2BD9A

Porcine pancreatic elastase complexed with beta-casomorphin-7 and arg-phe at ph 5.0 (50 min soak) and immersed in ph 9 buffer for 28 seconds (2nd ph jump)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
molecule keywords Elastase-1
molecule tags Hydrolase
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bd9A01
1GPZA 3BIVH 2OQUA 1BTWA 3U69H 1J15A 2A5IA 4X6NA 3QLPH 1HPGA 2EI6A 3G01A 1TNGA 2ZFPH 7KMEH 3GYLB 3OY5U 2WPLS 4ZMAH 1CT0E 1IQNA 3QN7A 5L2YH 2BYAX 3RLYH 1ACBE 2DE9A 4WF8A 3MO3A 1QRZA 3T2NA 1P9SA 1Q31A 3P8OA 1LHFH 1IQKA 1GCTB 1SSXA 1RGQA 1Z7KA 4NZLA 1W14U 1O38A 1EASA 1NRSH 3Q3YA 5JB9S 2FTMA 4FUJA 1SMFE 4Y79A 1FY4A 1YPGH 1BCUH 1ETTH 1CE5A 1KXDA 1O3OA 3VB3A 5AFZH 2FXRA 1EPTB 2G5VA 1YYY1 1GMCG 1RTFB 1WQVH 4ABEA 3P6ZB 2R2WU 4Q7ZA 2D2DA 2BXTH 2VIPA 1GJ8B 1CHOG 1YCPH 3GDVA 3LGWA 5FBEA 2FOGA 4K3JA 2A5KA 2ASUB 1GI3A 1E38B 3KIDU 2O8UA 1TMUH 1OWEA 3AAUA 1QBNA 1V2ST 2ZGCA 1SFQB 1ZTKA 2XBWA 2ZDVH 2FMJA 1DM4B 4NG9H 4YTAA 2J4IA 1S6FA 4Y7AA 1A1RA 2V3HH 3SBKA 4CR5A 3PMJA 3ATWA 4B73A 1LHGH 4WXIA 1KY9A 4E7RG 1AKSB 1MUEB 1OKXA 5DP8A 4XBBA 2AIQA 3P92A 1OYTH 1BIOA 1NRNH 4TWYA 4Y71A 5HM9A 2P3TB 1Z1JA 5GCHF 1CA0C 4YESB 5K0HA 1DVAH 2GZ8A 5G4BA 2GCHF 3SNCA 1T8OA 1LVBA 1LMWB 4CR9A 1LKAA 4RKJB 2XCNA 2OQ5A 5GIBA 1UCYH 2Z3CA 2CF9H 1C5PA 1GI8B 4GSOA 4X6MA 3SU1A 3TJNA 1ABIH 1UK2A 4IMQA 1BBRE 4FVDA 3SQEE 4KKDA 2AIPA 4DG4A 3UY9A 1IQJA 1O36A 4YLUA 3A81A 1C5ZB 3AW1A 5DK1A 3GCHC 4BAKB 2A2XH 4YOJA 1K1JA 4INHA 3LGYA 2Y5FA 2H9TH 1MMJN 3UOUA 1ARCA 2FDAA 3PV4A 1QB6A 3MH7A 5ESBA 1N8OB 2Q6DA 1VR1H 4WWYA 2ZTZA 3ZVFA 5J4SA 2FODA 4NIXA 3T26A 1E0FD 1TOMH 2Z9GA 4H6SB 1GI7B 1J14A 4XBCA 2ZDLA 2C90B 1QQ4A 3A8AA 4CBOA 1P57B 1V2PT 1ZMJA 5F8XA 2RCEA 2GV7A 2ZHQH 1C2HA 4I32A 4Y8YA 1UTLM 4I33A 3L3TA 3GCNA 5JB8S 2BDYA 1ZOMA 1NU9A 4ZKOU 1SL3A 3TGKE 2OC8A 1S0RA 1OOKB 2P3UB 3VGCB 1GI0A 5ESTE 2V0BA 1HIAA 1D9IA 2AMQA 3FFGA 1ORFA 4X2VA 1MTNC 1A3EH 2IOTA 4YO9A 1P2IA 3A7YA 4TY7A 1BZXE 2G4UA 1HNEE 4Y0YE 1ZLRA 1AQ7A 1QL8A 1SGRE 4AZ2B 4LZ1H 4K2YA 1A0JA 1K2I1 3RLWH 1F0SA 1EP6A 1C2JA 3SU6A 3PM3A 1KXBA 5LGOA 1SGFG 1SC8U 2H9HA 5JBTA 1LQDB 1ZSJA 3KN2A 3TK5A 1G32B 3EA7A 1LQEA 1A7SA 3MNXA 5E0JA 1O3MA 4FUEA 1GJ5H 1AIXH 5C2ZA 1QA7A 1JRSA 1GHYH 4ABIA 2Z94A 1O5CB 2H5CA 4AGJA 1H1BA 4X8TH 3RDZA 1CGIE 4FVBA 1TPAE 3RXVA 3RXRA 4XDEA 2VIQA 1GMDG 3UUZA 3P17H 1Z8RA 2BDBA 2ZPRA 1ZMNA 3UOPA 1DICA 1BITA 1F0TA 2DUCA 2BQ6B 3CS7A 4CRFA 4MVNA 2AGIX 5E0HA 5K7RA 1C5YB 2XTTB 3KHVA 2GT8A 1B0EA 2RG3A 3BEFB 3D49H 4Y76A 1O3GA 1TGCA 3RC6A 2HGTH 3MU5A 3PMAB 1GG6C 1SGCA 3M7QA 3IITA 2R3UA 2Q1JA 2V3OH 3PO1B 4MNXA 2VWMA 3U8RH 4ZHMU 3RXHA 1FLEE 3BTDE 1DWDH 3RMOH 1TBRH 5EPYA 1ZR0A 4IC6A 2Z9IA 1T31A 4YOGA 1MKXH 5EU8A 1K1IA 1BRUP 4ZXXH 5C5OA 3A86A 4UFFH 3M5NA 1SOTA 2Y5GA 3TH3H 3ENSB 3HGNA 1MCVA 1DLKB 2VWLA 2F9UA 1G3BA 1PPHE 1S6HA 2G00A 1GGDC 1TYNA 5HXFA 5FBIA 3A82A 1NTPA 4OS1A 1AB9C 2ESTE 4B75A 1QFKH 3MO6A 1RXPA 1NFUA 3E0PB 2J2UA 4H42U 6LPRA 5CHAB 3RMLH 1O5EH 4GHQA 1O3AA 1G30B 3LDXH 2IN2A 4LXBH 2ZGXH 3PLPA 3Q3KA 2XCFA 4ABHA 1JIRA 5IDKA 1YC0A 4ZHLU 4MNWA 3NK8A 4A1XA 3ZZBA 1QL9A 1OWIA 1OP8A 5DPAA 3M5MA 2WPMS 3A88A 4AGKA 1GMCF 1TABE 3RXAA 2Z9JA 3SJKA 2RA0A 1ETSH 1CHOF 1DWEH 1XKAC 1Y5UT 1INCA 1XUIA 3PWCA 2HRVA 4X8SH 3RXTA 3H7TA 2ZU1A 1CBWC 3SZNA 1JWTA 3ATKA 2ZFTA 3BTTE 2QV1A 1TQ7B 2FOMB 4X1PU 5I46H 4AFSA 1OWKA 3RXEA 5CMXH 2CHAC 4O03A 1HV7A 3RM2H 1A46H 1GMHG 1OP0A 3SV2H 3SORA 3VXFH 4DJZB 1O2WA 1GL0E 1ZSKA 1IQEA 2SGDE 5C3NA 3E91A 1FONA 4XOJA 1NPMA 1TGBA 4Y8ZA 5IYTA 2BX3A 5FCKA 1QL7A 2OBQA 3BEUA 2CGAA 2HPPH 3OTJE 3SV8A 2B5TB 2I6SA 2FP7B 4DGJA 1SLUB 2HVXA 2F83A 2Y5HA 3ZVGA 2PSXA 2GTBA 3TPIZ 3UNSA 5EOKA 1KXFA 3BTME 2UUYA 1AU8A 5FPYA 1UVSH 3HKJB 4AX9H 1ZPBA 1EOLA 1H9HE 1V2MT 1BMAA 4ZKNU 1O2UA 2LPRA 2XC4A 2F3CE 3E6PH 2PKSB 3EDXB 2ALPA 1EAUA 1L2EA 1O39A 2G81E 1W3CA 2CMYA 1C1SA 5C20A 3UQVA 1W11U 1O5AB 1GBBA 4GPGA 2ZHEH 2Y82A 5FHTA 1Y5AT 3GDUA 3RXBA 4IN1A 2WYGA 1W13U 4A7IB 1A3BH 1UHBB 1CHGA 2ZCHP 4ASHA 5C67A 1V2KT 2THFB 2CV3A 3OYPA 3LJOA 1TOCB 2XNIA 1S84A 2Y7ZA 2PUXB 3S9BA 4CRCA 1LPGB 2A7JA 1ZPCA 3AW0A 5H4IB 3ZVCA 1IAUA 2H2ZA 4F4OC 1O3BA 5A0AE 1FUJA 1EXFA 1NY22 1QCPA 1KLJH 1ZZZA 1ID5H 1GJCB 3GISB 4M7GA 1MKWH 2QXGA 5JYIA 4K60A 2ZKSA 2P93A 3D62A 2GDEH 2R2MB 2OC7A 2XW9A 2JETC 2VINA 5A8ZA 1G3DA 1C2LA 1RJXB 2XC5A 3U9AH 2FOEA 4AB9A 5DP4A 1TBQH 5EW1H 1AE5A 1LPZB 1EZSC 4X1QU 1A5HA 3F9EA 1P2NA 1ZJDA 1ZHMA 3FP7E 3SJOA 4B2CA 1VCQA 2GD4B 1C5XB 2ZNKH 3QWCH 3F6UH 1O2JA 2PFEA 2VWNA 3OSYA 3Q77A 1YLDA 3PLKA 4WH8A 3RC5A 1E34B 1VCPA 4A5TS 1F2SE 1XX9A 2BD8A 3A7WA 3SI3H 1JBUH 1QBVH 5JBAS 1EX3A 2ZFRH 1VGCB 2OC0A 5AVDA 2GCTC 5EQQA 3S0NA 1OPHB 1SGPE 1C4Y2 2SNWA 3T29A 1DWBH 6ESTA 3MNBA 1MZAA 4VGCC 1FDPA 4NIWA 1KDQA 1VZQH 5A09A 5DP6A 1GMDF 1TPPA 1OWHA 1ZYOA 2BD4A 1BMLA 3HKIB 1QJ6B 1UK4A 1MTNB 5EXNA 1F7ZA 2QAAA 1Y8TA 1GHVH 1ELGA 1O3CA 5ABWA 3UWJH 9ESTA 1U6QA 3QDZB 3BG4B 4JYTA 5B6OA 4GHTA 4BAMB 4AN7A 1ELAA 3NPSA 3LT3A 4CRGA 3DD2H 2VU8E 2FM2A 2ZTXA 3GY2A 1HAOH 2O8TA 2ZA5A 1Y3YA 2J9NA 2ZF0H 3ZV9A 1K1NA 1O2VA 3BSQA 1J17T 1DUAA 2ZU3A 2HPQH 1E37B 