2BDNL

Crystal structure of human mcp-1 bound to a blocking antibody, 11k2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
DIQMTQSSSSFSVSLGDRVTITCKATEDIYNRLAWYQQKPGSAPRLLISGATSLETGVPSRFSGSGSGKDYTLSITSLQTEDVATYYCQQFWSAPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small inducible cytokine A2
publication title Structure activity relationships of monocyte chemoattractant proteins in complex with a blocking antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2005-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bdnL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bdnL01
3GNML 3RWIB 3U7WL 4H20L 2MWCA 4XMPL 4F7PA 2FYYB 5AUMA 4IDLA 5AZ2L 1BECA 4N8CH 3CSYB 4G7YH 1FAKT 1OP3K 1RJYB 3KS0H 4IRZH 3WIHH 3HNTH 1XIWB 4O9HH 4MAYD 5I18L 5A2IH 4CVWA 4Z95H 1UT9A 3D85D 1U36A 4P59L 4K8RH 2C3VA 3KPMB 4U0QB 3LN5A 4I3SL 1DFBL 4LLMB 1S9VA 5I75B 4XP4H 3VWKD 1Q0XH 3DMMB 4C56D 4GRMB 4XAKE 3VXUA 1RZIB 5TE4H 4MA7L 1CGTA 3P0GB 1LILA 4CUCA 4FTVB 4OFKA 1B2WH 3SDAC 1MF2L 3OX8B 4Y5VB 2C4FT 3Q6GH 4O4YL 3V52H 1BM3H 4L3EE 2D31A 3U83A 1IAIL 2QSCH 2V9QA 4FFYL 1UFUA 1YNKH 1KUMA 3EFFB 4YHNB 5JXAH 3GMLA 1OGAB 1IGYA 3H8NA 5ADPL 2QHRH 4OZGE 2AQ3A 3VFUA 3F6LA 3LH2H 4LSRL 1F58L 1HZHL 1UVQA 3KLAA 1NC4A 5D1ZC 3REVB 5I76B 1PFCA 2Q86B 3UJJL 3QQ3A 2BSSB 3RWEB 3KPSE 2DD8H 1NMAH 1S7VA 1JV5A 3QUZB 1U95B 2ZCKL 4AH2A 4E9LA 4NKOA 4PLJC 1LDSA 3HG1E 3AXLB 5D96C 2VZUA 1YY8B 1S8DB 2HT3C 5T5NF 4NKIH 2L4OA 1YEIH 5FYJD 1CDIA 2BJML 3B5HA 4NBYB 1QBBA 5GSRB 4JZJA 5KTEH 1JMZA 4P23A 5JR1L 1A0QH 3WFEH 3WIHA 3JTSB 2K7QA 4Z6AT 3U0PA 4ODSH 5E8NA 3SO3B 1A1OB 3CLEL 1YPZF 3NA9H 5FA3A 2IH1B 1QLEL 4M4PA 1F3JB 3VXNB 4AENB 4WV1C 2MPAL 2BFVH 5FF6A 4ZAKB 1II4E 1F2XK 4WENB 4UNVA 4JKPL 3D2UD 1PYWB 2AJUH 1QR1B 2F15A 4LCWD 4HJ0D 3DV6B 4DK3A 1MCCA 4OCRH 5H37H 1HYRC 2LE9A 2Q8AL 1CLCA 1FJ1A 3I75A 1KN4H 5C2BL 1C5BL 4OI9A 4YHMH 3V5KA 4PJ7E 1MJ7L 4Z7UF 3QUYC 4Y4FB 4QRQB 1AFVL 4F9LA 1Q0YL 5J12C 1I7TB 1F11B 3TO2B 4U6HA 4K3JH 3ILQC 3G6AA 3NVQA 2EIZB 5MENB 3BDYH 3TA3C 4QRPD 5F7HA 3OKNA 5BRZB 3BZDA 4OAWB 5IMMB 4QTIL 5CCKH 1HH9A 1HEZB 1IMHC 3E6HB 3JTTB 2ZZUT 3LIZL 4LAJH 1YYML 2A77H 2PXYA 3H42H 2KKQA 3VH8G 5BVPL 2ZJSH 5DQDH 4D0DB 1RK1B 3T4AA 2IBZY 2VLLB 3NOIA 1RJLB 4X6BB 3UC0H 3B9AA 3V9FA 4M6OL 1XGYL 3F5WA 2VXUL 4DGVH 5D7IF 4MAYA 2IWGA 3RWFB 4GKSA 3D85A 3GMNB 4LLUB 1L0XA 2FSEB 1DBKH 4P5MA 3O6FB 3VXQB 3MRIA 3VWKA 3HMWH 2EEDA 2ZNXA 4C56A 4OCSL 3WFHB 5BW7C 4HWEH 1JFQL 4JHWH 5GGSA 2DQJH 2EDYA 2AI0L 4LAQL 5B39B 5EZJA 2VL4A 1OM3L 4QHNB 4PRAA 1NMCB 3BZ4B 3FB6B 4ZOBA 4Q6IA 5FCUL 2X4RB 4TOYH 3BE1L 3M17B 4JREC 4LNRA 3LKOB 3PIQA 1PQZA 2DTMH 4RFEA 1SY6L 2B20A 4WW2B 4M93B 5H8DA 1NAKH 2BERA 4F8QA 3H9YA 3OGCB 2D7QA 4M7ZB 3ZKSD 4M00A 3B5GA 2ORBH 3I9GH 1ZLVH 3ZE2F 4BQ6A 5IVXE 5EN2B 1I9EA 3BIKB 4NFDA 3BGMA 1QG3A 4PLOB 3VG9C 3OSKA 3MXVH 2FR4B 4MHHG 4JHAL 5D2LA 4S0SD 1YMMB 5TE7L 1X5ZA 3EDKA 4JM2C 5IBLC 3BKJL 3MBXL 2FX8L 4OCLC 5F21B 5GISH 2AQ2A 1W0VB 4MNHB 3WMSA 4KMQA 3THMH 3EDFA 4PJHE 4UB0L 3S3PA 3L5JA 3RVUC 4DGIL 4HXBL 5CUSH 3T65B 3O3EB 2UUDK 4YE4H 3P40A 4OB5H 3ABZA 1YQ2A 4L3CA 4WCYH 4NZRL 1T5WA 3RL1A 2NTFB 4RGNC 2VC2L 1T20A 1MHPL 2GY7B 1BIHA 1AI1L 4LPXA 1ZHKA 3V2AR 4W6WB 3IFLH 4N90E 4Y2OA 5I1GH 2VO5A 4UTAL 2OJEA 4I48A 4PJ5B 5GSVB 1CDHA 4ZUWA 3D2UA 4D9QE 3TNNB 1F4YL 2VMFA 3GK8L 4NJAH 4JZNA 1LO5B 4JM4L 2BDNL 2JB5L 4M02A 1VFAB 4LCWA 4NDMB 3MCKA 2NLJA 3UAJC 1CIUA 1GGYA 5HVWA 3F12B 2IPKA 3PGFH 2J88L 3HZMB 4HCRH 1UWEH 3ARFB 4DVBA 3H9SB 3BEWA 4PGEB 3QWRD 5JHDE 3ZKQD 5E2VH 4HIEA 5E7FA 2HMIC 2QR0A 2X4NA 2EIBA 3KXFE 2NX5E 1FP5A 4R4BA 1CFTB 4Y4KC 3QI9D 3UYOD 4QRPA 4NM8H 1OAZH 2GJZA 5ECJE 2CIKB 2YD4A 5GRZA 4E0RA 1U8PB 1WJ3A 4G6FB 4JO2L 1INQB 4I2XA 4ZUUB 4PJXE 4UUJB 5GGUB 3TNMA 4MJIE 4CADB 2VXTH 2VJXA 1BVKB 4MNGA 2QSQA 1KIPB 5E1AB 5IROA 4DUVA 1A8JH 5C7XH 1AD0B 2Y07L 2HJKB 5IJKA 3G6DL 1U3HC 5DJCA 4LVOB 5GS1C 3TVMB 1RU9L 3S3SA 5LGKA 1ZANH 4NT6B 5HHMB 3MYJB 4HFUL 1ERNA 1DQMH 1LO2L 5E08H 2ZOKB 1IM3A 1U8LB 2FECI 4PY7A 1HNFA 3HPJB 2G60L 3UMTA 4Z9KB 4L9LB 5KVEH 1IEHA 3CVIL 4TSCL 2MFNA 1DE4A 4XZUA 3EO0B 1CVSC 4HV8A 3JWDC 2VDNL 4FTVE 5DMGC 1JBJA 4XNZB 1GC1H 1E6OL 1CTOA 2AJXL 5E4EC 1I9JH 4K3HA 2RQ8A 1NCBL 2YPKA 3IDIB 4U05A 5F9OL 4F33B 4ZXBB 1MFNA 4HCRA 3C60B 2LQRA 2EDKA 1K2DB 4XCNA 5I19L 1HWHB 4X83A 3KPOA 4OF6A 5ADOH 5FK9A 4M6NH 1JTTA 1MIML 1CL7L 1HXMA 1JI2A 1NGXA 3A6CL 2M8XA 3D25B 1VGKA 3DO3A 2VDPH 5DFVD 2CMRH 3WNNA 2JK5A 1NC2B 2A6DA 3G5XB 4BZ2L 1CZ8H 1PAMA 4ODUB 1T89A 1NCNA 3BWAA 3CXHK 1CDBA 5HVHC 2DM7A 3H7BA 1H5BB 3O6KH 2P5WE 2BRQA 4Y88A 5CGMA 2ERJC 4OF0A 2E8YA 3KWWA 3OZ9L 1R5IB 3WEXA 2ED7A 2R1WA 2CJUH 3OKDA 3DETD 4PD4K 4XNXH 1J18A 4UT7L 1FLRH 1HKLH 2R8SL 1I8KA 3BN3B 4HWUA 3WD5L 3IETB 4NRXA 1A6AA 5DD0H 3QG6A 1GXEA 3E1F1 2ZOLB 4XTRD 3EGSB 4HH9B 4HULB 2R2CA 1ETZB 4K94C 1YEGL 1EJOL 5HI3D 4UAOB 4H88H 4F7CA 1NCAL 2PO6D 3FO0H 2FCBA 4X7TB 3RJQB 2QQNH 4FMKA 1T21B 4KJYB 1JNHA 4J3TA 3V5HB 1KB9K 3ALPA 3DUSA 4QHMA 3RL2A 2PN5A 2EXYC 1I7RB 1MNUL 3IDUA 1NH6A 2H41A 3QWRA 3O3AB 4JFPA 5D1XC 5SX5K 5HGDB 1T1ZA 3D0VA 4F37K 4P46D 1I4FB 3QI9A 3D39B 4TULH 1W8NA 2RFXA 