2BDNL

Crystal structure of human mcp-1 bound to a blocking antibody, 11k2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
DIQMTQSSSSFSVSLGDRVTITCKATEDIYNRLAWYQQKPGSAPRLLISGATSLETGVPSRFSGSGSGKDYTLSITSLQTEDVATYYCQQFWSAPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small inducible cytokine A2
publication title Structure activity relationships of monocyte chemoattractant proteins in complex with a blocking antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2005-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bdnL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bdnL01
3NIFE 1NGXB 1TPXC 3PWUA 4MQ7B 4XNXH 4EQ3A 1ZHKA 4WUUB 4PJBF 3HI5H 1GIGH 3HC0B 5DRZA 1A7QL 5H35B 1MRFL 1SJHA 3PHQA 3SY0A 5F21B 1TIUA 1A3RL 5JXED 1WTGT 5TE7L 3BH8A 3ALWA 3ZSTA 4D0BB 1WFOA 4O4YL 2Y7QB 2P24B 4K7PX 2VN4A 3CFBB 5C0AB 4M93C 4K8RC 1KIPA 1V05A 3IRZA 1YPZB 4WY7L 1CXHA 4WNQB 3AMLA 4HWEL 4AL8H 1S7QA 1T0PB 4XP5L 4Y5YC 1C12B 5E9DE 4GKZA 1G7IA 2FATL 2W38A 1T5WB 4MD0A 3DYPA 1L0YA 1N5YL 1J0YA 5IB5B 5DHYA 2DQEL 1WISA 3FN0H 1WIPA 5FEBA 3S5LG 1MCJA 1FLRH 1UJ3C 4OCXH 4OFYA 5FYKD 1EZVY 1F11B 1MIML 3OR6B 3MRLA 1ZT1A 4QRUB 3TBWB 5DD0H 4OLVH 5ERWA 4CMHB 4BZYA 3WJJA 3FKUS 2CGRL 3SKNB 1JWUA 5E6IB 4RDQF 5EOCH 1MHCA 1PKQB 2BSRB 1SVZA 1X5KA 5CHNB 1BLNB 2OM5A 2XFXB 4U1JA 3ZKSD 5J1TC 5EO1A 1NCBH 1DDHA 5GGUA 1WAAA 4N0YH 4KMQA 5IJKA 2NW3A 4Y1AD 3MOBL 3RZWA 3ZKXC 4F7MA 4YGVB 1QFWI 3TA3B 5LGHL 3C8HA 1TMCB 3RVVD 3LQZA 4UT6L 1BIIA 3U2SB 3SO5A 4NCDA 2X89D 2NY7L 4ZAKB 3VXNA 4CJ1A 1I1YA 5LGJB 4HKBB 1U8JB 1S7XB 3EOAA 4DK3A 2BHYA 5T3XH 5SWZE 5C0NC 1JGEA 2MQCA 2ZNWA 3KYOA 3MLZH 1TCRB 1MCOH 4JY5H 4YXHL 1LNUB 3CXHJ 4P5MA 2LTQB 1T2QL 2EH8L 3RAJH 5CEYB 5SX4I 1JF6A 2ZSVB 2BOBA 3GHEL 1D5ZA 5HYJD 4KK9D 4KK5C 1ZKAA 2DN7A 4NN6C 4XZUB 1BOGA 3FQNA 3QT2A 4P2RD 5JW5A 4C57C 4YJZL 2CDEA 3U7WH 1TZHB 2VUOA 2B1HH 2W92A 5F44A 1PZ5A 1T2JA 3QUZB 3O6MH 1NSNL 1U8IA 1QOKA 4HLZG 5SWQB 1N26A 3ARFC 3BN3B 4WGWB 5BW7A 2KH2B 1C7SA 4HJ0C 4YEFA 5ILTL 2K1MA 3DX8A 5E9DB 3FJTA 1U2HA 1WV7T 3B83A 4WENB 5C7XL 1N0XH 1U93A 2DQFB 3HE7D 2VLKD 1V7NL 4FZEH 5I1LA 2X4OA 4RAHA 3OKOA 1MCHA 2D2OA 4X7TA 5T1MA 5JDSB 2XA8H 3BIAX 1LP9E 3OKEA 3MRMB 4UDTA 3QQ9C 3HE6D 2V7NB 4HC1A 4PJHE 5D7SL 5DR5H 3MFGB 3W39A 2Z92A 3A6BH 1B4JL 4D9RD 1V3MA 2NQCA 4JRYE 3ARUA 3NOIA 1LEIA 4GW1B 2MCG1 4Y4FA 4HG4K 1KB9J 2ICCA 4ZD3H 1JWSA 5GGRA 5JOFA 4ORGA 3W11D 4AG4H 4H0HB 3OKKA 4QRSA 1WLHA 1Z9MA 2PNDA 2R8SH 5K9QI 2C9AA 3KJ6L 2QQLL 1YC7A 3MJ9H 1H9VA 4KXZH 4XVJL 3EYFB 4RMSA 1IM9B 3HR5B 2XKNA 4DW2H 1NDGB 1JK8B 4G42B 