3LGVA 4OS2A 1TPSA 1QB1A 1MTWA 5JPMH 1SLWB 2B7DH 3M5LA 1SPJA 1Z8GA 4ABDA 1UTPA 4NIVA 1ZJKA 1P9UA 1BMNH 2ZDAH 2SGPE 1QHRB 1EAXA 1SHYA 2QXHA 5GWZA 3BTWE 5I25A 1YPEH 1YKTA 3RC4A 2NU0E 1O2OA 3QGNB 1EUFA 3S7KB 1HXEH 1DDJA 2GMTB 1T7CA 1V2QT 2BVXH 2HWLB 3LJJA 1GG6B 1F0UA 2Z6BD 1FN6A 1A5IA 5HGGA 5AFYH 3F9FA 4MPVA 4D9QA 2LNCA 2C93B 2F91A 1D6RA 3MTYA 3MU0A 4K8YA 4KTSA 3SGAE 2VNTA 1QRXA 4CBNA 2G52A 1GDNA 1O2XA 1KTSB 1GVZA 4B74A 1GHAG 2M5TA 3MHWU 3VB7A 3ZV8A 3TK9A 3NUMA 4CHAB 5FPTA 1PJPA 1XMNB 3URCA 4JZ1A 2PR3A 4X1NU 3U1IB 2XXLA 1ZTLA 3S69A 1C1PA 3TNSA 4TPYA 1G2LA 2KAIA 5LPRA 1AUJA 1O2IA 3SHCH 2ODPA 4ZAEA 1NFWA 1AB9B 3KQCA 1B0FA 5EXMA 1GBAA 3M3VA 4RKOB 3UWIA 4D7GA 2FYQA 1CGJE 2GDDA 1AWFH 3LH1A 1TAWA 3K2UA 4MLFB 1FN8A 2BLVA 1NO9H 4K8BA 1HYLA 2VGCB 4OS7A 2C8YB 3UTUH 1BMMH 1GMHF 2WINI 3OX7U 1TX6A 2GP9B 1NROH 3V13A 3U8TH 1TGNA 1O2PA 2ZHFH 1HAXB 2FPZA 1K22H 4SGBE 4WMDA 3CENA 3DHKH 5EODA 1MTUA 2O8WA 4XSKU 2GZ9A 3UREA 1O3LA 1MQ5A 3RXPA 2C8ZB 3RXCA 2F9PA 3K65B 1ZSLA 2BD7A 4U32A 3SUFA 3P8FA 4JYUH 2XWAA 1PPCE 4NFFA 1TGSZ 4FUIA 1OS8A 3I29A 4MNYA 1PQ8A 4U01A 2D1JA 3PLBA 3A89A 3QZRA 2CHAB 3ZZ7A 2PWXA 1Z6EA 2BLOA 1TFXA 1LVOA 2PGBB 2R0KA 2FOAA 4NA7A 5T6GA 1TQ0B 4NZQA 2FEQH 1NN6A 1QIXB 3KCGH 1YCPM 2UWOA 4X2WA 1TNLA 1GJ7B 4FUCA 4X2YA 3QO6A 4X2XA 1NT1A 1O33A 2ZU4A 1C2IA 2PGQB 3M7UA 4BAHB 1O3IA 1W10U 4X0WU 2PV9B 3FANA 1F5RA 1PYTD 1EJAA 4A92A 1O5DH 4Y10E 1EP5A 2BMGB 4K5ZA 4IMZA 3V0XA 3O8CA 3SJ9A 1HJAC 2AGEX 2WUBA 2EC9H 3V12A 4LOYH 4BTIB 1MD7A 3QTOH 4CRAA 1KXEA 2BLQA 2HNTF 3ZVBA 5TJXA 1Y3WA 3URDA 1C2DA 1AFQB 2C8XB 2I6QA 4KELA 3UR9A 2DE8A 1C1NA 2BTCE 1THPB 2C3SA 3MMGA 2XBYA 3UR6A 1OWJA 2AERH 1NRPH 1O3EA 4J2YB 1P04A 3JZ1B 3TLOA 1DSUA 4AYVB 1MU6B 3BTQE 3PTNA 2BVSH 3SU4A 3SUEA 1IQMA 1FY8E 1BJUA 2G51A 2PKAA 1SHHB 1YCPK 3ZZCA 1JOUB 1MD8A 4ABJA 1VJAU 2BB4A 4E7NA 1EAIA 2FLRH 1F5KU 4FUGA 1O2NA 1V3XA 3SOSA 1GBIA 1HAVB 1OXGA 5J4QA 4HGCA 3UNRA 1QURH 1TGTA 1K21H 2ANYA 1ZHPA 1EZQA 2ZWLH 3RXOA 1PPFE 1QA0A 4INLA 1JRTA 6CHAC 2BY9X 2G5NA 2ZFQH 1A0LA 1SOZA 2VIWA 2FIRH 1V2JT 4D8NA 2ZI2H 5EG4A 1V2WT 1GI4A 4WJG2 4XBDA 3FVFB 1KLTA 2BLWA 4MDSA 1O3HA 3KQDA 1OSSA 4WMEA 1S0QA 3R3GB 2P59A 4Y0ZE 1KTTB 1FY3A 1AY6H 1V2OT 2BDCA 3QX5H 1DX5M 1T8LA 2EEKA 3MWIU 2GT7A 1WYKA 2HOBA 3K6ZA 3IWMA 3RP2A 3RMNH 2PSYA 1UCYK 4YLQH 1G3CA 1KDQB 1UTJA 1BDAA 1XUHA 4TWWA 4VGCB 2TRMA 3ZZ8A 1BBRH 4TY6A 1GWAA 3RU4D 4DIHH 1TALA 4KTCA 1O3PB 2QYIA 1LO6A 1BHXF 4UFDH 3TITA 1C5TA 1WV7H 1ZPZA 1Q3XA 2YOLA 3DFLA 1VJ9U 5DKMA 3GYMA 3SNAA 2OUAA 3U8OH 2XWBI 4WVPE 1SB1H 3SI4H 3LIWA 4GCHG 1YLCA 4Q7YA 1GVKB 1A4WH 2WPIS 1AVXA 3F1SB 4X8UH 1AWHB 1NFYA 1N6XA 2P8OB 4X6PA 1N1LA 4AYYB 1O2SA 2J94A 1C5VA 2QY0B 3STJA 1A5GH 1ANCA 1C5SA 1OP2A 1GHAF 2R9PA 2BD2A 3CP7A 2C4FH 1TWXB 1G37A 4UFEH 2PTCE 1FXYA 1EATA 2VIVA 2NU1E 1DSTA 4OGYA 2SFAA 4XE4A 2D8WA 3B9FH 4UEHH 2ZDKA 1S82A 3HATH 1DE7H 1P3EA 2Z9KA 3W95A 5E0GA 3WY8A 1Y5BT 3ZZ5A 3AVZA 4BTTB 1FIZA 3PYHA 5A0BA 1ANBA 2ZP0H 3RU4T 1GDQA 3SQHE 1GCTC 2ZECA 2FWWA 2WUCA 2ZO3H 1YF4A 1DY9A 1BRCE 2PTNA 3A7VA 4PROA 3T28A 1S81A 4BXWA 1K28D 1L4DA 1DY8A 2HLCA 2VVUA 1MBMA 1K9OE 3O8RA 2P3FH 3Q76A 4ZROA 1EB1H 1EPTC 1RRKA 3GY5A 6GCHG 2FX4A 5HMAA 1WAYB 1EPTA 5AF9H 3E1XB 4WY3A 3KGPA 3OY6U 1C2KA 1YPHE 5EQRA 5C1YA 3SV9A 1XM1A 3T5FH 1C1TA 1W2KH 1FPHH 1HGTH 3H7OA 2VVCA 4ISNA 2SGEE 3LC3A 1QRWA 1YPKH 3SU0A 1LHEH 2FESH 3SU3A 1A2CH 2ZIQH 1NC6A 4FUHA 1D3PB 2BXUH 2NU2E 3NCLA 1HUTH 4YZUA 1AKSA 1O3KA 2Z9LA 3M7TA 4I31A 1FAXA 4ISHH 4I7YH 2EA3A 1GI9B 1P09A 3LC5A 2A7HA 2EI8A 3SUDA 1MKXK 1SGQE 1JXPA 2AMPA 3M61U 1IHTH 1TMBH 2PW8H 1ANEA 1O5GH 3F9HA 1KIGH 2TGAA 3TGJE 1OYQA 1XXDA 4FU8A 1BT7A 4GVUA 4I8HA 1AVGH 1NS3A 1Y3UA 3V7TA 1C5QA 1RTKA 3T62A 2W5EA 3VPKA 4UD9H 7GCHG 3QK1A 1CA0B 1WBGB 1C1RA 1P02A 8KME2 3I77A 5PTPA 1GHBG 1BTHH 3AAVA 1GJBB 1Y59T 2WPKS 3C27B 1SBWA 3TJUA 1GDUA 2HALA 9LPRA 2PHBA 3UQOA 1N8OC 3TU7H 2ZGHA 2W7SA 4FU7A 1ABJH 3S9AA 4B2AA 2YNBA 1YM0A 3QTVH 1FZZA 4I8JA 2IPHA 1AVWA 4GUXA 1ELBA 4I8LA 3PMBB 1W0ZU 1KYNA 2VH0A 5E2PA 3GCHB 1O5FH 2WPJS 1BJVA 1GHZA 3RXJA 3EA9A 4K1SA 1TRYA 1XXFA 2QXIA 1K1PA 4IGDA 1UTNA 1DLEA 1PPGE 4Y8XA 4CREA 3L6PA 1C2GA 3GOVB 3MH5A 1H9IE 3BTEE 5E2OA 1ZHRA 2F9BH 1UK3A 1SQAA 1AGJA 1GJDB 3MU8A 3SUGA 3SJIA 4THNH 1YGCH 3ODDA 1J16A 1V2VT 2J34A 4Y11E 1C2FA 1ESBA 2ZCKP 2QF0A 1JIMA 3HK3B 1GHWH 1PQAA 2ZDNA 3MNCA 5T3HA 1LKBA 1GJ4H 1CT4E 3QUMP 4TYDA 1HIAB 1QJ7B 2A4QA 2TGDA 5EXLA 1LCYA 1TX7A 1SLXB 4O3TA 3RXQA 2J95A 4JZFH 3SGQE 4ZXYH 1ZMLA 4IW4E 3EA8A 2ULLA 2UUKB 3GDSA 3TJOA 1V6DA 4YT7H 3KL6A 1DS2E 5JBBS 1TX8A 3LOXA 2SNVA 3ODFA 4HTCH 3LGIA 5JBCS 4U30A 3MH4A 1XKBC 5F8TA 3EGKH 4GCHF 1L1JA 1C4V2 1HCGA 3ZYDA 1RTLA 3E3TA 4Z0KA 1CA8B 1HLTH 1W0YH 1THRH 3MFJA 3P8NA 1K1MA 3BF6H 1ESTA 1HJ9A 4HZHA 1YPHC 1F5LA 4NA9H 3U1JB 1LHDH 1ELCA 1T4VH 2BDGA 4NA8A 4K1TA 2NU4E 4ZKSU 1GHXH 3PO1C 1MKWK 3RXUA 2Z7FE 2ZPSA 1GBTA 2ZFSA 1RFNA 1IHSH 1LVMA 2EI7A 3A7TA 2QA9E 1O3JA 1ZRKA 5T6DA 1GBFA 1OX1A 4AG1A 4U2WA 2ODQA 1PPBH 1NRRH 2UUFB 1J8AA 1SFIA 2BDIA 1D4PB 2BY6X 1TMTH 1ELFA 4MPXA 1QQUA 4JK5A 2AMDA 2F9OA 4UFGH 1VITG 5FCRA 4DY7B 