2BDNL

Crystal structure of human mcp-1 bound to a blocking antibody, 11k2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
b'DIQMTQSSSSFSVSLGDRVTITCKATEDIYNRLAWYQQKPGSAPRLLISGATSLETGVPSRFSGSGSGKDYTLSITSLQTEDVATYYCQQFWSAPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small inducible cytokine A2
publication title Structure activity relationships of monocyte chemoattractant proteins in complex with a blocking antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2005-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bdnL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bdnL01
4Y4HB 1DUYA 1IAKB 5CWSB 5E4EC 1TJHL 3BDXA 5F71A 2W9DH 4LHUG 2DDQL 1CD0A 4D9RE 1BZ7A 4OZHB 3LKSB 3NA4A 4JRXD 5JMRA 4F7PA 1MQKL 4QHMB 4HIHB 4U1GC 4XZUB 2SEBB 3KLAA 2X4SA 2ZSWB 3T04D 4LASH 4JVWA 3WIIH 1FFOA 2GFBB 2IBZX 3Q0HA 5DUBB 5LWYH 1UFUA 1CFSB 1JUFB 2KUTA 4NZDA 2AJVH 4PTUA 1JWUB 3Q5OA 3BKYH 4JHAL 5L2KD 1N64L 4UAOC 1N6QL 1KELH 1QP1A 2P8PA 1UZ6E 3RP1A 4PGBB 4EIZC 3TV3H 4XNMA 2MOVA 5DJ6A 1CDIA 1I8LA 5F1IB 3VWJB 3VXPA 4ZNEA 1P6AB 4MQ7A 3NCYP 4O2CB 2ICEA 5DJAB 1DQML 5C09B 4L8DB 5AAMA 3FB6B 3GI8H 3H9HA 5H8DA 2YSSA 4F57L 3NN8B 4H5SB 3L3OB 3PQYB 3HI1A 4L8BA 1I4FA 2H32H 2XNAB 5ESAA 2R1WB 2OYPA 3RZCB 5F9OL 5BCAA 3MRNA 5BS0B 1YMME 1P4IH 43CAB 2AEPH 4MDJB 1RK0A 2XQBH 4QOKA 3UEZA 4HIIB 4GRWF 2R2EA 1BQHB 2F54B 2JK5B 4WEBH 3U79A 5GS2H 3DBXA 5MEOA 1MHPL 2QQLL 5ENWB 4QRPA 1IVLA 1BGXH 3AC0A 1BOGB 3I6KB 3MRGB 2F9BT 2WP3O 4P4KD 1X6LA 3MXVH 3WO3B 3FOMB 2DS4A 2IQAA 3Q5YA 4ZFGH 1V7MH 4EQ2A 5EBMB 2O5ZH 4YHYB 4BQ8A 4GS7C 15C8L 1GZQA 2G60H 3FN3A 4TUKL 5D9SB 3FJTA 3MX0A 3DIFB 4P59H 5IQ9B 1ES0A 1AGDB 5F9JA 1IGIL 3CFBB 4XB8A 3L3KB 4X83A 1UM6L 1DLFL 3HPLB 5HGGS 3FT4B 3O3BB 4KQ4L 4X4ZA 5D7LD 1I1AA 2O5YL 4PRBB 3TA3C 3U36A 3EO0A 1RUQH 3QIUC 1RZ8B 5IOPB 4HUUB 4N68A 3O6KL 4MA1B 1W2KT 3BQUD 2NR6C 3BPOC 4YHLL 1N7MH 3N9GH 4YBHA 2BDNH 5A2KH 5M7QA 2VLMD 1UM4H 1TJIH 1U41A 3HE6B 3MRPA 3O4LA 3RIAF 4QRSA 5I1EH 4OLYH 4G5ZL 1IT9H 1F00I 3WV0A 1G9NH 3WXWH 1BFOA 3QJFB 5TDNB 1TIUA 2XRAH 3KDMA 2R0LH 5EU5B 5FK9B 3VFTA 4JFOA 1I7RB 2XKSA 1LK3L 3KR3H 4WW1B 2GK0A 3NAAH 2FYYB 4WEMB 4GAYA 4X7EC 1D5IL 4OB5L 1A7QH 3BPNC 1ZHKA 2D0GA 4LSQH 1MI5E 1JF1A 1U95A 1NFDE 3GFUA 1V3JA 2GJJA 4LHUD 1JF5A 5C0JA 1IQDB 4U2YA 5DD1H 4TOYL 5DJXA 4F9PA 1AQDB 1KG0A 2FB4L 4H26B 2FR4B 4NN6B 3S36L 5D1QD 2MQCA 2EYRA 4R4NC 4WCYH 3REWA 4O2FA 4LLUB 1FZKA 2P5EE 4PJGB 2UY6A 3HZKA 4MLIA 3QEHA 2M8XA 3RJQB 3OGCB 5KZCB 3MFFA 4TSBL 4OD2B 1D6EB 3RDTB 2AS5M 2AI0L 4S1DD 5TFSH 5EU6D 2DQFA 1HH9A 3W0WD 1B90A 4I1NB 4NO0A 3CZFB 5EOTA 2Z31B 4G6MH 3WD5L 4F7EA 3FFCA 3BP5A 3U4EA 4N90E 1QLFB 4XNUL 5I71B 4URTB 1TENA 5IG7A 1S7WA 1I7TB 3WNKA 1S5HA 4NO3B 4E5XA 2R2HA 3GSNB 3MUJA 1QSEE 4MGXA 3QXDA 3EAKA 3ZL4L 4XPFL 5IHUL 3AROA 4GKOA 5IQ7H 1R3IH 4PJAF 4MZ3A 1CFVH 4LNRB 1ITCA 3QCUL 5EORH 5ACMA 4MNQD 1P9MA 3QFJD 1X7QB 3OAUL 1UACL 1XR9B 1DVFA 2HTKC 2EDKA 1Q8MA 3THML 3ZHDA 3RVWD 4NM8H 3H9SB 4K9EC 4ALAH 5FECB 3KJ4C 3G5YB 4LKXB 3PF2A 3C9NB 1VEMA 1GH7A 3MO1A 4NYLB 3CDFA 5GGSB 4Y1AD 5DFWH 4POZC 3BH9B 4XPHH 4ZAKA 1J0KA 3PG2A 1CICC 2PW1B 3GHBL 4LEXH 3CGTA 5E2WH 2MFNA 4NNXB 1RUPL 5DFVC 5HYQA 5HDOA 3QUKB 1KPVA 2HMID 4Y19B 3K74B 4P5TB 2XN9B 4JRXE 3QJHB 3F7YA 3B2UD 1GHFH 4BSWA 2VL5B 1HINL 4P2OA 1WFUA 3MLYH 4Y2DD 1KCRL 2ZOKA 1SVCP 1RV6X 3RFZC 2CO7B 1YY8A 5HYSA 1MCFA 1XR8A 1JGEB 3GJFK 3KPMA 3WYRA 5JW4R 3S96A 4XC1L 5E6ID 5L2KE 4UOW0 2O5XH 3AMLA 4P99A 2OTWA 4X4XA 1SY6H 1MIEL 4JPVL 3RWJA 5HGAA 3DI3B 3U7WH 4R3SB 1X5YA 2Y72A 3PGFH 1M7XA 2LFGA 5DJ2B 3T0AA 3W5NA 4ONHA 1EXUB 2NY3D 4PD4J 4X7DC 1OARL 4Y8DC 4LLQB 4Z7UF 3N50A 5C6TL 1ZA6A 5C0BD 1N6UA 3TVMB 4KY1H 4FQJL 3CFDA 1WWBX 2QJDA 3B8YA 3ULUF 4F2MA 4WUUD 2DQDH 2XG4A 5SWSA 2QR0B 4KGJA 5FA3B 4Q6IB 4BSVB 3L5XL 1S9VB 4ZDHB 3BHBA 3GM0A 3BZEB 3LEYL 1NQBA 1HXMA 5HGDB 3RIFF 1KUMA 5BJTA 1BX2A 1AFVL 2ZUWA 3VCLB 1KTLA 4Z8FL 3SGJC 2Z0BA 3MA7B 1K5NA 5F7FA 1NUDA 2PTTB 5E8EA 4GQPH 5CJ8A 4N0CC 3MV8B 4BELD 1QSFE 4C57C 4U7SA 4WO4C 3T8XA 2VLJB 3D1MC 1X5JA 2EYSB 4NSKB 5JPNA 1H3PL 2FX9H 2B2XL 3L5HA 3D3VD 3HNVH 5DQ9B 2JB6B 1P5UA 1TZIB 3PHSA 3S3SA 1RAMA 3FO0H 3MGOB 5B39G 2NNAA 1A14L 5FUCC 3LN9A 4U3HA 2PETA 2F53D 2X1XR 5D7LE 5H2BB 5FHAH 5FGCB 5GRUL 1AD0B 3HCVB 3QUXD 5EBLB 1GXEA 2Q3ZA 2HFFB 4U3CA 4ZUUB 2NY1D 4FNLL 3B8SA 3UTSD 4MAYB 3NZ8A 1I8MA 4U1HB 3UTOA 1MFNA 1T1XB 3CCHB 1RURL 1QRNA 1HWHB 1TNMA 2VLME 1U8MA 1J1OH 1PJ9A 4U3XA 2FDBP 1JHTA 4WJ5A 1SQ2N 5E5RB 4OM1L 5F1KC 4MQTB 1NCNA 1K8IA 1T7XA 1RIUL 4N8VG 4XVSL 5F9DC 3SGKC 2R2BA 3BMVA 4WHTB 5J13B 1B0GB 1TITA 1U8OA 1OPGH 3O8XD 1ND0B 1OSPL 4TSAH 4ZD3H 1A64A 3EIFA 1G7HB 4P2QA 4PRPD 1HQ4B 3KYMB 1A2YA 4JM2C 2FIKA 1IAOB 4BJLA 3ARDD 3PWUA 3S37H 1D5ZA 3MLRH 3PABB 3S35L 3MCLL 5BZDA 4P23D 4LU5H 4YO0A 4JY4A 3TBSB 5K9KA 4NQDD 5D7SL 1FGNH 3QHFH 1BPVA 1FVDB 3ELAT 2HJFA 4QRTB 1E6JL 3ES6A 5HYEA 3BKJL 2YRLA 3O6FB 2FHFA 2AK4D 1PKQB 2VXQL 2X70A 2ZPKL 2VLRD 4L3CA 2XA8H 2BVOB 2IQ9L 1U58B 1T20B 4K3DH 1KJVA 4LRIC 4ERSL 1A4JA 4AEIH 2C5DC 1AGCA 3CSGA 3MJ7B 3UPRA 5EU6E 5CIPB 2IF7A 4L4JA 2KL6A 5FGSA 3VFMA 1NCAH 5B3JE 3HE7A 5T1KD 4R6UA 