2QQNH 1SY6A 4XX1E 2AJVL 2VDQL 3O9WD 5ANME 4YHNA 3BUYB 4XHQA 1TJHH 1FVDA 4NWTH 1UM5H 4I3SH 3PWPA 4F7CA 2VDNH 3BIKB 1L0XA 4PLJC 3LRGA 3PHSA 3T65B 3TC9A 4M5ZL 4JHBA 3SGKC 1GL4B 1RU9L 4EUPB 3O3DA 5SWZB 5GZOD 1FE8H 2NY3B 3DSFH 4CDGC 1LEGB 2WWMD 1J0ZA 2FD6L 3UTTD 5D93B 4R26L 1OM3H 3MRJA 4LPCA 3FRUB 5FA3A 2V2XA 1OP5H 3KVQA 5D1QC 3Q1SL 1JNNH 1KCKA 3TYFA 3CLFH 2PW2A 3MMEB 1KLFA 2AKRA 3QEHB 4U6VH 1QZ1A 1F97A 3U48A 1MI5A 1I3RB 3LN4A 2FEDD 5FYKH 1JGUL 2AEPL 1FGNL 3FFCA 4NM4H 3PWNA 4HSQA 3RVTD 1MLBA 2NZ9C 3PNWB 4L8SB 1GOGA 4O2FB 5DI8A 3RU8H 1BFOB 2GK2A 1MIEL 1EZVX 3BD3A 1OAZL 5FHAL 3MBEB 1JFQH 2BSSA 1MWAB 1LDPH 4OCYL 4KKBC 1QA9B 5CJ5A 3EO1B 3O2WL 4PJ9B 1LP9B 2F5AL 4NZTL 3Q6FA 5KAQF 4QRQA 1MH5A 3VD3A 5KANI 4J8RA 4PJHB 1RJLB 2XNAB 1ZT4B 3UJJL 1VFUA 4JRYB 4LDLB 1NBZB 5CP7B 3MR9A 4LIQH 1J05A 1PBYA 4AK1A 3OAUL 1OTTC 5K93A 3IDXH 4QRRA 4PJ8A 3SE3C 2OCFD 2OL3H 4JG0H 1ZE3C 2IALA 4GSDL 1FFOB 1HSBA 4NQUA 5F96L 5GJSL 1HINH 4CGTA 4NZJA 5BV7B 2R23B 2RIKA 3VGBA 1I85C 2PTVA 4XB7A 4PJAA 1OPGH 4UB0L 1B6UA 4PV9B 5F7NC 3KGRA 3AREB 1E6OH 2OTWA 4Y2OA 4U49A 3H3PH 3QA3A 4X5XA 3U82B 4FA8A 5ANMB 1CGWA 3RWCB 2DQGH 4JFOA 1ERNA 4LAQH 3MUJA 1NCCL 2OXGA 2AK4D 2DBLH 1A4JA 2IAMA 2R0KL 3KYNB 5KSAC 1I8LA 3OL2A 1CXIA 4OZ4A 4JM2B 5IMMA 3EYSL 4H26A 2E9JA 4PJHF 1VGEH 4ZDHB 4IRJC 2DAVA 2FB4L 5D71H 3VFVB 3WDHA 5IHUL 4XCFH 4ONGH 1MHHB 5MI0C 2PF6A 3WFBH 5FKAB 5IV2B 5DVOA 4ODVL 5CD5C 4OQTH 4HIXH 4ZPVA 3D69B 1GC1H 2BNRA 3ARBC 1U8NA 5FYLE 4DUXA 5I74B 3TJHD 3D0LA 2FSEB 5CSZA 3LQAH 3SDXE 5J6GB 2J88H 2DWEB 1T83A 1EEUA 5GJTL 3QPQD 3SE8L 1MRDL 3VJ6B 4MJIE 1J86A 1DBKL 1DN2A 2J8UE 4LKXB 4P5KA 4LSRH 4WJ5B 4TVPL 1FO0H 3QUKA 4ZOAA 1QSFA 2HLAA 2X40A 2DLIA 4O51B 3N06B 5AWNL 5KS9E 3ESUF 5FDWA 4WW2B 5EU6D 3GO1H 3BRFA 3TT1L 1KB9K 3LN5B 4JY6A 1XT5A 4LCWE 3GJFK 1M7IB 1RZ8B 4APQD 4QNPE 2YRPA 4G3YH 3RZCD 3C5ZD 3WLBA 1CICC 1IGJA 4TNVF 2I5YL 3QO1A 1T1ZA 4HIIA 2BNQD 3LV3A 2VXVH 3R0MA 3IJYA 2VSCA 1IL1B 1FFRA 2A0LD 5IT2H 1X5IA 2N4IA 5CD3A 1JUFB 1ZA3B 1H15B 3S36L 5GS3A 3V4PL 2KUTA 2F5BH 4XBEH 4L4VD 3EDJA 2BC4B 3WEXA 1XGPB 3C09C 1YC8A 3TO4C 2V2TA 1I9JL 2QR0A 2IAND 3QDGE 5TE4H 5MEQB 3GMPB 4MAYD 4NRXA 2CMRL 1HSAB 2ICEB 2GCYA 4G9FD 3VRIA 2LQRA 2EIZB 4L9DA 3VFGH 2VQ1B 3BKJL 3DTXA 2X9YA 1A3QA 1KELL 4GAGL 3V52H 1CCZA 2VL5B 5CCKL 3EJYD 4NNPH 3VRJB 2DLFH 2B1AL 4HUKB 1HE7A 3GSRA 1G7PA 1T7VA 4MCYB 3SPVB 1UYWH 2WSKA 5FO9B 4CN6A 4FTVD 1NQBA 2XQBL 4AEEA 5IUSA 3EFDH 2O5YL 1AKJA 3QP3A 5D7JC 4TTDD 1DBBH 5C2BL 2OJZL 4OZFB 1DSFH 5I1CH 5GRZA 1FBIH 1KBGH 3H9SD 3OG6B 3RI5F 3VWJC 4RNRB 5D72H 4EI5C 