2A4GA 2R0LA 4B1TA 3SN8A 4A6LA 4B71A 2BD3A 4DT7B 2BOHB 2BQ7B 1GJ9B 1QNJA 1XVMA 4AG2A 3VB4A 2OXSA 2FZZA 1HB0B 5FX6A 1T32A 1UTOA 1P01A 2ZGBH 4E05H 3A8BA 3NWUA 5CHAC 5JDUB 1SGIB 1XUKA 1EAWA 1C1OA 2GGVB 1ZGVA 2ZEBA 3ZZAA 2FOFA 1EQ9A 2ZCLP 5BPEA 1O2RA 1FV9A 5CE1A 1O5BB 1UCYE 1HAYB 3TH2H 2CF8H 3UPEA 3K6YA 1GGDB 1V2RT 2JH6D 6GCHF 1MQ6A 2QXJA 4BXSA 2VH6A 2WPHS 1DT2A 1O3DA 1V2TT 1BTXA 1FJSA 1C5UA 1VCWA 3VB6A 2AH4X 3STIA 3TGIE 1RS0A 1DFPA 4WMFA 1KXAA 3CS0A 4FUDA 3RUOA 2QC2A 2V35A 5E8EH 2B8OH 3AASA 2STBE 3ZYEA 5FAHA 2XC0A 3E90B 5GPIB 4Z6AH 1F0RA 1ZGIA 2ALVA 2STAE 3MU1A 3D23A 3A83A 1EB2A 4ESTE 1O0DH 1O32A 1TA6A 4YT6H 5TCCA 1D3QB 1Z8JB 1AN1E 3K9XB 4F49A 1MCTA 1SGNE 1HBTH 4NFEA 2W7UA 2VVVA 4ABGA 1GBKA 4OS6A 2FTLE 1EKBB 3SO3A 3V3MA 2GVFA 2ZGJA 1LTOA 3ATLA 3ATIA 1BA8B 2JH0D 2QIQA 1YP9A 4NCYA 5T6FA 2ZHDA 3I78A 1MTVA 1WTGH 2O8MA 2Q6FA 1SG8B 1V2NT 5A8XA 1DXPA 1G36A 1CBWB 4Q80A 3A87A 1O35A 2FYRA 2ZZUH 1C1UH 2YNAA 1SQOA 2WYJA 3MOCA 3A7XA 3PROA 4WH6A 4AORA 4MPWA 3E16B 3U98H 1O2KA 1NRQH 1THSH 5HM2A 1CT2E 2XYAA 1TB6H 5A8YA 3LKWA 1QBOA 5EGMA 3A85A 2PKSC 1TRNA 4BNRA 7GCHF 3TH4H 1C1MA 4JCNA 1V2UT 1QJ1B 2SGFE 1FMGA 5L2ZH 3SHAH 5C1XA 1YBWA 1GHBF 1HAZB 1AO5A 1A0HB 1FY5A 2O8LA 2WV5A 5A0CA 2K1QA 1QGFA 2QN5T 5AHGH 2C8WB 4CH2B 2CXVA 4INKA 1NM6A 1UHBA 1P03A 3DA9B 8LPRA 1RIWC 2CJIA 2BY5X 1CQQA 4KP0A 4NIYA 4JK6A 2FI5E 2AEIH 2R3YA 3GICB 1MH0A 1ELTA 1Z1IA 1V2LT 2QF3A 1PFXC 3L33A 2A45B 5EW2H 1IQLA 1HFDA 2OD3B 1NFXA 2ZC9H 1RD3B 2A7CA 1UTQA 2BX4A 1EJMA 3BN9A 1DPOA 2G55A 1GBCA 1LPKB 2TGPZ 2TGTA 1H9LB 2XBVA 2VWOA 4SGAE 5A2MH 3SW2B 1O2YA 1HAIH 3ZZ3A 5ETXA 4IBLH 1TLDA 1GL1A 1PPEE 1CSOE 4FUFA 1UVPA 1MZDA 4A1VA 3E8LA 1PQ5A 3PB1E 1O3NA 1AZZA 4NSYA 2FI3E 2F9VA 4JZEH 5EPNA 3FZZA 3VB5A 1NU7B 1MTSA 3ITIA 2Z3DA 5GJ4B 3ZZDA 1MU8B 3ELAH 1SGYE 3SNDA 4JZDH 2RA3A 3MYWA 1BRAA 1P10A 2BD5A 4YM9A 5L6NH 2FOCA 1CGHA 1O2GH 3SV7A 2ZU5A 1GI6A 2BY8X 1GI1A 2AS9A 2JETB 4AB8A 2FX6A 1WSSH 3LPRA 2ZPQA 1VGCC 2FLBH 4MPUA 4DURA 3A7ZA 5DG6A 2A31A 2BY7X 3RXFA 1UVOA 1GJAB 2BHGA 1QTFA 3T25A 4HI3A 1W7XH 2F9NA 1CO7E 2JH5D 8GCHG 1SGFA 1FY1A 4X8VH 1FAKH 1O34A 3RXIA 3TK6A 1XUGA 1L1GA 5SGAE 3IG6B 4ABBA 4ISIH 1O2MA 1ZTJA 1TONA 1FPCH 2P95A 4I8KA 3TNTA 1FNIA 1Z6JH 1SGTA 3HPTB 4NWKA 3SV6A 3JZ2B 2TBSA 1P12E 4ZH8A 2IJOB 2GCTB 2AFQB 1SLVB 3BG4C 1IQHA 1LVYA 1H8DH 2Y6TA 3Q3XA 5DO4H 1UVUH 2B0FA 1C5RA 1P11E 4MG3A 2JKHA 1P8VC 2H5DA 3EE0B 2ZQ2A 3GCTG 1IQIA 3B8JA 3RU4E 2TPIZ 8ESTE 1L0ZA 4WXVA 1S83A 1UJ1A 4JMYA 4IN2A 3UIRA 4B76A 5DP5A 1BB0B 1DWCH 2Y80A 4NSVA 1O2HA 1T8NA 4X6OA 2BZAA 2FOHA 3TJVA 3VXEH 4UDWH 2HNTE 5DP3A 4AFQA 2OLGA 1WTHD 2BQWB 2ZHWH 3S9CA 3GY7A 3PTBA 4BOHA 1YPJH 1BHXB 1SGEE 1VITF 4UE7H 1UO6A 3PWBA 2ILNA 2A4OA 3ATMA 1D3DB 4LK4A 4ISOA 2ODYB 3F68H 3DFJA 1ZRBA 1HAGE 3ZZ6A 2GMTC 3LGUA 3FP8E 1GBDA 3SJ8A 1GI5A 2O9QA 3TIUA 1AUTC 3FAOA 3RXDA 1C5OH 4CRBA 3A8CA 1TNJA 4OS4A 1W7GH 2OBOA 2ANKH 4AFZA 4ZKRU 1O37A 1H8IH 4LZ4B 4Y6DA 3NZIA 3PMHB 4CHAC 1P2MA 2GZ7A 3ZZ4A 1ANDA 1TIOA 1PYTC 2PLXA 3O8BA 5GDSH 1G9IE 1P0SH 2V6NA 1C9PA 3BV9B 1O30A 2P94A 3SU5A 1BQYA 1LHCH 3GY4A 1SVPA 1C1VH 1MAYA 1XUFA 1W12U 1B7XB 1KXCA 5C1UA 5DJ7A 1NESE 2W3IA 4K1EA 3KQEA 4MQAA 1P3CA 1HJ8A 5FXLA 4FU9A 2FO9A 2J92A 2VGCC 4J1YA 1GBJA 2BVRH 1GCDA 2SGQE 3MNSA 4CH8B 1HRTH 2GX4A 1C5MD 5DGJA 4ABAA 2KAIB 5LPFA 2UUJB 3M37A 3D65E 2OP9A 2SGAA 1G2MA 4H4FA 5FPSA 1E36B 1Y3XA 3KEEA 1TPOA 1UMAH 2RDLA 1L1NA 4O97A 2AYWA 5TCAA 3ZVAA 1F92A 3C1KA 1MBQA 2A32A 1BBRK 3FZDA 1FIWA 1XUJA 1ETRH 3KQBA 1UTKA 4D7FA 1SI5H 1TA2A 1G3EA 3N7OA 2Q6GA 3TVJB 1GBLA 3EQ0H 2VIDA 1SQTA 3ZZ9A 1TNKA 3QGJA 1AI8H 1L4ZA 1PPZA 4Q2KA 3BTHE 5DP7A 1O2LA 1P05A 4KTUA 1T8MA 4OS5A 3SNEA 2FOBA 1O2QA 1XVOA 4ZUHA 1OWDA 3GY3A 1ELEE 4R8TB 4DIIH 1SR5C 4GLYA 3VFEA 5F6MA 2G8TA 1GVLA 1O31A 1P2OA 3HGPA 1DANH 3KNXA 1K1OA 4D76A 4QT8C 1S85A 2A5AA 1TNHA 3RXLA 1BRBE 1WQSA 1GBHA 2H9EH 2Z3EA 2VJ1A 4ABFA 2XRCA 2BM2A 1ELVA 4AFUA 1PQ7A 2BDHA 1BTZA 5BRRE 3P95A 1GI2A 1QR3E 2ANWA 1Y3VA 1C2MA 1AHTH 1DITH 3F9GA 4R0IA 3MH6A 4BTUB 1B5GH 4BAQB 4BAOB 3M36A 3O8DA 4X1RU 5L30H 2AGGX 3LONA 1LDTT 3BTGE 4DCDA 5F8ZA 2TIOA 5GXPA 3QZQA 3RXSA 2OCVB 3BTKE 2ZQ1A 5GCHG 1AFQC 1O2TA 5DP9A 2QCYA 2HNTC 1C2EA 2ZDMA 1BTPA 2GCHG 1YPMH 1GBMA 1RIWB 3A8DA 4KGAA 4XFQA 3W94A 1HJAB 1P2QA 3LH3A 2VB0A 3EYDA 1D3TB 1D6WA 1W8BH 5F03A 4AOQA 2ZFFH 3BEIB 2H1UA 3HK6B 1A61H 1NZQH 2D26C 3MI4A 3ZVDA 4ISLA 1T4UH 2BDAA 1ELDE 1VITH 4FUBA 3OU0A 1Z8IB 1C5WB 2ZU2A 4UONA 5LPEA 1WU1A 4DW2U 1UTMA 1DXWA 3VGCC 3LGTA 8GCHF 1AD8H 3H5CB 4I8GA 3DT0H 5C5NA 2P16A 1HAVA 1AZ8A 2WV4A 2XBXA 5EQSA 1FQ3A 2PKAB 1KSNA 3R0FA 3SGBE 2VIOA 4DOQA 1O3FA 3SNBA 1HAPH 2FS9A 1Q2WA 4NGAH 4CRDA 4X1SU 2CN0H 3P70B 1DUEA 1ESAA 2Y7XA 2A4RA 3B23B 3UFAA 1UVTH 1C4U2 3S7HB 1TE0A 2Y81A 1BOQA 3T27A 1AMHA 3Q00A 3NXPA 3GCTF 2A1DB 2BOKA 3M5OA 4IC5A 1C5LH 4O3UA 1HDTH 1TRMA 3VEQB 1X7AC 2UWPA 3RXGA 3ESTA 1HXFH 4D9RA 1C1QA 3M3TA 3FP6E 2UWLA 3M3SA 4E06H 4JZIA 3RXMA 6CHAB 1J9CH 1YPLH 3NKKA 4MNVA 4JYVH 2A2QH 1M9UA 5FX5A 1BUIA 3KF2A 1P2JA 1TBZH 4DVAU 5HYOA 1P06A 4TPIZ 1O2ZA 1QB9A 2H6MA 2ZG0H 4K69A 1EJNA 4H6TA 1TNIA 1C5NH 1GBEA 4NWLA 1SGDE 1WOFA 3BG8A 3RXKA 1K1LA 3GCOA 2B9LA 1IQGA 1HAHH 2FS8A 3EAJA 2OINA 1CU1A 1MAXA 2FI4E 3BIUH 4Q7XA 2BZ6H 2G4TA 3E0NB 2W3KA 3GY6A 1DOJA 2NU3E 5LH8A 3DUXH 1C1WH 1ARBA 2W26A 2OC1A 2P8OC 1P2KA 1C9TA 4O9VA 1GJ6A 4Y7BA 1H4WA 4FXGH 3UNQA 1E35B 1AE8H 1JMOH 1QY6A 3M35A 4YOIA 4IS5A 1CVWH 4RN6A 3A80A 1IQFA 2J38A 4HFPB 2BD9A 2GV6A 1AFEH 1N6YA 3RM0H 4GAWA 3MU4A 1FI8A 7ESTE 2NWNA 4A1TA 2GKVE 3LU9B 1BTUA 3GY8A 2A0QB 1Z71A 4OGXA 1S5SA 2QGRA 1BTYA 4MTBA 1WCZA 3A84A 4ZHAA 4B2BA 4BANB 1WUNH 2OTVA 4RSPA 3MO9A 1EOJA 3SU2A 2ANMH 3RMMH 1EZUC 1EZXC 3BTFE 2PUQH 1KLIH 7LPRA 3P8GA 3ZVEA 2ZTYA 1IOEA