5KSBB 2CIIA 4HGKC 1IRAY 2I5YH 5FXCH 4NC2B 3IXAB 2AJXH 2DF3A 4X4MA 1LDPH 3SGEH 2LABA 4PJ5B 4UQ3B 1H15B 2NY0C 4X80H 3GIVB 4JKKA 4RA3A 3LKQB 3NIDF 4YR6B 4EZMA 1MY5A 5GGRA 2R0KH 1T5WA 3D39D 3I2CL 3QO1B 3AS0A 4N0FB 1R3JB 3BE1H 4X6BB 1H9VA 4MNQE 5TE4H 4TTDD 1SY6A 3QFJE 2QSTA 3VWKA 2BXYA 4OQTH 4I8DA 3U82B 1WQVT 5DEFB 2VXSL 5GS0L 2DLEA 4DN4H 4GKNB 4QF1A 2YD9A 1I9RL 4J7RA 3UJJL 1PW3A 5I1HH 1KB5B 4M7KH 5ETUB 4Y1AE 1A6ZA 4X6CA 1J8HD 4KROD 1BHGA 3SQOH 2DQJH 2FCBA 4HF5H 1IC7L 3DHMA 1EHNA 3OBAA 2IBZY 5KSAB 1E4WL 1C5DB 1MFBL 4RIRB 4QTHB 1TZHA 2XXCB 2DOCA 4JO3L 5F7NC 4M48L 4ELKA 4GH7B 1WZ1L 3QXWA 4HT1H 1WSST 3IAPA 4G43B 5LBSL 4F7TA 2LU4A 4WENB 5DMKA 5I9QB 1L0QA 5D7IB 5HGBA 2F58L 1QACA 6FABH 2BMKA 1CE6B 2OJEB 5C9KA 3GMNB 1HKLH 4X8JA 4M43L 1XZ0B 3QAZC 2UYLB 4XNYH 4XPGL 4PJEB 2IAND 2P8LB 2C4XA 5F9WB 3CPLA 3FQRB 1KEGL 5IMMA 3V52L 1FAIH 4RMQA 3O81A 3GNML 5SWZD 3BW9B 2NZIA 3O3AA 3RVVC 1S9XB 4PJ7A 1BBJA 4ZTPH 3C2AL 1ED3B 3WNNA 5INDA 2AEIT 3VG0H 1S7TB 1DN2A 2VZOA 1U0QA 4M1CD 3UZEA 2CXGA 3I85A 3WNPA 3IETB 3BSZH 3GSNH 3MBEA 4LLAA 3UBXB 1FDLL 3B9KA 3INUL 2AV1B 3W2DH 1I1YA 5HDBE 4LARL 4AENB 3EO9H 5KSUA 5I1JH 1VGEL 4WUUE 5D6DC 1Y6MR 4WU7A 1KPUA 1KENL 2ICWB 5C0FA 1W72L 3VWJA 3HNTH 2D0HA 1ZGLA 3T2PA 3ZKQD 3O2WL 3QDJB 1AHWC 5T33L 3EZJB 3UYPA 4WHYG 5D1XB 1HXYB 3BZ4A 3EBAA 4FFWC 3GSWA 4NKMB 3HC0B 3S98A 2ADFH 4HIXH 5FOBA 3VXSA 5EUKB 4GW1B 2DQHL 3EYOB 4J3OC 2JCCF 4PJ9D 1P53A 1UGNA 3MTRA 3RWGB 1OGAA 1F3DJ 2YK1H 3IKCB 4MXWL 3MRBA 5C0DA 3ZTJG 3WSQH 4F58L 1ZANH 5B8CA 3D3VE 3O6LH 4I4WB 3K81A 2VDRH 4BZ1H 5BZWB 3AUVA 1NGQL 1PKOA 5J56B 1GC1C 4MDJA 5CCKH 1BIIA 2I60L 3BXNB 4L3EA 3SDXA 1A6WL 1EZVX 4YHZL 2VDKH 3RWEA 1G7MA 3G9AB 2F53E 5ENWA 4HCRA 4XC3L 1DQQA 5LG1A 4QCIB 2G2RB 4Y5VC 4Z95H 1BIHA 2BJML 1NDGB 5C9JA 1U8LB 3UTSE 1GGYA 3LRSA 1RULL 4Q0XL 3GO1L 3VFOA 3CDYA 4RAUB 2HVJA 1HEZB 1U93A 5CZVH 3TPUA 3ULVH 3QXTA 4NJ9H 3D25A 3RVTC 1RZ7H 4OZGA 4NQEA 4J6RH 5C0CA 3CFBA 5IF0A 4U1KA 1N8ZB 2DI8A 1C5CL 4RAHA 1F4YL 1UXSA 2C1OB 2BOBA 2P24A 2ZUQC 3HPLA 2EH7L 3QNYB 4Y4KD 3NCBB 3VFSB 3VW3H 4JN1H 5C86A 4LPUA 1OLLA 2GHWB 4U1IA 5DSCA 4PPTA 3RI5F 5CMAB 2YA1A 5GZND 5TE7H 5CJOH 1P6FA 4PBVC 1KCUH 3BISA 2V7NA 1MFDL 3LD8B 2QQQA 5J6HA 1J5OH 1TJGL 3P3YA 2J8UA 5GISH 4WW2A 4PRPE 3GZKA 4ZNCD 4MDIB 5CD3A 2P7TA 4I0KA 4KMQA 2PCPB 5HTSA 3BH8A 3V6OA 4MVBD 4JDZB 4YHKL 5CHNA 4EEEA 3V0VB 1ORQB 3V4PL 3WJLC 3CLEH 4DGYH 3VXNA 5HHXL 4NQDE 2EEAA 1OY3B 1FE8L 1OP5H 3QG6A 5T1DH 3DGCR 1I7RA 4Y4FA 5CJXA 2AK4E 3AFLA 5E4EB 4JB9L 2NY6D 3QNZA 4YWGH 2VSCA 2VLRE 4EKXA 4ODXA 2JTDA 2OX5A 3VFGH 4WI7A 2MKLC 5CBEB 1LEGA 4OI7A 2R23B 4ZUWA 4LSTH 3EO1B 4OFKA 5EU3B 4U1GB 4MXVE 1FZJA 4KKBD 4PREB 5HI3C 5ISZA 3UTZB 4JFEA 3JTTB 1UQSB 4Z7VB 3LN4A 3GSQB 4OKVA 5JUEL 2W91A 4NO2B 3HPJA 4UDUB 5DC0A 3TIDB 4UAOB 1WTLA 4GAGH 3TWCH 4E0RB 4YDJA 1BFVL 3TBYA 2BFVL 1AE6L 3D39E 3FB5B 5F44A 3ZKMD 4H8WC 3HC3L 5FYKL 2XI9A 1FJ1A 1EMTH 5DO2C 1MCNA 3F5WA 2GQHA 2EEDA 2XIDA 1UWXH 4LIQH 4LSPL 4Z7WB 1GGCH 5F1NA 4UTBH 3QFDB 4RGOL 3WXVH 3G6DL 4FQXC 3V8CA 4K3HA 3CFJA 1DANU 1VHPA 1J8HE 4LSUL 1DBKL 4MS8D 4AMKH 4ZXBA 3IFNH 5I1CH 4JDVA 5DRWA 5C0GB 1S5IL 4YFEA 4JG0L 1A9BB 1CG9B 4MA3B 3TPKA 1FFQA 5ICYB 3DPBA 4EI6A 1VFAA 2LAAA 1H0DA 1DBBH 4XP1H 3LPGA 1FL6B 5E9DE 2NYYD 3RA7L 1AQKL 2CLRB 1FNGA 5SX5H 1MCWW 3M8OL 5L7XL 1SMOA 4FQCH 3V4UL 4GS7B 3RIAK 5KJRL 4Y0GA 2GI7A 3U0TA 1PY4A 2NY5L 4I9WD 1EERB 2HTLD 1GGIL 4OF6A 3C5SB 3LEXA 3EOAA 3C9NA 4Y2OA 3OTTA 1Q9WB 1NMCB 5GGSA 5TQ2H 1KIRB 4IEFB 4Z7NE 2B39A 4WDIA 1YNLL 3OJDA 3MACH 5HYJD 5HVGB 4PS4H 3TBTA 4CADB 2IANE 5EUOA 1QBML 4GG6A 4E42B 2FATH 5EO1A 1FORH 3TA3B 1EFQA 4KPHL 4YDLC 4TULH 5CIPH 5CZXD 3QIUB 5SWZE 4JZJC 5JNYB 5J1SC 1IAMA 4CU6A 1EAPA 2ZG3A 3BPOB 3TBVB 5C07B 1A3QA 4J1UA 1NGYA 1UCTA 5I19H 2ERJC 3B6SB 3L3JB 3IFPA 3P4OB 4YNYB 2P1YA 3OKMA 3DX8B 2UWEF 5C3TA 5JR1L 1MAKA 4JFXB 3TZVC 4YUEH 4Z7OF 3KG5A 2H6PB 5E1AB 1FVCA 4M7JL 3VE0B 3HZMB 4HZLA 1V3KA 35C8H 3ARFA 3B83A 4YHPA 3ZE1F 1N26A 5HI5D 4UU9B 1S7QB 2IFFL 4HAGA 4NN7C 3ME0A 3BPNB 4XP4H 1KB5H 1F11A 4XBGB 5AD0A 4NP4L 4U31A 4LRNH 3IDNA 1E27A 1ZT1A 1X3DA 1ZV5A 4P2YA 4KK5C 2PYFA 1BVLA 5DD0H 3MGTA 3N85L 5F7WC 1FZMB 2YRZA 5IIEB 1OGTA 4NPYB 1FFPA 3KHOA 4M6ML 4IMLB 1NGZB 2YUXA 2PYEB 5F89B 2P47B 1DN0A 2EXWD 4K94L 2YPLB 3UXFA 4BQ6A 3MCKB 1A6VH 1V8HA 2W9EH 1U8KA 4OLZH 3WIFB 3SE3C 4PG9A 1AO7E 5C71A 5FO7B 3L95A 4HWZB 5I18H 4U1JB 5ADOL 4QRQB 1NGWB 1QO3B 5FO9B 1S7SB 5I1IL 3QIBD 5LKNA 4WVRA 4U6HB 2V9QA 2V2WB 4HDIB 3OHXA 3S4SA 2Q8AL 4DCQA 5JHLL 1Z3GL 1YZZA 1NGPL 4LCYB 4MJID 5I1AB 5D2NA 1CL7H 5CSBA 1I1RA 3T2OA 3MLWH 1WZMA 3WDIA 2VIRB 5HHOD 4D9LL 1JPTL 3MRIA 5I6XC 2QADC 5H2BA 3NCCB 3GMLA 4ETQB 4GKSB 1QFWH 4U6XA 4OGYH 4P46D 2YPVH 3FCTA 1MHEA 1MCCA 5ICXB 5BRZD 3UPAA 3WFBH 3HUJB 3QCVH 1MJUH 1DSFH 4XCNB 4UB0L 1E6OH 3VXUA 1QKZH 3KLDA 3KJ4B 3IJSA 3RGVD 2HFGH 3MRCA 3L3DA 1CYGA 3HB3D 2VXTL 2V7HB 5GQBA 3HG1A 1CICB 1T89A 2UUDK 2UZIL 3QRGL 3FONA 3JWDH 3MNVB 4JM4L 4LPYA 3TJEH 2VR9A 1K2DB 3SDCB 4P5KB 2VERN 4P0DA 3JSSA 4G7YH 2ATPB 1YEDB 5I2IB 2EIDA 3QUZC 4TNVF 4XAKD 3P11H 4XVTL 4F7CB 2D7MA 1YEGH 2GTWB 3NPZB 3A67L 2R0WL 4ELME 