1CFSB 5K9KA 3FOMB 1F4HA 4R4ND 1NKRA 5CJOL 3C6LB 1C08A 4FQ1L 4A2MA 3UO1L 3SDXB 1N64H 5EBWB 3ULSB 3LKRA 4RGND 2X1QA 4M7LT 3T2NL 4QGYA 1A7NH 4MJIB 5CKGA 2J8UB 4PGCB 5JOEA 1A6UL 4D3CL 5HGAB 5IOPA 2DDQL 3UBXG 1XZ0A 4MQSB 1T89A 4PYHA 5GS1A 5ADPL 4JO4H 4TSAL 2WMPA 5KS9B 4ZUSB 1RIUL 3IFLH 3LS5H 1NLDH 2GKIA 3LKOA 1EUUA 4UAOC 3ZL4L 4OM1L 1ZV5A 4LCWB 4IMKA 3QIBA 4Q9QL 4NP4H 5D9SB 1F58H 1S9VB 1HIMH 5C0JB 3BN9D 4PJGF 5A3IC 2A6DA 3OWEA 4PJXA 5JTWA 1UADC 4PRID 4IRSD 2H1PH 3MJ8B 4OZFH 4ZXBD 5CLTA 4S1RL 4MWFA 1J8HE 4XP1L 1D5MA 5C1MB 5F6IC 4JJHA 3DGGA 3ZZ1A 1U8MB 2G5BA 5FYLH 1N3NA 5DD3L 1R6VA 5ISZD 2NNAB 1ZMYA 5INCB 4NO5B 1YDPA 2F8VA 2WANA 3DX7B 5EPMB 4G6FD 3KPNB 4Y16B 2KQMA 3V5KA 3AUVA 4OLEA 3QZWG 3X13A 5E2TL 4RMWA 5D7LA 1A7QH 3HFMH 4LFHG 5EIIA 4R0LC 3B9DA 1MRFH 3U1SL 3BHBA 1JYWA 3VWKC 3C2AL 1A3RH 4P2OB 5TE7H 2BVPB 3GFUA 4O4YH 1QP1A 4KTDL 2Z31D 5FB8B 4LPYA 1Q94B 2WWKO 3CFJA 5DJ6A 3P30H 4KQ3L 1JHTB 3LRSB 3MRQA 3B43A 4OZIE 3QHZL 1F6AA 3VFRB 4HKZB 4WY7H 4HWEH 2HJFA 3BVNB 4XP5H 1QRKA 1LO4H 1BVKA 2AERT 4FZ8H 2NR6C 2FATH 3OGCB 4JAMB 5A16B 2VNCA 2IH1A 3ZE0E 2FX7L 2BSTA 4R97B 4XXDB 5JQHC 5L8LB 4S2SB 1XR8B 3TVMC 1N5YH 3SKOA 4LSSH 5JORA 1GHFL 2GJZA 4ZQKA 2DQEH 2PETA 1AXSA 4OJFL 1F13A 1K4CB 2MPAL 1BBDL 2DI9A 4GXUM 3NCYP 2NPLX 1AGEA 3C8KB 1WTLA 5D1ZA 3L3GB 3CUPB 1MIMH 5BZDA 3MLUL 1EBAA 3GIVA 4PBXA 5MEND 2B4CL 5JHLL 5DRXB 5FO8B 2VN7A 1Y6KR 1G9NC 3M17B 1F90L 3TYGL 3MC0A 5KOVC 2CGRH 2AP2A 4PYGA 5KG9B 3JTSA 3V4UH 4F15C 4HWUA 3GK8H 3CSBA 5IMOB 4DTGL 4W4NA 1YQVL 4LPUA 1IAIL 3MXVL 3HAEH 4LPTA 4S1DC 3MOBH 5EO9B 1J8HB 5LGHH 4PY8J 3D18B 2YKLL 4UT6H 3QWRD 4IRSB 3IETB 5F7KC 4MD4A 2FIKA 5ICZA 4ZXBB 1MF2H 4Q2ZB 4IDLA 4Z7QF 4M1GH 5BS0A 1NMCB 3PP3K 1FC1A 4YDIL 2AS5M 4LFHD 1CL7I 4L3EA 4YXHH 1RZKC 2C7UA 1K2DA 1EHLH 2AEQL 4MD5A 3RIFK 1T2QH 2EH8H 5HHOE 2F8XC 1FNGA 3CFDA 5H94B 5HYSG 3GHEH 4J1UB 4XBGA 4CMMA 3DETC 3R06B 3UYPA 1OQXA 2PCPA 1NJ9A 4RQQA 4OZIB 2BX5A 1NSNH 3Q5YA 3GUTB 4CNIB 4YFEA 4BH7B 4LCUB 5GS2D 3MRIB 5ILTH 5E94B 5C7XH 3DJ9A 3HPLB 4QHMB 4RSVA 4ZO8A 3QFDA 4PRAA 5IMKA 1Q9OA 1FYTD 1AGFB 1X5LA 3KJ4B 3OKDA 1S8DA 4H1LB 4XNMA 1F5WA 1T1WA 5D7SH 3NCFB 3ARGC 2HMID 2DMKA 1B4JH 4DEPB 1TXKA 5H37G 4XBPB 5HDBE 1SBSL 3DVFA 4M9OA 3ZT5A 3ET9F 3G5ZB 4MJ6A 1HOCB 3RDTD 1PG7L 1J5OL 5B3JE 5E2VL 4X8JA 5I1GH 2DQIH 3SDDA 1RJYB 3BDYH 2AJZA 1AFVL 1FORL 4QO1A 4QTHA 3ZTJH 3KJ6H 1S78C 2QQLH 3EJZC 1KFAH 1DQJA 2C1PA 4TVPE 2JLLA 1NFIA 3FB6A 5MHSD 5FUCE 5J13C 2AJVH 2VDQH 3ROOA 4KHTL 3MFFB 2LVCA 4R3SB 4OCMC 3GIZL 3DO7B 1JWMB 3WO4C 4Y7MA 2V7HA 1WEJL 4PP1D 1EH9A 3T3PE 