chains in the Genus database with same CATH superfamily
1GPZA 3BIVH 2OQUA 3N7DA 1BTWA 3U69H 2IJD1 1J15A 2A5IA 4X6NA 3QLPH 1HPGA 2EI6A 3G01A 1TNGA 2ZFPH 7KMEH 3GYLB 5C17A 3OY5U 2WPLS 4ZMAH 1CT0E 1IQNA 3QN7A 5L2YH 2BYAX 3RLYH 1ACBE 2DE9A 4WF8A 3MO3A 1QRZA 3T2NA 1P9SA 1Q31A 4ACAA 3P8OA 1LHFH 1E1RD 2KCAA 1IQKA 1GCTB 1SSXA 4TT3D 1RGQA 1Z7KA 4NZLA 1W14U 1O38A 1EASA 1NRSH 3Q3YA 5JB9S 3WWFA 2FTMA 4FUJA 1SMFE 4Y79A 1FY4A 1YPGH 1BCUH 1ETTH 1CE5A 1KXDA 1O3OA 3VB3A 2K0QA 5AFZH 2FXRA 1EPTB 2G5VA 1YYY1 4P02A 1GMCG 1RTFB 1WQVH 4ABEA 3P6ZB 2R2WU 4Q7ZA 2D2DA 2BXTH 2VIPA 1GJ8B 1CHOG 1UW7A 1YCPH 3GDVA 3LGWA 5FBEA 2FOGA 4K3JA 2A5KA 2ASUB 1GI3A 4AC9A 1E38B 3KIDU 2O8UA 1TMUH 1OWEA 3AAUA 1QBNA 1V2ST 2ZGCA 1SFQB 1ZTKA 2XBWA 2ZDVH 2FMJA 1DM4B 4NG9H 4YTAA 2J4IA 1S6FA 4Y7AA 1A1RA 2V3HH 3SBKA 4CR5A 3PMJA 3ATWA 4B73A 1LHGH 4WXIA 1KY9A 4E7RG 1AKSB 1MUEB 1OKXA 5DP8A 4XBBA 2AIQA 3P92A 1OYTH 1BIOA 1NRNH 4TWYA 4Y71A 5HM9A 2P3TB 1Z1JA 5GCHF 1CA0C 4YESB 5K0HA 1DVAH 2GZ8A 5G4BA 2GCHF 3SNCA 1T8OA 3CNRA 1LVBA 1LMWB 2KM0A 1LKAA 4CR9A 4RKJB 2XCNA 2OQ5A 5GIBA 1UCYH 2Z3CA 2CF9H 1C5PA 1GI8B 4Q4LA 4GSOA 4X6MA 3SU1A 3TJNA 1ABIH 5IK2D 1UK2A 5CHBA 4IMQA 1BBRE 4FVDA 2AHME 3SQEE 4KKDA 2AIPA 4DG4A 3DSGA 1IQJA 3UY9A 1O36A 4YLUA 3A81A 1C5ZB 3AW1A 5DK1A 3GCHC 4BAKB 2A2XH 4YOJA 1K1JA 4INHA 3LGYA 2Y5FA 2H9TH 1MMJN 3UOUA 1ARCA 2FDAA 3PV4A 1QB6A 3MH7A 5ESBA 1N8OB 2Q6DA 1VR1H 4WWYA 2ZTZA 3ZVFA 1E1QD 5J4SA 2FODA 4NIXA 3T26A 1E0FD 1TOMH 2Z9GA 4H6SB 1GI7B 1J14A 4XBCA 2ZDLA 2C90B 1QQ4A 3A8AA 4Z1MD 4CBOA 1P57B 1V2PT 1ZMJA 3DSPA 5F8XA 2RCEA 2GV7A 2ZHQH 1C2HA 4I32A 4Y8YA 1UTLM 4I33A 3L3TA 2CK3D 3GCNA 5JB8S 2BDYA 1ZOMA 1NU9A 4B6FA 4ZKOU 1SL3A 3TGKE 2OC8A 1S0RA 1OOKB 2P3UB 3VGCB 1GI0A 5ESTE 2V0BA 1HIAA 1D9IA 2AMQA 3FFGA 1ORFA 4X2VA 1MTNC 1A3EH 2IOTA 4YO9A 1P2IA 3A7YA 4TY7A 1BZXE 2G4UA 3GS9A 1HNEE 4Y0YE 1ZLRA 1AQ7A 1QL8A 1SGRE 4AZ2B 4LZ1H 4K2YA 1A0JA 1K2I1 3RLWH 1F0SA 1EP6A 1C2JA 3SU6A 3PM3A 1KXBA 5LGOA 1SGFG 1SC8U 2H9HA 5JBTA 1LQDB 1ZSJA 3KN2A 3TK5A 1G32B 3EA7A 1LQEA 1A7SA 3MNXA 5E0JA 1O3MA 4FUEA 1GJ5H 5DN6D 1AIXH 5C2ZA 1QA7A 1JRSA 1GHYH 4ABIA 2Z94A 1O5CB 2H5CA 4AGJA 1H1BA 4X8TH 3RDZA 1CGIE 4FVBA 1TPAE 3RXVA 3RXRA 4XDEA 2VIQA 1GMDG 3UUZA 3P17H 1Z8RA 2BDBA 2ZPRA 1ZMNA 3UOPA 1DICA 1BITA 1F0TA 2DUCA 2BQ6B 3CS7A 4CRFA 4MVNA 4RI0A 2AGIX 5E0HA 5K7RA 1C5YB 2XTTB 3KHVA 2GT8A 1B0EA 2RG3A 3BEFB 3D49H 4Y76A 1O3GA 1TGCA 3RC6A 2HGTH 3MU5A 3PMAB 1GG6C 1SGCA 3M7QA 3IITA 2R3UA 2Q1JA 2V3OH 1EFRD 3PO1B 4MNXA 2VWMA 3U8RH 4ZHMU 3RXHA 1FLEE 3BTDE 1DWDH 3RMOH 1TBRH 5EPYA 1ZR0A 4IC6A 2Z9IA 1T31A 4YOGA 1MKXH 5EU8A 1K1IA 1BRUP 4ZXXH 3EE7A 5C5OA 3A86A 4UFFH 3M5NA 1SOTA 2Y5GA 3TH3H 3ENSB 3HGNA 1MCVA 1DLKB 2VWLA 2F9UA 1G3BA 1PPHE 1S6HA 2G00A 1GGDC 1TYNA 5HXFA 5FBIA 3A82A 1NTPA 4OS1A 1AB9C 2ESTE 4B75A 1QFKH 3MO6A 1RXPA 1NFUA 3E0PB 2J2UA 4H42U 6LPRA 5CHAB 3RMLH 3F0OA 1O5EH 4GHQA 1O3AA 1G30B 3LDXH 2IN2A 4LXBH 2ZGXH 3PLPA 3Q3KA 2XCFA 4ABHA 1JIRA 5IDKA 1YC0A 4ZHLU 4MNWA 3NK8A 4A1XA 3ZZBA 1QL9A 1OWIA 1OP8A 5DPAA 3M5MA 3H09A 2WPMS 1E79D 3A88A 4AGKA 1GMCF 1TABE 3RXAA 2Z9JA 3SJKA 2RA0A 1ETSH 1CHOF 1DWEH 1XKAC 1Y5UT 1INCA 1XUIA 3PWCA 2HRVA 4X8SH 2KCYA 3RXTA 3H7TA 2ZU1A 1CBWC 3SZNA 1JWTA 3ATKA 2ZFTA 3BTTE 2QV1A 1TQ7B 2FOMB 4X1PU 5I46H 4AFSA 1OWKA 3RXEA 5CMXH 2CHAC 4O03A 1HV7A 1MABB 3RM2H 1A46H 1GMHG 1OP0A 3SV2H 3SORA 3VXFH 4DJZB 1O2WA 1GL0E 1ZSKA 1IQEA 2SGDE 5C3NA 3E91A 1FONA 4XOJA 1NPMA 1TGBA 4Y8ZA 5IYTA 2BX3A 5FCKA 1QL7A 2OBQA 3BEUA 2CGAA 2HPPH 3OTJE 2KX4A 3SV8A 2B5TB 1NBMD 2I6SA 2FP7B 4DGJA 1SLUB 2HVXA 2F83A 2Y5HA 3ZVGA 2PSXA 2GTBA 3TPIZ 3UNSA 5EOKA 1KXFA 3BTME 2UUYA 1AU8A 5FPYA 1UVSH 3HKJB 4AX9H 1ZPBA 1EOLA 1H9HE 1V2MT 1BMAA 4ZKNU 1O2UA 2LPRA 2XC4A 2F3CE 3E6PH 2PKSB 3EDXB 2ALPA 1EAUA 1L2EA 1O39A 2G81E 1W3CA 2CMYA 1C1SA 5C20A 3UQVA 1W11U 1O5AB 1GBBA 4GPGA 2ZHEH 2Y82A 5FHTA 1Y5AT 3GDUA 3RXBA 4IN1A 2WYGA 1W13U 4A7IB 1A3BH 1UHBB 1CHGA 2ZCHP 4ASHA 5C67A 1V2KT 2THFB 2CV3A 3OYPA 3LJOA 1TOCB 2XNIA 1S84A 2Y7ZA 2PUXB 3S9BA 4CRCA 1LPGB 2A7JA 1ZPCA 2QF5A 3AW0A 5H4IB 1IAUA 2H2ZA 3ZVCA 1O3BA 4F4OC 1FUJA 5A0AE 1EXFA 1NY22 1QCPA 1KLJH 1ZZZA 1ID5H 1GJCB 3GISB 4M7GA 1MKWH 2QXGA 2LP6A 5JYIA 4K60A 2ZKSA 2HLDD 2P93A 3OEED 4FETA 3D62A 2GDEH 2R2MB 2OC7A 2XW9A 2JETC 2VINA 5A8ZA 1G3DA 1C2LA 1RJXB 2XC5A 3U9AH 2FOEA 4AB9A 5DP4A 1TBQH 5EW1H 1AE5A 1LPZB 1EZSC 4X1QU 1A5HA 3F9EA 1P2NA 1ZJDA 1ZHMA 3FP7E 3SJOA 4B2CA 1VCQA 2GD4B 1C5XB 2ZNKH 3QWCH 3F6UH 1O2JA 