2BD9A

Porcine pancreatic elastase complexed with beta-casomorphin-7 and arg-phe at ph 5.0 (50 min soak) and immersed in ph 9 buffer for 28 seconds (2nd ph jump)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Elastase-1
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd9A01
1BTPA 1OWKA 1RS0A 1N8OB 4HGCA 2P95A 3AVZA 1TABE 2PKSC 3G01A 4D76A 3RMLH 1SHHB 1C5NH 3Q76A 1OYQA 1XM1A 1DSTA 5L6NH 2HNTC 1C5VA 2FOBA 4DT7B 1LQDB 1V2MT 3M7TA 5H4IB 3F9HA 1QA0A 1GMCF 1XKAC 2NU2E 2XTTB 2VVVA 3GDSA 3V0XA 2IN2A 3DFJA 3RU4D 3T29A 4YESB 5PTPA 2ANKH 1ESBA 5E0JA 1TMBH 1Q3XA 3LGYA 4MPWA 2VIWA 2PW8H 3O8CA 1OS8A 2H9TH 1BTUA 2H1UA 1YC0A 1PPEE 1SLVB 3BTFE 4BAQB 1HXFH 1RXPA 1CA8B 2RA3A 2ZTYA 3QDZB 2DE8A 1SGNE 1E0FD 2FP7B 1K22H 1J8AA 3S0NA 2A5KA 2FI4E 3EE0B 4Y10E 1OWIA 1UJ1A 3SI4H 2AERH 5IYTA 2OCVB 1DT2A 1C5OH 1VITG 3S9BA 1SMFE 2BTCE 2HPPH 1C2IA 2RDLA 1W10U 3ITIA 1TB6H 3EA8A 3TPIZ 2HWLB 2SGEE 1YPEH 2F3CE 2P94A 1GVKB 3S7KB 1Z8JB 3U8OH 1O3EA 1IHTH 1GMHF 9ESTA 1O3NA 1O5BB 1P01A 5JB8S 1MQ5A 1CA0C 2Z9LA 1MBQA 2H5CA 1UVUH 4AG2A 1ZPBA 3MH4A 1KLTA 2RA0A 5DP7A 1D6RA 2CJIA 1LHEH 1OX1A 1S5SA 3SU4A 1HJ8A 3KQBA 5JDUB 3ZV9A 3ZZ5A 2AYWA 1O2UA 3I78A 1UO6A 1E37B 1A4WH 3OY5U 4MNYA 2VGCB 5DG6A 1CHOF 2FOEA 4Y7AA 2ZG0H 4X8TH 1O5CB 3RXBA 2ALPA 3ZZ4A 1OP8A 3SU1A 3I77A 1EJNA 3LKWA 5EOKA 3STJA 2ASUB 4BANB 2JH0D 2A4QA 3M3TA 2ZKSA 5SGAE 4NZLA 1EXFA 2BLOA 1Y3YA 3LGIA 3GY2A 1TOCB 4RKJB 1FJSA 5AFYH 1T8MA 4WJG2 1DX5M 1SGFG 2JKHA 4X1PU 1V3XA 1Q2WA 2J34A 5HGGA 1G2MA 1MU8B 1A0JA 3E16B 1ESTA 3FZDA 1ABJH 1O3KA 3W94A 1AVWA 4VGCB 3E3TA 4CR5A 4AFSA 3SGAE 1NRQH 3NXPA 2DUCA 1QBVH 1WQSA 1QURH 2A31A 1AFEH 1H9IE 3VPKA 3MU4A 4MLFB 1WUNH 1VR1H 3LGUA 4K8YA 1A46H 2TRMA 1GMDG 1BTXA 1L1NA 3A7TA 2A2XH 3GCOA 4O3TA 4CRGA 1OSSA 4HI3A 1JBUH 2VIDA 1TGCA 2WUCA 3RXOA 3SQEE 1HJAC 3B8JA 2ZGCA 1LTOA 1UVPA 1YPMH 1GBTA 4WXIA 1B0EA 1JMOH 2ZGHA 4X6NA 1MTNC 1TNIA 1BQYA 3O8RA 1LHCH 4X6MA 3ZV8A 1FONA 2UUJB 4JK6A 2FS8A 1W11U 1LKBA 2C3SA 1RTKA 3K65B 3RU4T 2F9VA 2FMJA 4MPXA 4OS2A 2A4RA 2CN0H 1DVAH 1Y5AT 1MKXH 1YM0A 3P8FA 1SOTA 5EQQA 4Y8XA 1V2PT 5J4SA 2ALVA 4AB9A 4K3JA 1J9CH 3QLPH 3M35A 1ZHPA 2BX3A 4B71A 1LVYA 1WU1A 4XBDA 1QGFA 1QCPA 1ZSKA 3E0PB 2VJ1A 3R0FA 2BM2A 1EQ9A 1S84A 1UMAH 1FNIA 4MPVA 1NPMA 1FUJA 1YYY1 1XXFA 1IQKA 1H1BA 1SLWB 3VGCC 4IC5A 2ULLA 4ZROA 1TNJA 3GOVB 3PMHB 5JYIA 4M7GA 4SGBE 3BN9A 3F68H 1J16A 1L4DA 1EP6A 2GMTC 3SUEA 2QYIA 2EI8A 1W2KH 1HIAB 1V2VT 2VB0A 4I8JA 2YOLA 1WSSH 2GD4B 5F8ZA 3RLYH 2XRCA 4OS6A 3SNDA 3E91A 1DANH 2OTVA 3P8OA 2BVSH 5EU8A 1H8DH 3EGKH 4DIIH 2GDDA 1HGTH 1S0QA 5ESBA 1ZSJA 1OWJA 3QWCH 3FVFB 1DSUA 2WV4A 1IQHA 1DWDH 3QX5H 2PTNA 1U6QA 2STBE 2PUQH 3D23A 1T32A 1HXEH 1QJ6B 1P9SA 5LPFA 1NRSH 1MTUA 2H2ZA 3L33A 1DS2E 1NRNH 1D6WA 4H42U 3OYPA 5FCRA 2R3UA 1WTHD 1EKBB 2ZDMA 3EA9A 1P02A 5ETXA 3VXFH 1UVSH 3QTVH 2AIQA 2V6NA 2Z9GA 1NC6A 1O2QA 4IN1A 5T6FA 5GCHG 3UY9A 5A0CA 6GCHG 1AIXH 1ID5H 5GWZA 1BBRK 3LJJA 3SI3H 1TBRH 1T8OA 1AE8H 2QXGA 1V2NT 1YPHE 1FY4A 1O3PB 1P8VC 1GBLA 1V2WT 2WYJA 2SGFE 1SC8U 1QRZA 3A84A 4YT6H 1GBHA 2BD4A 2UUYA 1GCDA 3GCHC 1O2RA 6CHAC 5F8XA 3RXAA 4E7NA 1QRXA 5EPYA 1VGCC 3KNXA 3PO1C 3BTME 5C1UA 3GDUA 1YKTA 1Y5BT 3NUMA 1IQEA 1GPZA 1LHFH 1O39A 3LH1A 3DFLA 1O3OA 1UCYK 2HVXA 2BD3A 3U8TH 1G9IE 3V12A 2ZHQH 1XVOA 2FI3E 1QL7A 4INKA 4GPGA 4E06H 2JETC 3JZ2B 2BY6X 2TGAA 1J14A 2BD7A 1LKAA 1OWDA 2BOKA 3MH5A 3IITA 5DKMA 2O8LA 1F7ZA 4FU8A 4KTCA 4Y8YA 3BG8A 6GCHF 1H9HE 4XE4A 3ZZ6A 4NA7A 1FY5A 1YLDA 1OP0A 2FI5E 3BTQE 4ZHLU 1KDQB 5A8ZA 2ZNKH 1OWEA 1SVPA 4JZEH 1AY6H 1J15A 1C4U2 1FY3A 1ZOMA 5EW2H 1ZGIA 3T26A 1IQFA 2WPHS 5JBBS 3Q77A 1UTJA 2W7UA 3A87A 2VINA 2FZZA 4WH8A 2GCHF 2J9NA 1ORFA 2OXSA 3ZVEA 1MKWK 1WOFA 2XBVA 2VGCC 2VWLA 3BG4B 5HM9A 1CBWC 4GUXA 2FTMA 4HTCH 1UTKA 1KDQA 1EOJA 1CU1A 1BRBE 3RXSA 1DUAA 2B7DH 1A7SA 4OS1A 4Y0YE 2Y81A 1RRKA 4BAKB 1C5RA 3SV7A 1QFKH 1QRWA 1SGIB 5LPEA 1TA2A 1JXPA 2J95A 4ZKOU 3QTOH 3PMBB 3VFEA 2PV9B 1TAWA 1SB1H 1C5SA 1N1LA 5FPYA 3SJOA 1HCGA 1OPHB 3BEIB 1V2OT 1MZDA 1QNJA 1EZQA 2G4UA 4FU9A 4NZQA 4B75A 4RSPA 3BSQA 4J1YA 7GCHF 4X2VA 2GZ9A 2Q1JA 3BTEE 3MTYA 4CRDA 1LCYA 1G3BA 4Y6DA 1TNLA 5I46H 3SUDA 3QGNB 3EAJA 4TPYA 1GJ4H 2HRVA 1C5QA 4Y79A 1G32B 1O36A 1A3BH 4ZHMU 1W12U 1BJVA 4Y71A 5C3NA 3MO6A 3CP7A 1CQQA 1FI8A 1DE7H 1EPTB 1A5HA 1N8OC 3ZVAA 1Y5UT 1S83A 1GBDA 4AB8A 5GXPA 3TVJB 2GT8A 1LPKB 3P8NA 5F8TA 1BJUA 2J94A 3VB6A 4RKOB 2ZQ1A 1QY6A 4Y0ZE 4BXWA 1NRPH 2ZF0H 4IW4E 1SBWA 1RGQA 3RXIA 1O34A 1GBAA 2QN5T 2VVUA 1HBTH 1UCYE 3M5LA 3QN7A 2FEQH 3RC6A 5FPTA 1EP5A 2ZHWH 2G5NA 3TK6A 3MO9A 1FIZA 1O2VA 1T7CA 2ZEBA 1KLIH 1ZYOA 1GMDF 1INCA 3B9FH 1XMNB 2J4IA 3LH3A 4H4FA 3M5NA 1P10A 1SQTA 1EJMA 2BD9A 1Z1IA 3MO3A 1RIWC 1XX9A 1C4V2 3LT3A 2A7HA 1GBFA 1NU7B 1EOLA 3CENA 4MPUA 1YLCA 5DK1A 2PKAB 3ZVFA 3ATWA 4A1VA 3BF6H 1SLUB 5JB9S 1SQOA 4FUIA 4YM9A 2A45B 4ABIA 1SL3A 2G55A 1TRYA 2PKAA 2A0QB 1C5XB 2AMPA 5EXMA 4YOGA 3Q3KA 2B0FA 2ZDKA 1LPGB 5TCAA 3KCGH 2ESTE 1FIWA 1JOUB 1SGTA 1BIOA 1ZTLA 1A3EH 1ELDE 1T4UH 3MU0A 2IOTA 2CV3A 2G52A 4F4OC 4MDSA 1O3AA 1QHRB 3DA9B 3P92A 1P03A 2H9HA 2XCFA 1L1JA 