3FFCB 1BQLL 4ZFGH 4Z76B 3RUGF 5MENE 3CFKA 2NY7L 1ZHBB 5DUPL 3L3IA 4U1HA 3RWCB 5BRZE 1V7NH 1LHZA 3FTGA 1MCLA 2VLRD 3I6GA 4I0CC 5BOPA 2K1MA 5GGSY 4I1NB 4NZTH 4MNQD 43CAB 3JV5A 4LLYA 1OB1A 3PWPB 1A6VL 1ZK9A 3Q5YA 4YHOL 2FLRT 4W4NA 1T2QH 3UYPA 4H1LH 3FB7A 2FL5A 4PRIB 1V7ML 2F54D 3PWLA 3DO7B 4HIHA 1F90L 4M1CD 4MZ3A 2F8XC 3NABH 1LO0H 3LSOA 3T8XA 4HBCH 1E4WH 1UEYA 4IRSB 3WE6B 3IU3B 3QA3A 4RISH 2OTPA 5CWSA 4Z0XA 1G7HB 1MHHA 1U41A 3AU1A 2N56A 2OJZL 1OHQA 1EIBA 2OM5A 1KBGL 1RZJH 3ULUD 3D0LB 5JPNB 1RIUH 5CLWA 4FFZH 1IM9B 5FYKE 3MRNA 4DUXA 5HPOA 2EYTB 3DVNB 3S35L 3ARRA 3BZFA 4U1IA 3ULVH 1OAXL 4YFDB 5MHSD 2E5EA 3MOAL 3O4OC 1CFQB 3U9UA 5BQ7B 1RURH 4IIQC 2PUQT 2I5YL 5I8KH 1ZHNA 2NTSP 1M7IB 2ZUQB 3TBYB 3MLYL 5A3ID 2J8UB 5IESL 4MA3B 3U9PL 5HXMA 1CWVA 1AQKL 5T33H 1NCWL 1JZ5A 1G7QB 2D3VA 5IVNA 4LBEA 5KG9A 4OF7A 1LEGB 1L7TH 4S1RL 1U8IA 3O3BB 1H8NA 2AP2A 4DCQA 3CZFA 2WIIB 2AXHA 3ZMRA 1MRDH 2DJUA 3QCVL 2P43B 1YMME 4UIMA 5DZOA 2QADD 1XF5A 3DYMA 4JKLA 3V7MA 4RRPG 1A7BA 3BESR 5FUZL 5J56B 3FONA 4AJ0A 5D2NC 3RHWK 3TCLA 4IRJD 1P6AB 1MOEA 5SX4H 1CGSH 4H1LA 1FL6B 1OVZA 1Q1JL 2NNAB 3GMQB 2GYSA 1CXIA 4X6FB 2A6KA 4PREA 3ZKXC 3MLXH 3WNPA 4LQFH 5E6IB 5JORA 1HHHB 1AGEB 1BPVA 5CEYA 3CXDL 4WI9A 4NQUA 1FPTL 3ULUH 2FHFA 1VFMA 2X1PA 2J6EH 3N9GH 5E4IA 4RGMC 3SJVD 3LEYH 1ZHLA 1G6RB 3FN9A 3CIQA 3TO4D 2XY1A 4ZPVA 3DI3B 4KJQC 2LU7A 4BKLA 2PO6A 4JVWA 2VE6A 2ZG3A 3W39A 1OTTC 4PJ5E 3V8OA 1DSFL 1YECH 4I0PC 4IHOA 35C8L 1HI6A 3NFNB 1NBQA 4B0MM 4K7PH 2CRIA 4YO0A 2MCPL 3ET9F 2BC4B 2UWEE 3L3JB 3S96A 1T03L 2PNDA 4ZSOA 1KIQB 3ARED 1PEWA 3WO4B 2PCPA 4XNMA 5I1LA 4S1DD 2DQEL 4QLRA 3ARDB 4KKCC 4P46A 5IB1B 3MJ8B 2EE6A 4PJCF 2NY6B 4GQ9L 3HI6H 4Z7VA 2YA1A 1HNGA 1LGVA 3WJJC 1AXTL 1D6EA 4YDKH 4PJDB 3RWGB 2VLRA 4OUUB 5I1JL 4XXCC 4MNQA 1QYGH 1EA9C 2XICA 3JBG7 2JB6A 2V5SA 2DQCH 2GSIA 3EYFB 2EE9A 1A5FL 2MHAB 3RQ3A 1A1MB 1JN6A 3DSFL 4EN3D 3D1MC 1DVFB 5MEPB 4RX4D 2ATPA 2F54A 3LHPL 1E4XH 4XAWH 5FM4A 1TVHA 2Q3ZA 4PRHD 1XCTA 4J1UB 4XNQB 1LEIB 5F6HJ 5HHME 5LG1A 5DHYA 1CD1A 3GJEB 2WBJC 4PGZA 4G5ZL 1I8LA 1NPUA 4KKLC 2R0ZL 3EDJA 4FMFA 5C0GB 3HI5H 4H26B 4NNPH 3K81A 4Q0XH 2J6EA 4OD1H 4MD4A 4YDVB 2XZQH 3E0GA 3MRBA 2X5PA 3TEUA 4RMQA 1XH3A 2M1KA 3IT8D 2H26A 4LEXH 3ZT5A 4OZIB 4JQVA 4UDTA 1N3NA 2YSSA 4FNLL 1PGRB 3GFUA 5C6TH 1BZ9A 1F00I 3MMEB 3HPLB 1A7OL 1T5XA 2G5BB 1M6OB 5IFJB 4OV5A 2LU3A 1V3MA 1OLZA 1YEKL 1A9BB 2DYPB 4P2QB 3LN4B 4Z7OF 5ISZD 3C5ZB 5A2FA 3LQAH 4KK9C 5JA8B 1P84J 4A6YH 5FOBA 3GSRB 4U1KA 1DBBL 4MDIB 4ISVA 3UTQA 2DI9A 4QKXB 2E7HA 5HGGS 4I77L 1XR8B 2IAMB 4EDXA 1NEZA 1MQKH 4Q2ZA 1ODAA 1Z9MA 5IVOA 3WFDL 5DZLA 4NYLA 1BJ8A 3GNMH 2EKSA 4H20H 5GGTH 3O11A 3L5IA 3LV3A 5DHVB 3U30B 1VFBA 4F2MB 1UYWL 3IKKA 2H2SC 1NLDL 4N5ED 4P4KC 5H37G 1SMOA 4QTHB 4IRJA 3T0WA 1S5HA 4ZUSA 4ZD3L 4JG1L 3G5ZB 3VGBA 1JPFB 1CF8L 2NW3B 1YDPA 5F7KC 3TC9A 1Z5LB 2Z35A 1MSPA 5D2LF 3UJIH 4QOKD 1MHCB 1S7RA 1E28A 3BSZL 4PJGA 5D7JC 5DVOA 3EHBD 1S3KH 3UTSB 1E27A 3N85L 1RZGB 4MA1B 3LZFL 4LSSH 4UINL 3SJVA 5IHUH 4WVRA 3TO4A 2E7MA 5C07D 1ND0B 1WC7A 3MNVB 4D0CB 5GHWH 2XWJA 1FNGA 4JY4B 5D7LD 3LCYA 4YFLF 5IW1B 2EZ0D 5D7KD 3IAQA 3QFDB 1MHEA 5D4QA 1S9XB 2AEQL 4YUEL 3VGHA 4OFPA 5BS0D 2DBJA 4HLJA 4HX1B 3AREA 4Q9RL 4RMVA 2DL2A 1F58H 3PUCA 4R2GC 2Z8SA 3V6FA 2PYFA 3LQMA 1WBXA 4JFOB 2HFEB 2H8PB 1H3WM 3D39E 1M7DA 1A6WL 1EEZB 3FFCE 1A7QH 1RULL 3TZVD 4NCDA 2HH0H 2JJTC 4MJ6A 3VGDA 4K2UL 3WSQL 5F89A 4DN3H 12E8H 3EYQD 4A6YA 1YUHA 3HFML 4G9DB 4MX7A 3VXPA 2GTZB 2QV2A 4NGHH 4MCYA 2XA3A 5EIQA 5ID0B 5D71H 5T1MB 1BVLB 3PWPE 5GGTA 4WY7L 4EN3A 1KYOJ 4KVCH 2NY1B 4NUGL 4RX4A 1A4JA 5JR1H 3MV9D 1EAPA 3RFZC 5EULV 4PRHA 1RPQA 4QY8B 4AY0A 4DZBB 4EDWL 5CJBA 1NFIA 2MQ3A 3DLQR 5DRNB 1PZUB 2HJLA 3Q1SL 4QRTA 3TIDB 3B2UD 3K74B 1AXSB 5CEXB 2C3GA 1JF5A 1WV7T 4JKPH 4XMKH 5ID1B 4HDIB 3CCHA 1FC2D 4I5BA 3ILPB 2HLAB 4OIBA 1CE6B 4FHBD 1BFTA 2CGRH 5T3XE 3LEVL 2VXSH 4KQ4L 2VABB 4PTTB 3NCJH 3CFIC 2GTWB 1T3FB 3ZDXF 3OKMB 1T7WA 4YXKL 2P8MB 1ZLSH 3ZE0F 1R24A 4G8FB 1R3KA 4O2EA 2XRAH 1FNEB 5F6IC 5FO7A 2OL3B 3SOBH 4U6XB 1JUFA 1ZWIB 4QHLA 5ISZA 3IFOA 5JA9A 1P4LB 2J8UE 5EZLA 3RIAK 3H0TB 1RZ7H 3MUZ1 3D69B 4JQXA 3L9RA 5AZEH 3S88H 5FGBC 3NH7H 2LTQB 3VXTA 5BVPH 3PHOA 3MRJA 4D9LL 5FFLA 2XA8H 2HRPL 1YPZB 3DX9B 3S5LA 4Z0BL 3FOMA 3MV01 4W4OA 1G6VK 1WFOA 2V9RA 2YN5A 3CX5K 1F6LL 2C1PB 4U1MB 1XF3B 2BZDA 2R0LH 1DQLL 1SYVA 5IV2A 3Q5TA 5HI5D 3UTTA 4KPHH 2CXGA 2GK0B 2ZPKL 4L8DB 4NQDD 3KPPB 1BQHA 1AO7B 4QOKA 5KOMC 3A6BH 1J5OL 4NUJB 2IEPA 3KPRD 1C5CH 1B0RB 1GGCH 2RHEA 5IR1A 4N5UA 4Z7UB 1FRGL 1OM3H 5C07A 2NZ9C 3VRLE 1WITA 3ARPA 4G3YL 5D7LA 3PL6B 1EO8L 1UM6H 3MBEB 4LMQE 2NY3C 1NKOA 2KQNA 4LSUH 5IQ9A 3EZ8A 4XC1L 2CR3A 5BS0A 3P77B 4NHCH 3BWUC 4PRPB 4YHLL 1SJHA 4KK6C 4KROD 2JCCE 1KB5L 2D9QB 1KENH 5B38G 2VITB 3CH8A 3MGTA 1KN2H 1JF1B 1YN7B 4YBQD 2BSRA 2FZ3B 5HGHA 2FJHA 4HS3B 4XAKD 1NANI 4GAJL 3QQ4A 4G6JH 2WV3A 3F65A 2YUVA 4PJ9B 3C5SA 5DRZA 2OTUA 2VN4A 3TZVA 5C9JA 1EZVX 2R2EA 1NBYB 5DMJB 4JO4H 3NZ8B 4R26H 1FHGA 3B9KB 1BJMA 2NPLX 4YR6B 1DN0B 2I9LA 4L3ED 5DVMA 4PJDE 5F7NC 3BKJH 3RKPA 1G9NH 3IRZA 4DVRH 3WXWL 3FJTA 2FJFA 1QFWI 3TBWB 2NYYD 