2BD9A

Porcine pancreatic elastase complexed with beta-casomorphin-7 and arg-phe at ph 5.0 (50 min soak) and immersed in ph 9 buffer for 28 seconds (2nd ph jump)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase-1
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
molecule tags Hydrolase
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd9A01
2Z3CA 2GD4B 1Z8JB 1Y5UT 2PFEA 4CR5A 1A0JA 1QHRB 1J8AA 4NZQA 4OS2A 1BRAA 4D76A 1GI0A 3MI4A 4Q7YA 1C5QA 5C5OA 3S0NA 1BOQA 1TGNA 1NRPH 1OS8A 1CVWH 3TVJB 1THSH 2D8WA 1XXDA 5TJXA 1LHEH 3UR6A 1NM6A 1EAXA 1E37B 5CHAB 2HPQH 2GMTC 2ZQ1A 3MU1A 1K2I1 3U8TH 1LO6A 1C2FA 5E8EH 2NU2E 1KLTA 4NIXA 1Y3YA 1TBQH 3ZZ4A 4ABIA 3QZRA 3FP6E 4E7RG 2ZTZA 3TIUA 1TMTH 3RXGA 3W95A 3VB5A 3RXBA 1O2RA 2FDAA 1DDJA 5EPNA 3LKWA 1DWCH 2ZHDA 3TJOA 5SGAE 1YPKH 4UFDH 3SNAA 1LPGB 1GVLA 5DPAA 3SJOA 1P2IA 2VIDA 1AFQC 3KIDU 3HK3B 1TGSZ 3A80A 2FP7B 1TLDA 3PLPA 1NN6A 1C5ZB 4NIYA 2BQWB 2J38A 4X8TH 1O2LA 1DT2A 2Z7FE 4WH8A 4ZHAA 1D3PB 4WMDA 1XMNB 2QA9E 1GI7B 1GCDA 2ZA5A 4Q2KA 3SV2H 3UREA 1XUKA 5J4QA 1XXFA 3Q00A 4YM9A 1HRTH 3P8FA 2OD3B 3RMLH 1O2JA 5FBIA 1ESBA 1BRBE 1EAWA 1DM4B 4Y8ZA 1Y5BT 4U30A 2ZU4A 1SB1H 3PMAB 3UOPA 1O3HA 1B5GH 5EW2H 1H8IH 1ELCA 3PO1C 5E0HA 2OXSA 3K65B 2BLVA 1ZPZA 4Y71A 1V2JT 2ALVA 4KELA 1BDAA 1GJ5H 1MKXH 2SFAA 3GCHB 5H4IB 3A8CA 1AMHA 2VNTA 1MKXK 2BD7A 1SOZA 2WYGA 1A3EH 1AD8H 2VIPA 1AB9B 1BHXF 2BD8A 4X2YA 1AVGH 1VGCC 1TPOA 1H4WA 2FLRH 2WV5A 1ZTLA 2AYWA 4BNRA 1GL1A 2GCHF 1QQ4A 4M7GA 4CHAC 1DXWA 4Y6DA 1Q3XA 2I6SA 1TMUH 3A7VA 3TGKE 3S9BA 2IN2A 2OQUA 2BDGA 2AS9A 2QAAA 1HXFH 4UFFH 4X6OA 3PMBB 3TNSA 4Q7XA 1N8OC 3PMHB 3DD2H 4LK4A 1C5WB 1FN6A 1FXYA 5A2MH 3RXHA 1AE5A 4D9QA 1SGTA 3T27A 2ZDVH 1BTYA 1GDNA 1W8BH 2Z3EA 5DKMA 3TK9A 1C1WH 5DK1A 1FAXA 1ANDA 3C27B 1GVKB 1IQGA 1WTHD 2BDBA 1NESE 3M5MA 1SQOA 1AVWA 4ABEA 3SHCH 2P8OC 3ZYDA 2FM2A 1KXBA 3V12A 5L30H 1YYY1 1ELVA 4X1PU 4Z0KA 4AOQA 1XUIA 4D7GA 1BBRE 2WUCA 1ZSLA 5EW1H 3SJIA 2V6NA 1VZQH 3U9AH 1WQVH 2G81E 1GBDA 1J17T 3U69H 4NZLA 4DT7B 1GHZA 1F5KU 3FZDA 3GICB 1ZHRA 1KTSB 1ESAA 3TJUA 1UTMA 4NCYA 2STBE 2VWOA 1ABIH 5A09A 1BTXA 2P95A 1YM0A 2WYJA 1CBWB 5C2ZA 4GCHG 1O2OA 2WV4A 1C5PA 1HBTH 3MH5A 3RC4A 3GOVB 3GY8A 1S6HA 2P93A 5JDUB 1WAYB 2ANMH 4TWWA 2A2QH 1LKAA 2THFB 1CT4E 1O5DH 2F9VA 1PYTD 3UNRA 4BOHA 2BY5X 3DA9B 2W3IA 5AFYH 1EKBB 1S84A 1NT1A 4ISHH 2H2ZA 1UTOA 1SR5C 3LGYA 1V2WT 4ZKSU 2GT8A 1C1MA 2AMDA 4WF8A 1BJUA 1RJXB 1IAUA 2BTCE 2OBQA 1FONA 2FS9A 2ZO3H 2BXUH 3BTKE 2F83A 3VEQB 5T6GA 3Q3XA 2GT7A 2BLQA 3ZZ5A 3W94A 1L4ZA 1ZPCA 3GCTG 5CE1A 4DCDA 1BMMH 1K1OA 1A0LA 1JRTA 4GAWA 3QUMP 4A1XA 2NWNA 5IDKA 4BXSA 1V2RT 1QFKH 3ENSB 4KGAA 5A8ZA 1P57B 1W3CA 1SLWB 1AHTH 2UWLA 1C5XB 3V0XA 4I8KA 2OC1A 4VGCC 5HMAA 2A31A 4CRFA 3E0NB 4XBDA 1HPGA 1M9UA 2SGDE 2CMYA 2WUBA 1SGYE 2FOFA 1EP6A 3PLKA 3AASA 1U6QA 5L6NH 1Y59T 3KEEA 2FLBH 3LC3A 4UFEH 1BMAA 1CHGA 1G32B 3FZZA 1W11U 2W26A 4I7YH 2PUQH 3JZ1B 1C5LH 3MU8A 1BITA 1O2PA 2OUAA 4IMZA 1HJ9A 3BTME 3H7OA 3SU6A 1EZQA 3K2UA 2ZGCA 1ZTJA 1RTKA 1RGQA 2NU1E 1TALA 3QO6A 3UQOA 5CHAC 4D8NA 2G51A 4WXIA 1Z6JH 1O2TA 1TNKA 2UWPA 5JPMH 1P06A 2ZU5A 3TU7H 1SGFA 1OYTH 2ZHWH 5EQQA 1P2JA 4ABAA 4H4FA 4HZHA 1P3EA 3OX7U 1L4DA 1GJ4H 5A8YA 1NFYA 4O03A 2A45B 1C2MA 1O39A 3O8DA 1HGTH 2PGQB 1GI3A 4I8JA 2A5KA 1D6WA 4B2AA 4XOJA 1PPFE 1IQFA 1P0SH 3H5CB 1EASA 2Q6DA 2ZGXH 3LGVA 2NU3E 1SGRE 4X8UH 4Y7BA 1FY5A 2QY0B 2OP9A 4HGCA 4ISNA 1QL8A 2B7DH 4YZUA 1W2KH 5L2YH 1XM1A 2G5VA 3C1KA 5F8TA 1TFXA 1AFQB 4XBCA 3ZZ9A 1GJ8B 3AW0A 2BZ6H 4Q80A 1TQ7B 3BG8A 3F68H 1NU9A 2Z9KA 3KN2A 3TGJE 1EOLA 3O8BA 4IW4E 3UQVA 1SPJA 1HAIH 2TIOA 2WPLS 3A88A 2ZFFH 1HIAA 2ZGHA 1ZMNA 3M3VA 2JH6D 2QIQA 3ZYEA 1WTGH 4F49A 5A8XA 3A7WA 1H9LB 3PROA 3HPTB 4CH2B 5A0AE 7KMEH 1MAXA 2ASUB 1UK4A 1UJ1A 3EA9A 1S0RA 4KTCA 4X1SU 3QWCH 4MNYA 3SUDA 3ZV8A 2ZHEH 5DP9A 4MPVA 8KME2 2RA3A 2BD5A 3A7ZA 3BTQE 1LHGH 1AB9C 1S81A 2P59A 3N7OA 3MMGA 3PMJA 1W7GH 1G3BA 5TCAA 1GGDB 1GI2A 4PROA 6GCHF 1NU7B 2ZI2H 3M35A 1GBHA 1AKSA 1C5VA 3DUXH 4A6LA 2PTNA 1MQ6A 1QA7A 1PQAA 4JZ1A 4FUGA 4X2VA 3ZZ3A 1CT0E 1ELGA 2BDCA 2FYRA 1HFDA 2J95A 1GBLA 3STIA 4BAOB 1ESTA 1JIRA 3B23B 1UK2A 3RXEA 1UCYH 1G36A 1EUFA 1LQEA 1T8NA 3A8BA 1NC6A 3PM3A 1YCPM 1SSXA 2HALA 4YOGA 1UTQA 2AGIX 2PUXB 3LJOA 1O36A 1O3DA 2Z94A 3BTGE 1O3AA 3ZV9A 1SC8U 2BD9A 4B2CA 1K21H 2ZFSA 1YLCA 1ZYOA 3BV9B 1ZLRA 3S69A 3QTOH 3BTDE 1IQNA 2Z9LA 1P09A 4R8TB 5DP5A 2GCTC 3BTWE 1O3GA 3A85A 1HAVB 2GZ8A 2RDLA 2BLOA 5FBEA 1GBBA 4X1NU 1EPTA 1AY6H 1QJ7B 2XBVA 4Y79A 2W7UA 3FAOA 2WINI 3B8JA 1TE0A 1C1RA 5FX6A 3MO9A 1C2DA 1Z8GA 1SHYA 3ZVDA 3OTJE 4CH8B 1D3DB 1D4PB 3ZZ8A 5AF9H 1OP0A 1ANBA 1CBWC 3LIWA 1ZPBA 3OY6U 1ARCA 4ISIH 8GCHG 3VXEH 3E8LA 2ZTXA 1KTTB 1BHXB 3GY2A 4JK6A 1V2LT 1J9CH 1YCPH 3MU5A 1PPEE 5EXMA 2FXRA 2Q1JA 1B7XB 1TNHA 3T29A 2A5AA 4MNXA 2V0BA 1L1GA 5PTPA 2JH5D 3SO3A 2AMQA 1YPMH 3A7YA 4I32A 4DGJA 1FNIA 2C8ZB 3EA7A 1HAHH 4D9RA 3A81A 4K3JA 1DXPA 1HDTH 4JYVH 3SGQE 2W7SA 1Q31A 3E0PB 3Q77A 1ZSJA 2C8XB 2D26C 1QQUA 4UD9H 1TGBA 3U98H 2H5DA 3ZVCA 1O2VA 1IQMA 3BG4B 2HNTC 2F91A 5G4BA 3KF2A 4XFQA 1C5MD 4B2BA 3BTEE 4K5ZA 