3S9CA 1BBRH 2Y80A 2XW9A 4CHAC 2GZ7A 2JH6D 4ISIH 4NSVA 4JYUH 5C67A 2JETB 1EUFA 2FYRA 1FY1A 5AFZH 3ATMA 1D3TB 4YO9A 4CH2B 1KIGH 5EXNA 2V35A 3F9FA 4CH8B 4LZ4B 4NCYA 3VB3A 1O2PA 1WYKA 1LVOA 1ZMNA 2J38A 3P8GA 4JYTA 2Y7XA 4NSYA 4X1RU 3VXEH 5DP5A 3K6ZA 4Q7ZA 2CF8H 2OLGA 2FLBH 3ZZ7A 2WINI 4TY7A 3LGVA 1MD8A 2AS9A 5EPNA 3SV9A 1C1TA 1GVZA 2P3UB 4U2WA 3NKKA 3SJKA 4KGAA 1DXPA 3DT0H 5C5OA 1HV7A 1S6HA 4IN2A 1PQ7A 3O8BA 1E35B 1O37A 2FTLE 1T31A 3TH4H 2TGTA 1ELEE 1TX7A 1YPHC 1GGDC 2YNAA 1XVMA 4ZKSU 1O32A 2G4TA 2ZGJA 2KAIB 3V3MA 1F0SA 5L30H 1V2JT 3V7TA 1TRNA 4BAMB 2BVRH 1D9IA 3RXDA 3RXLA 2G00A 2O8WA 1K1NA 1GBBA 1FN6A 1FV9A 1YCPH 3AW1A 2P59A 1NT1A 2BB4A 5DP4A 1C9TA 4AX9H 1SFIA 3ZZDA 3KQDA 4ABAA 2M5TA 9LPRA 1C1PA 3ZYEA 4FVBA 3E6PH 4DY7B 1UTMA 5CMXH 3UQVA 4VGCC 4ISOA 4UFDH 3RDZA 1GCTC 4B73A 4ISHH 2BD5A 1MCVA 1LVMA 2Z9JA 3VB4A 5FX6A 2F83A 1V2UT 5A0BA 1MZAA 2GGVB 1CVWH 4YTAA 3T27A 4E05H 1FPHH 2ZCLP 1BHXB 1TBZH 1AB9C 1TGTA 1Y59T 2BZAA 4MNVA 2CXVA 1YP9A 1LPZB 1F2SE 4IMQA 2ODPA 1SGYE 2WPLS 5G4BA 5LH8A 4A92A 4B1TA 3L6PA 4LZ1H 1MQ6A 1HIAA 1WBGB 1Y8TA 2ZU4A 5HYOA 2NWNA 1BTYA 1LQEA 1KXDA 1JWTA 2O8UA 2V3OH 1GI9B 3FP8E 1A0LA 3L3TA 1O3FA 2XBXA 3UNRA 2WPJS 3TJVA 5LGOA 1P04A 3RXJA 7LPRA 1IQMA 2G51A 3RXPA 2BDBA 4Z6AH 2BDGA 4DG4A 4I7YH 1LMWB 2TPIZ 1EPTC 2ZFTA 1ANDA 4B74A 5HM2A 2XNIA 1ELCA 3RXEA 4RN6A 1O5GH 2R2MB 1FN8A 1O2SA 2D1JA 2BLQA 1D3DB 4YOIA 3RC5A 1GJ9B 1DWCH 3MU5A 2ZO3H 3M37A 2C8ZB 1P12E 1QQUA 4K60A 4AFUA 3E8LA 3BTWE 2PUXB 1TLDA 3UNSA 1ANCA 3SJIA 3MOCA 3GISB 1FZZA 4UFFH 1GI0A 2WV5A 1XUJA 1PPCE 5FPSA 2ZFPH 1TFXA 1Z8GA 1GBIA 4D7GA 1AN1E 1DICA 3UNQA 4DJZB 1HB0B 2BDCA 2UWLA 1LDTT 3SGQE 3UWIA 4CRCA 1GDNA 3TGJE 1BOQA 1SHYA 2SNWA 1C5YB 3SNBA 1NY22 2SGQE 4CBOA 3A8AA 3ATLA 4YZUA 3KGPA 3RM0H 1CA0B 3RP2A 3EA7A 3GY7A 1DPOA 1W8BH 3KN2A 3NWUA 4ZHAA 2PFEA 2UWOA 4WXVA 1SQAA 4XSKU 3PO1B 1O2HA 2FO9A 2FX6A 4A5TS 5FBIA 1ARCA 4NIVA 1O3HA 1L4ZA 3RMOH 1DOJA 3ENSB 1WAYB 1EZXC 1QB1A 1EAWA 2OC8A 4X2YA 1MMJN 2ZHDA 2UWPA 3A80A 4U01A 1P3EA 1BRAA 4X0WU 4HFPB 1HAVA 1D3PB 1TE0A 1TWXB 2XCNA 4K1EA 5E2PA 4ABDA 3LOXA 4WY3A 1THRH 3TNTA 1ELVA 3HGNA 2SGAA 3MNSA 1P2KA 4FU7A 1L2EA 4Q7XA 5EQSA 2QV1A 1SI5H 5T6GA 1ELTA 3ATIA 1C2HA 1MBMA 4JZDH 1ZMLA 2HALA 4XBBA 1GHZA 1PQ5A 1DY8A 2PR3A 1NROH 1C1RA 4PROA 4CHAB 4CBNA 3PROA 1A1RA 1HJ9A 3EQ0H 4ABHA 1C5TA 3N7OA 3A81A 1L0ZA 3UIRA 2ZDNA 2P93A 1VGCB 1O3DA 1TQ7B 8LPRA 1Z1JA 1BMAA 1Y3UA 1C1QA 4A7IB 1TOMH 2ZCHP 1PYTC 2ZFQH 4A1TA 2QGRA 3H5CB 1IQGA 4ZAEA 1FQ3A 1A5GH 4AG1A 4NGAH 1P09A 2Z3EA 4GCHG 2BZ6H 4I8GA 4H6SB 4QT8C 1NFYA 2OUAA 2ZDAH 4MNWA 5EG4A 1BT7A 3LDXH 4O03A 5C5NA 1K21H 1O2GH 1OYTH 1N6XA 2CGAA 4KP0A 1AKSB 3GY6A 1O38A 3U8RH 2BX4A 3T62A 4UONA 1GHWH 3PM3A 1NFUA 2AEIH 1F5LA 1GI5A 2Y7ZA 3EYDA 2AMQA 4TY6A 3CS7A 3GY8A 1BITA 3E90B 2XC5A 3ZZ9A 3ATKA 1KTSB 4X8SH 4X1NU 1TIOA 2R0LA 2XWAA 5EW1H 1S82A 4H6TA 1V2KT 2VWNA 3PTBA 3M7QA 1GI2A 1EX3A 1ZSLA 2BVXH 2PHBA 3UWJH 2VH6A 1C2KA 1MTVA 1TX6A 1C1NA 2C90B 4B2AA 1ZTJA 2BXTH 3RUOA 4UDWH 4KELA 1F5KU 1GJ5H 1ZLRA 2Z7FE 1QTFA 2O9QA 4ZKNU 3HK3B 1TQ0B 2AMDA 1VCWA 4B2CA 5FCKA 1O5DH 5TCCA 5C20A 1P06A 1MTWA 3K6YA 1T8NA 2ZTZA 4ESTE 3UQOA 7GCHG 3GICB 3UOPA 3PLBA 1GDQA 1LVBA 4XBCA 1O33A 4AORA 2ZGBH 3PMAB 1GI4A 3RXTA 2ZQ2A 1XXDA 3FP6E 3W95A 1O5FH 3MWIU 5CE1A 2ANWA 1HAZB 5AF9H 5BRRE 4BTIB 3UFAA 1ZJKA 3U69H 3STIA 1Z8RA 3GCHB 1QA7A 3RMMH 5DP8A 2A4OA 2IPHA 1TMTH 4SGAE 2XYAA 5DP6A 1QJ1B 3M7UA 3MYWA 2QA9E 2W5EA 3AAUA 1OOKB 5EQRA 3A8DA 3BEUA 1X7AC 2AGEX 1JIRA 1F0UA 5A8XA 2ZDVH 1GHAG 1ZZZA 3RXCA 1F0RA 1K1IA 4BTUB 4XOJA 2VIVA 2BYAX 3LGTA 2I6QA 3SUFA 1CHGA 4JYVH 4Y76A 2ZWLH 1UTOA 1C1WH 1C5LH 3KIDU 1VCPA 4NIWA 2NU0E 5JBCS 2BLWA 2O8TA 2F9PA 3O8DA 1W0ZU 3SZNA 5AVDA 3R3GB 3SN8A 1HDTH 3F6UH 4GAWA 2B5TB 4FUJA 3M61U 2FS9A 1BHXF 2BY9X 2ZU5A 1ARBA 1MAXA 5FXLA 1G3CA 2F9OA 1FLEE 2ZGXH 3I29A 1TA6A 3PYHA 3A89A 1TBQH 1AU8A 5HMAA 1P3CA 2G8TA 2ZU3A 1SGFA 1OKXA 1BMMH 1S6FA 2ZIQH 2GV7A 1GGDB 4K69A 4GLYA 4MTBA 3TJNA 1IQJA 5EODA 2ZFFH 1C1UH 1GMHG 4DURA 5JBAS 1O3BA 4R0IA 1CGIE 1W14U 2A4GA 2ZPRA 2ZTXA 2ZCKP 4ZUHA 1P2JA 1BB0B 2FOMB 2FOAA 1XUHA 1UK3A 3SNEA 2Z6BD 1C1VH 4D9RA 1NO9H 3HGPA 2V3HH 2BY5X 3U1IB 1C2JA 2WPIS 1OXGA 5C1XA 1TX8A 3TITA 4ABJA 1TPSA 1A61H 1K9OE 4O9VA 1RJXB 1O3MA 1E38B 1OP2A 2QY0B 4IC6A 6CHAB 1QB9A 1GI1A 1VITH 3A7ZA 5T6DA 2F9NA 2WYGA 3RU4E 1P2NA 2VIOA 4AFZA 1LO6A 1V2RT 1MH0A 1O2ZA 2O8MA 1O2KA 2Y6TA 1QJ7B 2GP9B 4MNXA 1KXEA 1RD3B 1TRMA 1GHAF 1ZPCA 3GYLB 3M5MA 4FVDA 1NFXA 3KQEA 1KXCA 1PQ8A 3MMGA 2OBQA 2BD8A 1VCQA 1MCTA 1MU6B 3A88A 1AZZA 3RXUA 2W3KA 2C93B 2NU1E 3RXGA 1S81A 3BV9B 3ZZ3A 4BOHA 1GMCG 2V0BA 2Y82A 3LC3A 4I33A 1ANEA 4DW2U 2VNTA 2JH5D 1TNGA 1KXFA 2GZ8A 4FXGH 1SG8B 2B8OH 2BDIA 1GJCB 1P2OA 1AHTH 3HKIB 2A1DB 1O3GA 4X1SU 2P16A 1W13U 1C5UA 1CE5A 3KQCA 3A7XA 3A85A 1BTHH 3TU7H 2PKSB 1CT2E 1HAIH 1GJBB 2P8OB 1TGNA 4UD9H 2HGTH 2HPQH 4MVNA 1IAUA 1GVLA 1Z6EA 4DIHH 1PPGE 3PMJA 2THFB 1O2NA 4TWYA 2C4FH 1PYTD 2FDAA 3A7VA 4X6OA 2R9PA 4OS4A 4GVUA 1SLXB 1G3DA 4WWYA 4HZHA 1AZ8A 1HPGA 1XUKA 4ZH8A 2BQ7B 1GL1A 2P3FH 1A0HB 4IBLH 3RXMA 2RG3A 2D8WA 2FLRH 