4LPVA 4ONHA 4P2OD 2FIRT 5DGQA 5T1KB 4FABH 3MV9A 1MFBL 1A7RH 3MJGX 3D18B 3NN8B 4RZCA 4L8BB 1IGFL 5IOPA 4K7PY 4OCWL 1HE7A 1GGTA 5LGJB 5DD3L 2ZKHH 1WFTA 3P0YL 4LOUC 1GZPA 4JY6B 1T1XB 2PW2B 4ZFOA 5LXGL 4QWWD 3S4SG 3G5YA 5DMYA 3CVHB 2WANA 4NP4L 1JP5A 2HN7B 4FQ2H 4UU9B 3HG1D 1YZZA 2YD3A 1WIOA 5C0BB 2R1XA 1V5JA 4ZFZB 3O9WD 2X1XR 3MUY1 5EBGA 4GG6F 4OKDA 5FB8B 5FO8B 2AXFB 3VGEA 2GI7A 4F3FA 1OSZA 4K3EH 5CJXA 5C0DB 4F15C 1IQWL 1OP3H 3WCYA 2EKJA 1MFCL 1JWMB 4WRLA 43C9B 4OZIE 2DWDA 2OK0H 3B43A 4QT5B 1P5VA 1KPUB 1NCDL 3P2TA 3QNZA 4JG0H 4I18B 3CDCA 3VU2A 4GRLB 4PLKC 4MSWA 2EDTA 4Z18A 4KQ3H 4HXAH 1U92A 5ITFA 1EHLL 3GI9H 3HUJE 2G5RA 5CKAA 4HFWB 3DX8B 1IGIH 3S37X 5HYSG 4JDVA 3NCMA 1TJIH 2H45A 4HIXH 4FG6C 1OTUC 4P2QE 1F2QA 4OCNC 3VW3H 2YEZA 1AP2B 1IBGH 4HGWB 5HY9A 4NN7C 3LKPA 1P1ZB 3DGCR 1PEZA 4HAGA 1Z9LA 3SY0A 1VKXA 1IZJA 2QSTA 3MGAA 5E8OB 4U1JB 2YD2A 3V6OC 5AYUH 4WDIA 2ZUYA 4GLRI 1TPXC 2XWTA 2DLTA 4YC2C 3DHMA 2R0KL 1J1OL 2CPCA 1T7YA 5DS8A 1VACB 2XWBA 2CDEB 1NDGA 5D72H 1Z9OA 1ZGLP 3ETBF 5D5ME 4X4XB 3TV3H 3PDGA 3WS3A 1JZ7A 4HHAB 5IF0A 4NQDA 2UVFA 4WTZA 1O5DT 1FYHB 1T2XA 4EKXA 3UX9B 4KZEL 4RAVB 3KPRA 1MCBA 5EU3B 1EGJL 4LLWB 2Q7YA 5L0QB 3UTSE 1QSFD 2GQHA 3JVGC 4JN2A 2APFA 3D5OF 1UACH 2HAZA 1LEKB 1IAII 4YBLB 3U4EB 1T0MA 5HGBB 1MREH 2ZNWA 4P57B 4OT1L 4CU6A 1YNLL 3X3FL 1NCBH 3MO1B 3JWNC 4AMKH 2QEJA 2Q6WB 3O45A 5I1CL 1YEJH 3STLA 4FQCL 3CH1B 4IJ3B 5I19H 4XP6L 2B1AL 2HFFA 2BCKA 2WM0A 2VLME 1QFUH 3LAFA 4I3GA 4W68A 3C6LC 4DW2H 2FEEI 2F5BL 4R7NB 2DQIH 3B3IB 3O0RL 4L3EA 1KSRA 2BY0A 5E5UB 5LQBH 3MA7A 2NW2A 3MJ7B 1BX2B 32C2A 5T5FL 4YHIB 1OOAA 1TITA 4P2OA 1KG0A 1XGUB 3L3KB 5KVDL 3QDGB 3X14B 2NY4B 3D9AH 4JRYD 3O81A 2C7UB 1KTRL 3O4LD 4BSWB 4JFEB 4DN4L 4HIIB 4U1SA 1CR9L 3EOBB 4LCCC 4XPBH 1KJ2H 4CMMB 4OLYL 4LARH 1VCAA 3HG1A 5F7DB 4HW6A 5DJ2B 4DWHA 1F02I 3W5NA 3DSNA 1NCAH 3LKRB 3O9WA 4Y5XA 3S3JA 3BPNB 4P4RA 1SJEB 3RWJB 5A43C 2VAJA 4UILH 1SYSB 4KGJA 1G7LA 4GMTH 4Y5YA 4J7RA 3QXUA 2M26A 5EORH 4MXVF 1G7IB 1D9KC 1AHWB 2A9NH 2FD6L 4KKAD 1UCBH 3DROA 4LRNL 3EJZD 2IADB 1C12B 1NSNH 4WGVB 2GCYA 1B0GB 4NZDA 1G7MA 3ROLB 4WUKL 3AB0C 4N90D 5T1DH 3BKYH 4D9QD 2IMNA 3PWJB 2VLJB 4XRCA 1DEDA 4LF3A 4Y2DC 4MS8C 3KR3H 2EH7H 4HUWB 3ULSA 3MRPA 5DF0A 3QUYD 3HNVL 3QJFB 3KHOA 1Q38A 3MLTB 3UDWA 3VRJA 1AY1L 1RUPH 3UBXB 1R3JA 4V1DB 2CK0H 1YPZE 2NY2B 1N59A 4J3UA 1F90H 1HHIB 2Y5EA 4NO5A 3KXFD 2ADFH 3BOVA 1QEWA 3JZ7A 3RVWD 1Y0LB 4LVHB 3CFEA 4KHXH 1IKNC 5JIHA 1FFQA 3ZT6A 2H1PL 4R0LA 5E7BA 4ENED 4WWKD 4G8GB 3REWB 5EIIB 4LPCA 2GHWB 1AO7E 1MCDA 1FC1A 4JPKL 4HJGA 4MJID 4HK3N 3ZKNC 4O51B 4POZD 2UZIH 3FRUB 1RK0A 3HI1B 1QSFA 3WKMH 5L9DL 2O93L 5EWIL 1KJ2A 3ARBD 4F7EB 5K9KA 1L9NA 4Z7UE 3AVEA 1RMFL 1F3DH 3MOBL 5JW5A 3NFPB 1IQDB 1S9WB 2D7TH 2XTLA 3RUGB 5IG7B 4WIQA 1WVZA 2Z91A 5EO1A 4OI8A 1A6TB 1XIWD 2UUDH 2G9HB 4UQ3B 3U4BH 2FIKB 1CFSA 3P73A 1IKFL 3ESVF 4HAFA 4PRPE 4G8IA 1GCFA 4G6KH 5IESH 3QDMB 2V7HA 3AAZA 1NCWH 3DMMD 5FHBH 1JNLL 1VEOA 3PG2A 1YNTB 2XN9E 1Y6NR 1RSFA 4KJPC 5C0RH 3QXDA 5KVGH 5I1DA 3RY6A 3OL2A 5MI0B 5D7IE 3QCVH 5ANMB 1NEUA 2FBJL 3QEHB 5FGSA 5KBNC 4ALAH 3MA9H 3I84A 4ORGA 2R1YB 4PJ8B 5DQ9A 4R7DA 1OGAD 4JGUA 2RIKA 4XVTL 3VXOA 5IHBA 1TQCB 3ISWA 1I1FB 1K4CA 2XXCB 4JRYA 4R8WH 5TGBA 3O4LA 1FSKC 1IAKB 3W0WB 5IVXA 4KDTA 3MUJA 3ARZA 3QP3A 4L29B 1Z9SA 5MEQB 5I1AA 4KXZH 1LE9B 2OSLB 4O02L 4ZTPL 4JDTL 2GITA 2IQAB 3LN5B 2XYCA 2GJJA 3HHRB 3QUZD 4EOWL 5E8EA 1T0NB 1NUDA 4BELD 4BSVA 4XHJC 3BUYB 5C0BE 3TYFA 3G5VA 1RZKL 4OGAD 3RWDA 5DR5H 4PJHA 3MZGB 4IS6A 5HHQA 2OTWB 3HE6C 1KPVA 1S7WB 1VERA 3ZE2E 1C08A 4WFEE 3ZO0A 3ZSTA 1YA5A 2X70B 5JXEC 5ILTH 4FZEH 3GUTB 4BZ1L 3DVIA 4KZDH 1LK2B 1IGYB 2W0FB 3V4VL 3MRFA 4PB9L 1RUKH 4HS6B 4OD2A 5HHXH 2Z31B 5I1JH 5JPMA 2FWOA 4ZAKD 1NC4B 3TWCL 4LU5L 4PR5A 4TVPL 1JGUL 1GJIA 2VTFA 1ZLWK 3QEUB 3U0TB 3BKML 4ODBD 1S7TA 4GAGH 5DTFB 5F3BA 2R29H 5KS9F 1LMKA 1DLHA 4NKOB 1NUNB 3VRIB 2BK8A 3KXFA 4Y4FD 3L3DB 1OAUH 2OZ4L 3ARTA 4YQXH 5CBEB 5DWUL 5MEND 3QHTC 4J8RB 5JLZA 5IBUG 3X3GL 5CSZA 3IJYA 4G43B 2EO1A 5BRZD 4OZ4A 4WWKA 1CE1L 3KYMA 5A16A 4MJIA 4LPWA 1OD9A 4NWTL 1CGWA 5TDNA 2IALA 2VQ1B 4YEEA 4A2LA 2AXGB 3ARBA 1B88A 5DJ8A 4OM0L 5LGHH 1D6VL 3RWIA 4FOMA 2FYYA 4PJCB 3VWJB 5C8JB 5D7SL 5C70A 3CSYA 3I6LD 1RJYA 4LNVA 1MJJB 3IAGC 5M7QA 1XIWA 1DBAL 3R1GH 5BW7A 1X44A 4M5ZL 3I75B 2HLFC 5F1SA 1CL7I 3V5KB 5M94B 3KPMA 5AD0B 4LLMA 3PWNB 3O6FD 3VG0H 1BQHG 1SBBA 4JKWA 3DMMA 1R6VA 4GRMA 1MCEA 5HI4C 3ROOB 2VUYA 1JZ6A 1ZEAH 3MR9B 1TTGA 4OZHF 4C4KT 4WFFE 1RZIA 5L8KB 3G6AB 3O2WL 1WEJH 2VWEE 1YEDB 4WO4B 5FYKD 1KIRB 2E9IA 3OX8A 4Y5VA 4DKEL 1FE8L 3LKNB 1N0XL 1MFAH 2OMNA 4KI5C 3OKLA 1UYWH 2WBKA 3RA7L 1NLDH 3ZLQC 3EFFA 4YHNA 5EH1A 1OGAA 4GS7B 5SX5H 4M7ZC 5B8CB 3GI8L 5CGYD 5F3HB 4XP5L 2BVTA 3QDGE 3MROB 4RGOL 4OLEA 3REVA 5I76A 4UT9H 3HA0A 3FO9B 2Q86A 4MLIA 4JFEE 5KSAB 5MEOB 2BSSA 1CQKA 2FB4H 3RWEA 1DP0A 3TBSB 4MAUL 2VDQL 3QUZA 1U95A 4LASH 4JPVH 1LDPH 3VWKB 1S7QB 3AXLA 1N7MH 1HCVA 1YY8A 1H3TA 5GGSB 3GSVB 1S8DA 2AEQH 3WXVL 1QFHA 1B0WA 3PGCB 5GSRA 3T1FB 4OM1L 1G9MC 1MCNA 2EDEA 1NGQL 3JTSA 3WLBB 5B4MD 1CK0H 1A1OA 2FX7H 1HHJB 2IH1A 1GPOH 