1CA8B 2V3HH 1SI5H 5FCRA 1T31A 2HVXA 2HRVA 5ABWA 2FIRH 4ASHA 2Y7ZA 3QK1A 3B9FH 1C5UA 1EATA 2HWLB 1B0FA 3TH2H 4Z6AH 4VGCB 1AWFH 2CGAA 4CR9A 1P9SA 5JYIA 4RKJB 4LXBH 5FHTA 2C93B 1F7ZA 3VB7A 4ESTE 3MH7A 1BBRK 3F6UH 1K9OE 1C9PA 3T25A 2ZU3A 3QX5H 3T28A 3MH4A 5AHGH 3ATKA 3LT3A 3U1JB 3A84A 1WUNH 4KKDA 3GISB 2ZCKP 2XBXA 1IHTH 1RIWB 3M5LA 1A46H 2G55A 1QBNA 4ISLA 3U1IB 2P94A 1OWJA 4NFEA 5GCHF 1YGCH 3S9CA 4IC5A 5DP7A 1LMWB 1KXEA 2TBSA 3GDVA 1Z7KA 3A86A 1O3FA 1XVMA 1Y8TA 5C20A 3GCTF 2DE8A 3RP2A 1GHYH 1T32A 1UHBA 3GCNA 1RTFB 1P8VC 1TNJA 3MO6A 1YPJH 1AN1E 4MG3A 3KQBA 2BDAA 3BSQA 1SOTA 3TK6A 2PKSB 3LOXA 3RMMH 3QDZB 2LNCA 2AEIH 2M5TA 1C4Y2 1LHCH 1ANCA 1ZHPA 1O2MA 6LPRA 1MTSA 1C5TA 1ZOMA 2ZCLP 5IYTA 3V3MA 2VVCA 3D49H 3QGJA 3F1SB 3SU3A 5JBBS 2SNWA 5K7RA 1BUIA 4FUJA 1ETTH 3ZVFA 5ETXA 1FY3A 1F5LA 1ETRH 1CHOF 1YP9A 3GY3A 1DE7H 1X7AC 4X2WA 1LTOA 3ZZ6A 2ZP0H 1EZUC 1IQJA 3SJKA 5FX5A 3ZVBA 4AYVB 3SUGA 4BAHB 1BA8B 2A7JA 1N1LA 5EQSA 3SI4H 4Y0ZE 1YPLH 3SOSA 5HM9A 4CRAA 2ZF0H 2FOCA 2Q6FA 1P04A 2B5TB 3MYWA 4GHTA 2VWMA 1ZZZA 3FANA 3ITIA 4WVPE 1Z1IA 2FOGA 3LGUA 3UNQA 1AE8H 5FPTA 4ZROA 1F92A 2YNAA 3T26A 1SGEE 4MNVA 1TONA 1C9TA 1QURH 2P3TB 1O37A 4MPXA 1FV9A 1O34A 3M5NA 1GMCF 1P03A 4CRCA 1GGDC 4ZMAH 1HJ8A 1LKBA 3RC5A 2CF9H 1SMFE 3ODFA 1ZJKA 2ZWLH 1K1IA 2KAIB 2PGBB 2RA0A 1S0QA 1YKTA 3BN9A 3RXMA 3V13A 2XYAA 3S7KB 2NU0E 5FCKA 5T6FA 2XRCA 3RC6A 1GVZA 2OLGA 4FU7A 1A5IA 3TK5A 2IPHA 4DVAU 3PTBA 2BYAX 1F5RA 4MQAA 1H1BA 2O8MA 2ZGJA 3ZZDA 4B1TA 5EU8A 2O8UA 3HGPA 1T8MA 3P8OA 2Z6BD 4IS5A 1ETSH 4FVDA 1IQEA 1YLDA 1AVXA 2EI7A 4NIWA 2ZFRH 3S7HB 1SGDE 5JB8S 3BF6H 1KXAA 2HNTE 4HI3A 1DICA 1JWTA 5DJ7A 1NZQH 1K1LA 4FU8A 3ATIA 3KL6A 1MKWK 1TNIA 4ZKOU 3RXRA 1ORFA 1HUTH 1DWDH 1HAZB 1O3NA 2XCNA 1OWHA 3RXJA 5JB9S 2OC7A 3NK8A 1PJPA 4MNWA 2BZAA 4FUFA 1DX5M 4I33A 2GCTB 4E05H 4HFPB 3KQCA 1JOUB 3ZVGA 1MTWA 2G00A 4NGAH 2YOLA 3MTYA 3SW2B 4ZXYH 2G4TA 2ZTYA 3UY9A 3QZQA 1K1JA 4K69A 1O31A 1AWHB 1EQ9A 3MFJA 3VGCB 1GBEA 1L1NA 2BQ6B 3LPRA 4UEHH 3SV6A 1SL3A 3SV7A 3GCOA 1E38B 2UUFB 3K9XB 4WJG2 1NFXA 1BIOA 3SGBE 4AFSA 3MO3A 1GI8B 5EGMA 1MH0A 4B73A 1OOKB 1GBFA 4F4OC 3M37A 1O5EH 4K8BA 1O2ZA 4WXVA 2GTBA 1EP5A 3O8RA 2D2DA 9ESTA 3TGIE 1HCGA 2PSYA 2XBWA 1IQLA 1EB2A 1MTNB 1EJMA 1TMBH 5HXFA 3U8OH 1O3MA 1QB9A 3R3GB 4JK5A 1V2NT 1O38A 1TYNA 2BVXH 2VU8E 2ZFPH 1HJAB 1P11E 2VH0A 2FEQH 4DIHH 2OQ5A 1JRSA 1SVPA 2OC8A 2TGDA 2ZDAH 1GDQA 1KY9A 1A5GH 3BG4C 3BIVH 7GCHG 2O8WA 3OY5U 2UUJB 3SORA 1C1SA 3IITA 1SBWA 4J2YB 3SJ8A 1YPGH 2A7CA 3CS0A 4DG4A 1V2ST 4KTUA 2AIQA 1Q2WA 4OS4A 1GG6B 1EAUA 1EZSC 2GV6A 2BD4A 1W13U 3RU4T 2BMGB 3GY6A 4U2WA 1ELFA 4CBNA 1EXFA 1N6XA 3RDZA 1P02A 4ABBA 4H42U 5C1UA 3TLOA 1AZZA 5C1YA 4I8GA 4Y76A 7ESTE 4AX9H 1OP2A 2H6MA 4ZKRU 1L2EA 1V2TT 3AVZA 1O3CA 1EZXC 3SJ9A 3M5OA 4JZIA 4YO9A 3UNSA 4OGXA 2C90B 4NG9H 3OYPA 3ATWA 4YOJA 4SGBE 2WPJS 1GHBF 1CE5A 1GBIA 2D1JA 1GMHF 2PTCE 1KLJH 2VJ1A 1RIWC 4A1VA 2R3YA 1GJCB 1IOEA 4UE7H 3I78A 2FTMA 3SNBA 1KLIH 3MU0A 3ZZAA 1QR3E 2PKAB 3F9FA 2C8WB 3LONA 1TX8A 2FOMB 1C1PA 1VJAU 3L6PA 4K1EA 3UWJH 1UVTH 3ZVEA 1IQIA 2VWNA 6CHAB 4INKA 1WU1A 1XKBC 1ELDE 1UVPA 3EE0B 4NWKA 3UWIA 4NWLA 1P01A 2PKSC 1QCPA 4A92A 2QN5T 1TAWA 2OBOA 2ZQ2A 5I46H 3A87A 3FFGA 2G52A 4WWYA 3UTUH 1MBQA 1A2CH 2QF0A 2I6QA 1MU6B 2ZCHP 3KQEA 4XE4A 4GLYA 1FN8A 4GUXA 2BX4A 1GWAA 3GY7A 4YTAA 1HAGE 1SG8B 1T8OA 2DUCA 2FI3E 3CS7A 4MDSA 1FJSA 3UR9A 4X8SH 3NZIA 1C5NH 2XBYA 3SU5A 1TRNA 3SV8A 1GDUA 1O3KA 1AZ8A 1HAYB 3VB4A 4CRGA 1C1NA 2B9LA 3G01A 3OU0A 5FPYA 2FOAA 1WV7H 1QTFA 2ULLA 1LCYA 2AERH 4FUBA 1RTLA 1A4WH 3MNXA 3PV4A 1KXFA 2ZEBA 2GCHG 2ZPRA 1TQ0B 2A4RA 4E7NA 1L0ZA 3NUMA 5EODA 4ZHMU 1QJ1B 1RRKA 3L33A 2BM2A 1T4UH 2XTTB 1PQ8A 4X2XA 1TPAE 3A7XA 3I29A 3P70B 1XUFA 1QRWA 4Y11E 1G3EA 8LPRA 2RG3A 1OYQA 4J1YA 4Y8YA 1EX3A 2SGEE 1GI9B 5LPEA 1AIXH 5DP3A 1O30A 4DURA 1LQDB 1GJBB 2A7HA 3MNSA 1MUEB 1C2IA 2DE9A 3GDSA 5ESBA 5HYOA 1OWDA 2BDHA 2VB0A 3GYLB 2BX3A 1FIZA 3SHAH 4BTTB 3ATLA 1V6DA 4Y7AA 3RXCA 2OINA 4X6PA 5ESTE 1MAYA 5E0GA 3LC5A 1LPKB 1Y3WA 2BXTH 1SLXB 2VIWA 2UUYA 3S9AA 2BQ7B 3AW1A 2QF3A 4ZXXH 1V2PT 3BTTE 2EI8A 1D3QB 2SNVA 1NS3A 2EA3A 5JBCS 1C5YB 1GPZA 1SQAA 1INCA 3LGTA 3P17H 2A32A 1BTZA 1TBRH 4IN1A 1ID5H 1S5SA 1O2SA 3A8DA 5DG6A 3VPKA 4Y0YE 2FYQA 1KYNA 1UMAH 1QB1A 3MNBA 1BTPA 4ZHLU 2R9PA 2BB4A 1SGQE 3E1XB 1SGPE 2A4GA 1BTHH 3E91A 1DFPA 2PSXA 1WYKA 2QXGA 1SFIA 5C3NA 2GX4A 2FPZA 4OS1A 4XDEA 1PPHE 2EI6A 2R3UA 1W10U 1FY8E 4BTIB 1ELAA 2G8TA 1QJ6B 3VGCC 3RXDA 1PPBH 3RMOH 4B71A 1SLVB 1BB0B 5E2OA 1O3OA 1Z1JA 1O3LA 2VWLA 1MD7A 3SU4A 3D23A 1QL7A 4NIVA 1O2XA 2VIQA 1H9IE 1O35A 3P8NA 4OS7A 2JKHA 4FUHA 4WY3A 1TGTA 1PPZA 1C2HA 2ANWA 1ELTA 1DVAH 4ZH8A 1W12U 4ZKNU 1PYTC 1ZMLA 5A0BA 1BMLA 5DO4H 1YPHC 1MZDA 3MHWU 1UTPA 3ODDA 2AMPA 4A7IB 1MTNC 1ZTKA 1MZAA 1EAIA 1HAOH 4AYYB 3PB1E 1W14U 2AGEX 3SQEE 3A89A 1O2HA 2B8OH 2Y6TA 4O3TA 1HJAC 4ZAEA 1G30B 3VB3A 1T7CA 2ZHQH 1Z8RA 2SGQE 3TNTA 3KHVA 1MTVA 2ZG0H 4INHA 1FQ3A 1RS0A 2BD2A 3P92A 1DSUA 1BCUH 1GMDG 1OXGA 1DOJA 1ARBA 1THPB 2XWBI 2PKAA 2Y5FA 1CQQA 3RMNH 1LHFH 1GG6C 2TRMA 1O3EA 2PR3A 2A2XH 2XC5A 1S83A 