3RUGF 1GYAA 4KH2A 3REVA 1D7FA 2J4WH 4OCRH 3V8OA 4W6XB 1C08A 5HJ3A 5IW1A 1KLFA 3V7AG 5TDOA 3PGDB 3BGAA 3RIFK 1R3LA 4J4PA 1ITBB 2X9YA 2X1PA 5GRJL 1AI1H 2DL2A 1FL5B 3QDGD 4FFZH 5FKAA 2BNQA 1MQ8A 4ZUVB 4ZSOE 3EDDA 5GSVA 2A0LC 3FOLB 2HN7B 4Q6YA 1MFAL 1Q1JL 5CUSL 1RZGA 2P45B 4HGMA 4CN6A 3AAZB 4JKPL 4TRPH 3RNKB 1K8DB 1U92A 5DJ8A 2W0FA 4M8QB 2ADIA 1OQXA 3S5LB 3WS3B 4HK0A 1VACA 2B0SH 1QR4A 4HLZH 1NC2D 4I3RL 3MV11 1LO3H 1KULA 2IALB 1IARB 4CMMA 1HWGB 3BDYL 4G42A 4H1LA 2XPGA 3BP7B 4K2UH 3WCYA 1RU9H 4EDXB 5EO9B 4LLVB 2NW3A 3EOYG 4DTGH 3UTPD 1FNSH 2WQRA 2BNRA 4D8PB 2NY7H 4FQHB 3UJTH 1X4ZA 2EDYA 4K3JL 4UNTA 4KJWD 4I9WE 4M7LT 2CJUL 4QNPF 1NAML 3M45A 1UWEL 2Q6WB 3VRJA 1XIWD 3MV9B 2JJTA 4OI8A 3FN9A 3ZHLA 5FV2A 4NZTH 4PRID 5HYJE 5IEHB 4JFYB 4OZHF 2FWOB 2X4PB 4NUJB 4PGDB 4Q9CA 1E4JA 4TVPH 2K7QA 2VDLL 1DUZA 4JPKL 1D6VH 3A6CL 2CGRH 5IB3A 3RKDD 5I8EA 1KIPB 1JRHL 4LVHC 1LILA 3U4BH 1T1ZB 2BOCA 3OKKA 3IJHA 4PB9L 2X9XA 1MVUB 5F7YC 3QWRA 4N8CL 5IVZB 3EFDL 1CIDA 3FZUD 3DSFH 4ZYKB 3SGDI 1NMBH 3K7UA 3C60D 1EGJH 3SO5A 3MREA 4MYWB 4Y8AA 4DW2H 4G8GB 4G8EB 5B22A 5I8OL 3I6GB 3CU1A 5DGQA 5DF0A 1AJ7H 5ACZB 3L3HA 1F42A 3QIWC 2CDFA 2ARJB 4J8RA 1LEIB 3P0VL 2H2SC 4H0GA 4JPIA 2WUBL 3PWLB 1JBJA 4HXBH 2EC9U 2RQ8A 3DX9A 3BW9A 2K9UA 3PDDA 4LVNC 4P2RD 5I1GH 5IFJA 2VN7A 4TN9A 5EWIH 2VZVA 1S7TA 4J12A 4KRMB 3UYOD 1QPXA 4JM2B 4V1DD 2Q76B 3SDYL 4I5BB 5IVXF 3ARGD 4WTXA 4IRJD 2I07B 4O02H 4EI5C 2F5BL 1UB6B 5GIRB 4XPAL 4CMHC 2BNUA 1N2RA 2ZNXA 4YXLH 3SOBH 1FBIH 5EG6C 3LMJL 1GJIA 3EUUA 7FABL 3OF6D 1KYOJ 2GJ6D 4ZODA 1L9NA 3MMEA 3P9MB 5TPWL 3TN0D 4RGND 2XWTB 3O3DA 5LXGH 4KRPD 3F7VB 3GB7A 2B4CL 4LPCA 4XRCA 4FP8L 1XCTA 3DMMA 3IDXH 4A2LA 3QDMB 4GRWE 1FIGH 4XNXH 4GW1A 2AP2A 1WCBA 4LQ1A 4X7CC 5SWQA 1SJHA 5IB1A 4HPOH 3BDBA 4RQQB 3T3MF 4HUWB 1IE5A 2AQ3A 1T6VN 1IFHH 1BQLL 4XI5C 5FA4B 3V0AC 3FFDA 4F33B 2DBJA 4EQ3A 4PGEA 2QBWA 4JQXA 1KTDA 1EO5A 1IBGH 3CVHB 4MJIE 3F58L 5ADPH 3EOTH 5HHOE 2NY0B 4EUPG 4FQ1H 2OR8A 1UVQB 2QHRH 1YMMA 2WMPA 3HLAA 3VXQB 3BRGC 5CFHA 3UC0H 5BRZE 3O11A 3PWVB 4G6KL 1J05B 5E2TL 4YDVA 4PUBH 1ACYH 4NQVB 3HRZA 1HILA 4NRXA 2AK1L 3FRUB 2QV2A 5DYOB 4ZTOL 3VFRA 4CU7A 4IRSD 5FM8A 1OWWA 3TH3T 3DRTA 4LSDA 1RZIA 4FHBD 1YC8A 1N4XL 2V6HA 3C8HA 3IXTB 4JHBA 1KN4L 2X4NB 4OD3H 2QSVA 5DRNA 4KRLB 4XWOD 3PDOA 1M7IB 4F80A 5IHLB 3BKMH 5EZIL 4XVJL 3T0EC 2F5AL 4XBPB 3QNXB 3X14A 2RJMA 5IK3A 5I30H 4OF8A 1JV5B 4PJIF 4O51B 5HVFB 2AKRA 5EFIB 2P49B 5E8NA 4M7LL 2A9NH 1FFNB 1QBLL 4XAKE 2P4AB 1A6AA 4MA7L 1YEIL 4G6AD 1XF2A 5KTEL 1PVHA 3T77A 5KS9B 3ARXA 2HG5A 3B4NA 4PJGF 4N0UE 2XZAL 1WIOA 4L4TD 4PY7A 3LQZA 2ZG2A 2E6JA 4UV7L 3QAZB 3VMNA 1XGRA 2ADJA 1UKTA 4P9HL 2J7LA 2W38A 4EN3A 1T83C 4YBQD 1H3VA 1LEKA 4PJ8C 12E8H 2Y07L 1DQLL 2CXKA 2YZ1A 4HQQH 4RWYL 4XT1C 4YHOH 1UJ3A 4AIOA 1UEYA 1F2QA 2R23A 4S10A 3ULUC 1V5JA 1YEHH 5D7JD 3PIQB 4MMZC 4UT7L 1MLBA 2H26B 4NRYB 2KZWA 2FBJH 5IJVA 4M6NL 5C7XL 3QXUA 2VLKB 3KPSB 1MI5A 3Q2CA 4FMKA 4C55A 3VG9C 5KSVA 1NFDA 2X4RA 3HMWH 1EGJA 5HBBA 3BP4B 3TEUA 1L6ZA 3NVQA 3G5XB 4UMGA 4UQ2B 5CEXB 5IESL 3IGAB 4K9EH 1D9KD 5IP4A 2DWDB 1SJEB 3QEGH 2IC2A 4DQOL 4JY5H 3T09A 1LO0L 3QHTC 2NX5B 5F3HB 3UTPE 3D0VB 3MV7D 3DYMA 4JGUA 2VC2H 1R0AH 4CAGA 4P3CL 1YEJL 1JPSH 2R8SL 3MJ8A 3QUYA 5HYFA 1MF2L 1WWAX 3ZDZE 2AJYH 2A6DB 4ZO9A 4EBQL 2Z91A 5CGYD 2D4DA 5FYLH 5BXFA 4C56A 1M05B 3QCTL 4OAWB 1DR9A 5GS0C 1ODAA 4PRIE 4WWKD 5GHWH 3BIKA 1FYTD 4NT6A 1ZLUK 3SJVB 5L0QC 4NJAH 5DHYA 4LSSH 2JIXB 1MCWM 2L7UA 1JMZA 3PWJB 1AKJB 4Y5VB 1FL6A 2I26N 1QSEA 5IV2B 5GJTL 1FLRH 3VFVA 4ONFH 2CLRA 5FYJU 1X5LA 3MLPA 4F37F 1MELA 3M1BA 1X6NA 1T66D 2Y4SA 4ODHH 3R06B 5FYJH 3LZFL 1TVBB 3BVNB 5DTFB 4P57B 1C12A 4KJPC 3HZYB 3WEXA 2ZUQB 4CADA 5DLMH 5HHQB 4PJFB 1A6UL 4KKCC 4Y16A 1OT1A 4ONOA 5D1QC 5I16A 3GGWB 4HHAB 2APWA 2FHBA 4P2RE 3N06B 1OOAA 1C5BL 1S7RB 4I77L 4U1SB 3FQWB 4PJCE 3UYRH 1SVZA 3E2HC 1NEZB 4LLDA 2DD8H 4HKJA 4S2SA 1Q9LB 4V1DE 5ID1A 4HFWA 1AP2B 5DJ0B 5JPMB 3X3GL 3C8KA 2Z9TA 1INDH 3DX8A 1FO0L 4KU1A 2A2QT 1WEJL 4JRXA 4DGIL 5CSZA 1A1OA 5C2BH 3BZDA 1OSZA 3QYCA 3VA6A 5TDPB 3GIZH 3DARA 2APTA 4KVCH 4PJBB 5ILTH 4JZOA 1CFTA 2GJ6E 3CK0L 2O93L 4PFEA 4X6EA 5L2KA 4JEGB 4LCIH 4RGNE 4YHML 5J4MA 1LK2B 2JLLA 4W68A 2WW8A 4HV8A 3OR7B 3ILPB 2WUCH 1MCQA 3GUTA 3ILQD 2F19L 4NZRL 1R5IB 4UIKH 3V7AE 5FUZL 3V6ZB 5D5MF 3P9LB 3JUZA 4L8CA 3QXAB 2PXYB 4UILH 2BY1A 5M95B 1KJ3H 2Q7NA 4NQXB 2M2DA 4U1LB 4MMXC 4G8FB 2FX7H 4XXCC 4UT6H 1X4XA 2YEZA 1I1AD 4PY8I 5DC4B 3MRHA 2VQ1A 4MX7B 5H37H 4QT5B 1FRGL 4LPXA 2I25N 5FFLA 4IIQC 1NBVL 4QRQA 3QG7L 1OAZL 3QULA 5JW3L 3LN5B 1PGRB 1MCJA 1MFCL 2CR3A 4U6HA 4QXTA 5KVEL 1FHGA 3Q1SL 3B2UC 5J9PB 1MSPA 1YPZB 4FQXB 1CXKA 4Y2DC 4OLVL 4JFHD 4GXUN 5ACLA 4ZS7L 1MJ8L 4R26H 3VFWB 4NM4H 2A38A 4Y88A 1KN2H 4FOMA 4ETQA 3C6LD 3EJYC 2DBLH 2HJLA 4I0PC 4ZUSA 2DQTH 1U3HB 3B43A 5F6HI 5JW5A 2EIZB 3MA9H 1HHIA 1LP9B 1ZHBB 3NH7L 1UG9A 2VZTA 5D7LA 3RVUC 1CLZL 3L1OL 1NDMB 2C7UB 4QHNA 4GRLD 1PX3A 1KXQE 4PRNB 5IR1A 1UH3A 4F3FB 5E08L 1LE5B 3NTCL 3LQAH 4A6YB 1JNHB 3LS4L 1MRDH 5JXAH 4C4KO 4L4TE 3VRLE 2VAJA 3HR5A 1J1PL 1YJDC 5E6ZA 1PSKL 3UO1H 3VXRB 3GMPA 3PUCA 3T2NH 1J87A 