1J0YA 1EAJA 4RFEB 1F3JA 1BOGA 2EIEA 3VXNA 3IAPA 5E99H 4AENA 3LRHA 5I30H 5FYKH 1KCUH 4NQTA 3Q2CA 3V79C 2O5YH 4P5KB 1VB9A 4ZAKA 5L7XL 3MODL 1H15A 3HTLX 1XGRB 5TE6L 4PJ5D 1PYWA 4Z78B 1QR1A 2VLJE 3QB7C 5E2TH 2UZYB 3DV6A 5ACZB 4G42B 5F1KC 3V4UL 5EUKB 3PDOB 5C0EA 1N5YH 4N9GA 2DQTH 1C7TA 2VN7A 3ARFD 4V1DE 1ORQB 3H9SD 4S1SL 4Y4FA 1MJUL 3SCMC 1I7TA 4MMZC 1F11A 5H2BB 3TO2A 2AJ3B 3BGFB 3MXWL 2EIZA 3KG5A 4UTBL 5JUEH 5MENA 3VGAB 1GL4B 1S78D 5BRZA 5IMMA 2O5XL 2CKNA 4LP5A 2W9DL 1HEZA 2P44B 3E6HA 2VLKB 3IDYB 3JTTA 4G8GE 4DAGH 1CDGA 3U1SH 2VXVH 5GZNC 5B21A 5IWLA 1KCVL 4WW1B 3L5WB 1MCWM 4KQ4H 3T2NH 4D0DA 1CXFA 1RK1A 2VLLA 3A67L 4X6BA 1RJLA 3ES6B 1G1YA 2FATH 3TVMD 1O0VA 2DQUL 5CP7B 4JZNB 2OMBA 1F4AA 5HHMD 4XMLH 3RUGE 2NLJB 3RWFA 1EXUB 1M05B 3GMNA 4LLUA 3VJ6A 4KJWC 4OKVB 2FSEA 1G7JB 3O6FA 3VXQA 4DVBB 5I1EL 4L4VB 4WTZG 4CKVX 4NRZB 4YGAB 3QDME 3MQIA 4M7KH 3WFHA 4LHQB 1OAKH 1DBJH 3AMLA 2QR0B 4HQQL 4F58H 3RVVD 3UZEA 1Q72L 7FABH 4PP1C 4TUKL 3BYTA 4LCYB 2GJ6E 2GJZB 5B39A 4QHNA 1JRHH 4P9HL 5IHLB 3FB6A 3GHBL 2X4RA 2WUCL 2AJVL 3M17A 1SBSL 3GSNL 2W07A 1HINH 3TN0C 3LKOA 4ODTH 4MNGB 1KTLB 2P45B 3LMJH 4WW2A 3C60D 2OCFD 1T7XA 1LE5B 4OBRA 4Y16B 5TFSH 5HYFA 3EYUL 1WCBA 1FH5L 4S1QL 5EZOL 5E0QA 3TLRA 1J8KA 1ZV5A 3W0WE 2P47B 5EN2A 3BIKA 4F80A 2ICWI 2YBRA 4Z7QF 3M45A 1NC2D 1DUZB 2FR4A 3TH2T 4UV7H 3INUH 5IIEA 1V05A 4M3KB 5ALCL 5I9QC 3MOQA 4LK4A 2PTTB 1DE4B 2XZAL 4MNHA 1P4BH 4ETQB 4BJLA 1SMAA 3L3OB 4RMSA 5E2UH 3MLSL 4OTXL 1DQDH 3T65A 3O3EA 2B4CH 5GQBA 2AJZB 2A1WL 5DHXB 1ONQB 2P5EB 2YPKB 1FNFA 4APQB 2Q8BH 4U7MA 4D94A 3X17A 4M8VA 2D9CA 1OARL 4PJ5A 5GSVA 4YXHL 3FQRB 1BD2B 3TNNA 1FQ9C 1LO5A 4OFDA 1VFAA 4HS8L 1HILB 4NDMA 4OD3H 1E4KA 4QHUB 4K3DH 2I25N 5I71B 4PY8I 3BWAB 3F12A 3T0XA 3TF7C 3ARFA 4LKXB 3H9SA 4PGEA 1J12A 1FO0B 4U0RB 1TZGH 3S7GA 4V2BA 1CFTA 4X7EC 4XI5C 2NXYC 3D39D 3RTQB 2NY0B 2JELL 1TETL 2R1WB 3S34L 5HGAB 4OLZH 3V5DB 3RVXD 1U8PA 4F9PA 1UM4L 5J1AB 4FFVC 4ZUUA 4UUJA 5GGUA 4UMGA 1YQVH 2LABA 4CADA 5CBAB 3MJ9L 1U91B 1BVKA 1KEGH 2JIXB 2QKIB 1KIPA 5E1AA 2CDFB 1A6AB 1PY4A 3PWPD 4XBPB 5IBTH 1AD0A 1CYGA 4M4RA 2WLYA 2HJKA 3ZE1F 1Z3GH 3TVMA 4UV4L 4NO3B 4PJCE 4NT6A 4PRID 4D9RE 5JQ6L 2IBGA 1AR2A 4HUUB 2ZOKA 5IMOB 1U8LA 1NDMB 4KC3B 3HPJA 4IRSD 3E2HB 1OT1A 1XZ0B 3F7RA 4HPOH 3K2UL 1XCQB 2EYSB 2V9TA 3JUZA 2PF6A 2HVKB 4P3DB 1YJDH 2AW2A 1JPSH 4K71C 5DI8B 1W72B 1IM9D 4X80L 5T3XD 2X40A 1G0DA 4J6RL 4PJAF 4U1HB 3HKFA 3IS1X 1LP9F 3C08H 4DFIA 4MQXC 2FJGB 3R0NA 1IC5H 4LLYB 3IDIA 1F5WA 4F33A 2COQA 4ZXBA 3V0WH 4JGJA 4MMXC 2DM4A 3C60A 3T0ED 1K2DA 4GG6B 3SDXB 1P53A 1MFDL 4PJBF 1F8TH 4FQIL 1JYXA 1OF2B 1CICB 3D25A 1AE6H 4NBZB 1NC2A 4JN1L 5J0BA 3G5XA 2P8LB 2YPVL 1OAQL 4NKMB 1AGBB 4ODUA 3M1BB 4XPTH 4XPAH 1H5BA 5CEZL 3LDBB 3CFCL 1C5DB 2EE2A 2HFGH 1P9MA 1I1AC 5F7MC 3BH8A 4D2NA 1R5IA 4N1EA 4YDIH 4Z7OE 1FZOB 2FGWL 3NBNA 4BK5A 3EZJB 3N1PC 3CSBA 3FQNB 2IANB 4GAFB 5CJQH 5E6ID 3WKNA 1QHPA 1TJHH 3QAZC 3PP4H 1N4XH 1QNZL 3IETA 3KYAA 3S35X 4OQTL 1I9RH 4OLXH 2ZOLA 5T3XH 4E41B 3EGSA 4HH9A 4N0YH 1ETZA 3MLPA 3WFBL 1I7UB 1I3GL 2JE8A 3H9ZA 2WINB 2A83A 4Y4HC 3WIIL 3IU4H 4X7TA 4HWZB 2V5YA 1T21A 4KJYA 2YD7A 3H6JA 1I7RA 3CZFB 4KK8D 5D2LE 1T83C 3O3AA 1LNUB 3P11L 4KVNL 5ENWB 3DUHA 5HGDA 2DI8A 1BEYL 2NY6C 1QKZH 3ARDD 1I4FA 3FOLA 3L3HB 3RX7A 3OXSB 3D39A 5FYJE 4CJ0A 4IOIB 3NGBB 5FV2A 5F70A 4Z76A 4RIRB 2DKSA 5ICZB 4L8SC 1ZHBA 3RWCA 5BV7B 2A6KB 4AG4H 3NPSC 2E7CA 4GXVL 2VLKE 4R4ND 1EMTL 3PWPA 1QA9B 4JZOB 1WSST 2R4SL 3S36H 1UA6H 4ZPVB 1DVFD 3GHEH 4PRIA 4R96B 3DO7A 4RDQF 4IHOB 4CJ1A 1ZSDB 1K4DB 4LCWE 1NBVL 2J1KA 3R4DA 4UT6L 2DQHL 3UJTL 4AEIL 1UWGL 4IRSA 3IU3A 1UQSB 4GSDL 3S96B 3WE6A 1G7HA 5DJ6B 3N1GC 3WHE0 3WV0A 1DTUA 1BZQK 4Z77B 1G6RH 2E8ZA 2QQKH 2N7AA 4P46B 4V2CB 5IFAH 3D0LA 4TSAH 5K93A 5JPNA 2BVOB 1IM9A 2CLZB 1TCMA 3U7YH 3M8OL 1ZLVK 4IOFD 2EYTA 3DVNA 3MLZL 5J57B 5EU4B 1FFNA 3RJDA 5DMIH 1CFQA 1CLZL 1J0ZA 4HEPG 1FORL 1MFEH 4TSBL 1X7QB 4LVNB 4MNGE 3T0BA 1MJ8L 1M7IA 2F74B 3QH3B 3T0EA 1HOCA 5I73B 3ZDYF 3BAEL 2J8UA 4MA3A 3QEGH 4P2QD 4TTDC 3ZSSA 4P5TC 4JVPA 1UH4A 3C5ZD 4JKKA 1LEGA 1G7PB 5DJXB 3O3BA 2W0PA 2HVJB 2IAMD 1PZ5A 3ZDXE 3U30C 1SJXA 4HLZG 2WIIA 5E94B 1GGUA 1RZKC 3MLUL 3ZE0E 2APBA 3HB3D 3MOBH 1UM5H 4D8PA 2MSPA 1MAJA 1I85C 4RFOL 5DD6A 4OJFH 1FL6A 3WN5B 4JM2F 2NNAA 1CI5A 1BMGA 4X6FA 4YDLC 1BJ1J 3UO1H 4GO6B 3ZTNH 3SKJH 4UDTB 5SV4A 3GIZH 4G7YL 4N8CL 1HHHA 5E6IA 1AGEA 4IRZL 3WIHL 3U0WH 3P4NB 1DZBA 3HNTL 2R69H 1JNLH 1T5XB 2Y25A 4O9HL 2P5EE 3EJYD 1J10A 4Z95L 3UTSD 3VH8B 3CMOH 4HF5H 1QBLH 2XQBH 4K8RL 1G6RA 2WK2A 3EJJX 4XP4L 4FP8H 1Q0XL 3MLRH 1BD2E 2W91A 4M7LH 5CZXC 2YD9A 2OP4H 3KLHC 3NFNA 3TH3T 1EBPA 5TE4L 5IQ7H 4UIKH 1T1WA 5J3HC 3QIBB 1B2WL 3L3JA 5JZ7D 3CFBB 5KOVC 5TH2B 1KIQA 1L4IA 1SEQL 3Q6GL 3V52L 1VFUA 1BM3L 4OLWH 2EEAA 2AJSH 2CR6A 4AEEA 5HHPA 3ARDA 5IB1A 2VLMD 3MJ8A 3QIWC 4IRJB 1YNKL 1YY9C 5JXAL 1AKJB 1FL5B 5HYQB 3QG7H 2QHRL 4JDTH 1GZQB 3LH2L 4PJDA 3RWGA 1P84K 4OUUA 3HC0A 1WCQA 4MVBC 3VD5A 4OLVH 1A3LH 1K8IB 3N1QC 5DHVH 2DRUA 4LFHG 3EYFA 2DD8L 1NMAL 2MHAA 1A1MA 2V5MA 4EBQH 1DVFA 2NY1D 5MEPA 2QHLA 1FNGB 4OCYH 1LEIA 1L6XA 2H6PB 3SN6N 4PG9B 