3D65E 2EC9H 1N6YA 3EYDA 5DP8A 2ZDKA 1F0SA 4R0IA 3RU4D 1OP8A 5F8ZA 1JXPA 1DANH 1OKXA 1TRYA 1W0YH 4A1TA 4GCHF 4WH6A 2Y82A 3URCA 4THNH 5E0JA 3JZ2B 1GHAG 1P05A 2VGCB 1QBVH 1BBRH 4NFFA 2GDEH 4FU9A 3DT0H 4H6TA 1JBUH 2R2MB 5JBAS 2ZIQH 3SNEA 3L3TA 5CMXH 1CO7E 1O5CB 3R0FA 3RXVA 1F0TA 5E2PA 1H8DH 1NROH 2FESH 2LPRA 1P10A 2G4UA 3T2NA 1KIGH 1Z8IB 5AVDA 1LHDH 1O2YA 3BIUH 1HLTH 3QTVH 2R0LA 6CHAC 7GCHF 1GHXH 9LPRA 1C5OH 4IBLH 1ABJH 1TGCA 4ABHA 1A7SA 2R0KA 1DLEA 2ZDLA 1JMOH 2J2UA 3Q76A 4E06H 3RXAA 1K1MA 1BTUA 1GHVH 5C5NA 1VITG 1O5FH 2H1UA 2ZNKH 1A5HA 3ZVAA 3TJNA 1WQSA 3FP8E 3TH4H 1EJAA 1TOMH 2J94A 1H9HE 4AGKA 4ZUHA 3KCGH 1NY22 4K60A 1XKAC 3SNDA 2BY8X 2WPMS 1QRXA 3RXIA 1LDTT 1HYLA 4DOQA 3BEFB 4U01A 1F0RA 2AH4X 1S85A 2PHBA 3IG6B 4SGAE 8ESTE 1OPHB 5F03A 1F2SE 1UCYE 1GBAA 1K1NA 2CN0H 2A1DB 3ELAH 1IQKA 1O2WA 4TY7A 1HNEE 4XSKU 4WMFA 1CGJE 3A7TA 2QCYA 1DLKB 2J4IA 5C1XA 1AUTC 3ZZBA 6GCHG 1TA2A 2JH0D 1GBMA 4LZ1H 3QGNB 3MH6A 3RM2H 4NSYA 1C2GA 1FAKH 2VVVA 1ZHMA 4OS5A 2ZPSA 4CRBA 1FUJA 4FXGH 4BTUB 1CA0B 2BDIA 2OCVB 3KGPA 1NRQH 2GKVE 3QN7A 1D9IA 5GIBA 1D6RA 3UUZA 1FPCH 1P2MA 1WSSH 1CT2E 3PWCA 1GHWH 1FIWA 5DP6A 2O8TA 2ZPQA 7LPRA 3FVFB 2W5EA 1C2KA 1V2OT 1K28D 2Y7XA 1FZZA 1T8LA 2V35A 3MWIU 1P2KA 4YOIA 1HAVA 1GI6A 1O5AB 3HKJB 2PW8H 1YPHE 3MU4A 2FOBA 1HAXB 1Y3VA 1PPGE 3CENA 1XUGA 1KXCA 1TOCB 1JIMA 3F9GA 2ZC9H 4I8HA 2F3CE 1Y5AT 2FTLE 1O33A 5BRRE 3O8CA 3GY5A 1KSNA 2XCFA 2Y5GA 2CXVA 3K6YA 1C2EA 4BAQB 1E34B 3AAUA 4WMEA 4FUEA 4NA8A 1QNJA 1DSTA 3RXKA 1P2OA 1O3BA 3LH3A 1DUEA 4LOYH 3NXPA 1WOFA 1E0FD 1GBJA 3DFLA 1FI8A 1PQ7A 5EXNA 3H7TA 4MPWA 4AFQA 4I8LA 1T4VH 1TNGA 5K0HA 3HATH 2P3FH 1J15A 4KTSA 2ZFQH 1PFXC 3V7TA 1O2QA 1MKWH 3SGAE 1W0ZU 4GVUA 4DIIH 1B0EA 1KXDA 1W7XH 1HIAB 2NU4E 1LVMA 2XWAA 2TGAA 4ABGA 1WBGB 4H6SB 1V2VT 2Z3DA 4A5TS 1OX1A 2FOHA 2VVUA 3MOCA 1GCTB 3LU9B 3LGIA 1S6FA 2ZU1A 2BHGA 1TABE 1TRMA 3M3TA 2AFQB 2ODYB 1P3CA 4K2YA 3SUFA 5EQRA 4TWYA 4O9VA 2BLWA 2CHAB 2A4QA 2FOEA 4GSOA 4DY7B 3TH3H 1CU1A 1XX9A 2Z9GA 3E16B 3RUOA 2W3KA 1HAPH 1O3IA 3SI3H 2J92A 1AKSB 4KP0A 1VJ9U 3KNXA 5T6DA 3GDUA 3URDA 1PQ5A 1FLEE 1OWKA 1TA6A 4X8VH 1FDPA 1V2MT 2QXHA 4YLQH 2A0QB 5GPIB 1NFUA 4ISOA 5HM2A 5FXLA 5B6OA 4LZ4B 2OTVA 3HKIB 1NO9H 3NPSA 1CGIE 2WPIS 1E36B 4JYUH 1Z71A 1MD8A 3EQ0H 2QGRA 4FUIA 2GDDA 3M36A 3NWUA 2ZGBH 3LGWA 3RXTA 1UVUH 2ZDMA 5GJ4B 1E35B 1ZGVA 2GZ7A 2Z9IA 1GJAB 5DGJA 3SNCA 3DFJA 3UOUA 1XUJA 3SQHE 1GI1A 3EGKH 1A61H 2BY6X 2BDYA 2TGTA 1O2NA 2XW9A 4MLFB 2F9OA 1J14A 3RXPA 1C1VH 2J9NA 2IJOB 2EEKA 1EPTB 1QA0A 1UO6A 2FI5E 2JETB 5HGGA 5GCHG 4O3UA 1K1PA 2Y81A 1OWEA 4BANB 2QC2A 3TJVA 3ZZ7A 3E90B 1YPEH 1QY6A 1GI4A 2VGCC 4AG1A 1C1UH 2BY9X 8GCHF 4YT7H 2ZKSA 4OGYA 2F9NA 1C1TA 4AZ2B 1V3XA 2ZU2A 4JZDH 2GZ9A 3M3SA 1KDQB 1G37A 3HK6B 1EJNA 2FMJA 2PLXA 1O0DH 1NPMA 1J16A 1BQYA 2ANKH 1MCVA 2BOHB 1O3JA 2HPPH 2XNIA 4TYDA 2G5NA 1C1QA 1TPPA 3F9HA 1MMJN 1XUHA 2CJIA 2O9QA 2GGVB 1UVSH 1DY9A 3BEIB 4UFGH 1ZMJA 2A4OA 1UTLM 1CHOG 3FP7E 1LVBA 3DHKH 1GMDF 2YNBA 4JZEH 2FS8A 2UUKB 1P12E 3Q3YA 1GJ6A 4IN2A 1UTNA 1O32A 1OSSA 3A82A 2HOBA 4MVNA 2Y80A 4BAMB 3GY4A 2VH6A 1A0HB 4MTBA 1TB6H 3TPIZ 1THRH 2VINA 1ZJDA 1O2IA 1D3TB 3STJA 2BVSH 1TIOA 2GMTB 1O2UA 1GHAF 3PWBA 2XXLA 2A5IA 1MU8B 1ZRKA 3LJJA 1RD3B 2F9UA 1SGNE 1VR1H 2RCEA 3A8AA 3SBKA 1C2JA 4IGDA 2H9TH 2FX6A 2ANYA 1QGFA 1G9IE 2SGPE 2KAIA 1UTJA 4DJZB 2F9BH 1GMCG 2ILNA 1A1RA 2P3UB 1ZSKA 2C8YB 5JBTA 5LGOA 1UTKA 3ATMA 2ZZUH 5GXPA 1C2LA 5LH8A 2K1QA 3E6PH 4TPIZ 5I25A 1A3BH 1HB0B 2XC0A 2HLCA 4X6MA 3RXQA 4BAKB 4ABDA 2SGFE 4RKOB 4B76A 2UWOA 5GWZA 3U8RH 3I77A 2ODQA 1EB1H 1P2QA 1CA0C 2XC4A 3RXSA 2FWWA 1HXEH 2B0FA 1GJ9B 1SQTA 2FO9A 2ODPA 4AFUA 2GP9B 3SU2A 3A83A 1DPOA 4IC6A 4AB9A 2BD3A 5FPSA 5BPEA 4OS6A 1VITF 4JYTA 4K1SA 2VIOA 1AI8H 1C5SA 4GPGA 1RFNA 4I31A 5T3HA 1AUJA 1UHBB 1UVOA 1VCPA 3SU1A 4AGJA 1SLUB 3E3TA 6ESTA 5F8XA 3OSYA 3EAJA 2TGPZ 1LVOA 1MTUA 4JCNA 1ELBA 5TCCA 1AFEH 1NTPA 1MQ5A 4INLA 3PO1B 3GCHC 3SZNA 5J4SA 3CP7A 2WPHS 3SV9A 1G3CA 3NKKA 4CREA 1SFQB 3K6ZA 1ACBE 3SUEA 3ZZCA 4ABFA 3KQDA 1DY8A 2J34A 1DITH 1ZGIA 1ZRBA 1DWBH 1O5BB 1FPHH 4ABJA 2FX4A 2PWXA 1Y3XA 5A0CA 3T62A 1AGJA 3T5FH 1DS2E 3HGNA 3M7QA 3ESTA 3VXFH 1C1OA 5FAHA 5EPYA 5LPRA 1P2NA 1VGCB 1SGCA 1FY1A 1VCWA 2IOTA 1O2GH 4GHQA 2GV7A 1O2KA 3P6ZB 1BT7A 3GYMA 5EOKA 2V3OH 4AN7A 3IWMA 4UONA 4CHAB 2SGAA 1LPZB 3TITA 1WCZA 4U32A 5AFZH 1BTWA 4K1TA 3RU4E 4AORA 4AB8A 4UDWH 5DP4A 5EXLA 1GJ7B 1TPSA 1GCTC 4JZFH 1TX7A 1N8OB 1VCQA 4DW2U 1YF4A 4YLUA 4Q7ZA 4BXWA 1HV7A 1GBCA 1VITH 1V2KT 1UCYK 1OWIA 2Q6GA 1GBKA 1C5RA 3RLYH 4NA9H 4D7FA 2ZECA 1QBOA 2FI4E 3D62A 3F9EA 1DUAA 3LDXH 2HNTF 2CHAC 3M61U 3BTHE 1FY4A 4FUCA 1AU8A 3P95A 1G2LA 2R2WU 1DWEH 2F9PA 1K22H 2P8OB 1QRZA 1GI5A 2P16A 4O97A 4QT8C 3BEUA 1IHSH 1RXPA 5EG4A 2PV9B 1NRSH 1Z6EA 4XBBA 5C67A 1C4V2 1QL9A 1P9UA 1F0UA 1YBWA 4YT6H 3PTNA 2STAE 3RXUA 1BRCE 1SHHB 2HGTH 3SU0A 4X6NA 2Z9JA 5LPFA 3MNCA 3EA8A 1BZXE 3AAVA 4AFZA 3EDXB 2VIVA 1QIXB 4IMQA 1XVOA 2C4FH 4CBOA 2ESTE 1V2UT 1BMNH 1IQHA 3Q3KA 1PPCE 4Y10E 4NSVA 1KDQA 2OC0A 3LH1A 3M7TA 3VFEA 1G3DA 2ZFTA 4FVBA 2CV3A 1ELEE 1SGIB 1UK3A 2ALPA 2QYIA 2H5CA 4RSPA 4YESB 1TWXB 1NRNH 2CF8H 1CGHA 3WY8A 3RXLA 2QXJA 3P8GA 4K8YA 1MCTA 1YCPK 1GHBG 3M7UA 2C3SA 3PYHA 4X1QU 4X0WU 1GMHG 1ZR0A 1QB6A 4AG2A 1EPTC 2BY7X 1AO5A 4B74A 3RXOA 3UIRA 2H9HA 1SGFG 2JETC 3UFAA 4JMYA 2GVFA 1S82A 2QXIA 2WPKS 3VB6A 4MPUA 1GBTA 1TNLA 4CRDA 3RM0H 1GL0E 3PLBA 2Y5HA 3SN8A 1CSOE 1NRRH 1TBZH 1GJDB 2AIPA 2BVRH 1O3PB 3QLPH 5F6MA 1ANEA 4Y8XA 2AGGX 5GDSH 1YC0A 4FUDA 1BJVA 2BOKA 2ZHFH 4NA7A 1C4U2 5L2ZH 1O5GH 1FMGA 1G2MA 2O8LA 1NFWA 3RXFA 1V2QT 4B75A 3NCLA 1L1JA 1AQ7A 4TPYA 2H9EH 1BRUP 1EOJA 4RN6A 1TX6A 1Y3UA 3UPEA 1LVYA 2FZZA 1MBMA 4TY6A 3BTFE 2QV1A 2ZDNA 3RLWH 4X1RU 2FODA 4HTCH 2TPIZ