3IKCB 3L3KB 3NFPA 2ITCB 3AMKA 4M5ZH 1P69B 4W68A 2EYSA 1H3PH 2JB5H 3MNWA 4EI6B 3PWVA 1RU9H 5ITFB 3VDCA 2WLYA 4H1LH 2FD6H 1DQQB 3CSYA 5C0DB 1S7RA 4R26H 1T0MB 1EJOL 3RTQB 4PJFA 3GEWB 5TH2B 4U1NB 1JTPA 3RUGE 3P4OA 1W0WA 3Q1SH 4N1CA 4BKLB 3MTRA 4Z7VA 4NRYB 3BGFC 5JPMB 3IDMB 2HT4D 3KWWA 2DYPB 4LOUC 1DR9A 4CVWA 4RGOL 1ZA6B 1JGUH 4JJ5B 1FGNH 4MNGA 1DCLA 5BMFL 3PABA 5LJYH 3KLDA 1QLFA 3V7MA 4QRTA 4LU5H 1XF5A 4NIKB 3ARQA 1UKTA 5TDOA 4KKCC 25C8L 4XNQA 5GS0L 1MIEH 4PLNC 5MP6H 4NOBA 1OAZH 5FHAH 2RCSL 4ODXB 4PJ7F 1XCQA 4XVUD 3VRLF 1HHGA 3EFFB 3O2WH 3WFHB 2F5AH 4NZTH 5KSBE 1NCTA 5C9KA 2FDBP 4KH2A 1VDGA 3OKYA 4I13B 1P4BL 4K8RL 3UJJH 3BWAB 1BX2B 4HUVB 2PXYB 4L4JA 1OSZA 3OHXA 5IQ9A 4PR5A 1C5DB 1OSPL 3BQUA 3FT4A 2Q6WB 4HXBL 2E9IA 3RPIA 4GSDH 4V2BA 4TUOA 4Y4HC 5F96H 5GJSH 4HUWA 4X6BA 1L9NA 3PE9A 3H42L 3UTQB 4RISL 4F80A 1Z9LA 1FG2B 1UZ8A 4UB0H 1KIQA 3V6OC 3EOBB 5JXAL 3RDTB 1RZJC 3IFOA 3P4MA 3ARDB 2EO1A 1F3DJ 1F8TH 5HGGS 1AGCA 1KCLA 5DJDA 1A6TA 1NCCH 4F7PA 5I8EA 2HAZA 5GRVK 2R0KH 4IS6A 3QCVL 2YA2A 3QULB 4FQHA 3EYSH 3CC5A 3L5XL 5C2UB 3PV7A 2AV7B 2Z8SA 3VXRE 5C09A 2EYRB 3CXDL 5IHUH 1EK3A 2GQHA 2QADC 4M5YL 5HDBF 3T4AA 3O6FA 1NCDL 3AROA 3CCHB 4LHUG 2GAZA 2ICES 4I77L 4PRPA 3RUGB 3K74B 5CZVH 5GSVA 5B3JF 1PLGL 5GRWA 3W81A 1V3KA 4UIKL 4OAWB 3O4OB 1NMAL 4Q0XL 3E2HB 4JKMA 3VXQA 3QEQE 5GJTH 3SE8H 3TN0C 1MRDH 1U3HD 2E7CA 5EH1A 1DBKH 1PQZB 1X5HA 4HBCH 4AEHL 5ESVA 3TZVD 1DQLL 4FXKB 5HJ3A 5AWNH 3JVGA 4DCQA 4D8PA 1A6PA 2XWBB 5ID1B 5KSBB 1HEZB 4B50A 2B7DT 4K55A 3MRCB 2I5YH 2EIDA 4DGVL 4HMCA 4Y4KD 1RK1A 1N2RA 1I1RA 1SYSB 5EU7E 2CIIA 1RZIA 3NCCB 1JN6A 4BQCA 4UILL 3V4PH 5E1HB 3T0EA 1RZFL 5EU4B 4DKDC 2GSIB 5TQ2H 1LE9B 2IFGA 4F7TB 1I9JH 2BZDA 2D7NA 3QBTB 2XN9A 2CMRH 2C4FU 5E8OB 2EC8A 1CD8A 4ZG1A 1KELH 4GAGH 4MA7L 3KYMB 3R0NA 5CCKH 4EIZC 2B1AH 5HHQA 4KRLB 4DZ8B 4P0DA 2MOVA 3OB8A 4NFCA 1WIUA 1HHKA 4NKOB 3UP1A 1NC4D 1NAKL 1EFXA 2E3VA 1FVCA 1KACB 2O5YH 1NGWA 3VXRB 1QSED 4LGSB 1IVLA 1B0GA 1E27B 1P9MC 2KZ1B 1VEMA 2J12B 3L6FB 5C2BH 2OJZH 4X7EC 2GYSA 5T1DL 1RJZB 3E6HB 7FABL 5INDA 3QJHB 3WE6A 5DSCA 4WV1C 5CJOH 2FBOJ 4FQ1H 4HS6A 2APTA 3UJTL 3U7YL 2BHUA 2HTLC 2E9BA 3QEQB 5T3ZL 3T2NH 3MXWL 3G08A 2ARJA 2Z0BA 3BW9B 4WU5B 1D9KC 3OJDA 3SJVE 2AQ2A 4D3CH 5FUZH 1CD1A 2DDQH 1G6VK 1B0RB 1FC2D 4NQEA 5B38A 3IDUA 3CFIC 4TSAH 1RIUH 4ZSOE 1A6AB 1CE6A 3A6CL 3I6GA 5HGHA 1IEAA 3IAPA 3ZL4H 2VLRD 4OM1H 4HLJA 4HWBA 4OLXL 5E8NA 2VDPL 1HH9B 4ISVA 2L7UA 4WHDA 4HEME 4RFOL 1TCMA 2V17L 1WICA 4X7SH 3IDJA 4MQTB 2JIXD 5E5MB 32C2A 3UZQA 1YEKH 2GIYA 3KPSA 4N68A 3NFNB 5EUOE 4LLQA 1A1OB 