4RDQG 3V5DB 5D2LE 3CC5A 4YDLB 5DD6A 3U9UA 2ATPA 4BZYA 4QRRD 1YEFH 5KVFL 3CVHH 4DEPC 1G7QB 3ZE2E 5BW7C 2ERJB 4AK1A 2OSLA 3G6JF 3U2SB 1XGPA 1Q94A 1T1WA 2DTSA 1FAKT 4I2XA 1G84A 3I3EA 3TZVB 3TT3L 4WY7H 4WTZG 3S34L 4XNZB 2FGWL 1OF2B 1P1ZB 5KN5B 1B4JL 5FDYA 4LHUA 2B5IC 4ODWA 5IWLC 4OF7A 2VRAA 1OTUD 4AQ1B 5BMFH 1WF5A 4WUKL 4NQCA 1KJ2B 1B2WL 4NN7B 3OX8A 1A5FH 3CXHK 2HN7A 3R0MA 5DURB 5DUMH 3ARVA 5MEND 3VXTA 5LGJB 1MPAL 4MCYA 4WWID 3MV7E 4CUCA 3KPRB 3OGOE 1BBDL 5DGRA 1JMXA 1CBVH 1IQWH 4JFFB 1BP3B 1S7UA 5AAWA 5CINH 3GBMH 3W0WA 4UOW1 1RHHA 4UINH 4G7VH 2DIAA 2L7JA 1FYTE 3ARWA 1XGUB 4PLJD 5D1ZC 2YA0A 4X9FA 2XOTA 2R69H 4QXGL 2H9GB 3VFPB 3SGJA 5I1KH 1I7UA 4AG4L 5GS2D 2I9LA 1CR9L 4I48B 3IU4H 3P0GB 3SBWC 4LAQL 1MCLA 2Y7QA 3NGBC 1VESA 1A3LH 4WO4A 4PYHA 5SV4A 4PJEF 1OW0A 3UAJD 2KDGA 1MHHB 4NN5C 5AZ2H 1EPFA 4MNQA 5IT2H 2IFGA 3QFJA 1DEEA 4GMSH 5H35A 3LH2H 3GMRA 3H3BC 3UTTD 4OZ4B 5E4IA 3PHOB 2BVQB 1RIVL 2YD8A 5IEHA 3X12A 1PG7H 1E4KA 4P23C 1JWSA 2NY5C 2QADB 32C2A 3TO4C 1XCQB 3DGGA 1DQTA 1ZEAH 2YPKB 1JFQL 4L4VB 3DNKA 4Y1AA 1UCBL 2RFXB 3MLXH 5DMGC 4QHLB 1UWGL 2CLVB 5JHDD 1YEKH 1C1EH 1E4XL 5JXED 4CVZB 3RU8H 3ARED 3ZDYF 4ORGA 4KZEH 2EKSA 3MYJB 3GSRB 2XZCL 2Q20A 2XWJB 1LO4L 1YY9D 3MNZA 1WVZA 1CGXA 3AS1A 4AY0A 5ITFB 4HJGB 3BD3A 4MJ5A 3I6GA 2Y5EA 1WC7B 3LS5L 5SWSD 5TE6L 4HUVB 4OGAD 3PGCA 1T3FA 5ACZA 4Y5YB 1XGTB 3MLVH 3QUML 2H45A 3OKEA 3I3DA 2Y6SC 3ZKND 4PJDA 3MRFA 2QTEA 5E6IA 1KIQB 1DQDH 3GSUB 2ESVD 4LKCA 4LGSB 1FVEB 2Q8BH 4PJXE 3QUZB 3LKPA 4DAGL 1G7IB 4Z76B 1GC1H 3MROB 2A77H 5E8OB 4QHUB 1XF4A 2WINA 4KK9C 2CQVA 1TZGH 5C0BA 2J88H 2R29L 1QNZL 3KJ6H 1GPOL 1SBSH 5ECJE 2JCCE 3L3GA 5DI8B 3U7YL 4RBPK 1I9IH 4UDTB 4XCEB 5EOCH 2BSRA 4XCFL 2EIEA 4WUUA 1HOCB 1OAUL 1FZOA 3MUGA 4Z78A 2OJZL 1VA9A 3EHBD 1IEBA 1CU4H 4X6DA 3DO7A 1CGUA 2OL3H 3FQTA 1WBXA 3FTGA 1P4BL 1P7QB 1CFQA 4XAWL 4NHUA 1RZKH 3JWOL 1IKNC 2BSTA 5JIIA 1ZGLM 5C2UB 1XF1A 3O4LE 4IRZH 1CDJA 3O3EB 4IHOB 1WFOA 5GRVL 4YE4L 1GGTA 4ODUA 3T1FB 1Q9OB 3EJZC 1H8SA 3FT2B 4PJHB 2MHAA 1Q9KB 5LCVH 3LHPL 1UVQA 3LKNA 1KXTB 3D3VA 1I3UA 5EA0L 2APFA 1CGVA 5L8KB 4AM0B 5D72L 3UP1A 4DKDC 3BAEL 1WUNT 3TCXA 5DVNA 3QI9D 2GITB 5C0EA 4R96A 2F53A 3HMXA 2D7OA 3STLB 1F2XK 4OM0H 5E03A 4CU8A 3H42L 5C3LD 5LAXA 4RAVB 1U8NA 5D71H 2VYRE 3SN6N 1G7JB 3EYVA 5L9DH 4K23H 1BFSA 1MAML 1F90L 2D31B 1F4XH 3D0LA 1BD2D 3VD9A 4MD4A 3FQNA 4JDTL 4CNIB 4XWGH 2WBJC 3VFNB 4YPJA 2WNGA 5A2JH 1RZFH 1II4E 2QSQA 3SKJH 3TT1L 2BC4A 2OMNA 4CVUA 4QXUL 4Z7VF 4LVHB 1K4CA 1Z9LA 3ZDXF 2FJHB 2CRYA 2D0FA 3EFFB 2XFXA 3S88L 3EYFB 4QRRE 1HHJA 2NTSP 1IZKA 1AGFB 3Q3GB 2DYPD 1CK0L 4XMKL 3MR9B 1ORSA 5J12C 4PBXA 2ZJSH 5K9OB 4PRPA 1HNFA 3SEPA 4WFFD 3CMOL 2DWEA 2LQRA 2OR9L 5K33A 3R1GL 4H8WH 4ZFFA 3QIWB 4QTIH 1NUNB 3OKNA 2Z8RA 4H25B 5CKAA 1DBJH 5GGUB 2PKDA 4OZFB 1RIHL 4NQDA 2P5EB 3CH1A 1KBGH 4LVNB 3GBLA 3SDAC 3OJMB 4L9LA 4B50A 2GUOB 5EOCJ 1WTGT 2GSIB 3FQXB 2AK4A 2YC1B 5MENE 3D9AL 3MRDB 1NL0H 1U91B 3GJFA 4HJJL 2IPKA 2PO6C 4PP2A 2VLRA 4TNWF 4K7FA 4LCCC 3HI5L 3O6ML 5BVJB 2IAMD 2IPTL 1BLNA 3RVXC 2HT4D 2CMRL 4CMHB 5MI0C 5E2VL 2E9IA 5D6DA 2X09A 4BFIB 1DQJB 4BKLB 5T1KA 4UQ2A 1ZS8A 3DETC 3QWOA 5CEXA 2J2ZA 5FUOL 1AHWA 4W6WB 3P9WB 4GQ9L 2AJZA 4HWEH 1QSVA 4A6YH 1JRHI 3GK8L 4IJ3C 4R7DA 3MYZA 2CD0A 3NFPA 3RWIA 4R9HA 2ORBH 1ROWA 3CDCA 5EC1B 3D39A 1GZPA 2NXYD 4HIJA 5J3HC 1N0XH 4HKXA 3RTQD 1RQ5A 5EOQL 5BV7L 3UTTE 3V7MA 3RWHB 1HSBA 4PJAB 3DOSA 4Z7QE 2PR4L 4N9GB 5F7LB 1JPFB 5GGRY 3P2TA 3W39B 3ZHKA 4IM8A 1YECH 1Y0LB 4Y4HD 4RISH 2FHCA 1AD9A 3W9DB 1LDSA 3G6AA 3O45A 4QGTA 3WFHA 1M1SA 5IFAL 3WDHA 2QKIA 7CGTA 4UNUA 1AKJA 1J8HA 1NFIA 3G04B 3PP3K 2DDQH 2W9DL 4MJ6A 5E6YA 5JHDE 1Z2KA 3OJ2C 3V6FA 5DRZB 3KLHD 3PDGA 4ZS6D 3B9KD 5IB5B 1PZ5B 2OL3A 4M5ZL 1D5BB 3L9RA 5B39A 4UBDD 1NH6A 4LASL 3WIIL 5LWYL 3U9PH 5E7BA 5SWSE 1KJ2H 1FNEA 4CL7A 2AJVL 3FO2B 1XGYL 4KDWA 3VWJD 4XP5H 1A1NB 4OZIE 4QRUB 3AY4A 3TV3L 5C09D 3C5ZC 2ARJQ 3T0EB 2VR4A 4KTEL 1J8KA 2X4OB 2ESVE 3C6SA 2R9HC 4U1SA 3WLBA 2HRPH 3P4MA 3GI8L 5HSFA 4WU5A 3TO2A 4GW4A 3ZKMC 5DJ0A 5SWZA 3JV0A 1T0PB 2R1XA 1CFNA 1OGAD 1XEDA 3QDHA 5F88A 1M7DA 4NBXB 1FSKC 3IKKA 2LTQC 3RZCD 1NBYA 3KYNA 4N8VA 5BS0D 4Y5XC 4IOFC 4DZBB 2CSPA 4G9FB 1JPGB 3KGRA 2F54D 2BY2A 4HC1A 1P4IL 3SDDC 5DK3A 5K59F 4PJ8B 3T0DA 1B0RB 2Y25A 4PIRF 4Z7UB 5T5FH 1PZUB 4UTAH 1MHPH 4WEBL 3WUWB 1JI1A 5DHVA 1CXHA 5B38B 1BGXL 2YHGA 3MXVL 1UB5A 3P9LA 4P4KB 4ZFGL 4KTDH 3UZVB 3DHJA 1FLTX 1NCBH 2B4CC 2O5ZL 4JKWA 2PW2A 4TUKH 1ZMYA 1PD6A 2G60L 1JZ3A 1QSFB 1T22A 1AR1D 1IGIH 4PGCA 4DVBB 5MEPA 3VG9B 3BIAX 4PJ9A 3HUJF 2WIIB 3IU3A 3VI3F 2FJFB 4MX7A 5E99L 1MH5B 3MOBH 4FFVD 5D70H 2C3WA 1A9EB 43C9A 1MLCB 5I75C 4D0BB 4UT9H 3H6JA 1GL4B 3RWFA 3MFGB 4F37K 2BCKB 3QQ3A 1T80A 3HE6D 1DBMH 1N7ML 5DWUL 5GSRA 3BQUB 1HCVA 5F8RC 3N9GL 1UA6H 2BDNL 5GRYA 1UM4L 1TJIL 1BZ9B 4JVPA 1CGTA 2A73A 4HUXB 5I1EL 4QHKJ 1BD2E 4OLYL 4BUGA 4D0CA 2NQCA 1IT9L 1G9NL 1CDCA 1JK8B 4BFEA 4YDIH 4JREC 3GHEL 4WTWA 5L0QB 5TF0A 4X5WB 2DTMH 1HYSD 3DRQA 2VWEE 4XVUD 1J9CT 1DBAH 4HJ0C 2R0LL 5E1HB 1R5VA 3BWAB 2YR3A 4Y4KA 3RY6C 2CUHA 3D2UB 1OAQH 3KR3L 3FRPA 3NAAL 1ONQB 1CZ8H 1PY9A 1CI5A 1E28B 