3TJHC 4BZ1H 4NKIL 1YEIL 5I2IA 5KTEL 3O6LL 4EXPX 5GS3A 2E7LA 1A0QL 3WFEL 4JFXB 1X9QA 5C0GA 4H26A 1JGUH 1UKQA 5CSBA 3NA9L 4YDVA 1LO3H 5KSUB 3MV7B 3AM8A 3WLWD 4OZIA 1K6QH 3L95B 4AEFA 3BPOB 4WU7B 5F9AC 2EDBA 5I0ZA 1QD0A 2AJUL 1RUAH 3MMEA 3TP4A 3VD4A 3HPLA 4JFDB 1OTUD 2WW8A 1MRCH 2G5BA 1M6OA 5IFJA 4OCRL 3IKCB 4EN3B 1KN4L 2DYPA 3X3GH 2ZCHL 4YHML 4X5WA 4P2QA 3LN4A 5K9JH 3C5ZA 2CXKA 4GG6E 1EAPB 4G6AD 2XZCH 5GZOC 3LB6D 4WWID 3CPLB 2B5IC 1MPAH 4MDIA 5L2JB 4K3JL 2DMBA 5F71A 1XR8A 2IAMA 3KLSA 1ZT4B 3BDYL 2R2HB 5EB9A 3OPZH 3MYZA 4P49A 4YLQT 3BPLB 3BW9B 4M6MH 5DHVA 5CCKL 2OX5A 4F2MA 2A77L 4I5BB 4EI5B 4QTHA 3WDHA 3OB0K 1KYOK 2IFFH 2RCSH 3G5ZA 5FYJL 4ZDHB 2ZJSL 1JPFA 5DQDL 4YX2H 1QPPA 1CCZA 3FQTB 1QOKA 2OR9L 3UC0L 5DUMH 3W9EB 1BIIB 2EC8A 1NGZB 3QXVA 1AO7D 1MHCA 4DGVL 2IANE 3NACH 5DEZA 4FFWD 4XNUH 3UTSA 3WUWG 1RZGA 3MRKB 5KS9B 1PX4A 4GBXB 2XT1B 4DKEH 1DBKL 1X5LA 5H94B 1ND0A 4E41E 3HMWL 5EZLB 4D0CA 5T3ZE 1JWSB 3H3BC 1A3RH 4KV5F 2A0LC 4JY4A 3PL6D 1QFPA 4RSVA 2FRGP 4HWEL 5IW1A 1KIUA 4U49A 4JHWL 2DQJL 3QFDA 5HDQH 1S9XA 4XPHH 5E1HB 4HX1A 3BP4B 3NTCH 4PRPD 1UEMA 3QDJD 2OL3H 4AT6B 3C6LD 5DO2C 4BFIB 4HG4J 4BH8B 4K23H 4TOYL 2HFEA 4HK0B 4KTEL 1NLBH 2H8PA 4PJ9D 2DTML 1EEZA 5CMAB 2NR6C 4MXQD 4U6TA 3OJMB 2H2PD 1NAKL 5IV2B 3B9KD 5BJTB 3OXRB 3O8XB 2OI9B 4F8TA 2ORBL 5FM5M 3I9GL 2GTZA 3UPRB 2VQTA 1OP5K 2IC2A 3J7HA 5ID0A 5MERB 3EDDA 1BGXH 1BVLA 3MXVL 4TNWF 4LCIH 3Q0HA 3GRWH 4QRSB 1MQ8A 1ZA6B 5T1KD 3OG4B 4OZHB 1U8HB 5I15H 1D5ZA 2WAHA 3I3EA 4DZBA 5GISL 5IQ9B 4EQ3A 5DRNA 3QSKB 2DQGH 3AUVA 3TIDA 4ZSOE 3MODH 1INDH 1AXSA 4YE4L 5CEXA 2H3NB 4OB5L 1VPOH 5ID1A 4HDIA 4WCYL 4JY5H 2R9HD 5KJRH 4P9HC 3ILPA 2HLAA 5DRZB 3TZVB 1U6AH 2ZUSA 4X5XB 2VABA 3IFLL 3MCLH 4PTTA 2DKMA 3V7AG 1ACZA 2GTWA 1T3FA 4WFED 3O6MH 2VLRE 4ZYKB 2P8MA 4NJAL 1UJTA 4OZFB 4G8FA 3SDDC 1FNEA 5EC2B 3N06B 5JW4M 5F97E 4HEME 3DTXA 2OL3A 4U6XA 1X4YA 1ZWIA 4H8WH 1KCKA 4ONHB 2ATKB 3PGFL 1UWEL 1UZ6F 3DV4B 1P4LA 4W70A 3H0TA 1NBZA 3D69A 5E2VL 5TQ0H 1VSCA 2BNUB 3SEPA 4NM8L 1OAZL 5DZNA 2W60A 4F57H 1DR9A 1T1YB 3SE4C 1YPZA 3DX9A 4MXVE 3RDTB 4JPWH 4RCAA 2DQUH 3PGDB 3SE8H 1NFDF 5DC4B 5KW9H 4L4TB 2XTJB 3CDGB 5K9QI 4QCIB 4F3FB 5K9OB 4NNYB 2C1PA 3GRWA 4U1MA 1XF3A 3S8WA 2E27H 3ALXA 1FNSH 3GMMB 3GSWB 4P3CH 4L8DA 2GK0A 2QQLH 2DQDH 3KPPA 1PG7H 1AO7A 1FZJB 1ZANL 3I2CH 3CVHH 3GIVA 4NUJA 3G9VA 1ZE3C 1DQML 1MCQA 4TUKH 3BPCB 5E08L 4JFYB 3QHFH 4Z7UA 4R4FH 4JDVB 3QCUH 3PL6A 5KVEL 3GKWH 3QUXB 1H8OA 3MBEA 1VEPA 1VKXB 3SY0B 2J5LB 3P77A 3HR5B 4PRPA 3QO0B 1GC1L 1XGTB 1S9YA 2VITA 3EYUH 2YZ1A 1JF1A 1X5FA 1YN7A 1I9JL 2FZ3A 2JJSC 4HS3A 1BVZA 1CFBA 4PJ9A 1RIHH 4WFFD 3DURA 4FQXC 4ZQKB 1I8MB 3NZ8A 2A73B 4BSJA 5IM7A 3OAUL 3B9KA 5E2WH 4YR6A 1DN0A 1ZLWH 2IGFL 4M6NL 4MYWB 3HZYB 4WI5A 2VDPL 5EUOA 1T7VA 1KEMH 2CMRL 2XZAH 4KMTH 4H5SB 3KGRA 4JFHE 5EU5B 3HE7D 2DJ4A 1CZ8L 3SKOB 1FIEA 3TBWA 3SJVE 4LSVH 5T1KA 3MV11 4BM7A 3SGEH 3D18A 3NN8A 3QDGD 4L8BA 3O6KL 4X9FA 2B1HH 3PP3K 2NY4D 4GFTB 1BQSA 5GS0D 4YIQB 2AGJH 2Q7NA 5LGJA 2R4RH 4JY6A 1T1XA 2CUIA 2PW2A 3IXAB 2N7BA 2CJUL 5JNYB 1D5IH 3DJ9A 2Q87A 3CVHA 4FXGB 5IMKB 3FRPA 2HN7A 4XNXL 3HE6D 2HFFB 4UU9A 1FLRL 1HKLL 4ZFZA 5IB3B 5JW3H 5DJZB 3RX5A 3A0OA 5FB8A 5FO8A 2AXFA 1ACYH 1WWCA 5DD0L 5F7LB 3RGVC 5C0DA 2G75A 3BP5B 1JWMA 1TVBB 3LQZB 1INEH 4Y8AA 4QT5A 4H88L 1KPUA 2H9GB 1AHWC 3MA7B 4YHYB 4I18A 3FO0L 1DCLA 5K33A 2QQNL 2X1QA 4GRLA 4S11A 2ICCA 4RFNC 5EOQH 4Q7DA 4KRPB 5DRXB 4HFWA 3DX8A 5CZKA 1IAMA 2J4WL 3OJ2C 1TCRB 5A2KH 4NZUH 1DQQB 1NGWB 2JTDA 4R3SB 3R8BB 4YFEA 3WL9B 1AP2A 4HGWA 1P1ZA 1UJ3B 2VLJD 4TULL 3HZVB 5E8OA 4ZFGL 3RZCC 3CK0H 4M6AA 1ADQH 1TQBC 2X4UB 5I6XC 1V7NL 3WS6A 4V1DD 4PB0L 2NY2D 1UGNA 2XXMB 3SBWC 2CK2A 4NZTL 5LKNA 2CDEA 5EBWB 3RKDD 5GS0H 3TH4T 1A6PA 4X4XA 1N26A 2OS7A 4KRLB 4M62H 4M9OA 3ZHDA 3X11B 3JWOH 3AY4C 4HHAA 1T2QL 3K2UH 5KZCB 1JHKL 3TT3H 5BV7L 4MQ7A 5EU3A 4LLWA 3NABL 1LO0L 3QUKB 4HBCL 3GKZA 1E4WL 2ARJB 4RISL 5KS9E 5FIEA 4NKDB 3VXMD 4U1LB 2WP3T 1LEKA 1WIUA 4X4YB 4NIKB 2AEPH 3U4EA 2WIMA 2D7MA 5HGBA 3OKKB 4X7SH 4P57A 1RZJL 4U1GC 1X5XA 4L8CB 3ULSB 1W0WB 1RIUL 3MO1A 4FFZL 3ARVA 3BUTA 2Q6WA 5HI4D 4LLQB 2R56H 5L88H 1SM3H 3QDMD 1P4IH 4PP2B 4U3CA 2EC9T 2NXZB 4EIZC 3QPXL 3Q3GA 1RURL 1RAMA 1TZIB 5DC9B 2YD6A 5I8KL 3OMZA 3SGKA 3OV6A 4R7NA 3BQUB 3ARGB 3B3IA 4P2RB 3QIUB 5JHLL 5I16B 3C8HA 5T33L 3L7EB 3MJ7A 1JNNH 3HE7A 1MCOH 1L7TL 1BX2A 4PJ8D 3KYOB 1ADQA 4YHIA 4TUJB 3GMRB 1XGUA 3L3KA 1MRDL 3QDGA 4AL8H 4JFFB 5DK2B 4OZHE 3X14A 3DVGA 3VDBA 1U0QA 1EBAA 2C7UA 3R06B 3W0WD 4BSWA 5JOFB 4G7VH 1S7SB 2E9WA 1ZVYA 3UCRA 4PJAB 5ICXB 1UKSA 4HIIA 1A6ZB 1LP9B 1JF6A 1NMBH 4G8IB 3EOBA 3HE6A 1HYSC 4CMMA 1J7VR 3SDAB 5F7DA 2X1WL 4QO1A 1FFOB 5DJ2A 3MLXL 4LQFL 3LKRA 2BXZA 4LQ1A 1JHTB 4QF1A 2HP4A 1SJEA 3RWJA 1D5XB 3ULUL 1SEBA 2J6EL 5GGQH 1G0XA 1SYSA 2J3SA 4PJBB 1HWGB 1X5AA 3LEYL 5C09D 4J2XA 4L1HA 4ZUVB 4FQHB 5JDSB 3QRFM 1YECL 1G7IA 1S7UB 1OCWL 4C58B 2O61B 3NAAH 5GJTH 4BQCA 3MV8B 1YEHH 5D1ZB 2IADA 4K7PL 1MAKA 1B0GA 3V0VB 2R15A 3ROLA 2M2DA 3QQ9C 1PLGH 2BVPB 2BXYA 3LS5H 3W9DB 3EKCA 2Z31D 5J7CC 3BXNB 3MLWH 3PWJA 3O4LB 5TGBB 2VLJA 2XPGB 4NWUH 1Q8MA 4RWHA 3IDXH 