2PFEA 2VWNA 3OSYA 3Q77A 1YLDA 3PLKA 4WH8A 3RC5A 1E34B 1VCPA 4A5TS 1F2SE 1XX9A 2BD8A 2EY4C 3A7WA 3SI3H 1JBUH 1QBVH 5JBAS 1EX3A 2ZFRH 1VGCB 2EQNA 2OC0A 5AVDA 2GCTC 5EQQA 3S0NA 1OPHB 4ASUD 1SGPE 1C4Y2 2SNWA 3T29A 1DWBH 6ESTA 3MNBA 1MZAA 4VGCC 1FDPA 3DSOA 4NIWA 1KDQA 1VZQH 5A09A 5DP6A 1GMDF 1TPPA 1OWHA 1ZYOA 2BD4A 1BMLA 3HKIB 1QJ6B 1UK4A 1MTNB 5EXNA 1F7ZA 2QAAA 1Y8TA 1GHVH 1ELGA 1O3CA 5ABWA 3UWJH 9ESTA 1U6QA 3QDZB 3BG4B 4JYTA 5B6OA 4GHTA 4BAMB 4AN7A 1ELAA 3NPSA 3LT3A 4CRGA 3DD2H 2VU8E 2FM2A 2ZTXA 3GY2A 1HAOH 2O8TA 2ZA5A 1Y3YA 2J9NA 2ZF0H 3ZV9A 1K1NA 2JJ2D 1O2VA 3BSQA 1J17T 1DUAA 2ZU3A 2HPQH 1E37B 3LGVA 4OS2A 1TPSA 1QB1A 1MTWA 5JPMH 1SLWB 2B7DH 3M5LA 1SPJA 1Z8GA 4ABDA 1UTPA 2J5UA 4NIVA 1ZJKA 1P9UA 1BMNH 2ZDAH 2SGPE 4ZCNA 1QHRB 1EAXA 1SHYA 2QXHA 2YMSC 5GWZA 3BTWE 5I25A 1YPEH 1YKTA 3RC4A 2NU0E 1O2OA 3QGNB 1EUFA 3S7KB 1HXEH 1DDJA 2GMTB 1T7CA 1V2QT 2BVXH 2HWLB 3LJJA 1GG6B 1F0UA 2Z6BD 1FN6A 1A5IA 5HGGA 5AFYH 3F9FA 4MPVA 4D9QA 2LNCA 2C93B 2F91A 3W1EA 1D6RA 3MTYA 3MU0A 4K8YA 4KTSA 2V3MA 3SGAE 2VNTA 1QRXA 4CBNA 2G52A 1GDNA 1O2XA 1KTSB 1GVZA 4B74A 1GHAG 2M5TA 3MHWU 3VB7A 3ZV8A 3WWBA 3TK9A 3NUMA 4CHAB 2WV9A 5FPTA 1PJPA 1XMNB 3N7EA 3URCA 4JZ1A 2PR3A 4X1NU 3U1IB 2XXLA 1ZTLA 3S69A 1C1PA 3TNSA 4TPYA 1G2LA 2KAIA 5LPRA 1AUJA 1O2IA 3SHCH 2ODPA 4ZAEA 1NFWA 1AB9B 3OTPA 3KQCA 1B0FA 5EXMA 1GBAA 3M3VA 4RKOB 3UWIA 3F2GA 4D7GA 2FYQA 1CGJE 2GDDA 1AWFH 3LH1A 1TAWA 3K2UA 4MLFB 1FN8A 2BLVA 1NO9H 4K8BA 1HYLA 2VGCB 4OS7A 2C8YB 3UTUH 1BMMH 1GMHF 2WINI 3OX7U 1TX6A 2GP9B 1NROH 3V13A 3U8TH 1TGNA 2J98A 1O2PA 2ZHFH 1HAXB 2FPZA 1K22H 4SGBE 4WMDA 3MQKC 3CENA 3DHKH 5EODA 1MTUA 2O8WA 4XSKU 2GZ9A 5T1VA 3UREA 1O3LA 1MQ5A 1W0KD 3RXPA 2C8ZB 3RXCA 2F9PA 3K65B 1ZSLA 2BD7A 4U32A 3SUFA 3P8FA 4JYUH 2XWAA 1PPCE 4NFFA 1TGSZ 4FUIA 1OS8A 3U28C 3I29A 4MNYA 1PQ8A 4U01A 2D1JA 3PLBA 3A89A 3QZRA 2CHAB 3ZZ7A 2PWXA 1Z6EA 2BLOA 1TFXA 1LVOA 2PGBB 2R0KA 2FOAA 4NA7A 5T6GA 1TQ0B 4NZQA 2FEQH 1NN6A 1QIXB 3KCGH 1YCPM 5EIYA 2UWOA 4X2WA 1TNLA 1GJ7B 4FUCA 4X2YA 3QO6A 4X2XA 1NT1A 1O33A 3F2HA 2ZU4A 1C2IA 2PGQB 3M7UA 4BAHB 1O3IA 1W10U 4X0WU 2PV9B 3FANA 1F5RA 1PYTD 1EJAA 4A92A 1O5DH 4Y10E 1EP5A 2BMGB 4K5ZA 1YLNA 4IMZA 3FOAA 3V0XA 3O8CA 3UB0A 3SJ9A 1HJAC 2AGEX 2WUBA 2EC9H 3V12A 4LOYH 4BTIB 1MD7A 3QTOH 4CRAA 1KXEA 2BLQA 2HNTF 3ZVBA 5TJXA 1Y3WA 3URDA 1C2DA 1AFQB 2C8XB 2I6QA 4KELA 3UR9A 2DE8A 1C1NA 2BTCE 1THPB 2C3SA 3MMGA 2XBYA 3UR6A 1OWJA 2AERH 1NRPH 1O3EA 4J2YB 1P04A 3JZ1B 3TLOA 1DSUA 2J97A 4AYVB 1MU6B 3BTQE 3PTNA 2KCOA 2BVSH 3SU4A 3SUEA 1IQMA 1FY8E 1BJUA 2G51A 2PKAA 1SHHB 1YCPK 3ZZCA 1JOUB 1MD8A 4ABJA 1VJAU 2BB4A 4E7NA 1EAIA 2FLRH 1F5KU 4FUGA 1O2NA 1V3XA 3SOSA 1GBIA 1HAVB 1OXGA 5J4QA 4HGCA 3UNRA 1QURH 1TGTA 1K21H 2ANYA 1ZHPA 5EJ1A 1EZQA 2ZWLH 3RXOA 1PPFE 1QA0A 3OEHD 4INLA 1JRTA 6CHAC 2BY9X 2G5NA 2ZFQH 1A0LA 1SOZA 2VIWA 2FIRH 1V2JT 4D8NA 2ZI2H 5EG4A 1V2WT 1GI4A 4WJG2 4XBDA 3FVFB 1KLTA 2BLWA 4MDSA 1O3HA 3KQDA 1OSSA 4WMEA 1S0QA 3R3GB 2P59A 4Y0ZE 1KTTB 3PRDA 1FY3A 1AY6H 3KQ5A 1V2OT 2BDCA 3QX5H 1DX5M 1T8LA 1H8ED 1W0JD 2EEKA 3MWIU 2GT7A 1WYKA 2HOBA 3K6ZA 3IWMA 3RP2A 3RMNH 2PSYA 1UCYK 4YLQH 1G3CA 1KDQB 1UTJA 1BDAA 1XUHA 4TWWA 4VGCB 2TRMA 3ZZ8A 1BBRH 4TY6A 1GWAA 2WPDD 3RU4D 4DIHH 1TALA 4KTCA 1O3PB 2QYIA 1LO6A 1BHXF 4UFDH 3TITA 1C5TA 1WV7H 1ZPZA 1Q3XA 2YOLA 3DFLA 1FX0B 1VJ9U 5DKMA 3GYMA 3SNAA 2OUAA 3U8OH 2XWBI 4WVPE 1SB1H 3SI4H 3LIWA 4GCHG 5F53A 1YLCA 4Q7YA 1GVKB 1A4WH 2WPIS 1AVXA 3F1SB 4X8UH 1AWHB 1NFYA 1N6XA 2P8OB 4X6PA 1N1LA 4AYYB 1O2SA 2J94A 1C5VA 2QY0B 3STJA 1A5GH 1ANCA 1C5SA 1OP2A 1GHAF 2R9PA 2BD2A 3CP7A 2C4FH 1TWXB 1G37A 4UFEH 2PTCE 1FXYA 1EATA 2VIVA 2NU1E 1DSTA 4OGYA 2SFAA 4XE4A 2D8WA 3B9FH 4UEHH 2ZDKA 1S82A 3OFND 3HATH 1DE7H 1P3EA 2Z9KA 3W95A 5E0GA 3WY8A 1Y5BT 3ZZ5A 3AVZA 3KYFA 4BTTB 1FIZA 3PYHA 5A0BA 1ANBA 2ZP0H 3RU4T 1GDQA 3SQHE 1GCTC 2ZECA 2FWWA 2WUCA 2ZO3H 2VBCA 1YF4A 1DY9A 4I86A 1BRCE 2PTNA 3A7VA 4PROA 3T28A 1S81A 3UAIC 4BXWA 1K28D 1L4DA 1DY8A 2HLCA 2M2AA 2VVUA 1MBMA 1K9OE 3O8RA 2P3FH 3Q76A 4ZROA 1EB1H 1EPTC 2PP6A 1RRKA 3GY5A 6GCHG 2FX4A 5HMAA 5C0TA 1WAYB 1EPTA 5AF9H 3E1XB 4WY3A 3KGPA 3OY6U 3OAAD 1C2KA 1YPHE 5EQRA 5C1YA 3SV9A 1XM1A 3T5FH 1C1TA 1W2KH 1FPHH 1HGTH 3H7OA 2VVCA 4YXWD 4ISNA 2SGEE 3LC3A 1QRWA 1YPKH 3SU0A 1LHEH 5DSFA 2FESH 3SU3A 1NBME 1A2CH 2ZIQH 1NC6A 4FUHA 1D3PB 2BXUH 2NU2E 3NCLA 1YY3A 1HUTH 4YZUA 1AKSA 1O3KA 2Z9LA 3M7TA 4I31A 1FAXA 4ISHH 4I7YH 2EA3A 1GI9B 1P09A 3LC5A 2A7HA 2EI8A 3SUDA 1MKXK 1SGQE 1JXPA 2YMSD 2AMPA 1S6LA 3KYGA 3M61U 1IHTH 1TMBH 2PW8H 5HKKD 1ANEA 1O5GH 5GNDA 3F9HA 1KIGH 2TGAA 3TGJE 1OYQA 1XXDA 4FU8A 1BT7A 4GVUA 4I8HA 1AVGH 1NS3A 1Y3UA 3V7TA 1C5QA 1RTKA 3T62A 2W5EA 3VPKA 4UD9H 7GCHG 3QK1A 1CA0B 1WBGB 4DT4A 1C1RA 1P02A 8KME2 3I77A 5PTPA 1GHBG 1BTHH 3AAVA 1GJBB 5KGOA 1Y59T 2WPKS 3C27B 1SBWA 3TJUA 1GDUA 2HALA 5EJZA 2PHBA 3UQOA 9LPRA 1N8OC 1VKYA 3TU7H 2ZGHA 2W7SA 4FU7A 1ABJH 3S9AA 4B2AA 2YNBA 1YM0A 3QTVH 1FZZA 4I8JA 2IPHA 1AVWA 4GUXA 1ELBA 4I8LA 3PMBB 1W0ZU 1KYNA 2VH0A 5E2PA 3GCHB 1O5FH 2WPJS 1BJVA 1GHZA 3RXJA 3EA9A 4K1SA 2JJ1D 1TRYA 1XXFA 2QXIA 1K1PA 4IGDA 