5ISZD 1HI6A 3I9GH 2G9HA 4JFED 1A7QL 2ZCKH 3KNBB 3R8BB 5FM5M 2CLZA 4A6YA 4LSQL 5JLZB 1J18A 3HS0A 4C83A 2B1HH 3LV3B 2CUIA 1KLGB 4F8QA 4WFFE 5FIEA 4AJ0A 4E41A 4HBCH 1AGEA 2VDQH 4IOIB 4LF3A 4X4ME 3S36H 3KAAA 5J1AB 3T4YB 3TFKC 1GGUA 5DJDB 4RFNC 4LOUD 3H7BA 3ARPA 4WCYL 1IM3B 3I02A 5D1QB 1T2QH 2HLFC 4G6FB 3UDWC 5KZCD 3V6BR 1NAMA 4ZFZA 3FO9A 4JZJA 1HSAA 3RDTD 4C59B 3DX6B 3WJJC 4P9HC 4YZFE 1I3RB 5MERA 4X6CF 4NQSB 3E2HB 1QFUH 2Z31D 3ROOA 3DVFA 3S36X 5F72S 5C08B 1A22B 4PR5B 4L1HA 4XNUH 4YHYC 1R5WA 4ELMA 2DQUH 3IFOB 4RSVA 1QVOB 2FO4A 4ZXBD 3EW3B 3FN0H 5I8KL 2DJSA 3GSVB 5HHVH 5IHUH 5KW9H 5FHBL 1LO2H 4FABH 4UZGA 2AQ2A 3QCUH 1R3IL 1CFVL 1FGVL 4OJFH 1W72B 4JHZA 4TYUA 1UACH 5EORL 2H3NB 1BM3H 3K1KC 1YN6B 3H9SD 4N5EC 3RPKA 1UXWA 1BMGA 4ZSOA 1F8TH 3MQIA 3EGSA 4LPVA 4NM8L 4LCWA 4ALAL 2ZCHL 2WANA 3IJYB 4JFFA 3OKLA 2G5BB 5EZOH 2Z93A 4JFPA 4NOFA 2IBBA 4XPHL 3IDYC 4GW5A 2NMSA 3GHBH 2VUYA 1I1CA 4KQ3H 4LLWA 4PV8B 2DI9A 2ZSVB 4YIQB 1FV1B 5T3XL 1KB9K 1RJLA 4LEXL 5EU7E 4FXGA 2ZOLB 1IL1B 5F7DB 4ZO7A 4P5TD 5SX5K 1OT2A 1MCKA 5E00B 5IROA 3OXSB 3VRIA 3QEQA 1EO8H 4R4FH 4P49A 1HINH 1NCDH 4K7PH 1GHFL 1KNOA 4JY6A 5DJZB 3MLYL 1O5DT 2A83A 1MFEH 4OZFH 4Y2DB 4F9LA 4OZ4A 2A6IB 1WBYB 5ERWA 1S9WB 3QQ4A 3ULVD 5E5MA 1XF5B 4HKZB 5HHPA 3SKNB 1BWMA 4OUUA 2WSKA 2X4UB 3GMOA 2O5XL 2Z35B 1I9JH 4TUJB 4UI2A 4I0PB 4PP1C 1KIUA 1SY6L 2EDFA 3JUYA 1Y18A 5C09E 1N5YH 4IS6A 1XF3B 4LLMA 3HC4L 2IH3A 3PGFL 1IGTA 1ZA3A 1ZOXA 5C6TH 2BSSB 1IGMH 3TVMD 2XV6B 2NY3B 4KDTC 3RNQB 2V2XA 4J3TA 3L6FB 1OGAE 4FQJH 4PRHB 3CDGA 4X98A 4KY1L 1JTOA 2X4QA 5BS0E 3JV4A 3E0GA 2VXVH 1JZ8A 2X89D 3WIHH 1Z6JT 4XP9H 3SDXE 1K9TA 2DQDL 2HVKA 1RK1B 2F54E 4K55A 5T1MB 3SKMB 3WMSA 2H2PD 1FCGA 5FB8A 2DM2A 1IKFH 1J11A 4OZGF 5HGHB 3MRRA 1TFHA 3A6OA 3ARTA 2GAZA 4BH7B 1AFVH 4ZMAT 2QQKH 2GY5A 2DIJA 1O0VA 4Z8FH 4OV5B 3OAZK 1OTSD 1XH3A 3CUPB 4DEPB 1ETZB 2W60A 4PYGA 3UX9B 5CD5D 3MXWH 4FXKB 4H0IA 5HVWA 4JG1H 4F7MA 3NCEB 3E8UH 3B3IB 4X5LA 3HNVL 3VMPA 2LU3A 1EEZA 1S3KL 2J8UF 1ZLVK 5DI8A 1JZ2A 3RPIB 4WW2F 1Z9SA 1YEEH 5CGTA 1A14H 2NXZD 3FO0L 2DN7A 2EDHA 3DTXB 4WNQA 4AIXA 1JN6B 1CLCA 1QFPA 2VZSA 5FHAL 2HKHH 1JGLL 4MAYD 3ZSSA 3T0XA 5FO8A 1ZT4A 3OKOA 3QUXB 4KK8D 4NOBA 2Z4QA 2M1KA 1KLUB 3UTSB 3V6OE 2G5RA 4WRLA 3LSOA 2PF6A 1M71A 4GUPB 3FZUC 1IM9B 5DMIH 3RL1A 3BT2H 2Y23A 2CDEB 4LPWA 5AG9A 1LVEA 4KV5F 4OM1H 2XWBA 4NNPL 3L5WB 3MRLB 3L5JA 3QQ9D 4XXDA 1MRFH 2PNDA 1RIUH 1P2CB 5FDWB 4AM0A 3UBXG 2FEDD 4OD1H 3TCLB 5J6GA 4MJIA 5D1ZB 4CN1A 1G6RA 1JWMA 4EXPX 5HHOA 3TYGH 3PL6C 4G3YL 2ATKB 3EOBA 4RZCB 2O61B 2O26U 5C0RH 1OPGL 4ZD3L 2UUDH 3OPZH 4TSAL 1OM3H 1YUHA 2V5SA 3NGBB 3I50H 1YDPB 3O8XB 5ISZE 4P46A 2I9TB 4JFEE 3U1SH 5BRZA 2C1PA 2R1YA 1WLHA 5E94B 3S35H 3S37L 5EBWB 5GZOD 3MLRL 4KKAC 3K4DA 3FQUA 2GJZA 4CNIA 4NKQB 2C3HA 4P23B 4FQQB 3VFNA 5CP3H 3O6FD 1GGBH 1FGNL 3O2VH 1E6JH 4NFDA 3QHFL 3TO4B 3ULUH 3RGVA 4APQA 5IM7A 1I75A 5IBLD 2QSCH 4ODTL 1C16B 5JOFB 2VXQH 1CD1B 2CRZA 3ULSA 2BNQD 4NKOA 1YNTB 3B9DA 2A9MH 2P44B 2IQ9H 5IVNA 5DK0A 2HWZH 2XA8L 3WDJA 3BO8B 3FO1A 4RGNC 1Q72H 1IGJA 4KRPC 4K3DL 5DS8B 3S35X 5ALBH 3X3FH 1H3TA 3VJ6B 4AEIL 1U9KA 2CDGA 1DDHB 3OWEA 3EYSH 4PB0H 1Z9OA 4OT1H 3DV4A 4YGVB 3MRJA 5E8PB 4U6YA 1TNNA 1NCAL 3PJSA 3JTSB 4LSVH 5CS7A 3FT3A 3GRWH 1MCSA 4N0UA 4MCZB 2VAAA 5GGVY 3HHRB 4X80L 4OZFA 2BRRH 2R0KL 4JN2A 1IC5H 2HT3C 1QHPA 2NZ9D 3JWNC 5FGRA 3BE1L 1CDHA 1IGFH 3KPPA 2VABA 5TE4L 3H9SE 2AV7A 5IW6B 3QDGA 4GG6F 4JO1L 4EI5A 1JF6A 3MLTA 1MCRA 3NCMA 4FG6C 4DN4L 4X5XA 1IAIH 4HLZG 4BFIA 5HPMB 4R4BA 5GRWA 1ZSDA 2HP4A 5B21A 4CBPA 2V2TA 4M7KL 3QPXH 5EUOE 3VU2A 4PLKC 3IDGB 5KSAD 1FO0A 3NPSC 5KAQG 3SQOL 1E4WH 2A74A 2XXMB 2DQJL 3C5JA 1NC2A 2XZZA 3D69B 3MJ6A 4HF5L 5EIVA 1H5BC 1IEAB 1T04A 4RMVA 3GMMB 4FTVB 4ZFOB 4WGVB 1E4XI 3NFNB 4LEOB 1U8IB 5E9DB 3TNNB 3AU1B 3DXAB 1VKXA 5LBSH 2A6JA 4HT1L 4OCNC 4JFDB 1MCDA 3P77A 4XHJD 3WLWD 2HJKA 4NUGL 4H0HB 1RJCA 4R2GC 1EUTA 2EKJA 3B9AA 4M43H 4N1CA 3WN5A 5ITBL 3ULVE 6FABL 3VXOA 4XPGH 4AL8H 3P4NA 3ARBC 4XNYL 4Z0XA 2JB5H 2ED8A 1Z9MA 2OTUA 5BO1L 4OFIA 5I15H 3VD3A 2IANB 1XIWA 1F97A 1FAIL 5LVEA 3CFCH 4X99B 4PV9B 2DLFH 1INQA 4DK6A 4ZTPL 4PG2C 2OP4H 3K8LA 3VG0L 3X13A 5TGBB 1YYLH 4W4OA 3BSZL 5D6CA 5FGBC 5INCA 1S8DB 4JO2H 1F3JA 4KMTH 3W2DL 5I1JL 3EO9L 2EDRA 3C60A 1CDUA 2WBJB 5E70A 3DVGA 3BGMA 4YXKH 1DE4A 3RZWA 3HNTL 4OUOA 5D1XD 3GSOB 3DMMD 1KT2A 1ZVSA 5HDQL 2CIKA 1PLGL 1TMCB 2UWEB 2VDPH 2V5RA 4LBEB 3AM8A 4R7NB 4TNWK 1KEML 2ADFL 3OAYK 3F12A 4LLYA 4P2RA 4GBXA 5JORB 3T0BA 4PJCA 2AERT 1XGQA 2VQUA 2H1PH 4HIEB 3ZTNH 2YK1L 5EZLB 1NGQH 2VO5A 1ZANL 1I3GH 2NW2B 1I1FA 3O6LL 4OGXL 5EH1A 4Z77B 1A6TA 2VDRL 4IRJA 4NFBA 3IDIA 4BZ1L 1T03H 1RZJC 3QBTB 4YHZH 5IMKB 5CCKL 4F8TA 5FGCE 5EO0B 1OB1B 4MXQD 2VDKL 1F5WA 1VPOL 3STZA 3U46B 2X10A 4H88H 3ET9F 3PWPB 5FCUH 2GJ6A 3KWWB 1YPZF 5DDHA 4JGJA 1IC4H 3ABZA 5F8QC 4Z95L 1VFUA 1AO7B 1RULH 3WL9B 4HH9A 4I3SH 3TN0A 2PO6B 1QEWB 4S1QH 4DN3L 5DUPH 1W0VA 4LCCB 5T5NG 1GAFL 5CZVL 1U8QB 2NCMA 1A1MA 1MWAA 4NJ9L 2ZUVA 1MHCA 1RZ7L 4XTRC 5AWNH 1NBZB 4LIQE 4ESKA 3JWOC 4J6RL 1OP3H 5BVPH 1LP9F 4KXZI 3FB7A 1QBBA 1JHKH 3L7EB 3BKCH 3HKFA 2YXFA 5I9QC 