4MGXA 3BHBB 5D96B 1J8HB 3OGOE 3HI6L 3QJFA 3ZDZF 4S0TD 4OV6F 3MLTA 3ZYIA 2I9TB 3UBXA 4YDKL 4V1DA 3MNZA 2F53B 3L6FA 1QYGL 5HHVH 4L4TE 2DQCL 4RMTA 1Y0LA 2F19L 4JZJC 2DQHH 4P23C 1UWGH 3BN9D 2AXJA 3LPGA 4WV1B 2HTKC 1KTDB 4G8GA 1E4XL 4XAWL 3REWA 5EIIA 3DX6B 4PUBH 4K8RC 4O51A 3FRUA 4L5FH 4CVXA 3HI1A 1WT5A 4MHHI 3HR6A 3V6BR 2VKXA 3VXMA 3RVTD 4OD2B 2Y06H 3U2SB 4CBPA 1CQYA 5C1MB 1ZAGA 2E6JA 5DEGB 5LVEA 3NFPA 1IQDA 3HI5L 1S9WA 2VDML 2VR5A 3VMOA 4ONGH 1WUNT 4Q0XL 4HMDA 3RUGA 4D9RD 4XH2B 4EQ2A 5IG7A 3E3QE 3QUYB 2XZQL 1QFWM 1A6TA 4EVNB 2G9HA 4UQ3A 4X6DF 4HPYH 1VEMA 2CLVB 2FIKA 4LLAA 5J06A 5J12B 3VFTB 4LEXL 1MIEH 3P3YA 5C3TA 4X9IA 4PP1D 3TA3B 2VH5H 4F9LC 4PJFF 3QDMA 3MACH 1K8DA 5C6TL 4YPJA 3MFFA 1YNTA 3DRQB 4GH7B 3VMNA 1BZ7B 5ANMA 1X6LA 3I6KB 1U2CA 2PXYC 3LQAL 2WLZA 2X9WA 4A6YL 1HH6A 4B7LA 2HT2C 1CT8B 3M07A 2R1YA 4PJ8A 5DJ8B 4NOBA 1MQKL 2FX9H 3VFSB 4FQPA 3K4AA 1WIPA 5GGTL 1Y18B 1IC4H 1I1FA 4MAYC 1IAKA 3W0WA 1CLYH 4L29A 5MEQA 1LE9A 2OSLA 5KSAD 4HKZB 3EIFA 4HIJB 4GW4B 2UV3A 5I8EB 2IQAA 3NCBB 3LKQA 1T0NA 5IFHL 3KDMB 1V3LA 3BUYA 3UJIL 1CTNA 5JMOC 4O2FB 4J4PD 1S3KL 2ILLA 2D0HA 4IDJH 2OTWA 4JREB 1PJ9A 4LSSL 5C09A 1OSPH 1S7WA 5IHUL 1IRAY 5A2LH 2YK1H 4OSUH 4Q6IC 5T1LB 4BFGA 1SEQH 1JMXA 3QWOB 5GHWL 3OKLB 2CUHA 2Y9RT 2X70A 4Z7QE 2AABH 3BP6B 3MRMB 3G08B 3RZWA 2ICWJ 3GUTA 1LK2A 2W0FA 5C92A 4HS6A 3VG9B 2Z31A 4GG8B 4MJ5A 1G84A 1DJSA 1RVFL 3NCEB 2EDXA 4FQJH 2XZZA 4KMLB 3QEUA 4JM2B 3U0TA 3BT2L 5IVZB 1JWUB 1A7QL 5E6YA 1IAIM 5FA4B 5DTFA 2QLVB 2HH0L 5F9DC 4HKBB 3QQNA 5B38B 2NXYD 4DN3L 12E8L 3VRIA 1DQJB 4HT1H 3L3DA 2ESVB 4NGHL 4EJ1C 4NQVA 1SJVA 5D71L 1OTSC 3NA4A 5CBEA 4Y89A 5FUCC 2VL5B 1U3ZA 4J8RA 4KVCL 4RGNB 5DJAA 3O6LH 4G43A 5T5NG 1F13A 5FV1L 1GH7A 2Q20A 2DLFH 2VLKD 2R0WH 4QHKI 4YWGH 5ALBH 2VQ1A 2VRAA 1BOGB 2AXGA 4CW1B 1F97A 3GZKA 4X6CF 4PY8J 3QZWG 3EFDH 4HMEA 4RMRA 1TMCB 2Q76B 1EDQA 2CIIB 4NC1E 4PJCA 1H15B 3VWJA 5C8JA 3W2DH 1D5BB 4XMKL 1MJJA 4JR9H 4U2ZA 1FDLH 4FZ8H 1MWAB 1QLRB 4M7JH 1RUQH 4MWFB 2CGRL 2IG2H 1BF8A 2VXSL 5C0EB 4Y4KB 2ZCHH 3DOSA 4N9GB 5BMFH 5AD0A 3NCJL 2GT9B 3PWNA 4L4VD 2GUOA 1T66D 1ZLSL 3ROOA 3MR9A 2XRAL 1A7PH 2D4FA 1YEDA 3LPFA 4WO4A 3IB4A 3SOBL 1S5IL 3ZE1E 5ACMA 1KIRA 5DMKB 3E8UH 3LKNA 1OWWA 4P2RE 4IEFB 1RZ7L 1U3HB 4F7TB 1WFUA 5GS1B 5AZEL 5IROC 3S88L 3NH7L 4KK5D 4POUB 2NY5H 3QRGH 5IJKC 2DIBA 1QSFE 5FYJH 5B8CA 2XA8L 5F3HA 2OR9H 4Y16D 3MROA 4JFFE 3PABB 4JHZA 1P2CB 3FO9A 5KSAA 5MEOA 4PJAE 3VJ6B 3TBVB 5EUOF 2R0LL 1LP9E 3TBSA 1FFRA 3L1OH 4ZFOL 4KPHL 4LIQH 4PGBB 1S7QA 4CN4A 2P48B 3A6BL 3MREB 5LBSH 3GSVA 4J4PA 1TZHB 4XPFH 5E4EB 1C5CL 5EU6B 1GGCL 4J3OC 2FHCA 3PGCA 4PJBE 3T1FA 2V5RA 3C8KB 3WLBA 1LD9B 5TDOB 1UM6L 3RNQB 1V3JA 4KTEH 1HHJA 4LEOB 4LSUL 1I1YB 2P5ED 1A4KB 4APQD 4NHCL 3MV8E 5F96H 4KWUA 1FGVL 4IMKA 1KENL 4P5KA 1M71B 3FRPG 1WCBB 1XGRA 1KN2L 4JRYE 1I3VA 1BD2D 1QRNB 3O4LE 4Z78A 5KSBF 1ZS8B 1AIFB 2YBRB 4G6JL 4NSKB 1T89C 5ACZA 4G42A 1JYWA 3OJDB 1J8HE 5EUKA 2ERJB 2AV1B 3PDOA 3SPVA 4JO4L 4R26L 5IIEB 1T6VN 4W6YB 3FB5B 5KVFH 5E00B 2DDQL 3KPQB 1Z0NA 1ORQA 3D6GA 3AMKA 2F53E 1G9NL 1FNAA 5H2BA 4HUVB 2AJ3A 4DVRL 1DBMH 3CDFA 1KV3A 4HUMB 3ZTJH 4I4WB 3RTQD 2NY0D 1NL0H 4FABL 2HTLD 1FG9C 5F9JB 1A7RL 5FHAH 3QNYB 2W9LA 2WWMD 3OR6B 2VLKA 1CDUA 1NAMB 3B9VA 2HFTA 2VR4A 5IMLB 3T4YB 2EXWD 2ZKHL 3FZUC 3HAEG 4Z7NF 4O58H 4WW1A 3L5WA 2JIXD 4ONOA 3IXTB 3MSPA 2XNAB 4Z8FH 1IGCL 2ZP0T 3ES6A 4FQ2L 4WFGE 5CP7A 2YXMA 2F58H 1IT9H 1GC1C 1GOGA 4OF5A 5D1XB 5J11C 3BP7B 4QNPF 1EXUA 1M05A 4K3EL 2MOVA 4OKVA 3T2OA 4BH7B 1ZTXH 4XB7A 1G7JA 5D6CB 2ED8A 4L4VA 5AG9A 2OK0L 4ERSH 4NRZA 1YEFH 2ICEB 3F7QA 4X9HA 1KLUB 3QI9C 3CMGA 2H32B 4JG0L 1JZ8A 2X4QB 1RUML 3MRDB 4YXLH 4X8XA 3S9DB 4KQ3L 4HXAL 4LCYA 3GI9L 1BBJB 1IGIL 3QO1B 1Y6MR 1MY5A 5EOCH 3OR7B 5C6WH 1TJIL 4HIXL 3NPZB 4XWOD 3BIAX 3VW3L 1IBGL 4RWYH 3OTTA 4XXDB 1R3HB 1FO0H 1KTLA 3F62A 5AYUL 3LRSB 4KAQH 3PQYB 3WDIA 1LE5A 1JPST 4Y16A 4XVUD 3PXHA 5SWQB 3FFDB 4X4ZA 1CICD 1XEDA 4BQ9A 3ECBB 5D72L 4GT7A 5GRYA 1CS6A 3KPNB 5KN5A 3TV3L 1DUZA 2WP3O 1KLGB 1DL7H 3LDBC 4Q9BA 2YXFA 4I3RL 1BBDH 2PTTA 2Y6SD 2EEBA 4Z7WF 2DMCA 3O4OB 4QXGH 3ZDYE 4IIQB 3WNOA 4ETQA 3L3OA 4AQ1B 1UACL 4N68A 1MREL 2VOTA 2AJZA 2RR3A 2IAND 2HKHH 1ONQA 4JQIH 2P5EA 2PW1B 4APQA 2AQ1A 4AMKL 1FVEB 2GKIA 2FHBA 2Q1EA 4E5XB 1OGAE 3OAUH 1W72H 1YEJL 1NFDB 4E41D 2IBZX 2AK4B 2D03H 3G04B 1UKTA 1GGIH 3GSOB 5DFVC 2YUZA 5T3ZD 2IGFH 3FQRA 1BD2A 4JVUA 3EYOB 1VFOA 1KJMA 1P6FA 1QFUL 1HILA 3IYLW 1KC5H 4DW2L 1FLTX 4QHUA 5D2NB 3CC5B 2DQIL 5CD5D 5I1HH 4IBLT 4LKXA 1YY9D 4LHUG 4J3SA 1A7NH 1AR1D 4O5LL 3B4NA 5D1QC 5LQBL 3IVKB 1FO0A 1TENA 3ZKXB 2ESVE 3TESA 3BH8B 3RTQA 6CGTA 3DETC 3GDBA 3GB7B 5HGAA 2ENSA 1MLCB 4IM8A 4NQSA 3V5DA 4RGNE 4RGMB 5J1AA 3BZEB 1Q9OB 3D9AL 1QP1A 3GMOB 5CBAA 1U91A 4TYUA 3VFGH 4XTRC 2JIXA 2QKIA 2CDFA 4I0PB 4XBPA 2CKBA 5HI3C 1RZJC 4HBQA 1T80A 2PO6C 4U2YA 4QXUH 4XPBL 4OFIA 3DXAB 1KJ2L 4LARL 3ALWA 3OB0H 4NO3A 1WBZB 2A83B 1WWAX 1QPXA 4K3GA 3ULVC 4HUUA 1OW0A 2YPLB 4UILL 4PRNB 5IMOA 1NDMA 4GMTL 5EO9A 2J4WH 1XZ0A 4PGDB 3I3DA 1BP3B 1XCQA 2EYSA 4P46C 1N8ZB 4C55A 5T3ZH 2HVKA 4P3DA 1OY3B 5EORL 1ORSB 3AS1A 2A9NL 