chains in the Genus database with same CATH superfamily
2Z3CA 2GD4B 1Z8JB 1Y5UT 2PFEA 4CR5A 3DSOA 1A0JA 1QHRB 1J8AA 4NZQA 4OS2A 1BRAA 4D76A 1GI0A 3MI4A 4Q7YA 1C5QA 5C5OA 3S0NA 1BOQA 1TGNA 1NRPH 1OS8A 1CVWH 3TVJB 1THSH 2D8WA 1XXDA 5TJXA 1LHEH 3UR6A 1NM6A 1EAXA 1E37B 5CHAB 2HPQH 2GMTC 2ZQ1A 3MU1A 1K2I1 3U8TH 1LO6A 1C2FA 5E8EH 2NU2E 1KLTA 4NIXA 1Y3YA 1TBQH 3ZZ4A 4ABIA 3QZRA 3FP6E 4E7RG 2ZTZA 3TIUA 1TMTH 3RXGA 3W95A 3VB5A 3RXBA 1O2RA 2FDAA 3PRDA 1DDJA 5EPNA 3LKWA 1DWCH 2ZHDA 3TJOA 5SGAE 1YPKH 4UFDH 3SNAA 1LPGB 1GVLA 5DPAA 3SJOA 1P2IA 2VIDA 1AFQC 4TT3D 3KIDU 3HK3B 1TGSZ 3A80A 2FP7B 1TLDA 3PLPA 1NN6A 1C5ZB 4NIYA 2BQWB 2J38A 4X8TH 2OK5A 1O2LA 1DT2A 2Z7FE 4WH8A 4ZHAA 1D3PB 4WMDA 1XMNB 2QA9E 1GI7B 1GCDA 2ZA5A 4Q2KA 3SV2H 3UREA 1XUKA 5J4QA 1XXFA 3Q00A 4YM9A 1HRTH 3P8FA 2OD3B 3RMLH 1O2JA 5FBIA 2RDEA 1ESBA 1BRBE 1EAWA 1DM4B 4Y8ZA 1Y5BT 4U30A 3WWFA 2ZU4A 1SB1H 3PMAB 3UOPA 1O3HA 1B5GH 5EW2H 2V7QD 1H8IH 1ELCA 3PO1C 5E0HA 2OXSA 3K65B 2BLVA 1ZPZA 2QF5A 4Y71A 1V2JT 2ALVA 4KELA 1BDAA 1GJ5H 1MKXH 2SFAA 3GCHB 5H4IB 3A8CA 1AMHA 3GS9A 2VNTA 1MKXK 2BD7A 1SOZA 2WYGA 1A3EH 1AD8H 2VIPA 1AB9B 1BHXF 2BD8A 4X2YA 1AVGH 1VGCC 1TPOA 1H4WA 2FLRH 2WV5A 2XOKD 1ZTLA 2AYWA 4BNRA 1GL1A 2GCHF 1QQ4A 4M7GA 4CHAC 1DXWA 3PRBA 4Y6DA 1Q3XA 2I6SA 1TMUH 3A7VA 3TGKE 3S9BA 2IN2A 2OQUA 2BDGA 2AS9A 2QAAA 1HXFH 4UFFH 4X6OA 3PMBB 3TNSA 4Q7XA 1N8OC 3PMHB 3DD2H 4LK4A 1C5WB 1FN6A 1FXYA 5A2MH 3RXHA 2KM0A 1AE5A 4D9QA 1SGTA 3T27A 2ZDVH 1BTYA 1GDNA 1W8BH 2Z3EA 5DKMA 3TK9A 1C1WH 5DK1A 1FAXA 1ANDA 3C27B 1GVKB 1IQGA 1WTHD 2BDBA 1NESE 3M5MA 1SQOA 3SYJA 1AVWA 3VG8A 4ABEA 3SHCH 2P8OC 3ZYDA 2FM2A 1KXBA 3V12A 5L30H 1YYY1 1ELVA 4X1PU 3F2GA 4Z0KA 1XUIA 4AOQA 4D7GA 1BBRE 2WUCA 1ZSLA 5EW1H 3SJIA 2V6NA 1VZQH 3U9AH 1WQVH 2G81E 1GBDA 1J17T 3U69H 4NZLA 4DT7B 1GHZA 1F5KU 1NBMD 3FZDA 3GICB 1ZHRA 1KTSB 1ESAA 3TJUA 1UTMA 4NCYA 2STBE 2VWOA 1ABIH 5A09A 2L74A 1BTXA 2P95A 1YM0A 2WYJA 1CBWB 5C2ZA 4GCHG 1O2OA 2WV4A 1C5PA 1HBTH 1YLNA 3MH5A 3RC4A 3GOVB 3GY8A 1S6HA 2P93A 4F48B 5JDUB 1WAYB 2ANMH 4TWWA 2A2QH 1LKAA 2THFB 1CT4E 1O5DH 2F9VA 1PYTD 4OM9A 3UNRA 4BOHA 2BY5X 3DA9B 2W3IA 5AFYH 1EKBB 1S84A 1NT1A 4ISHH 2H2ZA 2WZQA 1UTOA 1SR5C 3LGYA 1V2WT 4ZKSU 2GT8A 1C1MA 2AMDA 4WF8A 1BJUA 1RJXB 1IAUA 2BTCE 2OBQA 1FONA 4XD7D 2FS9A 2ZO3H 2BXUH 3BTKE 2F83A 3VEQB 5T6GA 5B6LA 3Q3XA 2GT7A 2BLQA 3ZZ5A 3W94A 2YMSC 1L4ZA 1ZPCA 3GCTG 5CE1A 4DCDA 1BMMH 1K1OA 1A0LA 1JRTA 4GAWA 3QUMP 4A1XA 2NWNA 5IDKA 4BXSA 1V2RT 1QFKH 3ENSB 4KGAA 5A8ZA 1P57B 1W3CA 1SLWB 4Q63A 1AHTH 2UWLA 1C5XB 3V0XA 4I8KA 2OC1A 4VGCC 5HMAA 2A31A 4CRFA 3E0NB 4XBDA 1HPGA 1M9UA 2SGDE 2CMYA 2WUBA 1SGYE 2F4LA 2FOFA 1EP6A 3PLKA 3AASA 1U6QA 3N7EA 5L6NH 1Y59T 3KEEA 2FLBH 3LC3A 4UFEH 1BMAA 1CHGA 1G32B 3FZZA 1W11U 2W26A 4I7YH 2PUQH 3JZ1B 1C5LH 3MU8A 1BITA 1O2PA 2OUAA 4IMZA 1HJ9A 3BTME 3H7OA 3SU6A 1EZQA 3SZEA 3K2UA 2ZGCA 1ZTJA 1RTKA 1RGQA 2NU1E 1TALA 3QO6A 3UQOA 5CHAC 4D8NA 2G51A 4WXIA 1Z6JH 1O2TA 2AHME 1TNKA 2UWPA 5JPMH 1P06A 2ZU5A 3TU7H 1SGFA 1OYTH 2ZHWH 5EQQA 1P2JA 4ABAA 4H4FA 4HZHA 1P3EA 3OX7U 1L4DA 1GJ4H 5T1VA 5A8YA 1NFYA 4O03A 2A45B 1C2MA 1O39A 3O8DA 1HGTH 2PGQB 1GI3A 4I8JA 4FOUC 2A5KA 1D6WA 4B2AA 4XOJA 1PPFE 1IQFA 1P0SH 3H5CB 1EASA 2Q6DA 2ZGXH 3LGVA 2NU3E 1SGRE 4X8UH 4Y7BA 1FY5A 3N7DA 2QY0B 2OP9A 4HGCA 4ISNA 1QL8A 2B7DH 4YZUA 1W2KH 5L2YH 1XM1A 2G5VA 4ZCNA 3C1KA 5F8TA 1TFXA 1AFQB 4F55A 4XBCA 3DSPA 3ZZ9A 1GJ8B 3AW0A 2BZ6H 4Q80A 1TQ7B 3BG8A 3F68H 5CDFE 1NU9A 2Z9KA 3KN2A 3TGJE 1EOLA 3O8BA 4IW4E 3UQVA 1SPJA 1HAIH 2TIOA 2WPLS 3A88A 2ZFFH 1HIAA 2ZGHA 1ZMNA 3M3VA 2IPQX 2JH6D 2QIQA 3ZYEA 1WTGH 4F49A 5A8XA 3A7WA 1H9LB 3PROA 3HPTB 4CH2B 5A0AE 7KMEH 1MAXA 2ASUB 1UK4A 1UJ1A 3EA9A 1S0RA 4KTCA 4X1SU 3QWCH 4MNYA 3SUDA 3ZV8A 2ZHEH 5DP9A 4MPVA 8KME2 5DSFA 2RA3A 2BD5A 3A7ZA 3BTQE 1LHGH 1AB9C 1S81A 2P59A 3N7OA 3MMGA 3PMJA 1W7GH 1G3BA 1UW7A 5TCAA 1GGDB 2J98B 1GI2A 4PROA 6GCHF 1NU7B 2ZI2H 3M35A 1GBHA 1AKSA 1C5VA 3DUXH 4A6LA 2PTNA 1MQ6A 1QA7A 1PQAA 4JZ1A 1W0JD 4FUGA 5EJLA 4X2VA 3ZZ3A 1CT0E 1ELGA 2BDCA 2FYRA 1HFDA 2J95A 1GBLA 3STIA 4BAOB 1ESTA 1JIRA 3B23B 1UK2A 3RXEA 1UCYH 1G36A 3F0PA 1EUFA 1LQEA 1T8NA 3A8BA 1NC6A 3PM3A 1YCPM 1SSXA 2HALA 4YOGA 1UTQA 2AGIX 2PUXB 4B6FA 3LJOA 1O36A 1O3DA 2Z94A 3BTGE 1O3AA 3ZV9A 1SC8U 2BD9A 4B2CA 1K21H 2ZFSA 1YLCA 1ZYOA 3BV9B 1ZLRA 3S69A 3QTOH 3BTDE 5HIYA 1IQNA 2Z9LA 5DN6D 1P09A 4R8TB 5DP5A 2GCTC 3BTWE 3MQKC 1O3GA 3A85A 1HAVB 2GZ8A 2RDLA 2BLOA 5FBEA 