2DAVA 3VW3L 1TLKA 2E8ZA 4UIMB 4JN1L 4YAQA 1A9EA 1YMHA 1I8LC 4MNHA 3GRWA 5H94A 5IB4A 5TE7L 1A47A 3QO0B 4IJ3B 5CJOL 1S78D 4M1DL 1KCUL 2EDXA 2IH1B 3JV6B 1J5OL 1YN7B 4QWWD 3IVKA 2VKWA 5DEGB 5GISL 1YJDH 5KBNC 1ULVA 4QYOB 3G5VA 5B4MC 1VDGA 3MRKA 2X41A 1UZ8B 3T4AA 5HHXH 4BA8A 4IRSA 1FE8H 3CLEL 2QQNH 4DGYL 4B7IA 1IGYB 1PKQE 3BUTA 1A7PL 4RFEA 1MCOH 3OMZA 5T1DL 1NAKH 4JB9H 3RWDA 1HH6B 2BNQE 3HZVA 4KK6C 4YWGL 3V2AR 4TVPD 3BPCB 3VFGL 1I8KA 1CT8A 1NJ9A 3D85A 1EA9C 4LSTL 4O58H 4X7TA 5KSBE 3WKNA 5DJYA 3X11B 5IEKB 2DKSA 5EN2B 3G08A 3VDCA 1NUGA 1TVHA 3LIZH 3T4YA 1XMWA 4NCDA 1ZHNA 3RBGA 3V5KA 5DVOA 4L4TA 1LD9A 4X9HA 3TWCL 4AT6B 3C5ZB 5FKPA 5FYKU 1R3HA 1I1AC 3J8F7 4YX2H 1S9YA 4LAJH 1N59B 1HN1A 4A2MA 2DM7A 1KCLA 5FYKH 3KYAA 5D2LA 4Q2ZB 3H0TB 2HLAB 1X5AA 1U8HB 2D7TH 3TNMA 4JFQA 3QUYD 4LIQL 5JDSB 1FSKB 2H8PB 2LTQB 5F70A 3BEVB 4UTBL 4Y5XB 1KGCD 3WXVL 4C56D 3E6FA 1A7NH 4X9GA 5D7JA 3H7LA 1K4DB 4WI4A 1HHHA 5GGVL 2C9AA 5ESQA 1I85A 4LSUH 4FA8A 1DBKH 5IMLB 4XNQB 4XX1G 1SM3H 3QT2A 3S6CA 4AMKL 2UZXB 3IFNL 4GRMA 5I8CA 2X4TB 1NGXA 2P5WB 3W9EB 4MA8H 2CK0H 1WBZB 1FL3B 1EK3A 3T65B 1DBBL 4XP1L 1ZLUH 4HPYH 4YK4C 3CLFH 1D9KA 4QXWA 4K8RC 3CX5K 4KI5F 2NY5H 4FQCL 5MP6H 3RQ3A 1EHLH 4PGZA 1G7PB 5D7IE 2ADGB 1CVSC 3MV7A 1EAJA 4GMTH 4F9PC 3MACL 2X6MA 1WAAE 4NC0B 1T21B 2JKXA 5HHNB 8FABA 3BP6B 3MCG1 2BVPA 5TQ0H 2Y5TB 4P5MB 3QIUD 5HYJB 2Y06H 2FATL 4KHTH 4IIQA 3GBNH 4TULL 5DD3H 2NR6D 5I75B 4WWKA 3TESA 1JGDA 5C07D 1FYTA 3IF1A 2C3GA 1A02N 2VLLB 3VGFA 1HHKA 3IYLW 3SY0B 1DLHB 5I19L 4FZ8H 4EUPA 1UZ6F 1P7KA 3BMWA 2YXMA 2A6IA 3V5HB 4OIIH 4KMLB 1W0YT 4P48A 2FSEA 4YUEL 4YXHH 3WBDA 1L7TH 2GCYA 4I18A 4JREB 2EDEA 3U0WL 1BVKB 5A16A 4CDHA 4DKEH 1WV7T 3QEUA 35C8L 2J1KA 3S5LG 1KACB 3KPTA 4XBEH 2IMNA 2FJGA 1EFXB 5FM5O 2XKNB 2BSSA 4KHXH 1P9MC 3VGAB 4JQIH 3CFKA 4XP4L 1KB5L 1WZLA 5D7KD 1DVFC 3PNWB 4LRNL 2CKBB 4AYFA 3MRQA 3OKDA 1UYWH 4NWUH 1JYWA 2OCFD 4ZPTA 2PYED 4R4ND 2AJSH 2IGFH 5DD0L 5ICZA 4FQ2H 2EYTA 5HD8C 2YUZA 1SJXA 1N3NB 3HN3A 4RFNB 3O41B 2V5TA 3U7AA 1HYRC 4ZAKC 1LE9A 4NGHH 1QBAA 4P4RA 3LY6A 1MREH 1FH5L 4X0KA 4YHNB 5IVXB 2W9EL 3I75A 4OLZL 3QISA 4O2EA 1KJMA 3LQMA 4JLRA 1T1YA 5JW4M 5I18L 4G8IB 5I1IH 2VDNH 4PJHF 4NKIH 3LKOB 4ENEC 2XZQH 4PJXA 5HDLA 4JPWH 5ELIA 1Z3GH 3QIBB 4P2OC 3IFLL 5BQ7B 1ZK9A 5T1LB 1N5AB 1CL7L 5H37G 3MLWL 1NMCC 3DUUA 3N1GC 1FC2D 5HY9A 3MRMB 1PEZA 4DVRH 5DK2B 3B5HA 3ZYJA 2JCCA 4XPTH 1M6OA 1CE1H 1CF8H 2HTKD 4OGYL 4GKZB 3WHXA 3EDEA 2YPVL 1GCFA 4P3DA 3WFBL 3QA3B 2GIYA 1R24B 1ADQH 3O0RH 3QCVL 3IDJB 4UB0H 3UTQA 1P4LB 2FX8H 3U6RA 1E6OL 2EICA 2OQJB 1IM9A 4POZD 3T3PE 1ZHLA 2HFGL 1DJSA 5JW4N 1CICD 3KXFB 2JJSA 1A4KB 2UZYB 3IDYB 4LMQE 2DQIH 3QRGH 1KPRB 5DFVD 5DHXB 2VE6A 4LGRB 4OGAC 5DJCA 5FYLD 3VFUA 4M7ZC 3IDMA 3JWDL 5I1LA 2OS7A 3TJEL 3HR6A 3V0WH 3C6LA 2HYMA 1NFDF 4TVPE 9CGTA 4G7YL 1MJ7H 4CVXB 3MZTA 2R0WH 3P11L 1YEGL 1IEHA 1AY1H 3DROB 2GTZA 5E8DH 4GRLA 4OCRL 4GSDH 1ZAGA 4GT7A 5FYJD 1JGUL 2EDOA 4PJIB 2APXA 4D3CH 1FG2A 2GSGA 2ITCA 3BPLC 4X6FB 1Z5LA 4NQCD 1QFHA 1S7VB 4MWFA 1AI1L 1CS6A 4FFZL 4Z7WE 2VH5H 3ESVF 3CU7A 1JE6A 4KUCF 5C8JA 2E6PA 1MUJA 4HS3B 1LNUA 4NO5A 4JAMB 4TRPL 4QRRA 5EZJB 1NLBH 3TC9A 3QB7C 1KGCE 3RAJH 4C56E 1SEBB 3CVIH 4JANA 4WV1A 3PV6B 2YWZA 3ZZ1A 4DZ8A 5A2FA 1Y6NR 1LO3L 1F58L 1QQDB 3ECBA 2L4OA 1L0YA 1QLEH 3F6IA 4HGWA 4R0LC 2AXGB 1NLDH 1YYMH 4K2UL 4L3AA 4N0CD 1RU9L 2P46B 4WO4D 4DTGL 1D5XA 3GMQA 1FNSL 3RL2B 5F3BA 4DK3A 4XCCH 2NY7L 3NCJH 4K3JH 3UJTL 3CIQA 3K0WA 3LAFA 2F15A 1LO5A 2BK8A 2MCPL 4QY8B 5AUMA 5HPOA 3D18B 1G7LB 5MENA 5IKCA 1MNUH 3MV9D 1S7XB 3BESR 3UJIH 1I8IA 3SCMA 2DKMA 1W0WB 5KVGH 4NZTL 1RJYB 4ZQKA 1HHGA 3C8DA 2VDLH 1DZBA 1FN4A 4PRIB 4NCC1 3PWNB 1H8NA 1D6VL 2VISA 4CDGC 2HT2C 2H32A 2Z92B 3L7FA 5C07E 3U4BL 1T0NB 4M62H 1GIGH 4JJ5A 3EFDH 3SDCC 3AU1A 4XGZB 3DURA 1CQKA 1VCAA 2DQCH 1CLYH 1QLRB 4PRDA 1T4KA 3DSFL 4G8GD 1NMBL 1EGJL 3LB6C 5CP7B 2HFEA 4UUJB 2E7BA 3HE7C 5EPMB 4DW2L 3T0WA 4RGMC 3DX7B 5TJWK 5I17B 2C3VA 5C0IB 5I76A 4HWBH 2RIKA 3UTTA 5J57B 2VQTA 3U0PB 1SYVB 2P43B 1RMFH 4HXBL 3M17A 4AH2B 4PBWD 3PL6B 5DVMA 4KVNH 2NY4C 5E95B 5I1GL 4JM2D 4U1NA 1T5XA 2A1WH 3AXLA 3SDYH 5IBTH 3VWKC 2AXFB 3DUHA 4WGWB 5D7KE 2F5BH 4KJYA 5JHDA 4V1DB 2Y9RT 1QR1B 1MJJB 2VITA 3ARGB 5JXEA 4L29A 4GG8B 3SE9H 3AREA 2PYEE 3W11C 1JPST 2EDWA 4YXLL 4RFOH 3SOBL 1FBIL 3CXHJ 3TBWB 4HX1A 4Q9RH 2CKNA 5DRXA 1K6QH 2FZ3A 2B4CH 4YGAB 3QDMD 5ID0B 2BY0A 5IHZB 4OZIA 1KCSH 3VI4E 4RGNB 4RBPH 4R7NA 4MD0A 4KRPB 3HAEB 2ZUXA 1FIGL 3SKOA 1WT5A 3MNWA 4XNXL 5GJSL 2ESVA 2PTVA 5JORA 4HPOL 1X4YA 3QH3A 1TXKA 1PQZB 2MPAL 3K3QA 1B9ZA 1D5MA 2X7LA 2XTJD 5F21B 2NY0D 2EZ0C 1NC4B 1IBGL 1F4HA 1TCRB 3CSYB 5ADPL 3BIBX 4KTYA 4UOJA 1VFBB 4FQ1L 4HXAH 2YBRB 4NZUH 5JO5A 3EZ8A 2QHRL 3SDAA 3HFMH 4D0DB 5D5MB 4FFYL 4BH8A 5GS1B 1EDQA 5GXBB 3UC0L 5CILH 4U1MB 1NUFA 5E2TH 2PO6A 1QEWA 4XX1E 2ZG1A 4ISVA 4LCCA 4PUBL 1ACYL 4WTZA 2EDTA 3SE4C 4CW1A 3QPQD 4FXLA 3MBEC 3RWCB 1KN4H 1P84K 3LKRB 5CBAB 4N0YH 3BEWB 4H20H 1T0MA 4L8SA 3ROLB 4MNGB 4IMKA 3NPSB 3ZKXC 4OQ1A 5FYLE 3MOQA 1SYSB 3BKML 3OR6B 2DB8A 2CKBH 4Z5RA 1F6AB 1VENA 1UM5H 1H5BB 2IH1A 2AJ3B 5I30L 1PYWB 4MSWA 2AJUH 