1P11E 3HPTB 5EGMA 3SW2B 2ILNA 1HAXB 3RXVA 4NA8A 1E34B 2OC1A 2XXLA 2CHAB 3LJOA 4THNH 3SORA 1NTPA 4TYDA 1AVXA 1BMLA 2ZP0H 3ZZAA 1NZQH 2AGGX 2FOGA 3OX7U 3A7YA 5DP3A 3SU6A 1BDAA 2FXRA 5DJ7A 2BQ6B 5FBEA 4FUCA 1RTLA 2BDHA 3SHAH 1RIWB 4JZFH 4DVAU 4ABEA 4X8VH 1AB9B 2IJOB 1GHXH 1H4WA 4KKDA 5DO4H 3AW0A 2ZU1A 3PB1E 3SJ8A 3HK6B 1HAVB 1KY9A 1ABIH 1IQIA 4YT7H 1TALA 2ZFRH 1C5WB 4AYVB 1OWHA 1DLKB 1DY9A 3IWMA 2BMGB 1GHVH 1SPJA 3U98H 4X6PA 1Y3XA 4Y8ZA 1K1MA 4CRBA 2ZPSA 4TPIZ 3RXQA 1XKBC 4Y7BA 2QC2A 1GG6C 3URCA 4ZXYH 1NN6A 2R0KA 4BNRA 4KTUA 4YLUA 5JBTA 1AD8H 1UHBB 2AFQB 4UFGH 1PPFE 1BBRE 1MKWH 1G2LA 2Q6GA 1SGDE 1V2LT 1B7XB 4OGXA 1KXAA 1O2MA 2BLVA 2OD3B 3P6ZB 3RXFA 1BTWA 3FZZA 2C8YB 2XC4A 1ELGA 1ANBA 1NU9A 6ESTA 5GCHF 5L2ZH 1ELAA 3QK1A 1TGSZ 3UR6A 1DDJA 2QXJA 1RFNA 3M3VA 3UTUH 1GI3A 3PWBA 1YPJH 2B9LA 2FWWA 2GKVE 1MTSA 1NRRH 3TJOA 4JMYA 2ODQA 3A8BA 4ISLA 1AVGH 2ZHEH 3UPEA 1UK2A 2ZZUH 1W7GH 1UHBA 1O2TA 3NPSA 3H7TA 1BA8B 4JCNA 3D65E 1HAHH 1UTLM 3SU5A 5JPMH 1HJAB 3GY5A 3MH6A 3E0NB 3GY4A 1ESAA 5A0AE 1GBMA 3QZQA 1W0YH 3TGIE 2Z3CA 1HLTH 1YPGH 3GY3A 1T4VH 1HAYB 5L2YH 2UUFB 2FIRH 5DP9A 2EEKA 2WUBA 5A09A 2OQ5A 1C2DA 1GBEA 2FOHA 2PGQB 2Y5FA 1C2MA 2EC9H 1C2LA 1P0SH 1Z7KA 4FUHA 4I32A 5C1YA 1FPCH 2OC0A 1EAXA 2ODYB 1SSXA 1VITF 4JZ1A 5BPEA 2ZHFH 2ANYA 1GI7B 3TIUA 2XWBI 3A8CA 2GX4A 3A82A 1TGBA 4K2YA 4ABGA 3UR9A 3TLOA 5ESTE 1QIXB 3T2NA 3LGWA 1K1OA 1AWHB 3ZVDA 2NU4E 1C5ZB 1KXBA 3SNCA 3RXKA 4CR9A 5GPIB 1C4Y2 1KYNA 2F91A 1EATA 1L1GA 1F92A 3T5FH 2BHGA 2TGPZ 2GCTB 1PPHE 1DWEH 2R3YA 2A5IA 8KME2 1YPKH 4CREA 1O3CA 2BDAA 3FANA 4AZ2B 1AWFH 1CO7E 2BY8X 4WMEA 3LU9B 1P2IA 4X1QU 1ZJDA 4Z0KA 1V2TT 1ZMJA 2VVCA 2Z9KA 1LHDH 1YGCH 1BMNH 1TPPA 2P8OC 5F03A 1Y3VA 2A32A 1NM6A 3FFGA 5ABWA 2HOBA 3HATH 5GIBA 1EASA 5K0HA 1K1LA 1BRCE 3ZZBA 1O31A 2AH4X 2UUKB 5E0GA 4U30A 3SGBE 5FX5A 3UUZA 2Q6FA 3PLKA 4DOQA 2KAIA 1HRTH 3SJ9A 3MFJA 4NWKA 4XDEA 2ZFSA 4F49A 3QUMP 4GHTA 2ZDLA 8GCHG 2C8WB 2TIOA 3BTHE 1IQLA 1NESE 5A2MH 1ELFA 1YPLH 1GJAB 2A7CA 4K5ZA 3RC4A 3V13A 2P3TB 3PTNA 1CGHA 4X2WA 3BTDE 2PSXA 3URDA 5B6OA 3RXHA 2HNTF 3B23B 4IS5A 2R2WU 1W3CA 2OBOA 2RCEA 3NCLA 2G5VA 1P2MA 2A5AA 1VJ9U 1SGCA 3E1XB 5FAHA 1O0DH 1ZRBA 3SHCH 4K8BA 3BEFB 4FUGA 1ZRKA 4X2XA 1PFXC 3D49H 3DUXH 1BUIA 1DWBH 3VB5A 1AMHA 2W3IA 1SGPE 2G81E 1GBKA 5T3HA 2OP9A 3MU1A 1AQ7A 3LIWA 4NIXA 4ABFA 3SV2H 2OC7A 1IOEA 1C5MD 1V2ST 3SOSA 3F9GA 3P95A 2OQUA 1ETRH 1GG6B 1EB2A 5C2ZA 3MNCA 3ZVCA 1C1MA 1ZTKA 4OS7A 4WMDA 2PTCE 4AOQA 1QBOA 2CHAC 1UVTH 3TJUA 3VEQB 4CRFA 1E36B 3K9XB 1TPAE 3SQHE 1ZHMA 2NU3E 2FOCA 4TWWA 1FXYA 2VH0A 2I6SA 3AAVA 4DCDA 5K7RA 3SV6A 4O3UA 3Q00A 1AO5A 4I31A 2DE9A 3QZRA 1C2GA 1G30B 1TMUH 1ACBE 2CMYA 1SGEE 2VU8E 3GCTF 3PLPA 3PV4A 5DPAA 1FMGA 1HAPH 4BAHB 1C9PA 3AASA 1YCPK 1HAGE 3FAOA 2QF0A 3BTTE 4D9QA 1ETSH 1O2WA 2BOHB 5CHAC 2ZC9H 4NWLA 2D2DA 3S69A 2H6MA 4CRAA 3S9AA 2AIPA 2ZU2A 2GT7A 3M3SA 2J92A 5DGJA 2J2UA 3SU2A 3KL6A 1DITH 1DUEA 1UCYH 1GDUA 5F6MA 1K2I1 4FUBA 1EAIA 4UEHH 4UFEH 1KLJH 1HUTH 3MI4A 2EI7A 2OINA 3NK8A 4Q7YA 4NG9H 1TNKA 3OTJE 2Z94A 1B0FA 1Z6JH 4B2BA 1J17T 4BTTB 4D8NA 2TBSA 2QIQA 4YOJA 1O5EH 4JZIA 4KTSA 4MQAA 2SGDE 2BY7X 4A1XA 1K1JA 1S85A 1WCZA 1DM4B 2SFAA 3DD2H 1CHOG 1YBWA 3TK5A 4O97A 1XUIA 4OS5A 1KTTB 3C1KA 3GCNA 1G3EA 1ELBA 3UOUA 1O2YA 3KF2A 2FM2A 2H5DA 3SNAA 1GI6A 3A83A 1AFQB 7KMEH 3U1JB 2VWMA 2TGDA 1VZQH 4ABBA 1P9UA 4WMFA 3GYMA 4K1TA 1GHYH 3BIVH 2WPMS 1D4PB 1WQVH 3A7WA 2XBWA 3A86A 1UVOA 1AGJA 3LC5A 1FAKH 4WH6A 5J4QA 3BTKE 1GI8B 1K1PA 1QL8A 1THPB 3ZYDA 1UTPA 1UTNA 4ASHA 3T28A 1O30A 4GHQA 1BCUH 1N6YA 1O3LA 3M5OA 1CGJE 1V2QT 4I8LA 2GDEH 1QL9A 4BXSA 3F9EA 1O35A 1UK4A 3RXRA 1AKSA 1XUFA 1H8IH 2QXHA 2GV6A 1TONA 4ZKRU 1QQ4A 2GMTB 4LOYH 1GJ6A 1FAXA 3C27B 4I8KA 1O2LA 1P05A 2QAAA 3TH2H 2GTBA 1SFQB 3ZVGA 2VIPA 1NS3A 1WV7H 1CT4E 5GDSH 2LPRA 1A5IA 2GCTC 3PWCA 5E0HA 4LK4A 1C5PA 1AUTC 3OSYA 1QR3E 1JRTA 1PPZA 4Q2KA 5FHTA 4UE7H 2H9EH 2BD2A 3D62A 1AFQC 3H7OA 3TGKE 1GL0E 2EA3A 3MH7A 3ESTA 2ZI2H 2AGIX 3VB7A 4NIYA 4INHA 1C2EA 2BQWB 3ZZCA 4E7RG 3LPRA 3TNSA 4FUEA 1EZUC 2A2QH 2ZECA 3SUGA 1C1SA 1QB6A 3HKJB 3RMNH 1PPBH 5IDKA 2SNVA 1CT0E 1AE5A 1ZHRA 1SGRE 1Z8IB 2W7SA 3BIUH 3LONA 1P2QA 4GCHF 4NA9H 1VJAU 3VGCB 1KSNA 4B76A 2BDYA 4Y11E 1GJ8B 1YF4A 3DHKH 4YLQH 2YNBA 1NFWA 1ZR0A 3QO6A 2GCHG 4BAOB 3KEEA 1SGQE 1F0TA 3KHVA 1IHSH 5E2OA 1UTQA 2PLXA 2WPKS 1T8LA 3WY8A 5CHAB 1O2XA 1CBWB 1GWAA 3SU0A 3UREA 2QXIA 5EXLA 1BZXE 3JZ1B 1GJDB 3QGJA 3U9AH 3MHWU 4OGYA 6LPRA 2Q6DA 4A6LA 3TH3H 2ZPQA 4WVPE 4J2YB 1ZGVA 4AN7A 1EB1H 3P17H 1GHBF 1B5GH 3ZVBA 5E8EH 2VIQA 1O3IA 3ODFA 4MG3A 1HNEE 1MAYA 1LHGH 3BTGE 3NZIA 1O2IA 1MTNB 3OY6U 1Z71A 2FPZA 8ESTE 4WF8A 4GSOA 3EDXB 1SOZA 2FOFA 3MNXA 3P70B 1O3JA 2F9BH 1DLEA 1HAOH 4IMZA 2EI6A 1GJ7B 2Y5HA 2FODA 2A7JA 1G37A 2Y5GA 3K2UA 1HFDA 1TPOA 4FUFA 1O5AB 1H9LB 1A2CH 4LXBH 2HLCA 3T25A 2ZA5A 1EAUA 2PGBB 4ZMAH 3ZZ8A 1O2OA 4ZXXH 1O2JA 1FDPA 4NFEA 5TJXA 1MKXK 7ESTE 5A8YA 1SR5C 5I25A 1P57B 2F9UA 2D26C 2LNCA 4Q80A 2W26A 3BG4C 4ISNA 1BTZA 4I8HA 2BXUH 2QF3A 4U32A 1MUEB 4XFQA 2PSYA 1IQNA 4INLA 5AHGH 1GHBG 4R8TB 4JK5A 2Z3DA 2C8XB 2FESH 3GCTG 1QBNA 1Y3WA 1S0RA 1MD7A 1TNHA 1D3QB 1GCTB 1C2FA 3MU8A 4IGDA 4FUDA 1JIMA 1DFPA 1GBJA 3CS0A 2XBYA 3SO3A 2K1QA 1G36A 1EZSC 4AGKA 1Q31A 1EJAA 1C1OA 4D7FA 4X8UH 3S7HB 1AUJA 1THSH 4AGJA 3F1SB 3M36A 1V6DA 1FY8E 1W7XH 1RTFB 1BRUP 8GCHF 1K28D 2VWOA 5HXFA 2STAE 2SGPE 2FYQA 2QCYA 3SU3A 2Z9IA 1DXWA 1F5RA 3SV8A 2FX4A 3ELAH 1ZPZA 4AFQA 3Q3XA 5GJ4B 4NFFA 3GDVA 1JRSA 3ODDA 1YCPM 3FP7E 1ETTH 4DGJA 3TK9A 1XUGA 2PWXA 3RM2H 1AI8H 1TYNA 1GBCA 2HNTE 3OU0A 4K1SA 5LPRA 2XC0A 1EPTA 4AYYB 3MNBA 3Q3YA 1WTGH 1PJPA 1HYLA 2ANMH 2GVFA 3RLWH 3SBKA 1CSOE 3IG6B 2CF9H 1M9UA 1PQAA