3FOLB 1J0JA 1UCBL 3JV4B 1PSKH 4S2SB 4XP1H 5DI8A 1NSNL 1W72A 3RAJH 3SGJA 2DKUA 2OR7A 5T1DL 4DEPC 4PB0H 3BKYL 1MAMH 2V17H 1CXLA 4DKDC 5C08B 2FJGA 5GRJH 3FKUS 3KR3L 2EH7L 4WJ5B 2I07B 4KI5F 2D7OA 5SWZD 4MD5B 5BXFA 1RUPL 4M1CC 4GG6A 1WAAA 1GRWA 1N6UA 3SDXA 2CK0L 2WBJB 4UOW1 1S9KC 1JHKH 1OF2A 1CICA 3I6LE 4XC3H 4PLNC 5BV7H 4PV8B 2GFBB 2JJVA 3PF2A 2ADFL 4HKJB 1NCCL 2P8LA 3C09B 4KHXL 4NKMA 1I8LC 1AGBA 3M1BA 4R6UA 1OP5H 2BRRH 1JGDB 3ULUC 2VZVA 5DJ0B 2Z4QA 2W92A 1IGTB 1RFDH 4DOHB 1C5DA 4K55A 3ZZ1A 3AGVA 2UZIL 1L0YA 5EU6E 3WKML 1IE5A 4JQVC 1FZOA 1HSAB 2ITDB 2BHUA 2J2ZA 1T6WA 3OHXB 1FFNB 9CGTA 2Z93B 5GS2D 3FQNA 2IANA 3DBXB 2D7TL 2APXA 3QPXH 3WFCH 2ZCLH 1O7SA 3NCCB 2NMSA 1WZLA 3UXFA 5A3IC 3U4BL 5C9KA 5ITBH 5J6HB 3T0EB 3ZL4H 1HOCB 4E41A 1FIGH 4ZO8A 2B0SH 4G6KL 2J8OA 5JHLH 2HT4C 1I7UA 3H3KA 4HK3J 1A6UH 2WINA 3ZKMD 3P9WB 5BZWA 4JAMB 2GY5A 3IF1B 5FHBL 1QRNE 4HWZA 3LKSB 2GSGB 2UYLA 3FQWB 4P4KB 1PZ5B 1H9VA 2QADC 3QIBD 5C0RL 5KVGL 1MCIA 5AWNH 1LNUA 2YA2A 3B5TA 5ENWA 3V4PH 4D8PB 4IRJC 4DKAA 4TQEH 3L3HA 5C0ND 1RJZA 1BFOB 3MA9L 3OXSA 3CFDB 4ALAL 5B3JF 5DD6B 2OXHA 4IOIA 2DM3A 3RPKA 1AKJD 1HK6A 4RIRA 5D7JB 3DVFA 2D7NA 5ICZA 2BP3A 1EJ6A 4M7LT 2P42B 1KF9B 4KV5E 2CQVA 4NC2B 5KAQG 5DT1L 4R8WL 5IEHB 4GAYB 3UTZB 4XX1E 1JGEB 4JFHD 3TO4C 2YS4A 5D70H 3HMXH 4AYFA 1QA9A 1SVZA 4JZOA 2D0GA 1K3ZA 5HPMB 4H25B 2X4OB 4R96A 5GS2H 4R2GB 1OCWH 4D3CH 5FKPB 1ZSDA 5A1AA 1K4DA 5DR5L 3QJHB 3AREC 4LRIA 2GW5A 1T1WB 1UQSA 2Z92B 5DJ6A 4TNWK 3KJ6H 4Z77A 5BO1H 3H9SE 1AQDB 5HHPB 4PS4H 4DGYH 5ILTL 1QSEB 1F6AB 1CGXA 4FZEL 1BAFH 2BVOA 3IFNH 2CLZA 4KZDL 3MV7D 3LQAC 1RUKL 3B9DA 4MA8H 5DJDB 5HHXL 5EU4A 3HC0B 1UC6A 1A21A 3DECA 4JFDD 3I85A 2F19H 3FMGH 4LLDB 3FT3A 4YGVB 1X7QA 1IAOB 2F74A 4GAGL 3QH3A 4XWGH 2XY2A 3PQYE 3VXRB 2R29L 5HYEA 1F4XH 2KDGA 4ZNCD 1OAUL 2EH8H 2DOCA 1A14H 3TFKD 1EVTC 1P7KB 4YQXL 1G7PA 4MDJB 1EFQA 5DJXA 3KHQA 2HVJA 5I2IB 3QDAA 1B6UA 4K7FB 5E94A 5TF1H 3W81A 2V5TA 1J88A 1MCPH 2VDMH 1FBIH 3HMXA 4RA0C 4EI5D 5EOCJ 1UZ6E 5F6IB 5I1KH 3WN5A 5FYLE 3PP3H 5LGHL 2RGSA 2VIRB 3N0PB 2MKWA 2CRZA 5BOZG 2MKLC 3P4NA 3QPQD 2EIDA 4R9HA 3R1GL 4XVJH 3VH8A 1X3DA 1J0IA 2N4IA 4XGZB 5F7FA 4GBXD 4X5WB 4JRXB 4JQXC 4QGYA 5DYOB 3VG0L 1NFDE 1CG9B 1YYLH 2AK4E 4RBPK 5DQJB 5BZDB 1YEEH 1OD7A 3SGDH 1ZEAL 4ODHH 3VI3F 1TVDA 2P7TB 1WEJL 2P8PB 1RHHB 1OLLA 3QIBA 5D2NE 3D3VB 1HHKB 3CFBA 5TH2A 3U4AA 4AIZB 4U7SA 1MFAL 4W4OC 1WISA 4N5EC 5DD1H 1IEBB 2ZSVB 2EDOA 2B39A 1BOYA 4KHTH 1KTKE 1L7IH 1J1XH 1KXTB 2WNGA 1AKJA 1FL5A 4XCEB 5HYQA 4X98B 1QUNA 1GZQA 4PYHA 5IFHH 4DTGH 4NO2B 4X6DB 1K8IA 3O8XD 4PG2A 4UT9L 3BRGC 1EEQA 2FB4L 2NY3B 4PJFB 3B8YA 4NN5C 5H35B 3MX0A 4LASL 4JPVL 1LDPL 2EZ0C 4AEHH 4C83B 3DXAE 5INCA 4M03A 1N7ML 5D9SB 2H6PA 4PG9A 2VDLH 2EDHA 3PWVB 5FO9B 4NOFA 2YPLE 2W65B 2GEEA 1U93B 4IMLB 4JFXA 3K4ZA 1RVFH 1CK0L 4QYOB 4N9OB 1QSVA 1S7XB 2FX7L 3TZVC 1GPOL 5KSUA 1NJ9B 3MV7A 3BT2H 3EYQC 1DQTA 4OZGB 5E99L 4YPGB 5I30L 1MRFH 3NMEA 5FYKL 1KCUL 1R0AL 3Q6FB 3B8SA 2O5YL 3MGOB 4K9EH 2EDJA 3L95A 4XP9H 3OBAA 4WU7A 3AFLA 4BUGA 3KYKH 3LD8C 5HHNB 4NN6C 4JFDA 3SKMB 5E2TL 5C0IB 3VFPB 3T09A 3KPSB 1ES0B 3IKCA 4H0HB 5E5RB 2ID5A 3A6OA 1N5YL 5DLMH 3U6RB 2DS4A 1BWMA 3WJLA 1EPFA 2DQTL 4HG4K 1YN6B 1CLOH 5E9DD 4YHPB 1D5ZB 4PRIE 2LU4A 4FQQB 3T3PF 4FQLH 3CPLA 3JV6B 5L2JA 3MRGB 5JUEL 1RIVH 2A2QT 1ZT4A 3ARQA 3B2UC 3PHSA 2R2HA 4FXLA 5J9PB 4D0BB 2QSVA 3HRPA 2YD1A 2BX5A 4F15B 3BW9A 2DB8A 2FO4B 3RDTD 4DAGL 1RI8A 5CJXC 3NCYS 2DBLH 4KRNA 3U1SL 4L4TD 2VXVL 2XTJD 4EI5A 1A9EB 3EBAA 1KT2B 2LAGB 2X4SB 4ZDHA 3GBNH 2ADIB 3T2NL 2E9JA 3FQTA 1OAYH 4LHJB 3W9EA 2B2XH 1BIIA 1GHFH 2FATL 1NGZA 1DLFH 1ZVSB 4ZOAA 1DUYB 4NN7B 5EA0H 4XMLL 3DTXB 2L0DA 5JIIA 3MRKA 8FABB 1S5IH 5KS9A 4GBXA 4GKNB 3T0EE 2YRZA 5H94A 2BVYA 1TPXB 1JWSA 1NBZB 5D93C 4M7KL 4YC2B 2YD5A 2J5LC 3QUXD 1OAKL 4XCFH 5E56A 1DBJL 4UZGA 4F58L 4OZFH 3RY4A 7FABL 4N0UB 4BUHA 3WYRA 1AGFB 4Y19B 2W60B 4MCZB 3BP4A 2DAVA 4AT6A 1G9NC 1JRHL 4EZMA 4BFIA 2XQYG 1CGVA 2JCCF 4E42B 4BH8A 4FQ1L 2HWZH 4X6CB 4HK0A 3OJVC 5SX4I 1HINL 4ODTL 2BOCB 5HI5C 3LMJL 4WTXA 5CMAA 4ZOCA 3LOWA 3DNKA 5TFSL 2ADGB 5BJTA 3OXRA 3O8XA 3SE9H 3GIVB 2X7LB 3UPRA 1QBMH 2P46B 1CDCA 4BA8A 2CH8A 3CLFH 5LWYH 4YHZH 5MERA 2RBLA 1GGBL 3K8LA 2VSCA 4MXWH 4QRSA 4UV7L 1ZA6A 5I8OH 1EHAA 3INUL 1LO4H 4FXKB 4KY1H 5DSCA 4U6VH 3I50H 4OZHA 4LSPH 4UBDD 1U8HA 1N5AB 3T2PA 1H8SA 3S97C 4KROC 1DANT 1CBVH 1P4BL 5D6DA 4DK6A 5EOTA 1FGVH 3QDJB 15C8H 3C6LB 5E2UL 3GBMH 1DQDL 1S9YB 1FAIL 3P4OB 2H3NA 2B4CL 5CINL 1HIMH 4NNXB 5IGXH 1IEAA 4PJIF 1W2KT 1QSEE 3UZQA 3DURB 4GMSH 1H3XA 1EVUA 1HCFX 3G9AB 1N64H 3CDYA 2Q8BL 4X5XA 5F8QC 1FVCB 5IM7B 1U42A 1WZMA 4YHYC 1TDQA 2DDQH 4ZYKA 3F7YB 4OZFA 2AJYH 1ITBB 4Z5RB 4W81A 5EUOB 2NYYC 5EC2A 1FVDB 4OD3L 4P2OC 4NFBA 4CDGC 4K3DL 4KKBD 5GGVH 3VA2C 2ATKA 4KRPD 5I74C 1E4XI 3HNSH 3VFNB 2KH2B 5E8PB 3DV4A 5E9DA 3RU8L 3VXRE 4JPIB 1HHGB 4X0KB 5FKAB 1R5VB 4LCCB 1WK0A 2KPNA 1GIGH 1X4ZA 1TZGL 4XB8A 2AKRB 4QWWC 5GJSL 4OGXH 2YA0A 2BNUA 4N8VB 3T3MF 4ELKB 4WHYH 4OLZL 1IGCH 3KJ4B 4GJTB 1T1YA 3O9WC 2VXQH 4Y5XC 1A2YB 4TPRH 3RDTA 3PGDA 3WHXA 5CHNB 1YQVL 1WAAF 2VR9A 3CDGA 3C5JA 3E6FB 