1GBBA 4X1NU 1EPTA 1AY6H 1QJ7B 2XBVA 4Y79A 2W7UA 3FAOA 2WINI 3B8JA 1TE0A 1C1RA 5FX6A 3MO9A 1C2DA 1Z8GA 1SHYA 3ZVDA 3OTJE 4CH8B 1D3DB 1D4PB 3ZZ8A 5AF9H 1OP0A 1ANBA 1MABB 1CBWC 3LIWA 1ZPBA 3OY6U 3OE7D 1ARCA 4Q4LA 4ISIH 8GCHG 3VXEH 3E8LA 2ZTXA 1KTTB 1BHXB 3GY2A 4JK6A 1V2LT 1J9CH 1YCPH 3MU5A 1PPEE 5EXMA 2FXRA 2Q1JA 1B7XB 1EFRD 1TNHA 3T29A 2A5AA 4MNXA 2V0BA 1L1GA 5PTPA 2JH5D 3SO3A 2AMQA 1YPMH 3A7YA 4I32A 4DGJA 1FNIA 2C8ZB 3EA7A 1HAHH 4D9RA 3A81A 4K3JA 1DXPA 1HDTH 4JYVH 3SGQE 2W7SA 1Q31A 3E0PB 3Q77A 1ZSJA 2C8XB 2D26C 1QQUA 4UD9H 1TGBA 3U98H 2H5DA 3ZVCA 1O2VA 1IQMA 2CK3D 3BG4B 2HNTC 2F91A 5G4BA 3KF2A 4XFQA 1C5MD 4B2BA 5EIYA 2YMSB 3BTEE 4K5ZA 1CA8B 2V3HH 1SI5H 5FCRA 2KCOA 1T31A 2HVXA 2HRVA 5ABWA 2FIRH 4ACBA 4ASHA 2Y7ZA 3QK1A 3B9FH 1C5UA 1EATA 2HWLB 3UB0A 1B0FA 3TH2H 4Z6AH 4VGCB 1AWFH 2CGAA 4CR9A 1P9SA 5JYIA 4RKJB 4LXBH 5FHTA 2C93B 1F7ZA 3VB7A 4ESTE 3MH7A 1BBRK 3F6UH 1K9OE 1C9PA 3T25A 2KR7A 2ZU3A 3QX5H 3T28A 3MH4A 5AHGH 3ATKA 3LT3A 3U1JB 3A84A 1WUNH 4KKDA 3GISB 2ZCKP 2XBXA 1IHTH 1RIWB 3M5LA 1A46H 2G55A 1QBNA 4ISLA 3U1IB 2P94A 1OWJA 4RI0A 4NFEA 5GCHF 1YGCH 3S9CA 4IC5A 5DP7A 1LMWB 1KXEA 3H09A 2TBSA 3GDVA 1Z7KA 3A86A 1O3FA 1XVMA 1Y8TA 5C20A 3GCTF 2DE8A 3RP2A 1GHYH 1T32A 1UHBA 2KCAA 1RTFB 1P8VC 1TNJA 3GCNA 3MO6A 1YPJH 1AN1E 4MG3A 3KQBA 2BDAA 3BSQA 1SOTA 3TK6A 2PKSB 3LOXA 3RMMH 3QDZB 4M9FA 2LNCA 2AEIH 2M5TA 1C4Y2 1LHCH 1ANCA 1ZHPA 1OHHD 1O2MA 6LPRA 1MTSA 1C5TA 1ZOMA 2ZCLP 5IYTA 3V3MA 2VVCA 3D49H 3QGJA 3F1SB 3SU3A 5JBBS 2SNWA 5K7RA 1BUIA 4FUJA 1ETTH 3ZVFA 5ETXA 1FY3A 1F5LA 5F53A 1ETRH 2J98A 1CHOF 3AK5A 1YP9A 3GY3A 1DE7H 1X7AC 4X2WA 1LTOA 3ZZ6A 2ZP0H 1EZUC 1IQJA 3SJKA 5FX5A 3ZVBA 4AYVB 3SUGA 4BAHB 1BA8B 1COWD 1N1LA 2A7JA 5EQSA 3SI4H 4Y0ZE 1YPLH 3SOSA 5HM9A 4CRAA 2ZF0H 2FOCA 2Q6FA 1P04A 1NBME 2B5TB 3MYWA 4GHTA 2VWMA 1ZZZA 3FANA 3ITIA 4WVPE 1Z1IA 2FOGA 3LGUA 3UNQA 1AE8H 5FPTA 4ZROA 1F92A 2YNAA 3T26A 1SGEE 4MNVA 1TONA 1C9TA 1QURH 2P3TB 1O37A 4MPXA 1FV9A 1O34A 3M5NA 1GMCF 1P03A 4CRCA 1GGDC 4ZMAH 1HJ8A 1LKBA 3RC5A 3UAIC 2CF9H 1SMFE 3ODFA 1ZJKA 2W6JD 2ZWLH 1K1IA 2KAIB 2PGBB 2RA0A 1S0QA 1YKTA 3BN9A 3RXMA 3V13A 2XYAA 3S7KB 2NU0E 3PV5A 5FCKA 5T6FA 2XRCA 3RC6A 1GVZA 2OLGA 4FU7A 1A5IA 3TK5A 2IPHA 4DVAU 3PTBA 2BYAX 1F5RA 4MQAA 1H1BA 2O8MA 2ZGJA 3ZZDA 4B1TA 5EU8A 2O8UA 3OEED 3HGPA 1T8MA 3P8OA 2Z6BD 4IS5A 1ETSH 4FVDA 1IQEA 1YLDA 1AVXA 2EI7A 4NIWA 2ZFRH 3S7HB 1SGDE 5JB8S 3BF6H 1KXAA 2HNTE 4HI3A 1DICA 1JWTA 5DJ7A 1NZQH 1K1LA 4FU8A 3ATIA 3KL6A 1MKWK 1TNIA 4ZKOU 3RXRA 1ORFA 1HUTH 1E1QD 1DWDH 1HAZB 1O3NA 2XCNA 1OWHA 3FKSD 3RXJA 5JB9S 2OC7A 3NK8A 1PJPA 4MNWA 2BZAA 4FUFA 1DX5M 4I33A 2GCTB 4E05H 4HFPB 3KQCA 1JOUB 5C0TA 2PP6A 3ZVGA 1MTWA 2G00A 4NGAH 2YOLA 3MTYA 3SW2B 4ZXYH 2G4TA 2ZTYA 3UY9A 3QZQA 1K1JA 4K69A 1O31A 1AWHB 1EQ9A 3MFJA 3VGCB 1GBEA 1L1NA 2BQ6B 3LPRA 4UEHH 3SV6A 1SL3A 3SV7A 3GCOA 1E38B 2UUFB 3K9XB 4WJG2 1NFXA 1BIOA 3SGBE 4AFSA 3MO3A 1GI8B 5EGMA 1MH0A 4B73A 1OOKB 1GBFA 4F4OC 3M37A 1O5EH 4K8BA 1O2ZA 4WXVA 2GTBA 1EP5A 3OAAD 2D2DA 3O8RA 9ESTA 1W0KD 3TGIE 1HCGA 2PSYA 2XBWA 1IQLA 2EY4C 1EB2A 1MTNB 1EJMA 1TMBH 5HXFA 3U8OH 1O3MA 1QB9A 3R3GB 4JK5A 2EQNA 1V2NT 1O38A 1TYNA 2BVXH 2VU8E 2ZFPH 1HJAB 1P11E 2VH0A 1SQRA 3DCLA 2FEQH 4DIHH 2OQ5A 1JRSA 2IJD1 1SVPA 2OC8A 2TGDA 2ZDAH 2KCPA 1GDQA 1KY9A 1A5GH 3BG4C 3BIVH 3EE7A 2O8WA 7GCHG 3OY5U 2UUJB 3SORA 1C1SA 3IITA 1SBWA 4J2YB 3SJ8A 1YPGH 1QZ8A 2A7CA 3CS0A 4DG4A 1V2ST 4KTUA 2AIQA 1Q2WA 4OS4A 1GG6B 1EAUA 1EZSC 2GV6A 2BD4A 1W13U 3RU4T 2BMGB 3GY6A 4U2WA 1ELFA 4CBNA 1EXFA 1N6XA 3RDZA 1P02A 4ABBA 4H42U 5C1UA 3TLOA 1AZZA 5C1YA 4I8GA 4Y76A 7ESTE 4AX9H 1OP2A 2H6MA 4ZKRU 1L2EA 1V2TT 3AVZA 1O3CA 1EZXC 3SJ9A 2M2AA 3M5OA 4JZIA 4YO9A 3UNSA 4OGXA 2C90B 4NG9H 3OYPA 3ATWA 4YOJA 4SGBE 2WPJS 1GHBF 5KECA 1CE5A 1GBIA 2D1JA 1GMHF 2PTCE 1KLJH 2VJ1A 1RIWC 4A1VA 2R3YA 1GJCB 1IOEA 4UE7H 3I78A 2FTMA 3SNBA 1KLIH 3MU0A 3ZZAA 1QR3E 2PKAB 3F9FA 5EJZA 2C8WB 3LONA 1TX8A 2FOMB 1C1PA 1VJAU 3L6PA 4K1EA 3UWJH 1UVTH 3ZVEA 1IQIA 2VWNA 6CHAB 4INKA 1WU1A 1XKBC 1ELDE 1UVPA 3EE0B 2WHXA 4NWKA 3OFND 2XNDD 3UWIA 4NWLA 1P01A 2PKSC 1QCPA 4A92A 2QN5T 1TAWA 2OBOA 2ZQ2A 5I46H 3A87A 3FFGA 2G52A 4WWYA 3UTUH 1MBQA 3U28C 1A2CH 2QF0A 2L6OA 2I6QA 1MU6B 2ZCHP 3KQEA 4XE4A 4GLYA 1FN8A 4GUXA 2BX4A 1GWAA 3GY7A 3ZIAD 4YTAA 1H8HD 1HAGE 1SG8B 1T8OA 2DUCA 2FI3E 3CS7A 4MDSA 2K0QA 1FJSA 3UR9A 4X8SH 3NZIA 2F43B 1C5NH 2XBYA 3SU5A 1TRNA 3SV8A 1GDUA 2WSSD 1O3KA 1AZ8A 1HAYB 3VB4A 4CRGA 1C1NA 2B9LA 3G01A 3OU0A 5FPYA 2FOAA 1WV7H 1QTFA 2ULLA 1LCYA 2AERH 4FUBA 1RTLA 1A4WH 3MNXA 3PV4A 1KXFA 2ZEBA 2GCHG 2ZPRA 1TQ0B 2A4RA 4E7NA 1L0ZA 3NUMA 5EODA 4ZHMU 1QJ1B 1RRKA 3L33A 2BM2A 2VBCA 1T4UH 2XTTB 3F0OA 1PQ8A 4X2XA 1TPAE 3A7XA 3I29A 3P70B 1XUFA 1QRWA 4Y11E 1G3EA 8LPRA 2RG3A 1OYQA 4TSFD 4J1YA 4Y8YA 1EX3A 2SGEE 1GI9B 5LPEA 1AIXH 5HKKD 5DP3A 1O30A 4DURA 1LQDB 1GJBB 2A7HA 2WV9A 3MNSA 1MUEB 1C2IA 2DE9A 3GDSA 5ESBA 5HYOA 1OWDA 5C94A 2BDHA 2VB0A 3GYLB 1K0HA 2BX3A 1FIZA 3SHAH 4BTTB 3ATLA 1V6DA 4Y7AA 3RXCA 2OINA 4X6PA 5ESTE 1MAYA 5E0GA 3LC5A 1LPKB 1Y3WA 2BXTH 5HIZA 1SLXB 2VIWA 2UUYA 3S9AA 2BQ7B 2LP6A 