5DS8A 4PRHD 4XP1H 3D2UD 2G9HA 1T5XB 2Y07L 3BIBX 4G8IB 1D6EB 1JI1A 4M8VA 3RNQB 2C3GA 1MUJA 5DD3H 2IMMA 2D7PA 1YUHB 1MVFA 1C16B 2NY1C 4RAVA 1NLBH 1F4AA 1GGIL 1NFDA 2X7LA 4GKNB 4Z0XA 5GISL 3DARA 4Q6IC 5GSRB 4PJDA 4O2CA 5E2TH 1SEBB 3IFNH 1KB5A 5L2JA 4QRPE 1LD9A 5LAXA 1SBBA 1W0VA 2QSQA 2MFNA 3U1SH 1T0NA 5F88B 3C2AH 4PJIF 4QXUH 3JBG7 2DKMA 5BQ7A 5J1SC 2GSGA 1H5BB 5C08E 4JRXD 5HHXL 2F74A 4KTDH 3EYOA 3OG4B 3U4EB 3GBLA 2I9TB 4KQ3H 3CX5J 1BJMA 1XGQA 3QHZH 3U79A 3C08L 4X6CE 1GGCL 1CLCA 1ES0A 1ED3B 3TO2B 4U1SA 2ZSWB 4YHZH 5B4MC 3ARZA 2WBKA 4OSUH 1CD0A 2F54E 1HYSC 4JPIB 5C0BE 5D2NE 2FX7H 5KW9H 4OZHA 1RHHB 2EDKA 4G7VL 4ZOBA 1IAMA 5IVXE 4NN7C 1N59B 4GRMB 2IMNA 1GHFH 3K4DA 3QUYA 1M71A 1ORSB 3OR7B 4KROC 4MLIA 3V6ZA 3QXVA 4HH9A 2K7PA 2QTEA 4OV6F 4UNUA 4GRLC 2MPAH 1BBDH 4LEOB 4N9GA 5KZCB 1H3GA 2H32A 3SJVB 4JFQB 5GGSB 4Y5XA 5F9AC 1PY4A 3G5YA 3MLUH 1ZXQA 3FQRB 3QYCA 5JHLH 4ZSOB 5C0EA 2O26U 2KPNA 4YK4B 2IFFL 3H3BC 1F90H 3TYGH 3QHTC 1U8QB 4JGMA 4WWKA 4OTXH 3C2SA 1SJEB 1WCQA 2DM4A 2Q76B 5KSUB 4PJEE 4O5LH 5JIHA 4DTGH 1YQVH 3IB4A 1IAIH 3MXVH 3UTSD 4LMQE 5EUOB 1ZHBA 4XCYB 4YAQB 1D6VL 4MLSA 1R5IA 2YKLH 3QUXB 1BQSA 4KTEL 3DV6B 4U6HA 1KJMB 1IAOB 3OGOE 5AYUH 1TTUA 1BVLB 4PRHB 1CFQA 3D2UB 4YDIH 2EKSA 3BH9A 3JWDC 3RWHB 1J8KA 1WWWX 5C8JB 5CEZL 3BZFB 4C4KO 2F8OA 5EN2A 2AEQH 4QRPB 3DMMB 4MX7A 4ZUUA 3MRNB 3T0XA 2PW1A 3GMQB 3STZB 4M62L 4QKXB 3CSPA 5C08B 1G6RL 4GAJL 4LP4A 5D1XB 5T1KB 2J8HA 1BOYA 4LKCA 4UTAL 3MSPA 4NQSB 2AQ3A 4POYA 2LE9A 4X6CB 1DLHB 3VXUE 3MROB 5ALCH 5L2KA 5IM7A 3QNXA 4YHLL 2F54B 5C0BB 2GJ6A 5D2NB 1T22A 1OGAA 5IVXB 3AY4A 1GGYA 2E6PA 2HJLA 3QRGL 4JB9L 4QWWD 1VFBA 3FCTB 1W8OA 1KXQE 4G8GE 2Z91A 3SCMA 5B39B 1MRCL 2W0FB 3MV7D 3L5WA 1I1FB 5C0ND 1MCFA 3BSZH 2NW2A 3MLVL 4P23A 3WO3B 3THMH 4TNWK 1T3FB 2EDRA 4JREB 1J5OH 4JPVL 1KTLA 4F9PC 5E2VH 3EGSA 4HDIB 4KDWA 1AFVH 1FORH 2WUCH 3MV7E 4KVCH 1T7ZA 3LEVL 3H9HB 3HZVB 4JFPB 3MO1B 2HFTA 1T7XA 4PJEB 2P7TA 4TULL 3TBVA 5HYQB 3I6LD 1UQSA 3GIZH 3VFOB 3KNBA 4ZOCA 5DMGC 5C3TA 4FQXC 3IAQA 1PYWB 3ARFD 4PJBA 3GJEA 1WEJH 1XGTA 5IVXF 4G6KL 4QF1A 4GAFB 4X6DE 3CMGA 1BFTA 5GRJL 3UTSB 3DYMA 1GCFA 3WUZA 1KPRA 4KXZI 5CJBA 2J6EA 1NGYB 2VWEC 2Y5TA 2VQTA 5I2IB 4HFWB 1FZMA 3CX5K 3IRPX 4ZUTA 4Y2DC 4XVTL 1TQCC 3L5IA 1CGUA 5I1AA 1EJOH 3I50L 2P5WD 3NA4A 2ATPA 5JA8B 1HHJA 1FFPA 3DXAA 5HPMB 2VZOA 5BRZE 4S1QH 3KPRE 2VZSA 1FZOB 5ID0B 4LLUA 1ONQB 5C6TL 3OAYK 1EA9C 1I9RL 1J1OL 3LKQB 4RGOH 2XYCA 4ZFOB 4AIZA 2P5WE 5IROC 5J89A 4PJEF 3CZFA 5BMFH 3MV9E 1UJ3B 5DQJA 3VXUB 3FFDA 1JYVA 3QQ3B 4GBXD 3Q48A 4J6RL 3QG6A 1BF2A 