1UTNA 1DLEA 1PPGE 4Y8XA 4CREA 3L6PA 1C2GA 1COWD 3GOVB 3MH5A 1H9IE 3BTEE 2LELA 5E2OA 1ZHRA 2F9BH 1UK3A 1SQAA 1AGJA 1GJDB 2WZQA 3MU8A 3SUGA 3SJIA 4THNH 1YGCH 3ODDA 1J16A 1V2VT 2J34A 4Y11E 1C2FA 1ESBA 2ZCKP 2QF0A 1JIMA 3HK3B 1GHWH 1PQAA 2ZDNA 3MNCA 5T3HA 2JDID 2QE7D 1LKBA 1GJ4H 1CT4E 3QUMP 4TYDA 1K0HA 5B6LA 1HIAB 1QJ7B 2A4QA 2TGDA 5EXLA 1LCYA 1TX7A 1SLXB 4O3TA 3RXQA 2J95A 4JZFH 3SGQE 4ZXYH 1ZMLA 4IW4E 3EA8A 2ULLA 2UUKB 3GDSA 3TJOA 1V6DA 4YT7H 3KL6A 1DS2E 5JBBS 1TX8A 3LOXA 2SNVA 3ODFA 4HTCH 3LGIA 5JBCS 4U30A 3MH4A 1XKBC 5F8TA 3EGKH 4GCHF 1L1JA 1C4V2 1HCGA 3ZYDA 1RTLA 3E3TA 4Z0KA 1CA8B 1HLTH 1W0YH 1THRH 3MFJA 3P8NA 1K1MA 3BF6H 1ESTA 1HJ9A 4HZHA 1YPHC 1F5LA 4NA9H 3U1JB 1LHDH 4M9FA 1ELCA 1T4VH 2BDGA 4NA8A 4K1TA 2NU4E 4ZKSU 1GHXH 3PO1C 1MKWK 3RXUA 2Z7FE 2ZPSA 1GBTA 2ZFSA 1RFNA 1IHSH 1LVMA 2EI7A 3A7TA 2QA9E 1O3JA 1ZRKA 5T6DA 1GBFA 1OX1A 4AG1A 4U2WA 2ODQA 1PPBH 1NRRH 2UUFB 1J8AA 1SFIA 2BDIA 1D4PB 2BY6X 2RFKC 1TMTH 1ELFA 4MPXA 1QQUA 4JK5A 2AMDA 2F9OA 4OM9A 1VITG 4UFGH 5FCRA 4DY7B 2A4GA 2R0LA 4B1TA 3SN8A 4A6LA 4B71A 2BD3A 4DT7B 2BOHB 2BQ7B 3SYJA 1GJ9B 1QNJA 1XVMA 4AG2A 3VB4A 2OXSA 2FZZA 1HB0B 5FX6A 1H8HD 1T32A 1UTOA 1P01A 2ZGBH 4E05H 3A8BA 3NWUA 5CHAC 5JDUB 1SGIB 1XUKA 1EAWA 1C1OA 2GGVB 1ZGVA 2ZEBA 3ZZAA 2FOFA 1EQ9A 2ZCLP 5BPEA 1O2RA 1FV9A 5CE1A 1O5BB 1UCYE 1HAYB 3TH2H 2CF8H 3UPEA 3K6YA 1GGDB 1V2RT 2JH6D 6GCHF 1MQ6A 2QXJA 4BXSA 2VH6A 2WPHS 1DT2A 1O3DA 1V2TT 1BTXA 1FJSA 1C5UA 1VCWA 3VB6A 2AH4X 5C0UA 3STIA 3TGIE 1RS0A 1DFPA 4WMFA 1KXAA 3CS0A 4FUDA 2RDEA 2QC2A 2V35A 5E8EH 3RUOA 2B8OH 1WXRA 3AASA 2STBE 3ZYEA 5FAHA 2XC0A 3E90B 5GPIB 4Z6AH 3WW7A 1F0RA 1ZGIA 2ALVA 2STAE 3MU1A 3D23A 3A83A 1EB2A 4ESTE 1O0DH 1O32A 1TA6A 4YT6H 5TCCA 4TSFD 1D3QB 1Z8JB 1AN1E 3K9XB 3FO8D 4F49A 1MCTA 1SGNE 1HBTH 4NFEA 2W7UA 2VVVA 4ABGA 1GBKA 4OS6A 2FTLE 1EKBB 3SO3A 3V3MA 2GVFA 2ZGJA 1LTOA 3ATLA 3ATIA 1BA8B 2JH0D 3PV5A 2QIQA 1YP9A 4NCYA 5T6FA 2KCPA 2ZHDA 3I78A 1MTVA 1OHHD 1WTGH 2O8MA 2Q6FA 1SG8B 1V2NT 2K8IA 1DXPA 1G36A 1CBWB 5A8XA 4Q80A 3A87A 1O35A 2FYRA 2ZZUH 1C1UH 2YNAA 1SQOA 2WYJA 3MOCA 3A7XA 3PROA 4WH6A 4AORA 4MPWA 3E16B 3U98H 1O2KA 1NRQH 1THSH 5HM2A 4XD7D 1CT2E 2QF4A 3OE7D 2XYAA 2KZ4A 2F4LA 1TB6H 5A8YA 3LKWA 1QBOA 5EGMA 3A85A 2PKSC 1TRNA 4BNRA 7GCHF 3TH4H 1C1MA 4JCNA 1V2UT 1QJ1B 2SGFE 1FMGA 5L2ZH 3SHAH 5C1XA 1YBWA 5HIYA 1GHBF 1HAZB 1AO5A 1A0HB 1FY5A 2O8LA 2WV5A 5A0CA 2K1QA 1QGFA 2QN5T 5AHGH 2C8WB 4CH2B 2CXVA 4INKA 1NM6A 1UHBA 1P03A 3DA9B 8LPRA 1RIWC 2CJIA 2BY5X 1CQQA 1SQRA 4KP0A 3AK5A 4NIYA 5KEDA 4JK6A 2FI5E 2AEIH 2R3YA 3GICB 1MH0A 1ELTA 1Z1IA 1V2LT 2QF3A 1PFXC 3L33A 2A45B 5EW2H 1IQLA 1HFDA 2OD3B 1NFXA 2ZC9H 1RD3B 2A7CA 1UTQA 2BX4A 1EJMA 3BN9A 1DPOA 2G55A 1GBCA 1LPKB 2TGPZ 2TGTA 1H9LB 2XBVA 1SKYE 2VWOA 4SGAE 5A2MH 3SW2B 1O2YA 1HAIH 3ZZ3A 5ETXA 4IBLH 1TLDA 1GL1A 1PPEE 1CSOE 4FUFA 1UVPA 1MZDA 4A1VA 3E8LA 1PQ5A 3PB1E 1O3NA 1AZZA 4NSYA 2FI3E 2F9VA 3NRLA 4JZEH 5EPNA 3PV2A 3FZZA 3VB5A 1NU7B 1MTSA 3ITIA 2Z3DA 5GJ4B 3ZZDA 1MU8B 3ELAH 1SGYE 3SNDA 4JZDH 2RA3A 3MYWA 1BRAA 1P10A 2BD5A 4YM9A 5L6NH 4B6EA 2FOCA 1CGHA 1O2GH 2XOKD 3SV7A 2ZU5A 1GI6A 2BY8X 1GI1A 2AS9A 2JETB 4AB8A 2FX6A 1WSSH 3LPRA 2ZPQA 1VGCC 2FLBH 4MPUA 3DCLA 4DURA 3FKSD 3A7ZA 5DG6A 2A31A 2BY7X 3RXFA 1UVOA 1GJAB 2BHGA 1QTFA 3T25A 4HI3A 1W7XH 2F9NA 1CO7E 2JH5D 8GCHG 1SGFA 1FY1A 4X8VH 1FAKH 1O34A 3RXIA 3TK6A 1XUGA 1L1GA 5SGAE 3IG6B 4ABBA 4ISIH 1O2MA 1ZTJA 1TONA 1FPCH 1YWUA 2P95A 2V7QD 4I8KA 3TNTA 1FNIA 1Z6JH 1SGTA 3HPTB 4NWKA 3SV6A 3JZ2B 2TBSA 1P12E 4ZH8A 2IJOB 2GCTB 2AFQB 1SLVB 3BG4C 1IQHA 2XNDD 1LVYA 1H8DH 2Y6TA 3Q3XA 5DO4H 1UVUH 2KFWA 2B0FA 1C5RA 1P11E 4MG3A 2JKHA 1P8VC 2H5DA 3EE0B 2ZQ2A 3GCTG 1IQIA 3B8JA 3RU4E 2TPIZ 8ESTE 1L0ZA 4WXVA 1S83A 1UJ1A 4JMYA 4IN2A 3UIRA 4F48B 4B76A 5DP5A 1BB0B 4RT0A 1DWCH 2Y80A 3VG8A 4NSVA 1O2HA 1T8NA 4X6OA 2BZAA 2FOHA 3TJVA 3VXEH 1KMHB 4UDWH 2HNTE 5DP3A 4AFQA 2OLGA 1WTHD 2BQWB 2ZHWH 3S9CA 3GY7A 3PTBA 4BOHA 1BMFD 1YPJH 1BHXB 1SGEE 1VITF 4UE7H 4Q63A 1UO6A 3PWBA 2ILNA 2A4OA 3ATMA 1D3DB 4ACBA 4LK4A 4ISOA 2ODYB 3F68H 3DFJA 4F55A 1ZRBA 1HAGE 3ZZ6A 2GMTC 3LGUA 3FP8E 1GBDA 3SJ8A 1GI5A 2O9QA 3TIUA 1AUTC 3FAOA 3RXDA 1C5OH 4CRBA 3A8CA 2OK5A 2HVYB 2YMSB 1TNJA 4OS4A 1W7GH 2OBOA 2ANKH 4AFZA 4ZKRU 3PRBA 1O37A 1H8IH 4LZ4B 4Y6DA 3NZIA 3PMHB 4CHAC 3F3BA 1P2MA 2GZ7A 3ZZ4A 1ANDA 1TIOA 1PYTC 2PLXA 3O8BA 5GDSH 1G9IE 1P0SH 5EJLA 2V6NA 1C9PA 3BV9B 1O30A 2P94A 3SU5A 1BQYA 1LHCH 3GY4A 1SVPA 1C1VH 1MAYA 1XUFA 1W12U 1B7XB 1KXCA 5C1UA 5DJ7A 1NESE 2W3IA 4K1EA 5HIZA 3KQEA 4MQAA 1P3CA 1HJ8A 4P00A 5FXLA 4FU9A 2FO9A 2J92A 2VGCC 4J1YA 2WSSD 1GBJA 2BVRH 1GCDA 2SGQE 5FL7D 3MNSA 4FOUC 4CH8B 1HRTH 2GX4A 1C5MD 5DGJA 4ABAA 2KAIB 5LPFA 2UUJB 3M37A 3D65E 2OP9A 2SGAA 1G2MA 4H4FA 5FPSA 1E36B 1Y3XA 3KEEA 1TPOA 1UMAH 2RDLA 1L1NA 4O97A 2AYWA 5TCAA 3ZVAA 1F92A 3C1KA 1MBQA 2A32A 1BBRK 3FN8A 3FZDA 1FIWA 1XUJA 1ETRH 3KQBA 2J98B 1UTKA 4D7FA 1SI5H 1TA2A 1G3EA 3N7OA 2Q6GA 3TVJB 1GBLA 3EQ0H 2VIDA 1SQTA 3ZZ9A 1TNKA 3QGJA 1AI8H 1L4ZA 1PPZA 4Q2KA 3BTHE 5DP7A 1O2LA 1P05A 4KTUA 1T8MA 1QZ8A 4OS5A 1WDIA 3SNEA 2FOBA 1O2QA 1XVOA 