chains in the Genus database with same CATH superfamily
1BTPA 1OWKA 1RS0A 5F53A 1N8OB 4HGCA 2P95A 3AVZA 1TABE 2PKSC 3G01A 4D76A 3RMLH 1SHHB 1C5NH 3Q76A 1OYQA 1XM1A 1DSTA 5L6NH 2HNTC 1C5VA 2FOBA 4DT7B 1LQDB 1V2MT 3M7TA 5H4IB 3F9HA 1QA0A 1GMCF 1XKAC 2NU2E 2XTTB 2VVVA 3GDSA 3V0XA 2IN2A 3DFJA 3RU4D 3T29A 4YESB 5PTPA 2ANKH 1ESBA 5E0JA 1TMBH 1Q3XA 3LGYA 4MPWA 2VIWA 2PW8H 3O8CA 1OS8A 2H9TH 1BTUA 2H1UA 1YC0A 1PPEE 1SLVB 3BTFE 4BAQB 1HXFH 1RXPA 1CA8B 2RA3A 2ZTYA 3QDZB 2DE8A 1SGNE 1E0FD 5DN6D 2FP7B 1K22H 1J8AA 3S0NA 2A5KA 2JJ2D 2FI4E 3EE0B 4Y10E 1OWIA 1UJ1A 3SI4H 2AERH 5IYTA 2OCVB 1DT2A 1C5OH 1VITG 3S9BA 1SMFE 2BTCE 2HPPH 1C2IA 2RDLA 1YLNA 1W10U 3ITIA 1TB6H 3EA8A 3TPIZ 2HWLB 2SGEE 1YPEH 2F3CE 2P94A 1GVKB 3S7KB 1Z8JB 3U8OH 1O3EA 1W0JD 1IHTH 1GMHF 9ESTA 1O3NA 1O5BB 1P01A 5JB8S 1MQ5A 1CA0C 2Z9LA 1MBQA 2H5CA 1UVUH 2HVYB 3WWBA 4AG2A 1ZPBA 3MH4A 1KLTA 2RA0A 5DP7A 1D6RA 2CJIA 1LHEH 1OX1A 1S5SA 3SU4A 1HJ8A 3KQBA 5JDUB 3ZV9A 3ZZ5A 2AYWA 1O2UA 3I78A 1UO6A 1E37B 1A4WH 3OY5U 4MNYA 2VGCB 5DG6A 1CHOF 2FOEA 4Y7AA 2ZG0H 4X8TH 1O5CB 3RXBA 2ALPA 3ZZ4A 1OP8A 3SU1A 3I77A 1EJNA 3LKWA 5EOKA 3STJA 2ASUB 4BANB 2JH0D 2A4QA 3M3TA 2ZKSA 5SGAE 4NZLA 3F0PA 1EXFA 2BLOA 1Y3YA 3LGIA 5EJLA 3GY2A 1TOCB 4RKJB 1FJSA 5AFYH 1T8MA 4WJG2 5HKKD 1DX5M 1SGFG 2JKHA 4X1PU 1V3XA 1Q2WA 2J34A 3F0OA 5HGGA 1G2MA 1MU8B 3OEED 1A0JA 3E16B 1ESTA 3FZDA 1ABJH 1O3KA 3W94A 1AVWA 4VGCB 3E3TA 4CR5A 4AFSA 3SGAE 1NRQH 3NXPA 2DUCA 1QBVH 1WQSA 1QURH 2A31A 1AFEH 1H9IE 3VPKA 3MU4A 4MLFB 1WUNH 1VR1H 3LGUA 4K8YA 1A46H 2TRMA 1GMDG 1BTXA 5DSFA 1L1NA 3A7TA 2A2XH 3GCOA 4O3TA 4CRGA 1OSSA 2J5UA 4HI3A 1JBUH 2VIDA 1E79D 1TGCA 2WUCA 3RXOA 3SQEE 1HJAC 3B8JA 2ZGCA 1LTOA 1UVPA 1YPMH 1GBTA 4WXIA 1B0EA 1JMOH 2ZGHA 4X6NA 1MTNC 1TNIA 1BQYA 3O8RA 1LHCH 4X6MA 3ZV8A 1FONA 2UUJB 4JK6A 2FS8A 1W11U 1LKBA 2C3SA 1RTKA 3K65B 3RU4T 2F9VA 2FMJA 4MPXA 4OS2A 4P02A 2A4RA 2J98B 2CN0H 1DVAH 1Y5AT 1MKXH 1YM0A 3P8FA 1SOTA 5EQQA 4Y8XA 1V2PT 5J4SA 2ALVA 4AB9A 4K3JA 1J9CH 3QLPH 3M35A 1ZHPA 3WW7A 2BX3A 4B71A 1LVYA 1BMFD 1WU1A 4XBDA 3U28C 1QGFA 1QCPA 1ZSKA 3E0PB 2VJ1A 2KFWA 3R0FA 2BM2A 1EQ9A 1S84A 1UMAH 1FNIA 4MPVA 1NPMA 1FUJA 1YYY1 1XXFA 1IQKA 1H1BA 1SLWB 3VGCC 4IC5A 2ULLA 4ZROA 1TNJA 5C17A 3DSPA 3GOVB 3PMHB 5JYIA 4M7GA 4SGBE 3BN9A 3F68H 1J16A 1L4DA 1EP6A 2GMTC 3SUEA 2QYIA 2EI8A 1W2KH 1HIAB 1V2VT 2VB0A 3KYGA 2YOLA 1WSSH 4I8JA 2GD4B 5F8ZA 3RLYH 2XRCA 4OS6A 3SNDA 3E91A 1DANH 2OTVA 3P8OA 2BVSH 5EU8A 1H8DH 3EGKH 4DIIH 2GDDA 3N7EA 1HGTH 1S0QA 5ESBA 1ZSJA 4ACAA 1OWJA 3QWCH 3FVFB 1DSUA 2WV4A 1IQHA 1DWDH 3QX5H 2PTNA 1KMHB 1U6QA 2STBE 2PUQH 3D23A 1T32A 1W0KD 1HXEH 1QJ6B 1P9SA 5LPFA 1NRSH 1MTUA 2H2ZA 3L33A 1DS2E 1NRNH 1D6WA 4H42U 3OYPA 5FCRA 2R3UA 1WTHD 1EKBB 2ZDMA 3EA9A 1P02A 5ETXA 3VXFH 1UVSH 3QTVH 2AHME 2AIQA 2V6NA 2Z9GA 1NC6A 1O2QA 4IN1A 5T6FA 5GCHG 3UY9A 5A0CA 6GCHG 4TSFD 1AIXH 1ID5H 5GWZA 1BBRK 3LJJA 3SI3H 1TBRH 1T8OA 1AE8H 2QXGA 1V2NT 1YPHE 1FY4A 1O3PB 1P8VC 1GBLA 1V2WT 2WYJA 2SGFE 1SC8U 1QRZA 3A84A 4YT6H 1GBHA 2BD4A 2UUYA 1GCDA 4Q63A 3GCHC 1O2RA 6CHAC 5F8XA 3RXAA 4E7NA 1QRXA 5EPYA 1VGCC 3KNXA 3PO1C 3BTME 3KYFA 5C1UA 3GDUA 1YKTA 1Y5BT 3NUMA 1IQEA 1GPZA 1LHFH 1O39A 3LH1A 3DFLA 1O3OA 1UCYK 2HVXA 2BD3A 3U8TH 1G9IE 3V12A 2ZHQH 1XVOA 2FI3E 1QL7A 4INKA 4GPGA 2V3MA 4E06H 2JETC 3JZ2B 2BY6X 2JDID 2TGAA 1J14A 2BD7A 1LKAA 1OWDA 2BOKA 3MH5A 3IITA 5DKMA 2O8LA 1F7ZA 4FU8A 4KTCA 4Y8YA 3BG8A 6GCHF 1H9HE 4XE4A 3ZZ6A 4NA7A 1FY5A 1YLDA 1OP0A 2FI5E 3BTQE 4ZHLU 1KDQB 5A8ZA 2ZNKH 1OWEA 1SVPA 4JZEH 1AY6H 1J15A 1C4U2 1FY3A 1ZOMA 5EW2H 1ZGIA 3T26A 1IQFA 2WPHS 5JBBS 3Q77A 1UTJA 2W7UA 3A87A 2VINA 2FZZA 4WH8A 2GCHF 5KECA 2J9NA 1ORFA 2OXSA 3ZVEA 1MKWK 1WOFA 2XBVA 2VGCC 2VWLA 3BG4B 5HM9A 1CBWC 4GUXA 2FTMA 4HTCH 1UTKA 1KDQA 1EOJA 1CU1A 1BRBE 3RXSA 1DUAA 2B7DH 1A7SA 4OS1A 4Y0YE 2Y81A 1RRKA 4BAKB 1C5RA 2LP6A 3SV7A 1QFKH 1QRWA 1SGIB 5LPEA 1TA2A 1JXPA 2J95A 4ZKOU 3QTOH 2YMSD 3PMBB 3VFEA 2PV9B 1TAWA 1SB1H 1C5SA 1N1LA 5FPYA 3SJOA 1HCGA 1OPHB 3BEIB 1V2OT 1MZDA 1QNJA 1EZQA 2G4UA 4FU9A 4NZQA 4B75A 4RSPA 3BSQA 4J1YA 7GCHF 4X2VA 2GZ9A 2Q1JA 3BTEE 3MTYA 4CRDA 1LCYA 1G3BA 4Y6DA 1TNLA 5I46H 3SUDA 3QGNB 3EAJA 4TPYA 1GJ4H 2HRVA 1C5QA 4Y79A 1G32B 1O36A 1A3BH 4ZHMU 1W12U 1BJVA 4Y71A 5C3NA 3MO6A 3CP7A 1CQQA 1FI8A 1DE7H 1EPTB 1A5HA 1N8OC 3ZVAA 1Y5UT 1S83A 1GBDA 4XD7D 4AB8A 2KZ4A 5GXPA 3TVJB 2GT8A 1LPKB 3P8NA 5F8TA 1BJUA 2J94A 3VB6A 4RKOB 2ZQ1A 1QY6A 4Y0ZE 4BXWA 1NRPH 2ZF0H 4IW4E 1SBWA 1RGQA 3RXIA 1O34A 1GBAA 