3QSKB 4UOW1 2DRUA 25C8H 3IDIB 4WUUA 1TVHA 4K3HA 3DO3A 2RCSH 5I15H 5I6XC 3FQUA 4LRIC 3T08A 4JGJA 1OHQA 4QXTB 1XGUB 4LSDA 2BMKB 3REVB 4CBPA 1P4BH 2JCCF 1CFBA 4XH2A 4K8RH 4PLJD 5C0AA 3PP3H 2HJKB 4G8GB 3MV11 3RIFF 1TQBB 2VXTL 3K0WA 5T3ZD 4AENB 5D2LE 2NXZC 1MHEB 1OSPH 4LSQL 4MA3B 4LNRB 1C12A 3ORJA 4HXBH 1T5WA 2RBLA 3V5HA 3AFLA 3H0TA 4P2QE 4WO4D 3MV7B 2VLLA 5IB5A 4IMLA 2VMFA 4RISH 3SQBA 3FO9A 3KLHD 1G7MB 1L7IL 3GSWB 5JXAH 1JGLL 5CILL 1A7PH 3U4BL 1P7QA 4U1MB 2ILLA 3L7EB 4G9DB 5F9WC 1JNHB 3CAFA 2NZ9D 3MV8D 5B3NA 5EU3A 1E4XL 1VA9A 9CGTA 4Y8AA 1G9NL 3P4LA 4QRUA 3MRHB 4NN6B 4LCCC 3OSKA 3QCVH 4NYLB 4X6DB 1YMMA 5E2WH 5J11C 3L5XH 3EDDA 3RJDA 2XZCL 3I84A 4AZ8A 5KSVB 1PKQA 1MAKA 2BSRA 4KKBD 4YBLC 2HT2C 8FABB 2HFFA 4M5YH 1MCWW 1N8ZA 1QBBA 1BLNA 3RWFB 3S5LB 3LHPL 2EDWA 2ZG1A 4NKDB 1J0JA 4I77H 4KI5E 1BMGA 2PUQT 1ZLUK 1PD6A 4FNLL 5BRZB 3S37L 3ZKNC 2EDDA 1NMAH 3KPRB 1FAKT 3U2SA 2ARWA 5D5ME 3KHOA 2P5WB 3F7VA 3CFEB 1M05A 3PQYA 1BBJA 1P5UA 7CGTA 3O6KL 3CVIL 1RZKL 1DQLH 1FNSL 4QOKE 3QI9A 4K7PH 2PTTB 4L4TD 1JRHL 2JF1A 3WJJC 5IB2B 3EYUL 1BJ1J 2ZSVA 1KPVB 2O5ZL 1KJ3L 5J4MA 2VLJD 2ICWJ 4ZO6A 2OZ4H 5KSAD 1OF2B 4FXLA 1S7TA 3QUZA 5IIEB 3I75A 5EDXA 4IRJD 5D2LB 1W72B 5JXEA 1X7QA 2IGFL 3VXSD 3HZKB 3MJ7B 2H26A 2X4SA 4GXUN 4X0KA 4UILH 5IEHB 5CD5D 3SGEH 3O6LL 4CADA 1XF1A 4XVSL 5HYFA 2BJML 4P2QB 1OQOA 4X5LA 4YLQT 1XIWB 3ARBD 1KENL 4QEGA 1FAIH 1DJSA 1DL7L 4KJWC 5JHDE 5F3BB 5LWYL 2OTUA 2ZOKB 1YECH 1YYML 5FYJD 1CLOH 3IJHB 1T7YA 4IOIB 4EKXA 5HVHC 4RA0C 4MA7H 4MXVF 2YUWA 5D1QB 3VDBA 3CIQA 4PJ5D 3NBNA 3Q6GL 5ELIA 3EDFA 4NQCD 2JJUA 3CVHB 4EDWL 5IQ7L 1NAKH 3LD8C 4YO0B 2X44D 4QY8B 5LVEA 1ZWIA 4PJ5E 3PP4L 3EYFA 1H3UA 5D2LF 2ENSA 1N6UA 1F3RB 2I07A 1CICD 1S7WB 3VW3L 5T1DH 1U8PA 7FABH 4I18A 5CEZD 5MERA 1BAFL 1R3IL 1CTOA 1VGKA 5IKCB 1FNLA 2H3NB 3UJTH 3U7YH 3BIKA 5JNYB 5D5MB 5T3ZH 3MXWH 3BPLB 2FHBA 4Y1AA 4UIMB 1AJ7L 1LEGA 3TO4D 4QOKB 3MZGB 2QLVB 5T1LD 3QWQB 3LH2L 3STLA 2X89A 1QPXA 2VXSL 3A6CH 1F4XL 2OL3A 2ITDB 2P8PA 1A1NB 3VFTA 4OLXH 2H9GB 2VDPH 4JVWA 1HN1A 3MCKB 4N5EC 5EC2A 3MMEA 3DUUB 4PREA 4RFOH 2V17H 1FNEA 4WDIA 4AT6B 1I3RA 4N5UA 3TPUB 4M1DL 1IEHA 4LLDA 4ZS6C 3RVXC 4K9EC 2P5ED 4XAKD 5J7CC 5HYJA 3TESA 2DF3A 4LSTH 3P3YA 5C07E 1BFOA 1QEWB 2P1YA 4P2RA 5KSAB 1FH5L 2X4RA 3DVGB 1DQML 2Y07H 3IU4L 3FO1A 2E5EA 1QA9A 4NGHL 3VWJD 3BZ4B 5L9DL 1K8DB 4HKXA 4LLYA 4P5TB 3WS3B 1GGIH 5IVZA 5JHDB 1RQ5A 1UB6A 2EDJA 5TE6L 2UY6A 1VACB 3HE7A 2VLKA 4RIRB 4JANA 4K7FB 5JPNB 4OQTA 2C4XA 1BVZA 1FL6B 3ARBB 3HS0B 2FECI 4ZFFB 1U95B 3HE6A 4PG9B 1OW0A 4OFVA 1J0IA 1Q72L 3DUHA 