3AW1A 2QF3A 4ZXXH 1V2PT 3BTTE 2EI8A 1D3QB 2SNVA 4HG6A 1NS3A 2EA3A 5JBCS 1C5YB 1GPZA 1SQAA 1INCA 3LGTA 3P17H 2A32A 1BTZA 1TBRH 4IN1A 1ID5H 1BMFD 1S5SA 1O2SA 3A8DA 5DG6A 1H8ED 3VPKA 4Y0YE 2FYQA 1KYNA 1UMAH 1QB1A 3MNBA 1BTPA 4ZHLU 2R9PA 2BB4A 1SGQE 3E1XB 1SGPE 2JDID 2HLDD 2A4GA 1BTHH 3E91A 4RT1A 1DFPA 2PSXA 1WYKA 2QXGA 1SFIA 4Z1MD 5C3NA 4RT0A 2GX4A 2FPZA 4OS1A 4XDEA 5KEDA 1PPHE 2EI6A 2R3UA 1W10U 1FY8E 4BTIB 1ELAA 2G8TA 1QJ6B 3VGCC 3RXDA 1PPBH 3RMOH 4B71A 1SLVB 1BB0B 5E2OA 1O3OA 1Z1JA 1O3LA 2VWLA 1MD7A 3SU4A 3D23A 1QL7A 4NIVA 1O2XA 2VIQA 1H9IE 3KYFA 1O35A 3P8NA 4OS7A 2JKHA 4FUHA 4WY3A 1TGTA 1PPZA 1C2HA 2ANWA 1ELTA 1DVAH 4ZH8A 1W12U 4ZKNU 1PYTC 1ZMLA 5A0BA 1BMLA 5DO4H 1YPHC 1MZDA 3MHWU 1UTPA 3ODDA 2AMPA 4A7IB 1MTNC 2K8IA 1ZTKA 1MZAA 1EAIA 1HAOH 4AYYB 3PB1E 1W14U 2AGEX 3SQEE 3A89A 1O2HA 2B8OH 2Y6TA 4O3TA 1HJAC 4ZAEA 1G30B 3VB3A 1T7CA 2ZHQH 1Z8RA 2SGQE 3TNTA 3KHVA 1MTVA 2ZG0H 4INHA 1FQ3A 1RS0A 2BD2A 3P92A 1DSUA 1BCUH 1GMDG 1OXGA 1DOJA 1ARBA 1THPB 2XWBI 2PKAA 2Y5FA 3KYGA 1CQQA 2LELA 3RMNH 1LHFH 1GG6C 2TRMA 1O3EA 2PR3A 2A2XH 2XC5A 1S83A 3D65E 2EC9H 1N6YA 3EYDA 5DP8A 2ZDKA 1F0SA 4R0IA 3RU4D 1OP8A 5F8ZA 1JXPA 2J97A 1KMHB 1DANH 1OKXA 3WW7A 1TRYA 1W0YH 4A1TA 4GCHF 4WH6A 2Y82A 3URCA 4THNH 5E0JA 3JZ2B 1GHAG 1P05A 2VGCB 4DT4A 1QBVH 1BBRH 4NFFA 2KFWA 2GDEH 5KGOA 4FU9A 3DT0H 4H6TA 1JBUH 2R2MB 5JBAS 2ZIQH 3SNEA 3L3TA 5CMXH 1CO7E 1O5CB 3R0FA 3RXVA 1F0TA 5E2PA 1H8DH 1NROH 2FESH 2LPRA 1P10A 2G4UA 3T2NA 1KIGH 1Z8IB 5AVDA 1LHDH 1O2YA 3BIUH 3N99A 1HLTH 3QTVH 2R0LA 6CHAC 3KQ5A 7GCHF 1GHXH 9LPRA 1C5OH 4IBLH 1ABJH 1TGCA 4ABHA 1A7SA 2R0KA 1DLEA 2ZDLA 1JMOH 2J2UA 3Q76A 4E06H 3RXAA 1K1MA 1BTUA 1GHVH 5C5NA 1VITG 1O5FH 2H1UA 2ZNKH 1A5HA 3ZVAA 3TJNA 2GJGA 1WQSA 3FP8E 3TH4H 1EJAA 1TOMH 2J94A 1H9HE 3FOAA 4ZUHA 4AGKA 3KCGH 1NY22 4K60A 1XKAC 3SNDA 2BY8X 2JJ2D 2WPMS 1QRXA 3RXIA 1LDTT 1HYLA 4DOQA 3BEFB 4U01A 1F0RA 2AH4X 1S85A 4YXWD 1FX0B 2PHBA 3IG6B 4SGAE 8ESTE 1OPHB 5F03A 1F2SE 1UCYE 1GBAA 1K1NA 2CN0H 2A1DB 3ELAH 1IQKA 1O2WA 4TY7A 1HNEE 5CHBA 4XSKU 4WMFA 1CGJE 3A7TA 2QCYA 1DLKB 2J4IA 5C1XA 1AUTC 3ZZBA 6GCHG 1TA2A 2JH0D 1GBMA 4LZ1H 3QGNB 3MH6A 3RM2H 4NSYA 1C2GA 1FAKH 2VVVA 1ZHMA 4I86A 4OS5A 2ZPSA 4CRBA 5C17A 1FUJA 4FXGH 4BTUB 1CA0B 2BDIA 2OCVB 3KGPA 1NRQH 2GKVE 3QN7A 1D9IA 5GIBA 1D6RA 3UUZA 5GNDA 1FPCH 1P2MA 1WSSH 1CT2E 3PWCA 5FL7D 1GHWH 3OEHD 1FIWA 5DP6A 2O8TA 2ZPQA 7LPRA 3FVFB 2W5EA 1C2KA 1V2OT 1K28D 2Y7XA 1FZZA 1T8LA 2V35A 3MWIU 1P2KA 4YOIA 1HAVA 1GI6A 1O5AB 3HKJB 2PW8H 1YPHE 3MU4A 2FOBA 1HAXB 1Y3VA 1PPGE 3CENA 1XUGA 1KXCA 2KZ4A 1TOCB 1JIMA 3F9GA 2ZC9H 4I8HA 2F3CE 1Y5AT 2FTLE 1O33A 5BRRE 3O8CA 3GY5A 1KSNA 2XCFA 2Y5GA 2CXVA 3K6YA 1C2EA 4BAQB 1E34B 3AAUA 4WMEA 1E79D 4FUEA 4NA8A 1QNJA 1DSTA 3RXKA 1P2OA 1O3BA 3LH3A 1DUEA 4LOYH 3NXPA 1WOFA 1E0FD 1GBJA 3DFLA 1FI8A 1PQ7A 5EXNA 3H7TA 4MPWA 4AFQA 4I8LA 1T4VH 1TNGA 5K0HA 2KX4A 2P3FH 1J15A 3HATH 4KTSA 2ZFQH 1PFXC 3V7TA 1O2QA 1MKWH 3SGAE 1W0ZU 4GVUA 4DIIH 1B0EA 1KXDA 1VKYA 1W7XH 5IK2D 1HIAB 2JIZD 2NU4E 1LVMA 2XWAA 2TGAA 4ABGA 1E1RD 1WBGB 1V2VT 2Z3DA 4H6SB 4A5TS 1OX1A 2FOHA 2VVUA 3MOCA 1GCTB 3LU9B 2KCYA 1S6FA 3LGIA 2ZU1A 2BHGA 1TABE 1TRMA 3M3TA 2AFQB 2ODYB 1P3CA 1YY3A 4K2YA 3SUFA 5EQRA 4TWYA 4O9VA 2BLWA 2CHAB 2A4QA 2FOEA 4GSOA 4DY7B 3TH3H 4XRNA 1CU1A 1XX9A 2Z9GA 2QF4A 3E16B 3RUOA 2W3KA 1HAPH 1O3IA 3SI3H 2J92A 1AKSB 4KP0A 1VJ9U 3KNXA 5T6DA 3GDUA 3URDA 1PQ5A 1FLEE 4AC9A 1OWKA 1TA6A 5EJ1A 4X8VH 1FDPA 1V2MT 4P02A 2QXHA 4YLQH 2A0QB 5GPIB 1NFUA 4ISOA 5HM2A 5FXLA 1S6LA 5B6OA 4LZ4B 2OTVA 3HKIB 1NO9H 3NPSA 1CGIE 2WPIS 1E36B 4JYUH 1Z71A 1MD8A 3EQ0H 2QGRA 4FUIA 3FO8D 2GDDA 3M36A 3NWUA 2ZGBH 3LGWA 3RXTA 1UVUH 2ZDMA 5GJ4B 1E35B 1ZGVA 2GZ7A 2Z9IA 1GJAB 5DGJA 3SNCA 3DFJA 3UOUA 1XUJA 3SQHE 1GI1A 3EGKH 1A61H 2BY6X 2BDYA 2TGTA 1O2NA 2XW9A 4MLFB 2F9OA 1J14A 3RXPA 1C1VH 2J9NA 2IJOB 2EEKA 1EPTB 3F2HA 1QA0A 1UO6A 2FI5E 2JETB 2JJ1D 5HGGA 5GCHG 4O3UA 1K1PA 2Y81A 1OWEA 4BANB 2QC2A 3TJVA 3ZZ7A 3E90B 1YPEH 1QY6A 1GI4A 2VGCC 4AG1A 1C1UH 2BY9X 8GCHF 4YT7H 2ZKSA 4OGYA 2F9NA 1C1TA 5C0UA 4AZ2B 1V3XA 2ZU2A 4JZDH 2GZ9A 3M3SA 1KDQB 1G37A 3HK6B 1EJNA 2FMJA 2PLXA 1O0DH 1NPMA 1J16A 1BQYA 2ANKH 1MCVA 2BOHB 1O3JA 2HPPH 2XNIA 2QE7D 4TYDA 2G5NA 1C1QA 1TPPA 3F9HA 1MMJN 1XUHA 4P00A 2CJIA 2O9QA 3WWBA 2GGVB 1UVSH 1DY9A 3BEIB 4UFGH 1ZMJA 2A4OA 1UTLM 1CHOG 3FP7E 1LVBA 3DHKH 1GMDF 2YNBA 4JZEH 2FS8A 2UUKB 1P12E 3Q3YA 1GJ6A 4IN2A 1UTNA 1O32A 1OSSA 3A82A 2HOBA 4MVNA 2Y80A 4BAMB 3GY4A 2VH6A 1A0HB 4MTBA 1TB6H 3TPIZ 1THRH 2VINA 1ZJDA 1O2IA 3W1EA 1D3TB 3STJA 2BVSH 1TIOA 2GMTB 1O2UA 1GHAF 3PWBA 2XXLA 2A5IA 1MU8B 1ZRKA 3LJJA 1RD3B 2F9UA 1SGNE 4FETA 1VR1H 2RCEA 3A8AA 3SBKA 1C2JA 4IGDA 2H9TH 2FX6A 2ANYA 1QGFA 1G9IE 2SGPE 2KAIA 1UTJA 4DJZB 2F9BH 1GMCG 2ILNA 1A1RA 2P3UB 1ZSKA 2C8YB 5JBTA 5LGOA 1UTKA 3ATMA 2ZZUH 5GXPA 1C2LA 5LH8A 2K1QA 3E6PH 2WPDD 4TPIZ 5I25A 1A3BH 1HB0B 2XC0A 2HLCA 4X6MA 3RXQA 4BAKB 4ABDA 2SGFE 4RKOB 4B76A 2UWOA 5GWZA 3U8RH 3I77A 2ODQA 1EB1H 1P2QA 1CA0C 2XC4A 3RXSA 2FWWA 1HXEH 2B0FA 1GJ9B 1SQTA 2FO9A 2ODPA 4AFUA 2GP9B 3SU2A 3A83A 1DPOA 4IC6A 4AB9A 2BD3A 5FPSA 