1HDMB 3VDBA 4ZO8A 2VZ1A 3Q6FB 3QI9A 1Q0YH 4I2XE 1AC6A 4LSRH 5CJBA 4OCSH 3IDUA 1J0YA 4R2GB 2IADA 5B8CC 5FYJE 4O9HH 3ARBB 1U8PA 5E5UB 5DMJB 1DTUA 2Y07H 2A6KA 4M4RA 3RVVD 3SKUD 6CGTA 1BD2A 12E8L 2IPUK 4KAQL 4PRAA 2GEEA 4NQCE 1RJZB 4XH2A 3KYOB 4HQQL 3D48R 4NRZA 4AIZB 4YHOL 5B3JF 4LCUB 1RY7B 3BOVA 4M61B 2NTFA 3E6HA 3TIEA 3DUSB 5BOPA 1SEQH 1YEHL 2WWMC 3KPOA 5IJKC 2EO1A 4HKBA 3OB0K 2VLKD 3KPSD 3O2DH 4ZPVB 4WFHD 2Q86A 5DQJB 2FBJL 3KPQA 2NLJB 5ESVB 3PP4H 3VH8A 4HSQA 2DYPA 5ANMA 1QHOA 3W0WE 4NKDA 1QA9A 1R3KB 2P48B 4XMPH 3GI9H 3HMWL 3KPNA 3FB8A 2CK2A 5EC2A 2GT9B 4FFWD 1U2CA 4OFYD 3RUGA 4DGVH 3K8KA 1L7IH 3G6JB 4ZUTB 3V95A 2NX5D 4K9EL 4TUOA 2P8MB 3QUMB 5L8JB 5DMYA 4RA0C 3QEGL 5FF6B 4HWBA 3WO4C 1AXSB 1ACZA 1ZWIA 3C09C 5I66B 1S9KC 4P3CH 5IGXL 4B5EA 2EE6A 3AB0C 4WW2C 3LPWA 2VC2L 5L6YH 3VXMB 1R0AL 5MEQA 1EEYB 1HZHH 1JPSL 4XPBH 1NMAH 3QZWA 3V6OC 2G75A 3LEVH 5KG9B 1VGKB 1K4DA 3MV9E 1G1CA 3OXRB 3FRPG 2VSDA 3CXDH 5FUCE 3MC0A 4YHIB 3SDDA 3ISWA 3SJVD 2IAMA 2FL5B 2ITDA 4PTTA 2JIXD 2R56H 1AIFA 2J8OA 1V7NH 5GHWL 1OAXH 1AKJD 4EVNB 4NJAL 1BECA 4LSSL 4Y4FC 1DUYB 5CJXC 2JJWA 3KPLB 3WNOA 5F9AC 3IS0X 1FLRL 3RVTD 4ONFL 3BZFA 1BZ7B 4J3XA 1LQSR 2XICA 3PP3H 4F7PB 2EDQA 4O4YH 5C0AA 2WWKT 4G8GE 4ODHL 3KLAB 1EV2E 2X4SB 1FFOB 5GGTH 3ZLQC 5LJYH 3L5IA 3RGHA 4PTUB 3RTQA 4B7LA 1A6UH 5I1DA 1I7ZA 3TYFA 2DJUA 5DLML 2P8PB 2Y5TA 4PJDE 3S7GA 3EDFA 2LV4A 4XNMB 1EBAA 5DJ6B 3VXPB 3BUYA 4MQ7B 5IBUG 1KOAA 1C5BH 2BRQA 2J12B 4I77H 2ICEB 4Y4HA 1IAKA 5CWSA 4HMCA 5C1MB 4Q74A 4HEPG 3H9HB 5HDBF 3UYRL 5TF1H 4OZHA 2DD8L 3LKSA 2YSSB 3MBXH 2V17H 4QHMA 4HIHA 4XZUA 3HI1B 2SEBA 2HH0H 4B0MM 5C0BE 2ZSWA 4L8BB 5C2BL 5IFHH 2GFBA 5DUBA 5ESAB 3LDBC 3MRNB 1CFSA 1JUFA 3GIZL 4TVSa 1JWUA 2DKUA 4KVCL 2DQEH 2X2YA 1RK0B 4QOKB 4PGBA 4KUZH 2EXYC 2R2EB 4ZXBC 3VDAA 4X6DE 4FN0A 5F1IA 3DBXB 5MEOB 3QDME 4LCIL 4QRPB 4K3EH 4O2CA 3VD5A 5DJAA 4POUB 2FIRT 5HI3D 4L8DA 5C09A 4M1GL 2WUCL 5GPRA 2IQAB 3BN3B 3FB6A 4Q58C 1QD0A 4S1RH 4UIKL 4IDLA 3H2WA 3TF7C 1GZQB 3NN8A 5E2UH 4UILL 4AEFA 4H5SA 3ALWA 1TQCC 3L3OA 3PQYA 2XTJE 1ES0B 5K9QI 1KJ3L 4U0RC 5F9JB 2XNAA 2R1WA 3RZCA 4KWUA 5BS0A 2FX7L 3UDWA 4UT6L 43CAA 2R39A 2VN4A 4HIIA 1I1AB 2K3TA 1BQHA 2F54A 2JK5A 3U36B 4BK5A 3EO0B 3ZMRA 3QG7H 5JW3H 3I6KA 1BOGA 3MRGA 3WFEH 3FOMA 3LKOA 2ZP0T 5KVEH 2VDOH 4L5FH 2D4FA 4FQXD 1Q0XH 5EBMA 3MRPB 2YZ8A 3O4LB 3RY4A 4OLVH 4QRSB 5D9SA 4ZOCA 1MJ8H 3DIFA 5IQ9A 1AGDA 1T2JA 1NCCH 1BFOB 3L3KA 4NM4L 4J3SA 1KN2L 4WFGD 2DBLL 5DVKA 3KDMB 3U83A 3FT4A 3O3BA 4JFOB 3VFTB 3ARFC 2DQTL 3FMGH 4PRBA 2GK0B 3MA9L 3L1OH 4YK4B 4GAYB 1RZ8A 2MKWA 3BWUC 5IOPA 4HUUA 4ZG1A 5KS9E 4KKLC 5E08H 1ZHKB 4AEHL 1RSFA 1RVFH 4MZ2A 1JF1B 1U95B 3LQAL 2FH8A 4E41D 1MCBA 1MRDL 5JXAL 2AAVA 3HE6A 4I3GA 5C0JB 4JQVA 2X44D 3KXFA 3VXRD 2VNCA 5DJXB 3WFCH 1KG0B 3NIGF 1WWWX 2AEQH 3K4ZA 3HAEH 4OQTA 3V9FA 2EYRB 3QJFA 3UO1L 2WBWB 5BV7B 3REWB 4O2FB 5TDNA 1FZKB 3EKCA 3HZKB 3QEHB 1NPUA 5DZLA 1J1XH 2H2PC 5FK9A 5EU5A 4MXVF 4ZOAA 2QHLA 4RMSA 3MFFB 2OM5A 4WW1A 3AMKA 2BY3A 4CVXA 2FYYA 1YEFL 3GKWH 3CVHL 5HI4C 1F45A 2DQFB 2JELH 1HH9B 2VLKE 4WFHE 5CD5C 1I3VA 4NO0B 5EOTB 4OLWH 4F7EB 1TTGA 3FFCB 3BP5B 3U4EB 4JKMA 1IQDA 4WY7L 1B4JH 2PXYC 3BRDA 1RFDH 5D2NC 2GY7B 2XQYK 5IG7B 1AQDA 2FR4A 4H26A 1OHQA 1S7WB 4E5XB 1S5HB 1CLOH 2R2HB 1ZT7B 5GGTA 3HMXL 1ZLSH 3PHQB 3QXDB 3P40A 4WUKH 2NXZC 1UH2A 4LLUA 2FD6H 3L3IB 4PJGA 5BMFL 3OGCA 1MPAH 1RHFA 1A5FL 4KDTA 3KPRD 1D6EA 4OD2A 5DUML 4EOWH 1BQUA 3K2MC 4KK5D 5EIIB 3RDTA 1DVFB 4LCWD 2R4RH 4Q97A 4JFFD 3IRZA 1B3JA 4U6VH 2K1MA 3CZFA 2Z31A 3MO1B 2Q7YB 1CBVL 1IQWL 1BZQK 3SJVE 1QLFA 5CINL 3GBML 3EYQC 3HTLX 4UINL 4ZAKB 5C0NC 1UH4A 1TCMA 3PV7A 2MWCA 4ODSL 4G7VL 2E7LA 1I7TA 4NO3A 3GSNA 4CKVX 4QXGH 2R69L 5HYQB 3PXJA 2RAMA 4GLRH 3NABH 3QEQD 5I1KL 4LNRA 1KPVB 2VOTA 1U3HC 3IU4L 4Z7NF 1X7QA 1A3LL 3F7YB 2QL1A 4B53A 1XR9A 2KPNA 5A1AA 4BSWB 2OR7A 4FQLH 4P2OB 5AZ2L 5IT2L 2ZOKB 2ZCLH 3H9SA 5JZ7D 1YY8B 4JRYB 5HYSB 3LH2L 4DKFL 1XR8B 5FECA 2QADD 4PJFE 3G5YA 3KPMB 4LKXA 3S96B 4L4VD 1QFOA 4NYLA 1PG7L 1RJYA 2DQGH 5DZNA 3BH9A 1JFQH 2OTWB 4X4XB 4WI8A 1UCBH 1ZEAL 3RWJB 5HGAB 2PW1A 4M3KB 4J4PC 4M93C 1X5GA 4HEME 1UWGH 3MLXL 4NNXA 3WS6A 4TQEH 5JQ6H 3QUKA 4ONHB 1OTTC 1YEKL 1C1EL 2W92A 5D8JH 3RU8L 4Y19A 1ZA6B 4P5TA 2XN9A 4OSUH 4OZFG 4KZEL 3ZE0E 3QJHA 4CGTA 2W1NA 4JGMA 5JDJA 2VL5A 2DIBA 3CFDB 4PJBE 3MUZ1 3I6LD 4F2MB 1JGEA 1FYHB 3MLVL 2OBGA 3E1F1 3B2VH 4M7ZB 4XNZC 2WP3T 1JNLH 3BHBB 1HXMB 3QUZD 1DQDL 1EO7A 4R3SA 5BJTB 1BX2B 5F7KC 4QLRA 1KTLB 2Q8BL 5DJ2A 1K5NB 1EXUA 1FC1A 1RZJH 4WI5A 5E8EB 2A77L 4LLQA 1JTTA 3NACH 3T8XB 2Y36H 1YA5A 4GG8A 3OAZH 3TVMA 5JPNB 1TZGL 4JO4H 2WLYA 1QG3A 1P69B 2J88L 3KJ6L 4M6OH 4TPRH 1CL7I 3MOAH 2JJTC 5AEAA 1I9IL 5EOCL 2QR0A 2NNAB 2X89A 3BPLB 3MODL 5FA3A 4Q6IA 4BSVA 2VXUL 1S9VA 1ZLVH 4ZDHA 1P7QD 2A0LD 3BZEA 1H3XA 3QXVA 4POYA 1CU4L 5HGDA 5CGMA 2WIMA 2OL3L 3JWOH 3VCLA 4OCXH 1RZKL 3NZ8B 3MA7A 1I8MB 1CGWA 2PTTA 4G9DB 1PQZA 3MV8A 4IRZL 1QRNB 5LQBH 1HQRB 1U8MB 2D03H 2VLJA 1QYGH 1KB9J 2EYSA 2FECL 2Z8WC 2R4SH 1JHTB 4WJ5B 4NSKA 5HXMA 4MB5A 5DQ9A 2JB6A 3LHPH 1TZIA 5EBGA 1K8IB 3B9VA 5LCVL 4WFGE 5IMOB 3LRGA 3MGOA 