4L4TA 4MD0B 4QCIA 3SDXF 4NQXB 1KEGL 5K9OA 4Y5YC 4NNYA 1NFKA 1D9KB 5IBTL 4K8RD 2X4PB 2C9AA 4LL9A 2G75B 1E6JH 3GMMA 5EZIH 3GSWA 5D5MF 2PTUA 5AAMA 1BHGA 1Z3GL 5KSBB 1PKOA 5IKCB 3SQBA 3AB0B 4QGTA 1FZJA 4LCUB 1XF4B 3R0MA 5HD8D 5KZCD 1C1EH 1EEYB 1RHFA 1RUMH 3ZDZE 4I9WE 4GOSA 4ELMF 3OAZK 4Y2DB 3BPCA 5TPWH 4JFYA 4PGCB 5F7EH 4DQOH 4HPOL 4Q97A 3L5HA 2BSED 2X9XA 1XAUA 1QVOB 4KKNA 2FGZA 3QUXA 1YJDL 2NX5B 1JPSL 2G2RB 3FQXA 3P30H 3FHQA 2J8HA 3UDWC 5EBLB 2R23B 4G80B 3HR5A 3DPBA 1EUTA 3QO0A 1KJ3H 3D3VE 1AGDA 1XGTA 3SQOH 1XR9B 4ONFH 3C08L 1REIA 2F5AH 2NXZD 5TDPB 1IC5L 2ICWB 4UDUB 4ZQKA 3V0WL 1I8MA 2A73A 1G1CA 4R0LC 3BQUD 4CMHC 3ARGD 5EBMB 3VXSB 4P2RD 3QIUD 1CFVH 3V95A 1F8TL 4DKFH 4I3RH 3UEZA 3HZYA 4X6DE 4MQ7B 1AE6L 5EU5A 3GMPB 3Q48A 4H5SA 5GPRA 5JO5B 4UNUA 1UB6B 3SKOA 4HJJH 4PJFE 4XPTL 4XPAL 3NIGF 1JI1A 3PV6A 4JFFD 1R3IH 4CVZB 2YUXA 2HFGL 4YIQA 2YUWA 5CIPB 4YDIL 3QDHA 3IXAA 4PGJA 4H1LG 2N1KA 4DFHA 5JNYA 4FXGA 5IMKA 3FCTB 3SDAD 3HLAB 4KTDL 3CAFA 4RRPA 3Q3GB 5CJQL 5K59F 2AK1H 5IB3A 5DJZA 1TJHL 3PP4L 1N4XL 5EU7E 4Q58C 3T77B 3PWUB 3RY6C 1I9RL 4OLXL 2AV7B 5T3XL 3BP5A 4N0YL 2OBGA 1TVBA 3LQZA 4O5LH 4TRPH 2H9GA 2IF7A 1QZ1A 3IU4L 3HE7B 1I8IB 1FSKB 2CRMA 3MV8D 2Y7QB 4X6EB 4Y1AD 5D1ZD 5DRXA 1TCRA 1DQQA 1NGWA 2FEEL 4R3SA 5DEFA 1ZGLA 4KDTC 4Z7WB 3WL9A 3EYSL 2P5WB 3DVGB 1VENA 1UJ3A 3BJ91 5C71A 3SDCC 5J13C 1QKZL 3CUPB 3HZVA 1JIBA 4PLJD 4UNTA 1J8HD 3STZB 1QBAA 4JFQB 5F9WC 3FQUB 2HT3D 3UTOA 1OTSD 3HE6B 2X4UA 3FO2B 2OQJB 4AG4L 4YK4C 3I02B 4KGLA 3VFRA 3MRLB 4LSTH 4YNYB 4QF1B 2F53D 3IRPX 5EBWA 1SEBB 3L7FB 3C6SB 4PJEF 3X11A 3S36L 1UA6L 3TYGH 3GHEL 1I3RB 5IJVB 1IARB 4KKAC 3EOAB 3EJZC 1Q94B 1FYTD 1U8KB 2HRLA 4M5YH 3PHQA 3QUKA 2ARJA 4NKDA 4U1LA 1MLBB 3V6OE 2VDKH 4X4YA 4WI3A 1G6RL 4G9FB 2QQKL 3OKKA 4ORZC 4WFGD 5ICYA 1UG9A 2CO7B 1M1SA 1EX0A 4K7PX 5IFAL 4L8CA 5C0AB 3MUGB 1W0WA 4TSAL 2QTEA 2C4XA 2EECA 1Z6JT 3FAXA 3H9HB 4N0UE 3U7YL 4LLQA 3ILQD 4Y19E 1FV1B 4PRDB 3MNZB 3TA3D 5DMIL 3RVWC 4PP2A 3RY5A 3SKNB 2IBBA 2VAAB 5SWSB 3L6FB 4QHKJ 2J12B 3FAWA 1TZIA 3B2VL 4X6CE 2X42A 1MFEL 3T08A 1NCCH 5CD3B 1EFXB 3BQUA 4ENEC 4M1GH 5E70A 4WWKC 3ARGA 4P2RA 4Q74A 3QIUA 3H3PL 3QEGL 4POZC 5I16A 1AC0A 4QRRB 3L7EA 5C0JB 3ARBC 4NO0B 3CSGA 4WEBH 4CVXB 1CGYA 2W0LA 3KYOA 1NEZG 3VXMB 4TUJA 3F58H 3GMRA 3TJEH 4FN0A 4JFFA 5DK2A 3FT2B 1UM5L 1XIWC 2WMPA 1N2RB 3R06A 5JOFA 2IH3B 1S7SA 4WI6A 3BKCL 4PJAA 4ZS6C 5ICXA 4TVSa 4OJFL 4EUPB 1A6ZA 1LP9A 1T04B 3F7PC 3BMWA 5I75C 3QDJE 4YBHA 3DMMC 3SDAA 3UO1L 1FFOA 4NKQB 3SKJL 3ZTNL 8CGTA 3GIZL 1Y6KR 1K8DB 3U0WL 5L6YH 2C1OB 1JHTA 2R69L 4XBEH 1D5XA 2IFGA 1UWXK 3MFFB 4Y5VC 3X13B 4BZYA 4PJBA 3CMOL 4HF5L 1QBLL 1RD6A 2XQBL 3B6SB 1I9IH 5T1LD 4FP8L 1EERB 1P7QB 3OWEA 4ZUVA 4FQHA 3QXAB 5JDSA 3MLRL 4M7LL 2HG5B 2OXGA 4GUPB 1HH6B 1S7UA 2OP4L 4AQOA 2O61A 3G6JF 5EUOE 3V6ZB 5IQ7L 3WUWB 1WWBX 3MV8A 4UIKL 5D1ZA 4Y1AA 3V0VA 4NJ9H 4WU5B 3SE3C 4WI8A 2BVPA 3T2QA 4NPYB 5LCVH 3W9DA 4OLWL 5DT1H 3NFSH 2AJSL 3BXNA 2XPGA 4WHDA 1KFAH 5TQ2H 4N0FB 5CILL 3BHBA 1J8HA 3F8UB 4JM2D 3MTRA 5IBLD 3QUZC 1BFSA 1JGVH 3QG7L 3UP1A 3UTPE 2I9TA 3LKQB 4HZLB 2AEWA 4OGAC 3RVUD 1FL3B 4OLVL 1A3LL 2F53A 1NCTA 2ESVD 4BFEA 5EPMB 4NHUB 4KTYA 5C09B 4NC0B 3PV7A 5IHZB 5DURB 3P0VH 4EBQL 4RGND 5IEKB 3FZUD 3SO3C 3BDXA 1HXYB 4WV1A 5KSBE 1KTDA 1EO5A 1LK3H 4M1DH 4URTB 1FYTA 3DX6A 4OCYL 5GGVY 4HWBH 2VZ1A 5DRWB 4JO1H 4G8EB 1EO7A 2UWEB 4ZAKC 4P9MH 4F7MB 4HC1H 3U2SA 2CD0A 3UAJD 4MJ5B 1JGLH 5DEGA 5EFIB 1WLHA 4XBGB 5GRUH 3SDYH 4XH2A 1QO3B 3DRTB 3QUYA 1LO3L 2DTSA 2PR4H 3SCMB 4EVNA 1IC7H 2CLVA 3VFTA 2HMID 2X41A 4Y4KD 1K6QL 4Y4FC 3TA3A 1NGPH 2XOTA 1ZA3B 1FCCA 3DGGB 3EOTH 1CFNB 1RUAL 4Z7NE 1UB5B 4NQVB 1MRCL 3DRQA 2YC1B 4ZO7A 5DJAB 5K9JL 2RB8A 1BZ7A 3I6KA 3VXSE 2XZCL 4QNPE 1U3HD 5IWLC 5D8JH 1MPAL 3MUHL 3FT4B 1IFHH 1CT8A 1QQDB 1UENA 2Y4SA 1KB5B 3HZKB 3IGAB 1J1PH 1CDYA 3VFSA 1MY7A 2VDOH 3OPZL 1WBYA 3DWTA 4XCCH 3VMPA 5INDB 4LPYA 1Y18A 3VD7A 4M6ML 1CD8A 1U8QB 3S5LG 5C0CB 5DK3A 1GAFL 1QLFA 4AIXA 5I17B 5IT2H 4OF8A 2IFFL 3V0AC 2RCSL 4HKZA 3O6FC 1HQ4A 1KPRB 4HIJA 2APWA 1H3VA 2MQ0A 4GW4A 5I8EA 4YX2L 3SHSA 4Q9QH 5DUML 2V7NB 2GUOB 5DMGD 2CLRB 3L3GB 3KDMA 4HWBA 3NACL 1RZFH 1CGUA 5ABDE 5IB2B 4O2FA 1MEXH 1XGPB 3U46B 4XNUL 5EU6D 2VERN 4HC1A 3TN0B 3VFVA 1MWAH 1NMCC 2IMMA 5T1LA 3KS0J 3QWOA 4M48L 1A3RL 4MQTB 2ZSWB 2JLLA 3BP6A 3CZJA 1UADC 3MRMA 3G08A 3BVNB 4M43L 4WHTB 5E5MB 5LAXB 4WW2C 5HDQL 4M93C 4XPHL 2GIYA 5CGYC 3Q5OA 4ODXB 5A2JH 3LEXB 3O3DB 2WBWB 3NTCL 2VISB 2EO9A 2OL3L 3FN0H 3OQ3B 4GG8A 1FZMB 3U48A 1VGEH 1ZT1B 4YDJB 1T4KA 4Z7WE 4N0CC 4AM0B 2A74B 4GKZA 5SV3A 3LRGA 4K23L 5L8LB 5I9QB 1TTFA 1NLBL 1QRND 5HJ3A 4JM2A 5D1QD 3X12B 2DL9A 5IVZA 1JWUA 2DN7A 3BH9B 3DARA 2HA1A 1U8OB 2HKFH 5FA4A 2YKLH 1PVHA 2F8VA 4HKBA 3CFJA 5B38A 4OGYH 1C16B 4KUZH 4PV9A 1DQJA 3EO9H 2ESVA 4OZFG 2A38A 4X7CC 3RGHA 4X99B 1BGXL 2VL5A 4LCIL 5B4MC 4NM4H 3GRWL 1KCRH 1MUJB 3MPCA 1J0HA 2YMXH 3TIEB 3WBDA 3JWDH 3S37H 5I15L 4WEMB 4PTUA 3WNKA 4TUOB 5B22A 4CW1A 5HYJB 1R0AH 3JUYA 2DQGL 1FN4A 1CVRA 2Q76A 3ULVD 2CIIA 1UCTA 1INDL 5ESVA 1KJVB 1D5BA 3KLDA 2EXYD 4OCXH 4G9FE 1VPOL 1E4KC 4JY5L 1IGJB 3HN3A 2I26N 1MWAA