESTA 3RC6A 4MLFB 2ZDAH 2FO9A 1QJ7B 2SGDE 2W3KA 1V2VT 4X2XA 5F03A 2BHGA 2TGAA 1P2JA 2QXJA 2SGEE 3SJKA 1HAYB 1XVOA 1V6DA 3MH6A 4IGDA 4OS6A 1VCQA 1TGSZ 2ZFRH 2ZNKH 4X6NA 8ESTE 1RIWB 1SGYE 3U1IB 3ZVDA 1Q31A 4KTCA 2VIVA 4GCHF 3VFEA 1ZGVA 1E37B 4INHA 2A5KA 1OX1A 1EPTC 4NFEA 1WTHD 1K1NA 2PHBA 1Q2WA 2G52A 4ABBA 4LOYH 5EOKA 1O2MA 1O39A 1O3HA 3ZV9A 4TY7A 3B23B 1LPGB 5JDUB 1A5HA 2GZ7A 2WPHS 1TX6A 1P12E 1AKSA 1SGFA 4X1QU 4H4FA 1YP9A 3SORA 3LGTA 2VIWA 1SGNE 4HTCH 4TWYA 4X8UH 3M36A 1ZTLA 1V2RT 4K1EA 3TU7H 2A0QB 5A09A 1ETRH 1FPHH 4MG3A 2VJ1A 1K1PA 4ZHAA 3UR6A 4JZEH 4B2BA 4BTIB 5A0AE 5EW2H 3LJOA 3DFLA 2ESTE 3FP6E 5J4SA 1INCA 3K9XB 1YKTA 3TJVA 2HLCA 3LIWA 3MFJA 2BLOA 1QBNA 3RLYH 2XCNA 5L2YH 1C5PA 3RMLH 2ZDNA 2NU0E 3NWUA 1G30B 1P0SH 2OC0A 1H9IE 4FUBA 2RDLA 4WMEA 2XC5A 3NPSA 1SQTA 1GI8B 1HBTH 2FOBA 3Q3YA 4YZUA 1DANH 2XWAA 1NRSH 5DP9A 1S81A 4XFQA 1TPPA 1GJAB 4ZUHA 3F9FA 1V2OT 1IQGA 1CHOG 3ELAH 1HAVA 3KL6A 5LPEA 4O03A 1QB6A 3SN8A 1OWKA 4XDEA 4ZHLU 3VB3A 4WXVA 1TPSA 1Y3UA 1Y3XA 1MTSA 1C4V2 1O2NA 2W5EA 3F9EA 1O2IA 2JH6D 1SGPE 2Z3DA 1UO6A 2BY5X 2J94A 2NU2E 1RTLA 4I31A 3P95A 1LVYA 2BQWB 4I7YH 1EPTA 4CBOA 1O3EA 2Z9IA 1L4DA 4M7GA 2AGIX 2WPLS 1O3DA 4CREA 3A7ZA 1DY8A 4K1SA 2PTCE 1ZMJA 3TGKE 5A0BA 1DITH 4D8NA 5L6NH 2BDHA 1UTJA 1XUIA 5DJ7A 2BOHB 4AGJA 1Z71A 4UEHH 1GMDF 1K22H 6CHAC 1V2JT 2CMYA 2W26A 1TBRH 1ZGIA 2FZZA 3RM0H 4A92A 5A8ZA 2AS9A 1G2LA 3RXJA 4E7NA 1FONA 2BOKA 4B1TA 1BJVA 3SHCH 4LZ1H 4X2VA 3MYWA 5GDSH 1XKBC 1U6QA 1QNJA 2QF3A 2BDYA 3RC5A 3RXOA 1THPB 4X1SU 1GJ5H 1AKSB 2M5TA 3GYLB 1FIZA 2J4IA 1ID5H 1A5GH 1SHHB 2FM2A 1VITF 4H6SB 1PQAA 2P94A 1CGHA 4ZKNU 1GDUA 1RXPA 3LH1A 1O2WA 3FAOA 4BAOB 3A81A 1IHSH 3A7VA 4X1RU 3SW2B 3M5NA 1EB2A 2ZCHP 1NS3A 4AORA 5IDKA 1QRWA 3MOCA 1LMWB 1RGQA 3I77A 4GHQA 1YPGH 1W0ZU 1GI1A 4ZMAH 3RXIA 2QF0A 2QV1A 1O5DH 2Y82A 3O8RA 1YYY1 5JPMH 1YPHC 2ZFSA 1J15A 1JIMA 4KELA 4ZKOU 1BIOA 4X1NU 1GI6A 4AG1A 5ESTE 1KIGH 3M7UA 1NRPH 4UFGH 6GCHF 3O8CA 1NC6A 3SUFA 1SB1H 2BQ7B 4ASHA 3PWCA 1H4WA 5I25A 3RXAA 1SL3A 2A4OA 3BTTE 1P2MA 5TCAA 3TJOA 4JMYA 1IHTH 1S82A 1GJCB 3T2NA 4WH8A 3LT3A 1W7GH 2ZU4A 1T4VH 1VITG 1S6HA 1ANDA 1GMCG 2PKAB 4IW4E 2FP7B 2UWOA 3S69A 3RU4T 1SGQE 3C1KA 3EA7A 2C8YB 3BTGE 5BRRE 3EAJA 3A83A 1G32B 4BTTB 4KP0A 5A8XA 3MO9A 1QL9A 3W95A 2CF8H 4U30A 3GYMA 2W3IA 1ELFA 4ZKRU 5FPYA 1EX3A 1BTUA 1C5YB 1YF4A 2KAIB 1LHFH 2BYAX 5HM2A 4CR5A 3MNXA 4NWKA 4OGYA 4YLQH 3E8LA 5F8XA 4LXBH 1EP5A 3P8FA 3NZIA 3P17H 3FVFB 1MU6B 1GI2A 2EI6A 2V0BA 4Q7ZA 3ZZ9A 2WPIS 2WINI 1F0SA 4AN7A 3HKJB 3TGJE 2ILNA 3GCTG 1GVZA 1GBJA 1BB0B 1ESAA 1UMAH 1GJBB 1YLCA 7KMEH 1O33A 3VB6A 1H8IH 3IWMA 1TNKA 5I46H 1FQ3A 3STJA 6ESTA 1C5SA 4XBBA 1UK2A 2XW9A 1C1WH 3UNRA 3QTOH 1TABE 1FMGA 1Y59T 1UTQA 1GBMA 4ABHA 5K0HA 1DT2A 1QL8A 1PQ8A 2FESH 3KQDA 2FEQH 2GD4B 1LHCH 4I8HA 3M7TA 1HRTH 3RXCA 2F9VA 1RS0A 2JETC 4CRDA 5AVDA 1SOTA 4DIHH 4WVPE 1F7ZA 1KXFA 2P3TB 4NA7A 2Q6DA 2YOLA 4XBCA 1CO7E 2BZAA 2A5AA 1GJ7B 4PROA 2FLBH 2LNCA 5C20A 3QGJA 3TJUA 3GY4A 1ELTA 1FZZA 2BXUH 2JETB 1C1TA 1ZZZA 5BPEA 3PO1B 3BEFB 5E0HA 1MKXK 2BX3A 4ZHMU 3VB4A