3SZEA 2QN5T 2VVUA 1HBTH 1UCYE 3M5LA 3QN7A 2FEQH 3RC6A 5FPTA 1EP5A 2ZHWH 2G5NA 3TK6A 3MO9A 1FIZA 1O2VA 1T7CA 2ZEBA 1KLIH 1ZYOA 1GMDF 1INCA 3B9FH 1XMNB 2J4IA 3LH3A 4H4FA 3M5NA 1P10A 1SQTA 1EJMA 2BD9A 1Z1IA 3MO3A 1RIWC 1XX9A 2RDEA 1C4V2 3LT3A 2A7HA 1GBFA 1NU7B 1EOLA 3CENA 4MPUA 1YLCA 5DK1A 1E1QD 2PKAB 3ZVFA 3ATWA 4A1VA 3BF6H 1SLUB 5JB9S 1SQOA 4FUIA 4YM9A 2A45B 4ABIA 1SL3A 2G55A 1TRYA 2PKAA 2A0QB 1C5XB 2AMPA 5EXMA 4YOGA 3Q3KA 2B0FA 2ZDKA 1LPGB 4ASUD 5TCAA 3KCGH 2WZQA 2ESTE 1FIWA 1JOUB 1SGTA 1BIOA 1ZTLA 1A3EH 1ELDE 1T4UH 3MU0A 2IOTA 2CV3A 2G52A 4F4OC 4MDSA 1O3AA 1QHRB 3DA9B 3P92A 2KCAA 1P03A 2H9HA 2XCFA 1L1JA 3S9CA 1BBRH 2EQNA 2Y80A 2XW9A 4CHAC 2GZ7A 2JH6D 4ISIH 4NSVA 4JYUH 5C67A 3F3BA 2JETB 1EUFA 2FYRA 1YY3A 1FY1A 5AFZH 3ATMA 1D3TB 4YO9A 4CH2B 3OEHD 1KIGH 5EXNA 2V35A 3F9FA 4CH8B 4LZ4B 4NCYA 3VB3A 1O2PA 1WYKA 1LVOA 1ZMNA 2J38A 3P8GA 4JYTA 2Y7XA 4NSYA 4X1RU 3VXEH 3AK5A 5DP5A 3K6ZA 4Q7ZA 2CF8H 2OLGA 2FLBH 3ZZ7A 4FETA 2WINI 4TY7A 3LGVA 1MD8A 2AS9A 5EPNA 3SV9A 1C1TA 1GVZA 2P3UB 4U2WA 4B6FA 3NKKA 3SJKA 4KGAA 1DXPA 3DT0H 5C5OA 1HV7A 1S6HA 4IN2A 1PQ7A 2KCOA 1E35B 3O8BA 1O37A 2FTLE 1T31A 3TH4H 2TGTA 1ELEE 1TX7A 1YPHC 1GGDC 2YNAA 1XVMA 4ZKSU 1O32A 2G4TA 2ZGJA 2KAIB 3V3MA 1F0SA 5L30H 1V2JT 3V7TA 1TRNA 4BAMB 2BVRH 1D9IA 3RXDA 3RXLA 2G00A 2O8WA 1K1NA 3OAAD 2RFKC 3W1EA 1GBBA 1FN6A 1FV9A 1YCPH 3AW1A 2P59A 1NT1A 2BB4A 5DP4A 1C9TA 4AX9H 1SFIA 3ZZDA 3KQDA 4ABAA 2L6OA 2M5TA 9LPRA 1C1PA 3ZYEA 4FVBA 3E6PH 4DY7B 1UTMA 5CMXH 3UQVA 4VGCC 4ISOA 4UFDH 1OHHD 3RDZA 1GCTC 4B73A 4ISHH 2BD5A 1MCVA 1LVMA 2Z9JA 3VB4A 5FX6A 2F83A 1V2UT 5A0BA 1MZAA 2GGVB 1CVWH 1VKYA 4YTAA 3T27A 4E05H 1FPHH 2ZCLP 1BHXB 1TBZH 1AB9C 2V7QD 1TGTA 1Y59T 2BZAA 4MNVA 2CXVA 1WDIA 1YP9A 1LPZB 1F2SE 3DSGA 2ODPA 1SGYE 2WPLS 4IMQA 5G4BA 5LH8A 4A92A 4B1TA 3L6PA 4LZ1H 1MQ6A 1HIAA 1WBGB 1Y8TA 2ZU4A 5HYOA 2NWNA 1BTYA 1LQEA 1KXDA 1JWTA 2O8UA 2V3OH 1GI9B 3FP8E 1A0LA 2GJGA 3L3TA 1O3FA 2XBXA 3UNRA 2K8IA 2WPJS 3TJVA 5LGOA 1P04A 3RXJA 7LPRA 1IQMA 2G51A 3RXPA 2BDBA 4Z6AH 2BDGA 4DG4A 4I7YH 5T1VA 1LMWB 2TPIZ 2QF4A 1EPTC 2ZFTA 1ANDA 4B74A 5HM2A 2XNIA 1ELCA 3RXEA 4RN6A 1O5GH 2R2MB 1FN8A 1O2SA 2D1JA 2BLQA 1D3DB 4YOIA 3RC5A 1GJ9B 1DWCH 3MU5A 2ZO3H 3M37A 2C8ZB 1P12E 1QQUA 4K60A 4AFUA 3E8LA 2WHXA 3BTWE 2PUXB 1TLDA 3UNSA 5C0TA 1ANCA 3SJIA 3MOCA 3GISB 1FZZA 4UFFH 1GI0A 2WV5A 1XUJA 1PPCE 5FPSA 2ZFPH 1TFXA 1Z8GA 1GBIA 4D7GA 1AN1E 1DICA 3UNQA 4DJZB 1HB0B 2BDCA 2UWLA 1LDTT 3SGQE 3UWIA 4CRCA 1GDNA 3TGJE 3WWFA 1BOQA 1SHYA 2SNWA 1C5YB 3SNBA 1NY22 2SGQE 4P00A 4CBOA 3A8AA 3ATLA 4YZUA 3KGPA 3EE7A 3RM0H 1CA0B 3RP2A 3H09A 3EA7A 3GY7A 1DPOA 1W8BH 3KN2A 3NWUA 4ZHAA 2PFEA 2UWOA 4WXVA 1SQAA 4XSKU 3PO1B 1O2HA 2QF5A 2FO9A 2FX6A 4A5TS 5FBIA 1ARCA 4NIVA 1O3HA 1L4ZA 3RMOH 1DOJA 3ENSB 1WAYB 1EZXC 1QB1A 1EAWA 4ACBA 2OC8A 4X2YA 1MMJN 2ZHDA 2UWPA 3A80A 4U01A 1P3EA 1BRAA 4X0WU 2QE7D 1HAVA 4HFPB 1D3PB 3FKSD 1TE0A 1TWXB 2XCNA 4K1EA 5E2PA 4ABDA 3LOXA 4WY3A 1THRH 3TNTA 3SYJA 1ELVA 3HGNA 2SGAA 3MNSA 1P2KA 4FU7A 1L2EA 4Q7XA 5EQSA 2QV1A 1SI5H 5T6GA 1ELTA 3ATIA 1C2HA 1MBMA 4JZDH 1ZMLA 2HALA 4XBBA 1GHZA 5HIYA 1PQ5A 1DY8A 2PR3A 1NROH 1C1RA 4PROA 4CHAB 4CBNA 3PROA 1A1RA 1HJ9A 3EQ0H 1UW7A 4ABHA 1C5TA 3N7OA 3A81A 1L0ZA 5EJZA 3UIRA 2ZDNA 2P93A 5CHBA 1VGCB 1O3DA 1TQ7B 8LPRA 1Z1JA 1BMAA 1Y3UA 1C1QA 4A7IB 1TOMH 2ZCHP 1PYTC 2ZFQH 4A1TA 2QGRA 3H5CB 1IQGA 4ZAEA 5C0UA 1FQ3A 5EJ1A 2HLDD 1A5GH 4AG1A 1SKYE 4NGAH 1P09A 2Z3EA 4GCHG 2BZ6H 4I8GA 4I86A 4H6SB 3N99A 4QT8C 1NFYA 2OUAA 2ZDAH 4MNWA 5EG4A 4TT3D 1BT7A 3LDXH 4O03A 5C5NA 1K21H 1O2GH 1OYTH 1N6XA 2CGAA 4KP0A 1AKSB 3GY6A 1O38A 2JJ1D 2KX4A 3U8RH 3MQKC 2BX4A 3T62A 4UONA 1GHWH 3PM3A 1NFUA 2J98A 2CK3D 2AEIH 1F5LA 1GI5A 2Y7ZA 3EYDA 2AMQA 4TY6A 3CS7A 3GY8A 1BITA 3E90B 2XC5A 3ZZ9A 3ATKA 1KTSB 4X8SH 4X1NU 1TIOA 2R0LA 2XWAA 5EW1H 1S82A 4H6TA 1V2KT 2VWNA 3PTBA 2YMSC 3M7QA 1GI2A 1EX3A 1ZSLA 2BVXH 2PHBA 3DSOA 3UWJH 2VH6A 1C2KA 1MTVA 1TX6A 1C1NA 1NBME 2C90B 4B2AA 1ZTJA 2BXTH 3RUOA 4UDWH 4KELA 1F5KU 1GJ5H 1ZLRA 2Z7FE 1QTFA 2O9QA 4ZKNU 3HK3B 1TQ0B 2AMDA 1VCWA 4B2CA 5FCKA 1O5DH 5TCCA 5C20A 1P06A 1MTWA 3K6YA 1T8NA 2VBCA 2ZTZA 4ESTE 3UQOA 7GCHG 3GICB 3UOPA 3PLBA 1GDQA 1LVBA 4XBCA 1O33A 4AORA 2ZGBH 3PMAB 1GI4A 3RXTA 2ZQ2A 1XXDA 3FP6E 3W95A 1O5FH 3MWIU 5CE1A 2ANWA 1HAZB 5AF9H 5BRRE 4BTIB 3UFAA 1ZJKA 3U69H 3STIA 1Z8RA 3GCHB 1QA7A 3RMMH 5DP8A 2A4OA 2IPHA 1TMTH 4SGAE 2XYAA 5DP6A 1QJ1B 3M7UA 3MYWA 2QA9E 2W5EA 3AAUA 1OOKB 5EQRA 3A8DA 3BEUA 1X7AC 2AGEX 1JIRA 1F0UA 5A8XA 2ZDVH 1GHAG 1ZZZA 3RXCA 1F0RA 1K1IA 4BTUB 4XOJA 2VIVA 2BYAX 3LGTA 2I6QA 3SUFA 1CHGA 4JYVH 5EIYA 4Y76A 2ZWLH 1UTOA 1C1WH 1C5LH 3KIDU 1VCPA 4NIWA 2NU0E 5JBCS 2BLWA 2O8TA 2F9PA 3O8DA 1W0ZU 3SZNA 5AVDA 3R3GB 3SN8A 1HDTH 3F6UH 4GAWA 2B5TB 4FUJA 3M61U 2FS9A 1BHXF 2BY9X 2ZU5A 1ARBA 1MAXA 5FXLA 1G3CA 2F9OA 1FLEE 2ZGXH 1WXRA 3I29A 1TA6A 3PYHA 3A89A 1TBQH 1AU8A 5HMAA 1P3CA 2G8TA 2ZU3A 1SGFA 2J97A 1OKXA 1BMMH 1S6FA 2ZIQH 2GV7A 1GGDB 4K69A 4GLYA 4MTBA 3TJNA 1IQJA 5EODA 2ZFFH 1C1UH 1GMHG 4DURA 5JBAS 1O3BA 4R0IA 1CGIE 1W14U 2A4GA 2ZPRA 2ZTXA 2ZCKP 4ZUHA 1P2JA 5KEDA 