4JN1L 1KTKE 4NQXB 3HI6L 2IBZY 1Q0XL 3ROLB 3O45A 5HHXH 1LO5A 5TQ0L 1ITCA 2DMBA 5ACZB 1ZHNA 2WQ8A 4PJ5B 1G0YR 4HWNA 2YZ1A 1RZJL 1GGCH 4EN3B 5TPWL 1FO0A 3X12A 5A3ID 4M48H 3NABL 4N90D 5K9QG 1P5VA 1A4KB 5ANMA 5DT1L 2NXYB 1SYVB 4OGAC 2CK0L 4G7VH 5I19L 2B0SL 1BZQK 5I75B 5E6IC 3O9WA 4ZDHA 2PO6B 1RSFA 4PP2B 4D0DA 3O41A 2IADB 3C5JA 3OX8B 4GLRH 4M8QB 1INEL 1CLZL 5DK0B 3LKSA 3VFNB 5IV2A 4PJ8C 3GMMA 4RGMB 4TPRL 2D0FA 4KUCD 3PGFL 5IHZA 5DVKA 2IFFH 5JZ7D 5IBLD 3BZEB 3TA3C 2BSED 4OZGE 5TDNB 1G6RB 2YD3A 5FCUH 2ATKB 4LHQB 5FM5M 2JJSC 4BELD 3I85A 3ULVD 4ZAKC 4Z76B 4Z5RA 3ES6A 2ORBL 5DGRA 1RUML 2LU4A 5I76B 3U0TB 5C07B 1FDLL 2IAMC 3KXFE 4RBPK 4WRLA 4MJ4A 3WKML 1WT5A 1D6VH 3BT2H 1R3HA 2DI8A 2LTQC 4O51A 1UH3A 2P44B 4I0CC 1VFAA 4KTEH 1IEBB 2YC1A 3F6LA 2NR6D 1TLKA 3O4LE 3CH1A 5DHVA 5HI4D 1JZ3A 5IB1A 2P42B 5D7JB 3CSGA 3D25A 5GGTL 3FZUD 1NAMH 3TVMD 4UTBH 5CEZH 4U6XB 3LQMA 3WKNA 1JV5B 4RWHA 4EI5B 5HHPB 1YMHB 3NTCL 3F7YA 2YSSB 2XXMB 1JUFA 1ZA3A 5KANG 3LN9A 2EE6A 2BC4A 3WJLA 3N9GL 4UTAH 4IIQA 1MCPL 2IPKB 5MEQA 3GMPA 4NWUL 1TTFA 4NNXB 4CKVX 4HZAA 1XH3A 3HG1E 3PGDB 4J7RA 5E4IA 1PSKL 1F4YL 4YHLH 5I17B 4JO3L 1F3DH 1DUZA 3MLTB 5BXFA 1CQYA 1HHHB 5H2BB 1AR1D 4QHKJ 3BE1L 2Y06L 1JPTL 3L9RB 4MCYA 1G7JA 3QRGH 4JB9H 4WTZA 1K4DB 4ZNEA 5F89A 2FYYA 4OUOA 4OUUA 4UQ2B 3C60C 2W0LA 1MCQA 3W0WD 4WCYL 1ORQA 4PJGA 4DGIL 2AK4A 1IGCL 2VAAA 4KV5E 4ONHB 1MRCH 3MLWL 2VABA 5A1AA 4ELMA 1QQDA 3JWOC 2VTFA 1ETZA 3MLVH 4DZBB 2UUDK 2VL4A 4O9HH 4OF3A 4BQBA 4RNRA 1I4FB 2EO9A 5FOBB 5C0FB 3BP6B 4JPVH 4OZGB 4XPAL 2AJXL 4HQQL 2ZUUA 2EDOA 2F19L 3TCXA 4HFUL 2VH5H 5AZ2L 5DTFA 4G8EA 3LEVH 5I9QB 4NO0B 1QBAA 3HI1B 4KAQH 5I0DA 3DETD 4GXVL 1U2CA 4ZUVA 2NY3C 4I2XA 4TULH 5D93C 2QQKH 1Y18B 3FQXA 4R0LB 3X14B 1TNNA 1WCBA 3KXFB 1AD0A 1D5IL 3VWKB 4W70A 1EBPA 1ND0A 3KPLB 4G6KH 4AMKL 5CIPH 1BIHA 2X1WL 3O4LB 3V5DB 1T6WA 2VAJA 4OB5L 5GRJH 2FX8L 2MQ3A 2IBZX 4MDIB 2QHRL 1NC2D 5EBLA 2EYTB 5CBAB 3VXPB 2W65A 4OF0A 4PJCE 2C3XA 5EU6A 3KS0J 4XVTH 3UBXB 1QSVA 5BVJB 4NQVB 5FCSH 3MJ8A 3I50H 3ARGD 4X83A 1QYGL 4APQA 4MQXC 3RZCA 3U9PH 3C5ZA 4OZGF 3RWEA 3MBEC 3RX5A 5SWSE 2BNQA 5C6TH 3U0PB 1I9RH 1J1OH 4KUCF 4PJ9C 4BSWB 5T5NF 1OAQL 1R24A 3QQNA 2ADIB 3MYJA 4OLWL 2ZJSL 3BPCB 3DX7A 4S10A 1S78D 2EZ0C 3KPNA 4J6RH 4Y16A 4Y8DC 5GS1C 1IQDB 3BOVA 3E8UH 3HG1B 4KRNA 2DTSA 4L4VA 4WHYG 4WFGD 1TFHA 5I1DB 4WFEE 4IMKC 3GGWB 3NZHL 5C71A 1YN6A 4NKMA 1XCTA 4G9FA 1OB1B 3HKFA 2CLZA 4UNVA 2BVPA 1UVQA 3WL9B 43CAA 1H8OA 1C8PA 4L8CB 5BV7C 2DMCA 1Q0YL 2I9LB 2BVOB 1HXMB 3SDAD 1TITA 3QAZC 4JN2A 5F3HA 2VXTH 4XCNB 3G6JE 3LKPA 3QZWB 