4ZUHA 1OWDA 3GY3A 1ELEE 4R8TB 4DIIH 1SR5C 4GLYA 3VFEA 5F6MA 2G8TA 1GVLA 1O31A 1P2OA 3HGPA 1DANH 3KNXA 2W6JD 1K1OA 4D76A 2KR7A 4QT8C 1S85A 2A5AA 1TNHA 3RXLA 1BRBE 1WQSA 1GBHA 2H9EH 2Z3EA 2VJ1A 4ABFA 2XRCA 2BM2A 3ZIAD 1ELVA 4AFUA 1PQ7A 2BDHA 1BTZA 5BRRE 3P95A 1GI2A 1QR3E 2ANWA 1Y3VA 1C2MA 1AHTH 1DITH 3F9GA 4R0IA 3MH6A 2L74A 2WHXA 4BTUB 1B5GH 4BAQB 4BAOB 3M36A 3O8DA 2F43B 4X1RU 5L30H 2AGGX 3LONA 1LDTT 3BTGE 4DCDA 5F8ZA 2TIOA 5GXPA 3QZQA 3RXSA 2OCVB 3BTKE 2ZQ1A 5GCHG 1AFQC 1O2TA 5DP9A 2QCYA 2HNTC 1C2EA 2ZDMA 1BTPA 2GCHG 1YPMH 1GBMA 1RIWB 3A8DA 4KGAA 4XFQA 3W94A 2GJGA 1HJAB 1P2QA 3LH3A 2VB0A 3EYDA 1D3TB 1D6WA 1W8BH 5F03A 4AOQA 2W6ID 2JIZD 2ZFFH 3BEIB 2IPQX 2H1UA 3HK6B 1A61H 1NZQH 2D26C 3MI4A 3ZVDA 4ISLA 1T4UH 2BDAA 1ELDE 1VITH 4FUBA 3OU0A 1Z8IB 1C5WB 2ZU2A 4UONA 5LPEA 1WU1A 4DW2U 1UTMA 1DXWA 3VGCC 3LGTA 8GCHF 1AD8H 3H5CB 4I8GA 3DT0H 5C5NA 2P16A 3F2FA 1HAVA 1AZ8A 2WV4A 2XBXA 5EQSA 1FQ3A 2PKAB 1KSNA 3R0FA 3SGBE 4RT1A 2VIOA 4DOQA 1O3FA 3SNBA 1HAPH 2FS9A 1Q2WA 4NGAH 4CRDA 4X1SU 2CN0H 3P70B 1DUEA 1ESAA 2Y7XA 2A4RA 3B23B 3UFAA 1UVTH 1C4U2 3S7HB 1TE0A 2Y81A 1BOQA 3T27A 1AMHA 3Q00A 4HG6A 3NXPA 3GCTF 2A1DB 2BOKA 3M5OA 4IC5A 1C5LH 4O3UA 1HDTH 1TRMA 3VEQB 1X7AC 2UWPA 3RXGA 3ESTA 1HXFH 4D9RA 1C1QA 3M3TA 3FP6E 2UWLA 2L6OA 3M3SA 3N99A 4E06H 4JZIA 4XRNA 3RXMA 6CHAB 1J9CH 1YPLH 3NKKA 4MNVA 4JYVH 2A2QH 1M9UA 5FX5A 1BUIA 3KF2A 1P2JA 1TBZH 4DVAU 5HYOA 1P06A 4TPIZ 1O2ZA 1QB9A 2H6MA 2ZG0H 4K69A 1EJNA 4H6TA 1TNIA 1C5NH 1GBEA 4NWLA 1SGDE 1WOFA 3BG8A 3RXKA 1K1LA 3GCOA 2B9LA 1IQGA 1HAHH 2FS8A 3EAJA 2OINA 5KECA 1CU1A 1MAXA 2FI4E 5CDFE 3BIUH 4Q7XA 2BZ6H 2G4TA 3E0NB 2W3KA 3GY6A 1DOJA 2NU3E 5LH8A 3DUXH 1C1WH 1ARBA 2W26A 2OC1A 2P8OC 1P2KA 1C9TA 4O9VA 1GJ6A 4Y7BA 1H4WA 4FXGH 3SZEA 3UNQA 1E35B 1AE8H 1JMOH 1QY6A 3M35A 4YOIA 4IS5A 1CVWH 4RN6A 3A80A 1IQFA 2J38A 4HFPB 2BD9A 2GV6A 1AFEH 1N6YA 3RM0H 4GAWA 3MU4A 1FI8A 7ESTE 3F0PA 2NWNA 4A1TA 2GKVE 3LU9B 1BTUA 3GY8A 2A0QB 1Z71A 4OGXA 1S5SA 2QGRA 1BTYA 4MTBA 1WCZA 3A84A 4ZHAA 4B2BA 4BANB 1WUNH 2OTVA 4RSPA 3MO9A 1EOJA 3SU2A 2ANMH 3RMMH 1EZUC 1EZXC 3BTFE 5C94A 2PUQH 1KLIH 7LPRA 3P8GA 3ZVEA 2ZTYA 1IOEA
chains in the Genus database with same CATH topology
1GPZA 3BIVH 2OQUA 1BTWA 3U69H 1J15A 2A5IA 4X6NA 3QLPH 1HPGA 2EI6A 3G01A 1TNGA 2ZFPH 7KMEH 3GYLB 3OY5U 2WPLS 4ZMAH 1CT0E 1IQNA 3QN7A 5L2YH 2BYAX 3RLYH 1ACBE 2DE9A 4WF8A 3MO3A 1QRZA 3T2NA 1P9SA 1Q31A 3P8OA 1LHFH 1IQKA 1GCTB 1SSXA 1RGQA 1Z7KA 4NZLA 1W14U 1O38A 1EASA 1NRSH 3Q3YA 5JB9S 2FTMA 4FUJA 1SMFE 4Y79A 1FY4A 1YPGH 1BCUH 1ETTH 1CE5A 1KXDA 1O3OA 3VB3A 5AFZH 2FXRA 1EPTB 2G5VA 1YYY1 1GMCG 1RTFB 1WQVH 4ABEA 3P6ZB 2R2WU 4Q7ZA 2D2DA 2BXTH 2VIPA 1GJ8B 1CHOG 1YCPH 3GDVA 3LGWA 5FBEA 2FOGA 4K3JA 2A5KA 2ASUB 1GI3A 1E38B 3KIDU 2O8UA 1TMUH 1OWEA 3AAUA 1QBNA 1V2ST 2ZGCA 1SFQB 1ZTKA 2XBWA 2ZDVH 2FMJA 1DM4B 4NG9H 4YTAA 2J4IA 1S6FA 4Y7AA 1A1RA 2V3HH 3SBKA 4CR5A 3PMJA 3ATWA 4B73A 1LHGH 4WXIA 1KY9A 4E7RG 1AKSB 1MUEB 1OKXA 5DP8A 4XBBA 2AIQA 3P92A 1OYTH 1BIOA 1NRNH 4TWYA 4Y71A 5HM9A 2P3TB 1Z1JA 5GCHF 1CA0C 4YESB 5K0HA 1DVAH 2GZ8A 5G4BA 2GCHF 3SNCA 1T8OA 1LVBA 1LMWB 4CR9A 1LKAA 4RKJB 2XCNA 2OQ5A 5GIBA 1UCYH 2Z3CA 2CF9H 1C5PA 1GI8B 4GSOA 4X6MA 3SU1A 3TJNA 1ABIH 1UK2A 4IMQA 1BBRE 4FVDA 3SQEE 4KKDA 2AIPA 4DG4A 3UY9A 1IQJA 1O36A 4YLUA 3A81A 1C5ZB 3AW1A 5DK1A 3GCHC 4BAKB 2A2XH 4YOJA 1K1JA 4INHA 3LGYA 2Y5FA 2H9TH 1MMJN 3UOUA 1ARCA 2FDAA 3PV4A 1QB6A 3MH7A 5ESBA 1N8OB 2Q6DA 1VR1H 4WWYA 2ZTZA 3ZVFA 5J4SA 2FODA 4NIXA 3T26A 1E0FD 1TOMH 2Z9GA 4H6SB 1GI7B 1J14A 4XBCA 2ZDLA 2C90B 1QQ4A 3A8AA 4CBOA 1P57B 1V2PT 1ZMJA 5F8XA 2RCEA 2GV7A 2ZHQH 1C2HA 4I32A 4Y8YA 1UTLM 4I33A 3L3TA 3GCNA 5JB8S 2BDYA 1ZOMA 1NU9A 4ZKOU 1SL3A 3TGKE 2OC8A 1S0RA 1OOKB 2P3UB 3VGCB 1GI0A 5ESTE 2V0BA 1HIAA 1D9IA 2AMQA 3FFGA 1ORFA 4X2VA 1MTNC 1A3EH 2IOTA 4YO9A 1P2IA 3A7YA 4TY7A 1BZXE 2G4UA 1HNEE 4Y0YE 1ZLRA 1AQ7A 1QL8A 1SGRE 4AZ2B 4LZ1H 4K2YA 1A0JA 1K2I1 3RLWH 1F0SA 1EP6A 1C2JA 3SU6A 3PM3A 1KXBA 5LGOA 1SGFG 1SC8U 2H9HA 5JBTA 1LQDB 1ZSJA 3KN2A 3TK5A 1G32B 3EA7A 1LQEA 1A7SA 3MNXA 5E0JA 1O3MA 4FUEA 1GJ5H 1AIXH 5C2ZA 1QA7A 1JRSA 1GHYH 4ABIA 2Z94A 1O5CB 2H5CA 4AGJA 1H1BA 4X8TH 3RDZA 1CGIE 4FVBA 1TPAE 3RXVA 3RXRA 4XDEA 2VIQA 1GMDG 3UUZA 3P17H 1Z8RA 2BDBA 2ZPRA 1ZMNA 3UOPA 1DICA 1BITA 1F0TA 2DUCA 2BQ6B 3CS7A 4CRFA 4MVNA 2AGIX 5E0HA 5K7RA 1C5YB 2XTTB 3KHVA 2GT8A 1B0EA 2RG3A 3BEFB 3D49H 4Y76A 1O3GA 1TGCA 3RC6A 2HGTH 3MU5A 3PMAB 1GG6C 1SGCA 3M7QA 3IITA 2R3UA 2Q1JA 2V3OH 3PO1B 4MNXA 2VWMA 3U8RH 4ZHMU 3RXHA 1FLEE 3BTDE 1DWDH 3RMOH 1TBRH 5EPYA 1ZR0A 4IC6A 2Z9IA 1T31A 4YOGA 1MKXH 5EU8A 1K1IA 1BRUP 4ZXXH 5C5OA 3A86A 4UFFH 3M5NA 1SOTA 2Y5GA 3TH3H 3ENSB 3HGNA 1MCVA 1DLKB 2VWLA 2F9UA 1G3BA 1PPHE 1S6HA 2G00A 1GGDC 1TYNA 5HXFA 5FBIA 3A82A 1NTPA 4OS1A 1AB9C 2ESTE 4B75A 1QFKH 3MO6A 1RXPA 1NFUA 3E0PB 2J2UA 4H42U 6LPRA 5CHAB 3RMLH 1O5EH 4GHQA 1O3AA 1G30B 3LDXH 2IN2A 4LXBH 2ZGXH 3PLPA 3Q3KA 2XCFA 4ABHA 1JIRA 5IDKA 1YC0A 4ZHLU 4MNWA 3NK8A 4A1XA 3ZZBA 1QL9A 1OWIA 1OP8A 5DPAA 3M5MA 2WPMS 3A88A 4AGKA 1GMCF 1TABE 3RXAA 2Z9JA 3SJKA 2RA0A 1ETSH 1CHOF 1DWEH 