1BB0B 2FOMB 2FOAA 1XUHA 1UK3A 3SNEA 2Z6BD 1C1VH 4D9RA 5KGOA 1NO9H 3HGPA 2V3HH 2BY5X 3U1IB 1C2JA 2WPIS 1OXGA 5C1XA 1TX8A 3TITA 4ABJA 1TPSA 1A61H 1K9OE 4O9VA 1RJXB 1O3MA 1E38B 1OP2A 2IJD1 2QY0B 3OFND 4IC6A 6CHAB 1NBMD 1QB9A 1GI1A 1VITH 3A7ZA 5T6DA 1SQRA 2F9NA 2WYGA 3RU4E 1P2NA 2VIOA 4AFZA 1LO6A 1V2RT 1MH0A 1O2ZA 2O8MA 1O2KA 2Y6TA 1QJ7B 2GP9B 4MNXA 2K0QA 1KXEA 1RD3B 1TRMA 1GHAF 1ZPCA 3GYLB 3M5MA 5FL7D 4FVDA 1NFXA 3KQEA 1KXCA 1PQ8A 3MMGA 2OBQA 3PRBA 2BD8A 1VCQA 1MCTA 1MU6B 3A88A 1AZZA 3RXUA 2W3KA 2C93B 2NU1E 3RXGA 1S81A 3BV9B 3ZZ3A 4BOHA 1GMCG 2V0BA 2Y82A 3LC3A 4I33A 1S6LA 1ANEA 4DW2U 2VNTA 2JH5D 1TNGA 1KXFA 2GZ8A 2PP6A 4FXGH 1SG8B 2B8OH 2BDIA 1GJCB 1P2OA 1AHTH 3HKIB 3NRLA 2A1DB 1O3GA 4X1SU 2P16A 1W13U 1C5UA 1CE5A 3KQCA 3A7XA 3A85A 1BTHH 3TU7H 2PKSB 1CT2E 1HAIH 1GJBB 2P8OB 1TGNA 4UD9H 2HGTH 2HPQH 3PRDA 4MVNA 1IAUA 1GVLA 1Z6EA 4DIHH 1PPGE 3PMJA 2F4LA 2THFB 1O2NA 4TWYA 2C4FH 1PYTD 2FDAA 3A7VA 4X6OA 2R9PA 4OS4A 4GVUA 1SLXB 1G3DA 4WWYA 4HZHA 5IK2D 1AZ8A 1HPGA 1XUKA 4ZH8A 2BQ7B 1E1RD 1GL1A 2P3FH 1A0HB 4IBLH 3RXMA 2RG3A 2D8WA 2FLRH 1P11E 3HPTB 5EGMA 1EFRD 2ILNA 1HAXB 3RXVA 3SW2B 4NA8A 1E34B 2OC1A 2XXLA 2CHAB 3LJOA 4THNH 3SORA 1NTPA 4TYDA 1AVXA 1BMLA 2ZP0H 3ZZAA 1NZQH 2AGGX 2FOGA 3OX7U 3A7YA 5DP3A 3SU6A 1BDAA 2FXRA 5DJ7A 2BQ6B 5FBEA 4FUCA 5C94A 1RTLA 2BDHA 3SHAH 1RIWB 4JZFH 4DVAU 4ABEA 4X8VH 1AB9B 2IJOB 1GHXH 1H4WA 4KKDA 5DO4H 3AW0A 2ZU1A 1H8HD 3PB1E 3SJ8A 3HK6B 1HAVB 1KY9A 1ABIH 1IQIA 4YT7H 1TALA 2ZFRH 1C5WB 4AYVB 1OWHA 2WV9A 1DLKB 1DY9A 3IWMA 2BMGB 1GHVH 1SPJA 3U98H 4X6PA 1Y3XA 4Y8ZA 1K1MA 4CRBA 2ZPSA 4TPIZ 3RXQA 1XKBC 4Y7BA 2QC2A 1GG6C 3URCA 4ZXYH 1NN6A 2R0KA 4BNRA 4KTUA 4YLUA 5JBTA 1AD8H 1UHBB 2AFQB 4UFGH 1PPFE 1BBRE 1MKWH 1G2LA 2Q6GA 1SGDE 1V2LT 1B7XB 4OGXA 1KXAA 4B6EA 1O2MA 2BLVA 2OD3B 3P6ZB 3RXFA 1BTWA 3FZZA 2C8YB 4RI0A 2XC4A 1ELGA 2IPQX 1ANBA 1NU9A 6ESTA 5GCHF 5L2ZH 1ELAA 3QK1A 1TGSZ 3UR6A 1DDJA 2QXJA 1RFNA 3M3VA 3UTUH 1GI3A 3PWBA 1YPJH 2B9LA 2FWWA 2GKVE 1MTSA 1NRRH 3TJOA 4JMYA 2ODQA 3A8BA 4ISLA 1AVGH 2ZHEH 3UPEA 1UK2A 2ZZUH 1W7GH 1UHBA 1O2TA 3NPSA 3H7TA 1BA8B 4JCNA 3D65E 1HAHH 1UTLM 3SU5A 5JPMH 1HJAB 3GY5A 3MH6A 3E0NB 3GY4A 1ESAA 5A0AE 1GBMA 3QZQA 1W0YH 3TGIE 2Z3CA 1HLTH 1YPGH 3GY3A 1T4VH 1HAYB 5L2YH 2UUFB 2FIRH 5DP9A 2EEKA 2WUBA 5A09A 2OQ5A 2PGQB 1C2DA 1GBEA 2FOHA 2Y5FA 1C2MA 2EC9H 1C2LA 1P0SH 1Z7KA 4FUHA 4I32A 5C1YA 1FPCH 2OC0A 1EAXA 2ODYB 1SSXA 1VITF 4JZ1A 5BPEA 2ZHFH 2ANYA 1GI7B 3TIUA 2XWBI 3A8CA 2GX4A 3A82A 1TGBA 4K2YA 4ABGA 3UR9A 3TLOA 5ESTE 4YXWD 1QIXB 4F48B 3T2NA 3LGWA 1K1OA 1AWHB 3ZVDA 2NU4E 1C5ZB 1KXBA 3SNCA 3RXKA 4CR9A 4M9FA 5GPIB 1C4Y2 1KYNA 1COWD 2F91A 1EATA 1L1GA 1F92A 3T5FH 3ZIAD 2BHGA 1YWUA 2TGPZ 2GCTB 1PPHE 1DWEH 1FX0B 2A5IA 2R3YA 8KME2 5HIZA 1YPKH 4CREA 1O3CA 2BDAA 3FANA 4AZ2B 1AWFH 1CO7E 2BY8X 4WMEA 3LU9B 1P2IA 4OM9A 1ZJDA 4X1QU 4Z0KA 1V2TT 1ZMJA 2VVCA 2Z9KA 1LHDH 1YGCH 4HG6A 1BMNH 1TPPA 2P8OC 5F03A 1Y3VA 2A32A 1NM6A 3FFGA 5ABWA 2HOBA 3HATH 5GIBA 1EASA 5K0HA 1K1LA 1BRCE 3ZZBA 1O31A 2AH4X 2UUKB 5E0GA 4U30A 3SGBE 5FX5A 3UUZA 1QZ8A 2Q6FA 3PLKA 4DOQA 2KAIA 1HRTH 3FN8A 3SJ9A 3MFJA 4NWKA 4XDEA 2ZFSA 4F49A 3QUMP 4GHTA 2ZDLA 8GCHG 2C8WB 2TIOA 3BTHE 1IQLA 1NESE 3UB0A 5A2MH 4AC9A 1ELFA 1YPLH 1GJAB 2A7CA 4K5ZA 3RC4A 3V13A 2P3TB 3PTNA 1CGHA 4X2WA 3BTDE 2PSXA 3URDA 5B6OA 3RXHA 2HNTF 3B23B 4IS5A 2R2WU 1W3CA 2OBOA 2RCEA 3NCLA 2G5VA 1P2MA 2A5AA 1VJ9U 3CNRA 1SGCA 3E1XB 5FAHA 1O0DH 1ZRBA 3SHCH 4K8BA 3BEFB 4FUGA 1ZRKA 4X2XA 1PFXC 3D49H 3DUXH 1BUIA 1DWBH 3VB5A 1AMHA 2W3IA 1SGPE 2G81E 1GBKA 5T3HA 2OP9A 3MU1A 1AQ7A 3LIWA 4NIXA 4ABFA 3SV2H 2OC7A 2OK5A 1IOEA 1C5MD 1V2ST 3SOSA 3F9GA 3P95A 2OQUA 1ETRH 1GG6B 1EB2A 5C2ZA 3MNCA 3ZVCA 1C1MA 1ZTKA 4OS7A 4WMDA 2PTCE 4AOQA 1QBOA 2CHAC 1UVTH 3TJUA 3VEQB 4CRFA 1E36B 3K9XB 1TPAE 3SQHE 1ZHMA 2NU3E 2FOCA 4TWWA 1FXYA 2VH0A 2I6SA 3AAVA 4DCDA 5K7RA 3SV6A 4O3UA 3PV2A 3Q00A 5CDFE 1AO5A 2W6ID 4I31A 4Q4LA 2DE9A 3QZRA 1C2GA 1G30B 1TMUH 1ACBE 2CMYA 1SGEE 2VU8E 3GCTF 3PLPA 3PV4A 5DPAA 1FMGA 2WPDD 3FOAA 1HAPH 1H8ED 4BAHB 1C9PA 3AASA 1YCPK 1HAGE 3FAOA 2QF0A 3BTTE 4D9QA 1ETSH 1O2WA 2BOHB 5CHAC 2ZC9H 4NWLA 4FOUC 2D2DA 3S69A 4RT1A 2H6MA 4CRAA 3S9AA 2AIPA 2ZU2A 2GT7A 3M3SA 2J92A 5DGJA 2J2UA 3SU2A 3KL6A 1DITH 1DUEA 1UCYH 1GDUA 5F6MA 1K2I1 4FUBA 4ZCNA 1EAIA 4UEHH 4UFEH 1KLJH 1HUTH 2YMSB 3MI4A 2EI7A 2OINA 3NK8A 4Q7YA 4NG9H 1TNKA 3OTJE 2Z94A 1B0FA 1Z6JH 4B2BA 1J17T 4BTTB 4D8NA 2TBSA 2QIQA 4YOJA 1O5EH 4JZIA 4KTSA 4MQAA 2SGDE 2BY7X 4A1XA 1K1JA 1S85A 1WCZA 1DM4B 2SFAA 3DD2H 1CHOG 1YBWA 3TK5A 4O97A 1XUIA 4OS5A 3DCLA 1KTTB 3C1KA 3GCNA 1G3EA 1ELBA 3UOUA 1O2YA 5B6LA 3KF2A 2FM2A 2H5DA 3SNAA 1GI6A 2KCPA 3A83A 1AFQB 7KMEH 3U1JB 2VWMA 2TGDA 1VZQH 4ABBA 1P9UA 4WMFA 3GYMA 2LELA 4K1TA 1GHYH 3BIVH 2WPMS 1D4PB 1WQVH 3A7WA 2XBWA 3A86A 1UVOA 1AGJA 3LC5A 3F2GA 1FAKH 4WH6A 5J4QA 3BTKE 1GI8B 1K1PA 1QL8A 1THPB 3ZYDA 1UTPA 4Z1MD 1UTNA 4ASHA 3T28A 1O30A 4GHQA 1BCUH 1N6YA 1O3LA 2F43B 3M5OA 1CGJE 1V2QT 4I8LA 2GDEH 2XOKD 1QL9A 2JIZD 4BXSA 3F9EA 1O35A 1UK4A 3F2HA 3RXRA 1AKSA 1XUFA 1H8IH 2QXHA 2GV6A 1TONA 4ZKRU 1QQ4A 2GMTB 