5BPEA 4OS6A 1VITF 4JYTA 4K1SA 2VIOA 1AI8H 1C5SA 4GPGA 1RFNA 2HVYB 4I31A 5T3HA 1AUJA 1UHBB 1UVOA 1VCPA 3SU1A 4AGJA 1SLUB 3E3TA 6ESTA 5F8XA 3OSYA 3EAJA 2TGPZ 1LVOA 1MTUA 4JCNA 1ELBA 5TCCA 3DSGA 1AFEH 1NTPA 3NRLA 3F2FA 1MQ5A 4INLA 3PO1B 3GCHC 3SZNA 5J4SA 3CP7A 2WPHS 3SV9A 1G3CA 3NKKA 4CREA 1SFQB 3K6ZA 1ACBE 3SUEA 3ZZCA 4ABFA 3KQDA 1DY8A 2J34A 1DITH 1ZGIA 1ZRBA 1DWBH 1O5BB 3F3BA 1FPHH 4ABJA 2FX4A 2PWXA 1Y3XA 5A0CA 3T62A 1AGJA 3T5FH 1DS2E 3HGNA 3M7QA 4ACAA 3ESTA 3VXFH 1C1OA 5FAHA 5EPYA 5LPRA 1P2NA 1VGCB 1SGCA 1FY1A 1VCWA 2IOTA 1O2GH 4GHQA 2GV7A 1O2KA 3P6ZB 1BT7A 3GYMA 5EOKA 2V3OH 4AN7A 3IWMA 4UONA 4CHAB 1SKYE 2SGAA 1LPZB 3TITA 1WCZA 4U32A 5AFZH 1BTWA 4K1TA 3RU4E 2W6ID 4AORA 4AB8A 4UDWH 5DP4A 5EXLA 1GJ7B 1TPSA 1GCTC 4JZFH 1TX7A 1N8OB 1VCQA 4DW2U 1YF4A 4YLUA 4Q7ZA 4BXWA 1HV7A 1GBCA 1VITH 1V2KT 1UCYK 3FN8A 1OWIA 2Q6GA 1GBKA 1C5RA 3RLYH 4NA9H 4D7FA 2ZECA 1QBOA 2FI4E 3D62A 3F9EA 1DUAA 3LDXH 2HNTF 2CHAC 3M61U 3BTHE 1FY4A 4FUCA 1AU8A 3P95A 1G2LA 2R2WU 1DWEH 2F9PA 1K22H 1QRZA 1GI5A 2P16A 2P8OB 4O97A 4QT8C 3BEUA 1IHSH 1RXPA 5EG4A 2PV9B 1NRSH 1Z6EA 4XBBA 5C67A 1C4V2 1QL9A 1P9UA 1F0UA 1YBWA 4YT6H 3PTNA 2STAE 3RXUA 1BRCE 1WDIA 1SHHB 2HGTH 3SU0A 4X6NA 2Z9JA 5LPFA 3MNCA 3EA8A 1BZXE 3AAVA 4AFZA 3EDXB 2VIVA 1QIXB 4IMQA 1XVOA 2C4FH 4CBOA 2J5UA 2ESTE 1V2UT 1BMNH 1IQHA 3Q3KA 1PPCE 4Y10E 4NSVA 1KDQA 2OC0A 3LH1A 3M7TA 3VFEA 1G3DA 2ZFTA 4FVBA 2CV3A 1ELEE 1SGIB 1UK3A 2ALPA 2QYIA 2H5CA 4RSPA 4YESB 1TWXB 1NRNH 2CF8H 1CGHA 3WY8A 3RXLA 2QXJA 2V3MA 3P8GA 3OTPA 4K8YA 1MCTA 1YCPK 1GHBG 2RFKC 3M7UA 2C3SA 3CNRA 3PYHA 4X1QU 4X0WU 1GMHG 1ZR0A 1QB6A 4AG2A 1EPTC 2BY7X 1AO5A 4B74A 3RXOA 3UIRA 2H9HA 1SGFG 2JETC 3UFAA 4JMYA 2GVFA 1S82A 2QXIA 2WPKS 3VB6A 4MPUA 1GBTA 1TNLA 4CRDA 3RM0H 1GL0E 3PLBA 2Y5HA 3SN8A 1CSOE 1NRRH 1TBZH 1GJDB 2AIPA 2BVRH 1O3PB 3QLPH 5F6MA 4ASUD 1ANEA 4Y8XA 2AGGX 5GDSH 1YC0A 4FUDA 1BJVA 2YMSD 2BOKA 2ZHFH 4NA7A 1C4U2 5L2ZH 1O5GH 1FMGA 1G2MA 2O8LA 1NFWA 3RXFA 1V2QT 4B75A 3NCLA 4B6EA 1L1JA 1AQ7A 4TPYA 2H9EH 1BRUP 1EOJA 4RN6A 1WXRA 1TX6A 1Y3UA 3UPEA 1LVYA 2FZZA 1MBMA 4TY6A 3BTFE 2QV1A 2ZDNA 1YWUA 3PV2A 4X1RU 3RLWH 2FODA 4HTCH 2TPIZ
chains in the Genus database with same CATH topology
2Z3CA 2GD4B 1Z8JB 1Y5UT 2PFEA 4CR5A 1A0JA 1QHRB 1J8AA 4NZQA 4OS2A 1BRAA 4D76A 1GI0A 3MI4A 4Q7YA 1C5QA 5C5OA 3S0NA 1BOQA 1TGNA 1NRPH 1OS8A 1CVWH 3TVJB 1THSH 2D8WA 1XXDA 5TJXA 1LHEH 3UR6A 1NM6A 1EAXA 1E37B 5CHAB 2HPQH 2GMTC 2ZQ1A 3MU1A 1K2I1 3U8TH 1LO6A 1C2FA 5E8EH 2NU2E 1KLTA 4NIXA 1Y3YA 1TBQH 3ZZ4A 4ABIA 3QZRA 3FP6E 4E7RG 2ZTZA 3TIUA 1TMTH 3RXGA 3W95A 3VB5A 3RXBA 1O2RA 2FDAA 1DDJA 5EPNA 3LKWA 1DWCH 2ZHDA 3TJOA 5SGAE 1YPKH 4UFDH 3SNAA 1LPGB 1GVLA 5DPAA 3SJOA 1P2IA 2VIDA 1AFQC 3KIDU 3HK3B 1TGSZ 3A80A 2FP7B 1TLDA 3PLPA 1NN6A 1C5ZB 4NIYA 2BQWB 2J38A 4X8TH 1O2LA 1DT2A 2Z7FE 4WH8A 4ZHAA 1D3PB 4WMDA 1XMNB 2QA9E 1GI7B 1GCDA 2ZA5A 4Q2KA 3SV2H 3UREA 1XUKA 5J4QA 1XXFA 3Q00A 4YM9A 1HRTH 3P8FA 2OD3B 3RMLH 1O2JA 5FBIA 1ESBA 1BRBE 1EAWA 1DM4B 4Y8ZA 1Y5BT 4U30A 2ZU4A 1SB1H 3PMAB 3UOPA 1O3HA 1B5GH 5EW2H 1H8IH 1ELCA 3PO1C 5E0HA 2OXSA 3K65B 2BLVA 1ZPZA 4Y71A 1V2JT 2ALVA 4KELA 1BDAA 1GJ5H 1MKXH 2SFAA 3GCHB 5H4IB 3A8CA 1AMHA 2VNTA 1MKXK 2BD7A 1SOZA 2WYGA 1A3EH 1AD8H 2VIPA 1AB9B 1BHXF 2BD8A 4X2YA 1AVGH 1VGCC 1TPOA 1H4WA 2FLRH 2WV5A 1ZTLA 2AYWA 4BNRA 1GL1A 2GCHF 1QQ4A 4M7GA 4CHAC 1DXWA 4Y6DA 1Q3XA 2I6SA 1TMUH 3A7VA 3TGKE 3S9BA 2IN2A 2OQUA 2BDGA 2AS9A 2QAAA 1HXFH 4UFFH 4X6OA 3PMBB 3TNSA 4Q7XA 1N8OC 3PMHB 3DD2H 4LK4A 1C5WB 1FN6A 1FXYA 5A2MH 3RXHA 1AE5A 4D9QA 1SGTA 3T27A 2ZDVH 1BTYA 1GDNA 1W8BH 2Z3EA 5DKMA 3TK9A 1C1WH 5DK1A 1FAXA 1ANDA 3C27B 1GVKB 1IQGA 1WTHD 2BDBA 1NESE 3M5MA 1SQOA 1AVWA 4ABEA 3SHCH 2P8OC 3ZYDA 2FM2A 1KXBA 3V12A 5L30H 1YYY1 1ELVA 4X1PU 4Z0KA 4AOQA 1XUIA 4D7GA 1BBRE 2WUCA 1ZSLA 5EW1H 3SJIA 2V6NA 1VZQH 3U9AH 1WQVH 2G81E 1GBDA 1J17T 3U69H 4NZLA 4DT7B 1GHZA 1F5KU 3FZDA 3GICB 1ZHRA 1KTSB 1ESAA 3TJUA 1UTMA 4NCYA 2STBE 2VWOA 1ABIH 5A09A 1BTXA 2P95A 1YM0A 2WYJA 1CBWB 5C2ZA 4GCHG 1O2OA 2WV4A 1C5PA 1HBTH 3MH5A 3RC4A 3GOVB 3GY8A 1S6HA 2P93A 5JDUB 1WAYB 2ANMH 4TWWA 2A2QH 1LKAA 2THFB 1CT4E 1O5DH 2F9VA 1PYTD 3UNRA 4BOHA 2BY5X 3DA9B 2W3IA 5AFYH 1EKBB 1S84A 1NT1A 4ISHH 2H2ZA 1UTOA 1SR5C 3LGYA 1V2WT 4ZKSU 2GT8A 1C1MA 2AMDA 4WF8A 1BJUA 1RJXB 1IAUA 2BTCE 2OBQA 1FONA 2FS9A 2ZO3H 2BXUH 3BTKE 2F83A 3VEQB 5T6GA 3Q3XA 2GT7A 2BLQA 3ZZ5A 3W94A 1L4ZA 1ZPCA 3GCTG 5CE1A 4DCDA 1BMMH 1K1OA 1A0LA 1JRTA 4GAWA 3QUMP 4A1XA 2NWNA 5IDKA 4BXSA 1V2RT 1QFKH 3ENSB 4KGAA 5A8ZA 1P57B 1W3CA 1SLWB 1AHTH 2UWLA 1C5XB 3V0XA 4I8KA 2OC1A 4VGCC 5HMAA 2A31A 4CRFA 3E0NB 4XBDA 1HPGA 1M9UA 2SGDE 2CMYA 2WUBA 1SGYE 2FOFA 1EP6A 3PLKA 3AASA 1U6QA 5L6NH 1Y59T 3KEEA 2FLBH 3LC3A 4UFEH 1BMAA 1CHGA 1G32B 3FZZA 1W11U 2W26A 4I7YH 2PUQH 3JZ1B 1C5LH 3MU8A 1BITA 1O2PA 2OUAA 4IMZA 1HJ9A 3BTME 3H7OA 3SU6A 1EZQA 3K2UA 2ZGCA 1ZTJA 1RTKA 1RGQA 2NU1E 1TALA 3QO6A 3UQOA 5CHAC 4D8NA 2G51A 4WXIA 1Z6JH 1O2TA 1TNKA 2UWPA 5JPMH 1P06A 2ZU5A 3TU7H 1SGFA 1OYTH 2ZHWH 5EQQA 1P2JA 4ABAA 4H4FA 4HZHA 1P3EA 3OX7U 1L4DA 1GJ4H 5A8YA 1NFYA 4O03A 2A45B 1C2MA 