1CDBA 2AW2A 5D5MA 2XY1A 3SO3C 4KI5C 3K1DA 4X9BA 4R0LB 5D96C 1WWCA 2R2BB 3RY5A 1AD0A 3HCVA 2N1KA 1U8OB 4KJQC 2AVGA 5EBLA 4FQPA 2HFFA 2AGJL 3T2QA 4P2QB 4ZUUA 1O7VA 3ZT7A 1A2YB 4MAYA 2FIKB 5D71L 1FCCA 3PWUB 4U1HA 3CCHA 1T1XA 4HC1L 1D5ZB 5L9DL 4E41E 3D6GA 4K23L 4KXZH 5BZDB 3F6LA 1F4XL 4FRWA 4YO0B 5L8LB 4JY4B 3VXRE 4V2BA 1HCFX 5K9KB 4APQD 4O5LH 4XWGL 5C6PB 2HJFB 1RZFL 3ES6B 3KYKH 4Y5YC 2B1AH 1H5BA 2X70B 4ELMF 1PYWA 2HKFH 3ZT5A 4IDJH 4WHTA 3K2UH 1B0GA 3DMMC 3I3BA 1KJVB 1ND0A 1G7HA 1JTPA 1A4JB 4XMKH 1AGCB 3ARRA 1HQ4A 3WUWG 3KYMA 3UPRB 5B38G 1IAOA 4MD5B 3VFMB 5JTWA 2ZJSL 3HE7B 4LL9A 2CIIB 3DSNA 3PABA 3QIWD 3DYOA 2H2SD 4RGMB 4JQXC 3TBSA 2BVEA 2K7PA 4QTIL 2OLDA 1DBJL 1FVDA 4QRTA 5GGRB 3KYOA 3O6FA 2NY4B 1KBGL 1T5WB 1PKQA 3CAFA 2BVOA 3BN9D 1U58A 2YD5A 1T20A 4EI5D 3KPRE 3VWKB 1NL0L 3RX7A 1TTUA 3HI5H 1MEXL 4LCWE 1PEWA 2ZUSA 5FGBA 3MJ7A 2NLJA 3HI6H 5CIPA 3JV5A 4JFFE 4QF1B 2D7QA 5KSBA 2FEEL 3IXAA 1A6ZB 4X6CB 4EDWL 5FUOH 4K8RH 4PJ5A 4UQ3A 1H15A 3GIVA 3LKQA 3WNMA 4YR6A 4HWEL 2EH8H 3QO1A 4A6YL 2AQ1A 4N0FA 3QEQE 3CX2A 1R3JA 1TZHB 4X6BA 2ORBL 4XI5D 4ELKB 5FAAA 1V3LA 1VSCA 4OCYH 5DEFA 4F7TB 4GKNA 5DMKB 5HGBB 4OCWH 5HYIA 2WAHA 2BMKB 4N1HB 4X8JB 4L4VE 1KB5A 5ETUA 4EN3C 4RISL 3CPLB 2ICWJ 5IMMB 3KPLA 5DA4A 4Z18A 3O3AB 4PJ7B 5KSAA 1BBJB 1C5DA 1UJ3C 4RIRA 4QTHA 5INDB 2RCSL 5DZOA 1OD7A 4M5ZH 4HG4K 2APVA 3MBEB 3B9KB 1ZTXH 4G43A 1I1YB 1XGYH 3U9PL 3I6LE 5KSUB 1KJ2L 5D7IA 5DQDH 3MUY1 4JR9H 3T0ED 4WU7B 1H3GA 1CE6A 2OJEA 1KPUB 3GMNA 4HD9A 5D4QA 1XZ0A 4XP5L 3ZKXB 5C0FB 2UYLA 4PJEA 2P8LA 4KTEH 1ZGLB 3RRQA 3FQRA 1WAAA 5JA8B 4MHHG 3DVNB 3NIFF 2NY2C 4LDOB 3BZ4B 3GSWB 1S9XA 2HRPL 4GBXD 3VXSB 5FOBB 1MCPH 1B6UA 1ED3A 1A3RL 2X5PA 4NDMB 4FQIL 2YD1A 1XT5A 4G9FD 2ICCA 1OGAB 3IETA 1JGVH 1GVIA 3QUYC 3UBXA 5C0DB 3MRBB 3OAYH 2RR3A 2VDMH 5B8CB 3S3JA 2AV1A 1EVTC 4PJ8D 4AENA 1BIIB 4L3EB 3RX8A 3SDXB 2XKUA 1INEH 3RWEB 2IJ0C 2ICWA 5T5FL 1A0QH 3JVGA 3W81A 4LQFH 4UTAL 1G7MB 3LVEA 1MIMH 2HRLA 3ULUD 1DQQB 1J10A 3QDJA 3CFEB 3ZYOA 5D1XA 1HXYA 4NKMA 5C9JB 3HC0A 5EIQA 3LRSB 3VFOB 2IG2H 1QSFD 5DXWA 2HVJB 4KTDL 4HW6A 1U93B 5EUKA 1NCBL 1BWWA 3TPUB 3O9WC 3EYOA 3D25B 2YD4A 4OZGB 3RWGA 4NQEB 5C0CB 1CVRA 4PJHE 3IKCA 5IF0B 4U1KB 4I4WA 1NSNH 5BZWA 4X7FC 1UXSB 5E99H 2BOBB 2P24B 4L1DA 1OLZA 3BXNA 4Y16C 2HFTA 3MOBL 4U1IB 5DSCB 2OXHA 5D70L 1X5ZA 3WO4B 2V7NB 3C09B 5J6HB 5KANI 4UT9L 4QCIA 5I74C 2W07A 2G2RA 3BD5A 3AB0B 2J8UB 2EC8A 4WW2B 5DWUH 5DT1L 1NDGA 1U8LA 1EX0A 1DBML 5CD3B 2P7TB 1YQVH 2RBLA 4RAUA 1HEZA 3BH8B 1OP3K 1CFBA 3P4LA 1UA6L 5CHNB 5L88H 5GS0D 3OZ9H 3WFDH 4BYHA 1MY7A 3GHEH 3VXNB 1N8ZA 4YDIL 2C4FT 5F96H 2C1OA 3QNYA 4HBQA 4LK4A 3VFSA 2DTML 3QG6B 2VTFA 3D2UD 4Y4FB 1DBAL 2BSED 3MUHL 5CMAA 3QNZB 1OAQL 4ODXB 5IB2B 3D85D 1LEGB 5K9JH 1CZ8L 4YC2C 3I9GL 4ZUWB 2ZCKL 4LHJB 1FZJB 4Q9BA 5ISZB 4KJPD 4JFEB 4MDIA 5GRZA 2EE2A 2MNUA 2PCPA 3LN4B 4JDZA 4OKVB 2B1HL 4KKCD 3HPJB 5LGHH 2V5YA 4HBCL 2VDQL 3V0VA 1ORQA 4G6FD 2CUMA 4YDJB 5D93C 1T2QL 3TBYB 1PX4A 4KRNA 4R97C 5L2JB 3U48A 3QDGE 1FJ1B 5CBEA 3NZHH 4U0QB 3F5WB 1QFUL 5C08D 4JCMA 5CLWA 3C87A 3EO1A 5F1NB 5EU3A 3UTZA 4PREA 1BAFH 4P4KC 3JTTA 1UQSA 4Z7VA 2E5EA 3GSQA 1F13A 3LDBB 4LVEA 1P7HL 4NO2A 2VUOA 3CFJB 4U7MA 1G6RL 2DQUL 1KV3A 4UDUA 5I8KH 3TIDA 1ZT7A 3FN0L 3PHQA 5FHBH 4ZXBB 5HHVL 2MCG1 3L3IA 2YD6A 4JDVB 5DRWB 4E0RA 5KW9L 1LO2L 4FABL 3EDJA 1FGVH 3GJEB 4EI6B 1VFAB 2COQA 2DMBA 1H0DB 4OJFL 3FB5A 3ZDZF 5EIIA 3P73B 1BM3L 2YD2A 3EYUH 3MLSH 1FNGB 1SJVA 4AZ8A 2BP3A 4YDKL 1RPQA 4CJ0A 2ZCHH 4Z7WA 3U0TB 1F8TL 4PJAE 3A6BH 1TQCB 3C08H 3EOAB 3LEXB 3QFDA 2XA3A 3BQUC 2Q7YA 4U0RB 3WKMH 5GGQH 4MQSB 3GDBA 4WI2A 4WDIB 2XT1B 5EZOL 3OJDB 1IGCH 4B41A 3TBTB 4MQXD 5KVDH 5T3XH 2OK0H 4KQ3L 2CPCA 5EUOB 4GG6B 5EO1B 4KZDL 3RI5K 4ONGH 5C0GA 1A9BA 1CG9A 4MA3A 5ICYA 1HK6A 3KS0H 4K3GA 5AZEH 1EAPB 3Q6GH 1EO8L 4M5YL 4J1UB 4R4FL 1NGYB 1NCDL 4OTXL 4K7PL 4KGLA 3IFPB 2W59A 4JRYA 3OKMB 2Y1VA 4BFGA 4S1SH 1MFEL 3C5SA 3EJYD 1Q9WA 1KIRA 5FOJA 4I0PD 2LE9A 3T0EE 1FVCB 4HZLB 1AH1A 4PJCF 1I9JL 4WI9A 3FHAA 4TSCH 3ARFB 3RVUD 1N5YL 4YHPB 2E9BA 4GXVL 3HC4H 4E42A 3KHQA 4HZAA 3TA3A 1CGYA 3QIUA 1G9EA 5JNYA 5CEZH 2OI9C 4PRHD 1FP5A 1EJOH 1IGML 1F11B 5AD0B 3TBVA 3IDNB 5C07A 1E27B 3IAGC 1ZT1B 1F6LL 3W82A 1RUKL 3B6SA 3L3JA 4HULB 2PYFB 4G9FE 3P4OA 4G6JH 4YNYA 1LMKA 1BVLB 2VL4A 1MRCH 3MGTB 2VXVL 4XP6L 4S1DC 1OGTB 3WIHL 4JFXA 1FFPB 4Z7UE 4XP9L 2ENSA 2ICES 2UV3A 2F8OA 2H6PA 5E1AA 1DN0B 1OD9A 3VE0A 3VGDA 3HZMA 1K85A 1IKFL 5IUSA 2W0LA 3HNSH 1ZE3C 4DOHB 1U8KB 4J3VA 3H3PL 3ULUE 3MLZH 4PG9B 2QQKL 1S7QA 4UU9A 3N1FC 4XMLH 2L0DA 3L95B 4FZEL 5F7EH 1WCQA 1JJUA 4GXUM 3X17A 4XBGA 3MXWL 8CGTA 5CLTA 1OW0C 4JG1L 3OHXB 3S4SB 3E8UL 4DCQB 1S3KH 1JZ6A 5D2NB 3RVWC 1A8JH 1CD9B 3P30H 1FZMA 5IIEA 3E3QE 4NPYA 1YEEL 2AABH 1E4KC 2YUWA 3MRIB 4IMLA 1DFBL 1NGZA 2PYEA 2LVEA 3GMLB 5F89A 2NXZB 2Q3AA 1JGLH 1XAUA 3CX5J 2YPLA 1U36A 4JHWH 2HKHL 3MCKA 4U6XB 1B88A 3WIFA 3FCTB 1MHEB 4OLUH 3W5MA 5FO7A 4HWZA 4U1JA 1NGWA 4G9DA 4GAJH 4U2ZA 5FYKD 1IM9D 1QO3A 5FO9A 1S7SA 4ODVH 3VXUB 5CAYB 4QO1A 1G0XA 2FO1A 3MLUH 1HQRA 2J6EH 3KS0J 4NHCL 1LHZA 2V2WA 2D7PA 3IJSB 4HDIA 2HMIC 3MRCB 4NNPH <