1XKAC 1Y5UT 1INCA 1XUIA 3PWCA 2HRVA 4X8SH 3RXTA 3H7TA 2ZU1A 1CBWC 3SZNA 1JWTA 3ATKA 2ZFTA 3BTTE 2QV1A 1TQ7B 2FOMB 4X1PU 5I46H 4AFSA 1OWKA 3RXEA 5CMXH 2CHAC 4O03A 1HV7A 3RM2H 1A46H 1GMHG 1OP0A 3SV2H 3SORA 3VXFH 4DJZB 1O2WA 1GL0E 1ZSKA 1IQEA 2SGDE 5C3NA 3E91A 1FONA 4XOJA 1NPMA 1TGBA 4Y8ZA 5IYTA 2BX3A 5FCKA 1QL7A 2OBQA 3BEUA 2CGAA 2HPPH 3OTJE 3SV8A 2B5TB 2I6SA 2FP7B 4DGJA 1SLUB 2HVXA 2F83A 2Y5HA 3ZVGA 2PSXA 2GTBA 3TPIZ 3UNSA 5EOKA 1KXFA 3BTME 2UUYA 1AU8A 5FPYA 1UVSH 3HKJB 4AX9H 1ZPBA 1EOLA 1H9HE 1V2MT 1BMAA 4ZKNU 1O2UA 2LPRA 2XC4A 2F3CE 3E6PH 2PKSB 3EDXB 2ALPA 1EAUA 1L2EA 1O39A 2G81E 1W3CA 2CMYA 1C1SA 5C20A 3UQVA 1W11U 1O5AB 1GBBA 4GPGA 2ZHEH 2Y82A 5FHTA 1Y5AT 3GDUA 3RXBA 4IN1A 2WYGA 1W13U 4A7IB 1A3BH 1UHBB 1CHGA 2ZCHP 4ASHA 5C67A 1V2KT 2THFB 2CV3A 3OYPA 3LJOA 1TOCB 2XNIA 1S84A 2Y7ZA 2PUXB 3S9BA 4CRCA 1LPGB 2A7JA 1ZPCA 3AW0A 5H4IB 3ZVCA 1IAUA 2H2ZA 4F4OC 1O3BA 5A0AE 1FUJA 1EXFA 1NY22 1QCPA 1KLJH 1ZZZA 1ID5H 1GJCB 3GISB 4M7GA 1MKWH 2QXGA 5JYIA 4K60A 2ZKSA 2P93A 3D62A 2GDEH 2R2MB 2OC7A 2XW9A 2JETC 2VINA 5A8ZA 1G3DA 1C2LA 1RJXB 2XC5A 3U9AH 2FOEA 4AB9A 5DP4A 1TBQH 5EW1H 1AE5A 1LPZB 1EZSC 4X1QU 1A5HA 3F9EA 1P2NA 1ZJDA 1ZHMA 3FP7E 3SJOA 4B2CA 1VCQA 2GD4B 1C5XB 2ZNKH 3QWCH 3F6UH 1O2JA 2PFEA 2VWNA 3OSYA 3Q77A 1YLDA 3PLKA 4WH8A 3RC5A 1E34B 1VCPA 4A5TS 1F2SE 1XX9A 2BD8A 3A7WA 3SI3H 1JBUH 1QBVH 5JBAS 1EX3A 2ZFRH 1VGCB 2OC0A 5AVDA 2GCTC 5EQQA 3S0NA 1OPHB 1SGPE 1C4Y2 2SNWA 3T29A 1DWBH 6ESTA 3MNBA 1MZAA 4VGCC 1FDPA 4NIWA 1KDQA 1VZQH 5A09A 5DP6A 1GMDF 1TPPA 1OWHA 1ZYOA 2BD4A 1BMLA 3HKIB 1QJ6B 1UK4A 1MTNB 5EXNA 1F7ZA 2QAAA 1Y8TA 1GHVH 1ELGA 1O3CA 5ABWA 3UWJH 9ESTA 1U6QA 3QDZB 3BG4B 4JYTA 5B6OA 4GHTA 4BAMB 4AN7A 1ELAA 3NPSA 3LT3A 4CRGA 3DD2H 2VU8E 2FM2A 2ZTXA 3GY2A 1HAOH 2O8TA 2ZA5A 1Y3YA 2J9NA 2ZF0H 3ZV9A 1K1NA 1O2VA 3BSQA 1J17T 1DUAA 2ZU3A 2HPQH 1E37B 3LGVA 4OS2A 1TPSA 1QB1A 1MTWA 5JPMH 1SLWB 2B7DH 3M5LA 1SPJA 1Z8GA 4ABDA 1UTPA 4NIVA 1ZJKA 1P9UA 1BMNH 2ZDAH 2SGPE 1QHRB 1EAXA 1SHYA 2QXHA 5GWZA 3BTWE 5I25A 1YPEH 1YKTA 3RC4A 2NU0E 1O2OA 3QGNB 1EUFA 3S7KB 1HXEH 1DDJA 2GMTB 1T7CA 1V2QT 2BVXH 2HWLB 3LJJA 1GG6B 1F0UA 2Z6BD 1FN6A 1A5IA 5HGGA 5AFYH 3F9FA 4MPVA 4D9QA 2LNCA 2C93B 2F91A 1D6RA 3MTYA 3MU0A 4K8YA 4KTSA 3SGAE 2VNTA 1QRXA 4CBNA 2G52A 1GDNA 1O2XA 1KTSB 1GVZA 4B74A 1GHAG 2M5TA 3MHWU 3VB7A 3ZV8A 3TK9A 3NUMA 4CHAB 5FPTA 1PJPA 1XMNB 3URCA 4JZ1A 2PR3A 4X1NU 3U1IB 2XXLA 1ZTLA 3S69A 1C1PA 3TNSA 4TPYA 1G2LA 2KAIA 5LPRA 1AUJA 1O2IA 3SHCH 2ODPA 4ZAEA 1NFWA 1AB9B 3KQCA 1B0FA 5EXMA 1GBAA 3M3VA 4RKOB 3UWIA 4D7GA 2FYQA 1CGJE 2GDDA 1AWFH 3LH1A 1TAWA 3K2UA 4MLFB 1FN8A 2BLVA 1NO9H 4K8BA 1HYLA 2VGCB 4OS7A 2C8YB 3UTUH 1BMMH 1GMHF 2WINI 3OX7U 1TX6A 2GP9B 1NROH 3V13A 3U8TH 1TGNA 1O2PA 2ZHFH 1HAXB 2FPZA 1K22H 4SGBE 4WMDA 3CENA 3DHKH 5EODA 1MTUA 2O8WA 4XSKU 2GZ9A 3UREA 1O3LA 1MQ5A 3RXPA 2C8ZB 3RXCA 2F9PA 3K65B 1ZSLA 2BD7A 4U32A 3SUFA 3P8FA 4JYUH 2XWAA 1PPCE 4NFFA 1TGSZ 4FUIA 1OS8A 3I29A 4MNYA 1PQ8A 4U01A 2D1JA 3PLBA 3A89A 3QZRA 2CHAB 3ZZ7A 2PWXA 1Z6EA 2BLOA 1TFXA 1LVOA 2PGBB 2R0KA 2FOAA 4NA7A 5T6GA 1TQ0B 4NZQA 2FEQH 1NN6A 1QIXB 3KCGH 1YCPM 2UWOA 4X2WA 1TNLA 1GJ7B 4FUCA 4X2YA 3QO6A 4X2XA 1NT1A 1O33A 2ZU4A 1C2IA 2PGQB 3M7UA 4BAHB 1O3IA 1W10U 4X0WU 2PV9B 3FANA 1F5RA 1PYTD 1EJAA 4A92A 1O5DH 4Y10E 1EP5A 2BMGB 4K5ZA 4IMZA 3V0XA 3O8CA 3SJ9A 1HJAC 2AGEX 2WUBA 2EC9H 3V12A 4LOYH 4BTIB 1MD7A 3QTOH 4CRAA 1KXEA 2BLQA 2HNTF 3ZVBA 5TJXA 1Y3WA 3URDA 1C2DA 1AFQB 2C8XB 2I6QA 4KELA 3UR9A 2DE8A 1C1NA 2BTCE 1THPB 2C3SA 3MMGA 2XBYA 3UR6A 1OWJA 2AERH 1NRPH 1O3EA 4J2YB 1P04A 3JZ1B 3TLOA 1DSUA 4AYVB 1MU6B 3BTQE 3PTNA 2BVSH 3SU4A 3SUEA 1IQMA 1FY8E 1BJUA 2G51A 2PKAA 1SHHB 1YCPK 3ZZCA 1JOUB 1MD8A 4ABJA 1VJAU 2BB4A 4E7NA 1EAIA 2FLRH 1F5KU 4FUGA 1O2NA 1V3XA 3SOSA 1GBIA 1HAVB 1OXGA 5J4QA 4HGCA 3UNRA 1QURH 1TGTA 1K21H 2ANYA 1ZHPA 1EZQA 2ZWLH 3RXOA 1PPFE 1QA0A 4INLA 1JRTA 6CHAC 2BY9X 2G5NA 2ZFQH 1A0LA 1SOZA 2VIWA 2FIRH 1V2JT 4D8NA 2ZI2H 5EG4A 1V2WT 1GI4A 4WJG2 4XBDA 3FVFB 1KLTA 2BLWA 4MDSA 1O3HA 3KQDA 1OSSA 4WMEA 1S0QA 3R3GB 2P59A 4Y0ZE 1KTTB 1FY3A 1AY6H 1V2OT 2BDCA 3QX5H 1DX5M 1T8LA 2EEKA 3MWIU 2GT7A 1WYKA 2HOBA 3K6ZA 3IWMA 3RP2A 3RMNH 2PSYA 1UCYK 4YLQH 1G3CA 1KDQB 1UTJA 1BDAA 1XUHA 4TWWA 4VGCB 2TRMA 3ZZ8A 1BBRH 4TY6A 1GWAA 3RU4D 4DIHH 1TALA 4KTCA 1O3PB 2QYIA 1LO6A 1BHXF 4UFDH 3TITA 1C5TA 1WV7H 1ZPZA 1Q3XA 2YOLA 3DFLA 1VJ9U 5DKMA 3GYMA 3SNAA 2OUAA 3U8OH 2XWBI 4WVPE 1SB1H 3SI4H 3LIWA 4GCHG 1YLCA 4Q7YA 1GVKB 1A4WH 2WPIS 1AVXA 3F1SB 4X8UH 1AWHB 1NFYA 1N6XA 2P8OB 4X6PA 1N1LA 4AYYB 1O2SA 2J94A 1C5VA 2QY0B 3STJA 1A5GH 1ANCA 1C5SA 1OP2A 1GHAF 2R9PA 2BD2A 3CP7A 2C4FH 1TWXB 1G37A 4UFEH 2PTCE 1FXYA 1EATA 2VIVA 2NU1E 1DSTA 4OGYA 2SFAA 4XE4A 2D8WA 3B9FH 4UEHH 2ZDKA 1S82A 3HATH 1DE7H 1P3EA 2Z9KA 3W95A 5E0GA 3WY8A 1Y5BT 3ZZ5A 3AVZA 4BTTB 1FIZA 3PYHA 5A0BA 1ANBA 2ZP0H 3RU4T 1GDQA 3SQHE 1GCTC 2ZECA 2FWWA 2WUCA 2ZO3H 1YF4A 1DY9A 1BRCE 2PTNA 3A7VA 4PROA 3T28A 1S81A 4BXWA 1K28D 1L4DA 1DY8A 2HLCA 2VVUA 1MBMA 1K9OE 3O8RA 2P3FH 3Q76A 4ZROA 1EB1H 1EPTC 1RRKA 3GY5A 6GCHG 2FX4A 5HMAA 1WAYB 1EPTA 5AF9H 3E