1O39A 3O8DA 1HGTH 2PGQB 1GI3A 4I8JA 2A5KA 1D6WA 4B2AA 4XOJA 1PPFE 1IQFA 1P0SH 3H5CB 1EASA 2Q6DA 2ZGXH 3LGVA 2NU3E 1SGRE 4X8UH 4Y7BA 1FY5A 2QY0B 2OP9A 4HGCA 4ISNA 1QL8A 2B7DH 4YZUA 1W2KH 5L2YH 1XM1A 2G5VA 3C1KA 5F8TA 1TFXA 1AFQB 4XBCA 3ZZ9A 1GJ8B 3AW0A 2BZ6H 4Q80A 1TQ7B 3BG8A 3F68H 1NU9A 2Z9KA 3KN2A 3TGJE 1EOLA 3O8BA 4IW4E 3UQVA 1SPJA 1HAIH 2TIOA 2WPLS 3A88A 2ZFFH 1HIAA 2ZGHA 1ZMNA 3M3VA 2JH6D 2QIQA 3ZYEA 1WTGH 4F49A 5A8XA 3A7WA 1H9LB 3PROA 3HPTB 4CH2B 5A0AE 7KMEH 1MAXA 2ASUB 1UK4A 1UJ1A 3EA9A 1S0RA 4KTCA 4X1SU 3QWCH 4MNYA 3SUDA 3ZV8A 2ZHEH 5DP9A 4MPVA 8KME2 2RA3A 2BD5A 3A7ZA 3BTQE 1LHGH 1AB9C 1S81A 2P59A 3N7OA 3MMGA 3PMJA 1W7GH 1G3BA 5TCAA 1GGDB 1GI2A 4PROA 6GCHF 1NU7B 2ZI2H 3M35A 1GBHA 1AKSA 1C5VA 3DUXH 4A6LA 2PTNA 1MQ6A 1QA7A 1PQAA 4JZ1A 4FUGA 4X2VA 3ZZ3A 1CT0E 1ELGA 2BDCA 2FYRA 1HFDA 2J95A 1GBLA 3STIA 4BAOB 1ESTA 1JIRA 3B23B 1UK2A 3RXEA 1UCYH 1G36A 1EUFA 1LQEA 1T8NA 3A8BA 1NC6A 3PM3A 1YCPM 1SSXA 2HALA 4YOGA 1UTQA 2AGIX 2PUXB 3LJOA 1O36A 1O3DA 2Z94A 3BTGE 1O3AA 3ZV9A 1SC8U 2BD9A 4B2CA 1K21H 2ZFSA 1YLCA 1ZYOA 3BV9B 1ZLRA 3S69A 3QTOH 3BTDE 1IQNA 2Z9LA 1P09A 4R8TB 5DP5A 2GCTC 3BTWE 1O3GA 3A85A 1HAVB 2GZ8A 2RDLA 2BLOA 5FBEA 1GBBA 4X1NU 1EPTA 1AY6H 1QJ7B 2XBVA 4Y79A 2W7UA 3FAOA 2WINI 3B8JA 1TE0A 1C1RA 5FX6A 3MO9A 1C2DA 1Z8GA 1SHYA 3ZVDA 3OTJE 4CH8B 1D3DB 1D4PB 3ZZ8A 5AF9H 1OP0A 1ANBA 1CBWC 3LIWA 1ZPBA 3OY6U 1ARCA 4ISIH 8GCHG 3VXEH 3E8LA 2ZTXA 1KTTB 1BHXB 3GY2A 4JK6A 1V2LT 1J9CH 1YCPH 3MU5A 1PPEE 5EXMA 2FXRA 2Q1JA 1B7XB 1TNHA 3T29A 2A5AA 4MNXA 2V0BA 1L1GA 5PTPA 2JH5D 3SO3A 2AMQA 1YPMH 3A7YA 4I32A 4DGJA 1FNIA 2C8ZB 3EA7A 1HAHH 4D9RA 3A81A 4K3JA 1DXPA 1HDTH 4JYVH 3SGQE 2W7SA 1Q31A 3E0PB 3Q77A 1ZSJA 2C8XB 2D26C 1QQUA 4UD9H 1TGBA 3U98H 2H5DA 3ZVCA 1O2VA 1IQMA 3BG4B 2HNTC 2F91A 5G4BA 3KF2A 4XFQA 1C5MD 4B2BA 3BTEE 4K5ZA 1CA8B 2V3HH 1SI5H 5FCRA 1T31A 2HVXA 2HRVA 5ABWA 2FIRH 4ASHA 2Y7ZA 3QK1A 3B9FH 1C5UA 1EATA 2HWLB 1B0FA 3TH2H 4Z6AH 4VGCB 1AWFH 2CGAA 4CR9A 1P9SA 5JYIA 4RKJB 4LXBH 5FHTA 2C93B 1F7ZA 3VB7A 4ESTE 3MH7A 1BBRK 3F6UH 1K9OE 1C9PA 3T25A 2ZU3A 3QX5H 3T28A 3MH4A 5AHGH 3ATKA 3LT3A 3U1JB 3A84A 1WUNH 4KKDA 3GISB 2ZCKP 2XBXA 1IHTH 1RIWB 3M5LA 1A46H 2G55A 1QBNA 4ISLA 3U1IB 2P94A 1OWJA 4NFEA 5GCHF 1YGCH 3S9CA 4IC5A 5DP7A 1LMWB 1KXEA 2TBSA 3GDVA 1Z7KA 3A86A 1O3FA 1XVMA 1Y8TA 5C20A 3GCTF 2DE8A 3RP2A 1GHYH 1T32A 1UHBA 3GCNA 1RTFB 1P8VC 1TNJA 3MO6A 1YPJH 1AN1E 4MG3A 3KQBA 2BDAA 3BSQA 1SOTA 3TK6A 2PKSB 3LOXA 3RMMH 3QDZB 2LNCA 2AEIH 2M5TA 1C4Y2 1LHCH 1ANCA 1ZHPA 1O2MA 6LPRA 1MTSA 1C5TA 1ZOMA 2ZCLP 5IYTA 3V3MA 2VVCA 3D49H 3QGJA 3F1SB 3SU3A 5JBBS 2SNWA 5K7RA 1BUIA 4FUJA 1ETTH 3ZVFA 5ETXA 1FY3A 1F5LA 1ETRH 1CHOF 1YP9A 3GY3A 1DE7H 1X7AC 4X2WA 1LTOA 3ZZ6A 2ZP0H 1EZUC 1IQJA 3SJKA 5FX5A 3ZVBA 4AYVB 3SUGA 4BAHB 1BA8B 2A7JA 1N1LA 5EQSA 3SI4H 4Y0ZE 1YPLH 3SOSA 5HM9A 4CRAA 2ZF0H 2FOCA 2Q6FA 1P04A 2B5TB 3MYWA 4GHTA 2VWMA 1ZZZA 3FANA 3ITIA 4WVPE 1Z1IA 2FOGA 3LGUA 3UNQA 1AE8H 5FPTA 4ZROA 1F92A 2YNAA 3T26A 1SGEE 4MNVA 1TONA 1C9TA 1QURH 2P3TB 1O37A 4MPXA 1FV9A 1O34A 3M5NA 1GMCF 1P03A 4CRCA 1GGDC 4ZMAH 1HJ8A 1LKBA 3RC5A 2CF9H 1SMFE 3ODFA 1ZJKA 2ZWLH 1K1IA 2KAIB 2PGBB 2RA0A 1S0QA 1YKTA 3BN9A 3RXMA 3V13A 2XYAA 3S7KB 2NU0E 5FCKA 5T6FA 2XRCA 3RC6A 1GVZA 2OLGA 4FU7A 1A5IA 3TK5A 2IPHA 4DVAU 3PTBA 2BYAX 1F5RA 4MQAA 1H1BA 2O8MA 2ZGJA 3ZZDA 4B1TA 5EU8A 2O8UA 3HGPA 1T8MA 3P8OA 2Z6BD 4IS5A 1ETSH 4FVDA 1IQEA 1YLDA 1AVXA 2EI7A 4NIWA 2ZFRH 3S7HB 1SGDE 5JB8S 3BF6H 1KXAA 2HNTE 4HI3A 1DICA 1JWTA 5DJ7A 1NZQH 1K1LA 4FU8A 3ATIA 3KL6A 1MKWK 1TNIA 4ZKOU 3RXRA 1ORFA 1HUTH 1DWDH 1HAZB 1O3NA 2XCNA 1OWHA 3RXJA 5JB9S 2OC7A 3NK8A 1PJPA 4MNWA 2BZAA 4FUFA 1DX5M 4I33A 2GCTB 4E05H 4HFPB 3KQCA 1JOUB 3ZVGA 1MTWA 2G00A 4NGAH 2YOLA 3MTYA 3SW2B 4ZXYH 2G4TA 2ZTYA 3UY9A 3QZQA 1K1JA 4K69A 1O31A 1AWHB 1EQ9A 3MFJA 3VGCB 1GBEA 1L1NA 2BQ6B 3LPRA 4UEHH 3SV6A 1SL3A 3SV7A 3GCOA 1E38B 2UUFB 3K9XB 4WJG2 1NFXA 1BIOA 3SGBE 4AFSA 3MO3A 1GI8B 5EGMA 1MH0A 4B73A 1OOKB 1GBFA 4F4OC 3M37A 1O5EH 4K8BA 1O2ZA 4WXVA 2GTBA 1EP5A 3O8RA 2D2DA 9ESTA 3TGIE 1HCGA 2PSYA 2XBWA 1IQLA 1EB2A 1MTNB 1EJMA 1TMBH 5HXFA 3U8OH 1O3MA 1QB9A 3R3GB 4JK5A 1V2NT 1O38A 1TYNA 2BVXH 2VU8E 2ZFPH 1HJAB 1P11E 2VH0A 2FEQH 4DIHH 2OQ5A 1JRSA 1SVPA 2OC8A 2TGDA 2ZDAH 1GDQA 1KY9A 1A5GH 3BG4C 3BIVH 7GCHG 2O8WA 3OY5U 2UUJB 3SORA 1C1SA 3IITA 1SBWA 4J2YB 3SJ8A 1YPGH 2A7CA 3CS0A 4DG4A 1V2ST 4KTUA 2AIQA 1Q2WA 4OS4A 1GG6B 1EAUA 1EZSC 2GV6A 2BD4A 1W13U 3RU4T 2BMGB 3GY6A 4U2WA 1ELFA 4CBNA 1EXFA 1N6XA 3RDZA 1P02A 4ABBA 4H42U 5C1UA 3TLOA 1AZZA 5C1YA 4I8GA 4Y76A 7ESTE 4AX9H 1OP2A 2H6MA 4ZKRU 1L2EA 1V2TT 3AVZA 1O3CA 1EZXC 3SJ9A 3M5OA 4JZIA 4YO9A 3UNSA 4OGXA 2C90B 4NG9H 3OYPA 3ATWA 4YOJA 4SGBE 2WPJS 1GHBF 1CE5A 1GBIA 2D1JA 1GMHF 2PTCE 1KLJH 2VJ1A 1RIWC 4A1VA 2R3YA 1GJCB 1IOEA 4UE7H 3I78A 2FTMA 3SNBA 1KLIH 3MU0A 3ZZAA 1QR3E 2PKAB 3F9FA 2C8WB 3LONA 1TX8A 2FOMB 1C1PA 1VJAU 3L6PA 4K1EA 3UWJH 1UVTH 3ZVEA 1IQIA 2VWNA 6CHAB 4INKA 1WU1A 1XKBC 1ELDE 1UVPA 3EE0B 4NWKA 3UWIA 4NWLA 1P01A 2PKSC 1QCPA 4A92A 2QN5T 1TAWA 2OBOA 2ZQ2A 5I46H 3A87A 3FFGA 2G52A 4WWYA 3UTUH