4LOYH 1GJ6A 1FAXA 3C27B 4I8KA 1O2LA 1P05A 2QAAA 3TH2H 2GTBA 1SFQB 3ZVGA 2VIPA 1NS3A 1WV7H 1CT4E 5GDSH 2LPRA 1A5IA 2GCTC 3PWCA 5E0HA 4LK4A 4F55A 1C5PA 1AUTC 3OSYA 1QR3E 2W6JD 1JRTA 1PPZA 4Q2KA 5FHTA 3VG8A 4UE7H 2H9EH 2BD2A 5GNDA 3D62A 1AFQC 3H7OA 3TGKE 1GL0E 2EA3A 3MH7A 3ESTA 3GS9A 2ZI2H 2AGIX 3VB7A 4NIYA 4INHA 1C2EA 2BQWB 3ZZCA 4E7RG 3LPRA 3TNSA 4FUEA 1EZUC 2A2QH 2ZECA 3SUGA 1C1SA 1QB6A 3HKJB 3KQ5A 3RMNH 1PPBH 5IDKA 2SNVA 1CT0E 1AE5A 1ZHRA 1K0HA 1SGRE 1Z8IB 2W7SA 4RT0A 3BIUH 3LONA 1P2QA 4GCHF 4NA9H 3UAIC 1VJAU 3VGCB 1KSNA 4B76A 2BDYA 4Y11E 1GJ8B 1YF4A 3DHKH 4YLQH 2KCYA 1NFWA 1ZR0A 2YNBA 2GCHG 3F2FA 3QO6A 4BAOB 3KEEA 1SGQE 1F0TA 3KHVA 1IHSH 5E2OA 1UTQA 3PV5A 2PLXA 2WPKS 1T8LA 3WY8A 2L74A 5CHAB 3OE7D 1O2XA 1CBWB 1GWAA 3SU0A 3UREA 2QXIA 5EXLA 1BZXE 3JZ1B 1GJDB 3QGJA 3U9AH 3MHWU 4OGYA 6LPRA 2Q6DA 3OTPA 3TH3H 4A6LA 2ZPQA 4WVPE 4J2YB 1ZGVA 4AN7A 1EB1H 3P17H 1GHBF 1B5GH 3ZVBA 2XNDD 2KM0A 5E8EH 2VIQA 1O3IA 3ODFA 4MG3A 1HNEE 1MAYA 2KR7A 1LHGH 3BTGE 3NZIA 1O2IA 1MTNB 3OY6U 1Z71A 2M2AA 2FPZA 8ESTE 4WF8A 4GSOA 1MABB 3EDXB 1SOZA 2FOFA 3MNXA 3P70B 1O3JA 2F9BH 1DLEA 1HAOH 4IMZA 2EI6A 1GJ7B 2Y5HA 2FODA 2A7JA 1G37A 2Y5GA 3K2UA 1HFDA 1TPOA 4FUFA 1O5AB 1H9LB 4XRNA 1A2CH 4LXBH 2HLCA 3T25A 2ZA5A 1EAUA 2PGBB 4ZMAH 3ZZ8A 1O2OA 4ZXXH 1O2JA 3N7DA 1FDPA 4NFEA 5TJXA 2EY4C 1MKXK 7ESTE 5A8YA 1SR5C 5I25A 1P57B 2F9UA 2D26C 2LNCA 4Q80A 2W26A 3BG4C 4ISNA 1BTZA 4I8HA 2BXUH 2QF3A 4U32A 1MUEB 4XFQA 2PSYA 1IQNA 4INLA 5AHGH 1GHBG 4R8TB 4JK5A 2Z3DA 2C8XB 2FESH 3GCTG 1QBNA 1Y3WA 1S0RA 1MD7A 1TNHA 1D3QB 1GCTB 1C2FA 3MU8A 3FO8D 4IGDA 4FUDA 1JIMA 1DFPA 1GBJA 3CS0A 2XBYA 3SO3A 2K1QA 1G36A 1EZSC 4AGKA 1Q31A 1EJAA 1C1OA 4D7FA 4X8UH 3S7HB 1AUJA 1THSH 4AGJA 3F1SB 3M36A 1V6DA 1FY8E 1W7XH 1RTFB 1BRUP 8GCHF 1K28D 2VWOA 5HXFA 2STAE 2SGPE 2FYQA 2QCYA 3SU3A 2Z9IA 1DXWA 1F5RA 3SV8A 2FX4A 3ELAH 1ZPZA 4AFQA 3Q3XA 5GJ4B 4NFFA 3GDVA 1JRSA 3ODDA 1YCPM 3FP7E 1ETTH 4DGJA 3TK9A 1XUGA 2PWXA 4DT4A 3RM2H 1AI8H 1TYNA 1GBCA 2HNTE 3OU0A 4K1SA 5LPRA 2XC0A 1EPTA 4AYYB 3MNBA 3Q3YA 1WTGH 1PJPA 1HYLA 2WSSD 2ANMH 2GVFA 3RLWH 3SBKA 1CSOE 3IG6B 2CF9H 1M9UA 1PQAA
chains in the Genus database with same CATH topology
1BTPA 1OWKA 1RS0A 1N8OB 4HGCA 2P95A 3AVZA 1TABE 2PKSC 3G01A 4D76A 3RMLH 1SHHB 1C5NH 3Q76A 1OYQA 1XM1A 1DSTA 5L6NH 2HNTC 1C5VA 2FOBA 4DT7B 1LQDB 1V2MT 3M7TA 5H4IB 3F9HA 1QA0A 1GMCF 1XKAC 2NU2E 2XTTB 2VVVA 3GDSA 3V0XA 2IN2A 3DFJA 3RU4D 3T29A 4YESB 5PTPA 2ANKH 1ESBA 5E0JA 1TMBH 1Q3XA 3LGYA 4MPWA 2VIWA 2PW8H 3O8CA 1OS8A 2H9TH 1BTUA 2H1UA 1YC0A 1PPEE 1SLVB 3BTFE 4BAQB 1HXFH 1RXPA 1CA8B 2RA3A 2ZTYA 3QDZB 2DE8A 1SGNE 1E0FD 2FP7B 1K22H 1J8AA 3S0NA 2A5KA 2FI4E 3EE0B 4Y10E 1OWIA 1UJ1A 3SI4H 2AERH 5IYTA 2OCVB 1DT2A 1C5OH 1VITG 3S9BA 1SMFE 2BTCE 2HPPH 1C2IA 2RDLA 1W10U 3ITIA 1TB6H 3EA8A 3TPIZ 2HWLB 2SGEE 1YPEH 2F3CE 2P94A 1GVKB 3S7KB 1Z8JB 3U8OH 1O3EA 1IHTH 1GMHF 9ESTA 1O3NA 1O5BB 1P01A 5JB8S 1MQ5A 1CA0C 2Z9LA 1MBQA 2H5CA 1UVUH 4AG2A 1ZPBA 3MH4A 1KLTA 2RA0A 5DP7A 1D6RA 2CJIA 1LHEH 1OX1A 1S5SA 3SU4A 1HJ8A 3KQBA 5JDUB 3ZV9A 3ZZ5A 2AYWA 1O2UA 3I78A 1UO6A 1E37B 1A4WH 3OY5U 4MNYA 2VGCB 5DG6A 1CHOF 2FOEA 4Y7AA 2ZG0H 4X8TH 1O5CB 3RXBA 2ALPA 3ZZ4A 1OP8A 3SU1A 3I77A 1EJNA 3LKWA 5EOKA 3STJA 2ASUB 4BANB 2JH0D 2A4QA 3M3TA 2ZKSA 5SGAE 4NZLA 1EXFA 2BLOA 1Y3YA 3LGIA 3GY2A 1TOCB 4RKJB 1FJSA 5AFYH 1T8MA 4WJG2 1DX5M 1SGFG 2JKHA 4X1PU 1V3XA 1Q2WA 2J34A 5HGGA 1G2MA 1MU8B 1A0JA 3E16B 1ESTA 3FZDA 1ABJH 1O3KA 3W94A 1AVWA 4VGCB 3E3TA 4CR5A 4AFSA 3SGAE 1NRQH 3NXPA 2DUCA 1QBVH 1WQSA 1QURH 2A31A 1AFEH 1H9IE 3VPKA 3MU4A 4MLFB 1WUNH 1VR1H 3LGUA 4K8YA 1A46H 2TRMA 1GMDG 1BTXA 1L1NA 3A7TA 2A2XH 3GCOA 4O3TA 4CRGA 1OSSA 4HI3A 1JBUH 2VIDA 1TGCA 2WUCA 3RXOA 3SQEE 1HJAC 3B8JA 2ZGCA 1LTOA 1UVPA 1YPMH 1GBTA 4WXIA 1B0EA 1JMOH 2ZGHA 4X6NA 1MTNC 1TNIA 1BQYA 3O8RA 1LHCH 4X6MA 3ZV8A 1FONA 2UUJB 4JK6A 2FS8A 1W11U 1LKBA 2C3SA 1RTKA 3K65B 3RU4T 2F9VA 2FMJA 4MPXA 4OS2A 2A4RA 2CN0H 1DVAH 1Y5AT 1MKXH 1YM0A 3P8FA 1SOTA 5EQQA 4Y8XA 1V2PT 5J4SA 2ALVA 4AB9A 4K3JA 1J9CH 3QLPH 3M35A 1ZHPA 2BX3A 4B71A 1LVYA 1WU1A 4XBDA 1QGFA 1QCPA 1ZSKA 3E0PB 2VJ1A 3R0FA 2BM2A 1EQ9A 1S84A 1UMAH 1FNIA 4MPVA 1NPMA 1FUJA 1YYY1 1XXFA 1IQKA 1H1BA 1SLWB 3VGCC 4IC5A 2ULLA 4ZROA 1TNJA 3GOVB 3PMHB 5JYIA 4M7GA 4SGBE 3BN9A 3F68H 1J16A 1L4DA 1EP6A 2GMTC 3SUEA 2QYIA 2EI8A 1W2KH 1HIAB 1V2VT 2VB0A 4I8JA 2YOLA 1WSSH 2GD4B 5F8ZA 3RLYH 2XRCA 4OS6A 3SNDA 3E91A 1DANH 2OTVA 3P8OA 2BVSH 5EU8A 1H8DH 3EGKH 4DIIH 2GDDA 1HGTH 1S0QA 5ESBA 1ZSJA 1OWJA 3QWCH 3FVFB 1DSUA 2WV4A 1IQHA 1DWDH 3QX5H 2PTNA 1U6QA 2STBE 2PUQH 3D23A 1T32A 1HXEH 1QJ6B 1P9SA 5LPFA 1NRSH 1MTUA 2H2ZA 3L33A 1DS2E 1NRNH 1D6WA 4H42U 3OYPA 5FCRA 2R3UA 1WTHD 1EKBB 2ZDMA 3EA9A 1P02A 5ETXA 3VXFH 1UVSH 3QTVH 2AIQA 2V6NA 2Z9GA 1NC6A 1O2QA 4IN1A 5T6FA 5GCHG 3UY9A 5A0CA 6GCHG 1AIXH 1ID5H 5GWZA 1BBRK 3LJJA 3SI3H 1TBRH 1T8OA 1AE8H 2QXGA 1V2NT 1YPHE 1FY4A 1O3PB 1P8VC 1GBLA 1V2WT 2WYJA 2SGFE 1SC8U 1QRZA 3A84A 4YT6H 1GBHA 2BD4A 2UUYA 1GCDA 3GCHC 1O2RA 6CHAC 5F8XA 3RXAA 4E7NA 1QRXA 5EPYA 1VGCC 3KNXA 3PO1C 3BTME 5C1UA 3GDUA 1YKTA 1Y5BT 3NUMA 1IQEA 1GPZA 1LHFH 1O39A 3LH1A 3DFLA 1O3OA 1UCYK 2HVXA 2BD3A 3U8TH 1G9IE 3V12A 2ZHQH 1XVOA 2FI3E 1QL7A 4INKA 4GPGA 4E06H 2JETC 3JZ2B 2BY6X 2TGAA 1J14A 2BD7A 1LKAA 1OWDA 2BOKA 3MH5A 3IITA 5DKMA 2O8LA 1F7ZA 4FU8A 4KTCA 4Y8YA 3BG8A 6GCHF 1H9HE 4XE4A 3ZZ6A 4NA7A 1FY5A 1YLDA 1OP0A 2FI5E 3BTQE 4ZHLU 1KDQB 5A8ZA 2ZNKH 1OWEA 1SVPA 4JZEH 1AY6H 1J15A 1C4U2 1FY3A 1ZOMA 5EW2H 1ZGIA 3T26A 1IQFA 2WPHS 5JBBS 3Q77A 1UTJA 2W7UA 3A87A 2VINA 2FZZA 4WH8A 2GCHF 2J9NA 1ORFA 2OXSA 3ZVEA 1MKWK 1WOFA 2XBVA 2VGCC 2VWLA 3BG4B 5HM9A 1CBWC 4GUXA 2FTMA 4HTCH 1UTKA 1KDQA 1EOJA 1CU1A 1BRBE 3RXSA 1DUAA 2B7DH 1A7SA 4OS1A 4Y0YE 2Y81A 1RRKA 4BAKB 1C5RA 3SV7A 1QFKH 1QRWA 1SGIB 5LPEA 1TA2A 1JXPA 2J95A 4ZKOU 3QTOH 3PMBB 3VFEA 2PV9B 1TAWA 1SB1H 1C5SA 1N1LA 5FPYA 3SJOA 1HCGA 1OPHB 3BEIB 1V2OT 1MZDA 1QNJA 1EZQA 2G4UA 4FU9A 4NZQA 4B75A 4RSPA 3BSQA 4J1YA 7GCHF 4X2VA 2GZ9A 2Q1JA 3BTEE 3MTYA 4CRDA 1LCYA 1G3BA 4Y6DA 1TNLA 5I46H 3SUDA 3QGNB 3EAJA 4TPYA 1GJ4H 2HRVA 1C5QA 4Y79A 1G32B 1O36A 1A3BH 4ZHMU 1W12U 1BJVA 4Y71A 5C3NA 3MO6A 3CP7A 1CQQA 1FI8A 1DE7H 1EPTB 1A5HA 1N8OC 3ZVAA 1Y5UT 1S83A 1GBDA 4AB8A 5GXPA 3TVJB 2GT8A 1LPKB 3P8NA 5F8TA 1BJUA 2J94A 3VB6A 4RKOB 2ZQ1A 1QY6A 4Y0ZE 4BXWA 1NRPH 2ZF0H 4IW4E 1SBWA 1RGQA 3RXIA 1O34A 1GBAA 2QN5T 2VVUA 1HBTH 1UCYE 3M5LA 3QN7A 2FEQH 3RC6A 5FPTA 1EP5A 2ZHWH 2G5NA 3TK6A 3MO9A 1FIZA 1O2VA 1T7CA 2ZEBA 1KLIH 1ZYOA 1GMDF 1INCA 3B9FH 1XMNB 2J4IA 3LH3A 4H4FA 3M5NA 1P10A 1SQTA 1EJMA 2BD9A 1Z1IA 3MO3A 1RIWC 1XX9A 1C4V2 3LT3A 2A7HA 1GBFA 1NU7B 1EOLA 3CENA 4MPUA 1YLCA 5DK1A 2PKAB 3ZVFA 3ATWA 4A1VA 3BF6H 1SLUB 5JB9S 1SQOA 4FUIA 4YM9A 2A45B 4ABIA 1SL3A 2G55A 1TRYA 2PKAA 2A0QB 1C5XB 2AMPA 5EXMA 4YOGA 3Q3KA 2B0FA 2ZDKA 1LPGB 5TCAA 3KCGH 2ESTE 1FIWA 1JOUB 1SGTA 1BIOA 1ZTLA 1A3EH 1ELDE 1T4UH 3MU0A 2IOTA 2CV3A 2G52A 4F4OC 4MDSA 1O3AA 1QHRB 3DA9B 3P92A 1P03A 2H9HA 2XCFA 1L1JA 3S9CA 1BBRH 2Y80A 2XW9A 4CHAC 2GZ7A 2JH6D 4ISIH 4NSVA 4JYUH 5C67A 2JETB 1EUFA 2FYRA 1FY1A 5AFZH 3ATMA 1D3TB 4YO9A 4CH2B 1KIGH 5EXNA 2V35A 3F9FA 4CH8B 4LZ4B 4NCYA 3VB3A 1O2PA 1WYKA 1LVOA 1ZMNA 2J38A 3P8GA 4JYTA 2Y7XA 4NSYA 4X1RU 3VXEH 5DP5A 3K6ZA 4Q7ZA 2CF8H 2OLGA 2FLBH 3ZZ7A 2WINI 4TY7A 3LGVA 1MD8A 2AS9A 5EPNA 3SV9A 1C1TA 1GVZA 2P3UB 4U2WA 3NKKA 3SJKA 4KGAA 1DXPA 3DT0H 5C5OA 1HV7A 1S6HA 4IN2A 1PQ7A 3O8BA 1E35B 1O37A 2FTLE 1T31A 3TH4H 2TGTA 1ELEE 1TX7A 1YPHC 1GGDC 2YNAA 1XVMA 4ZKSU 1O32A 2G4TA 2ZGJA 2KAIB 3V3MA 1F0SA 5L30H 1V2JT 3V7TA 1TRNA 4BAMB 2BVRH 1D9IA 3RXDA 3RXLA 2G00A 2O8WA 1K1NA 1GBBA 1FN6A 1FV9A 1YCPH 3AW1A 2P59A 1NT1A 2BB4A 5DP4A 1C9TA 4AX9H 1SFIA 3ZZDA 3KQDA 4ABAA 2M5TA 9LPRA 1C1PA 3ZYEA 4FVBA 3E6PH 4DY7B 1UTMA 5CMXH 3UQVA 4VGCC 4ISOA 4UFDH 3RDZA 1GCTC 4B73A 4ISHH 2BD5A 1MCVA 1LVMA 2Z9JA 3VB4A 5FX6A 2F83A 1V2UT 5A0BA 1MZAA 2GGVB 1CVWH 4YTAA 3T27A 4E05H 1FPHH 2ZCLP 1BHXB 1TBZH 1AB9C 1TGTA 1Y59T 2BZAA 4MNVA 2CXVA 1YP9A 1LPZB 1F2SE 4IMQA 2ODPA 1SGYE 2WPLS 5G4BA 5LH8A 4A92A 4B1TA 3L6PA 4LZ1H 1MQ6A 1HIAA 1WBGB 1Y8TA 2ZU4A 5HYOA 2NWNA 1BTYA 1LQEA 1KXDA 1JWTA 2O8UA 2V3OH 1GI9B 3FP8E 1A0LA 3L3TA 1O3FA 2XBXA 3UNRA 2WPJS 3TJVA 5LGOA 1P04A 3RXJA 7LPRA 1IQMA 2G51A 3RXPA 2BDBA 4Z6AH 2BDGA 4DG4A 4I7YH 1LMWB 2TPIZ 1EPTC 2ZFTA 1ANDA 4B74A 5HM2A 2XNIA 1ELCA 3RXEA 4RN6A 1O5GH 2R2MB 1FN8A 1O2SA 2D1JA 2BLQA 1D3DB 4YOIA 3RC5A 1GJ9B 1DWCH 3MU5A 2ZO3H 3M37A 2C8ZB 1P12E 1QQUA 4K60A 4AFUA 3E8LA 3BTWE 2PUXB 1TLDA 3UNSA 1ANCA 3SJIA 3MOCA 3GISB 1FZZA 4UFFH 1GI0A 2WV5A 1XUJA 1PPCE 5FPSA 2ZFPH 1TFXA 1Z8GA 1GBIA 4D7GA 1AN1E 1DICA 3UNQA 4DJZB 1HB0B 2BDCA 2UWLA 1LDTT 3SGQE 3UWIA 4CRCA 1GDNA 3TGJE 1BOQA 1SHYA 2SNWA 1C5YB 3SNBA 1NY22 2SGQE 4CBOA 3A8AA 3ATLA 4YZUA 3KGPA 3RM0H 1CA0B 3RP2A 3EA7A 3GY7A 1DPOA 1W8BH 3KN2A 3NWUA 4ZHAA 2PFEA 2UWOA 4WXVA 1SQAA 4XSKU 3PO1B 1O2HA 2FO9A 2FX6A 4A5TS 5FBIA 1ARCA 4NIVA 1O3HA 1L4ZA 3RMOH 1DOJA 3ENSB 1WAYB 1EZXC 1QB1A 1EAWA 2OC8A 4X2YA 1MMJN 2ZHDA 2UWPA 3A80A 4U01A 1P3EA 1BRAA 4X0WU 4HFPB 1HAVA 1D3PB 1TE0A 1TWXB 2XCNA 4K1EA 5E2PA 4ABDA 3LOXA 4WY3A 1THRH 3TNTA 1ELVA 3HGNA 2SGAA 3MNSA 1P2KA 4FU7A 1L2EA 4Q7XA 5EQSA 2QV1A 1SI5H 5T6GA 1ELTA 3ATIA 1C2HA 1MBMA 4JZDH 1ZMLA 2HALA 4XBBA 1GHZA 1PQ5A 1DY8A 2PR3A 1NROH 1C1RA 4PROA 4CHAB 4CBNA 3PROA 1A1RA 1HJ9A 3EQ0H 4ABHA 1C5TA 3N7OA 3A81A 1L0ZA 3UIRA 2ZDNA 2P93A 1VGCB 1O3DA 1TQ7B 8LPRA 1Z1JA 1BMAA 1Y3UA 1C1QA 4A7IB 1TOMH 2ZCHP 1PYTC 2ZFQH 4A1TA 2QGRA 3H5CB 1IQGA 4ZAEA 1FQ3A 1A5GH 4AG1A 4NGAH 1P09A 2Z3EA 4GCHG 2BZ6H 4I8GA 4H6SB 4QT8C 1NFYA 2OUAA 2ZDAH 4MNWA 5EG4A 1BT7A 3LDXH 4O03A 5C5NA 1K21H 1O2GH 1OYTH 1N6XA 2CGAA 4KP0A 1AKSB 3GY6A 1O38A 3U8RH 2BX4A 3T62A 4UONA 1GHWH 3PM3A 1NFUA 2AEIH 1F5LA 1GI5A 2Y7ZA 3EYDA 2AMQA 4TY6A 3CS7A 3GY8A 1BITA 3E90B 2XC5A 3ZZ9A 3ATKA 1KTSB 4X8SH 4X1NU 1TIOA 2R0LA 2XWAA 5EW1H 1S82A 4H6TA 1V2KT 2VWNA 3PTBA 3M7QA 1GI2A 1EX3A 1ZSLA 2BVXH 2PHBA 3UWJH 2VH6A 1C2KA 1MTVA 1TX6A 1C1NA 2C90B 4B2AA 1ZTJA 2BXTH 3RUOA 4UDWH 4KELA 1F5KU 1GJ5H 1ZLRA 2Z7FE 1QTFA 2O9QA 4ZKNU 3HK3B 1TQ0B 2AMDA 1VCWA 4B2CA 5FCKA 1O5DH 5TCCA 5C20A 1P06A 1MTWA 3K6YA 1T8NA 2ZTZA 4ESTE 3UQOA 7GCHG 3GICB 3UOPA