3HAEA 3AREC 4FTVA 4LSQH 1JHKL 3OGCA 4MB4A 4JAMA 2F53E 4XXDA 5IR1A 3FB8A 1BREA 1UA6L 4X6EA 4XPGL 3C6SB 4JM2C 2DICA 1AD9B 3H9SA 1L7IH 2EDEA 1X5JA 1JGLH 4W4OC 5CILH 4P4RB 3T8XB 5IB3A 3C8KA 1EEZB 5DK2A 4ZODA 3L3GA 3CUPA 5ADOL 3CDGA 4GG6E 4B41A 1E4XH 3GM8A 1G9NH 3BYTA 2Y72A 5JLZB 2GUOA 2AXJA 1FL5B 5DEFB 4KKCD 5I74C 3AB0B 1WZLA 5HYIA 4J3OC 2R0WL 3UAJD 2XZCH 4PD4K 4L3CB 4OFDA 1FGVH 5DMKB 1KTRL 1EVTC 4PJCB 2APXA 4JFXB 1A9EA 1WBYB 1OLZA 1IGTB 5D7IA 2O5XL 3ZDZE 4FNLH 3S37H 3D18A 3GMRB 1D3CA 5SWSB 4WW2C 4PRIA 1WFNA 4M61B 5FGRA 4YHYC 4WI8A 4IRSA 3NAAH 4M4RA 5EULV 5EWIL 3ZHDA 3IETA 3O3AB 1BECA 3QCTL 4ZXBA 5D1ZC 4NN5B 4Q2ZA 4Y4HD 3O6KH 1CGTA 3CVIH 3JWDL 4P48A 1NGZA 1RZKH 1W0YT 2YWZA 3DX9B 1CT8A 1GJIA 2APFA 1JMZA 5ISZA 4BYHA 1JRHH 2JJWA 1KN4L 2FR4A 3DVIA 3QFJE 3EYUH 3QPXL 5DQDL 3MOQA 2O5ZH 3QXUA 2HG5B 4J1UA 3MRKB 5D6CA 4R4BA 1YEDA 4YUEL 5IG7B 3LDBC 4PJCF 5J13B 3AS1A 3E0GA 5I1JL 4CW1B 5EZJA 3G6JB 2QL1A 2Z93B 4XNZB 2A74B 2YEZB 3F12B 2IGFH 3MRIA 2YRLA 5E94A 1O7VA 2Z31A 4K94C 2OYPA 4QHMA 5C0RL 2F53B 1A9BB 3KPMB 3O6LH 4QLRA 1RHFA 3SDCB 5HYSB 1T1XA 4XVSH 2BJMH 5B8CB 4KJYA 4MSWA 3OAYH 4G8FA 1KENH 4YH6A 1YEGL 3N0PB 3MCLL 1RIVL 4H1LA 5LWYH 2P48B 2VXQH 5DRNA 1YYMH 2C3HA 1MSPA 2B8OT 3PHOB 4GG6B 2ESVD 3AAZB 1T20A 3BGFB 3W9DB 2Z35A 5E95B 5FV1L 3G5ZA 1HOCA 3Q6GH 1LE5B 2D9QB 3C6LC 1IAKB 3OZ9L 4MGXA 1N4XL 4J3XA 5GGVL 4EDWH 3ILPA 1MFNA 2BNUA 1J11A 3MLRL 3PP4H 5JO5B 1M6OB 1AH1A 3VW3H 5L8KB 5EIVA 2O93L 1IT9L 4YXLL 1XF2A 3MFFA 2MTPA 3B2UC 1BAFH 4X4ME 4X98B 1R3IH 1ZLWH 4JQXA 5ICYA 4PJ7A 1GPOL 1Q1JL 4U1HB 3IKCA 1Q9WB 2ZG3A 4YR6A 1S5IH 4DAGH 4NO3B 2CLVB 1AJ7H 2YPKB 5ITFA 3DROB 4MJ5B 2OSLA 1DQQA 2OP4L 4NO2B 2FJHB 5E8DL 5C0DA 3K80A 2WQRA 2ZCLL 3QWRA 3LH2H 4ZUWB 1JPFB 4KDTA 3RTQA 2Q1EA 1U92A 2VXSH 1F4XH 3VFSB 3QFJB 3WNOA 1KEGL 3GSNB 5JPMA 3IDMA 3GBNL 1SVCP 4DKEL 4M1DH 4MNQD 4DUVA 5ECJE 3Q5TA 3QWOA 3D6GA 2NYYC 4NOFA 1AGDB 4XRCB 4ZS7H 3C9NA 2M26A 4ONOA 4YNYB 5H8DA 1T04A 4HGMA 1ADQL 3L95A 2UZYB 1TJGL 4ZFZA 3TBYB 1DQMH 4NPYA 1I7ZA 3IU4H 2YPLE 3KLAB 4WU7B 1MAML 4NGHH 1CGSH 4NRZB 5C0CD 2NCMA 4P2OC 3RGVB 2QADB 3F58L 5IHBA 2FO4B 5TE6H 4DOHE 4EDXB 1LQSR 2DB8A 4I0PC 2EDNA 4HUVA 2PXYA 4Q9CA 5C0CE 1OCWH 3K3QA 1FYTA 1D9KD 3GJFB 4KKLD 3DI3B 4BSVB 1U8OB 4LCIL 1SJVA 1IGMH 2HVJA 3CU1A 4KUZL 1Q72H 4JN1H 1H0DA 5HGBB 3HI6H 1I7UB 1Q0XH 1U8LA 5DUBB 4TRPH 5TQ0H 3TN0B 2Z4QB 1RY7B 3DWTA 1NGQL 2R2EA 3O8XB 4E41E 2YRZA 3GRWL 2FWOA 1RZJH 3G5VB 5J06A 4LARL 4XCCL 4F33B 3ALPA 5TPWH 3RDTA 4P9ML 3NABH 1JPST 4BZ2L 4YDLC 5DD1H 5EUKB 5DT1H 5BO1L 3TV3H 5TFSL 1RURL 1VKXA 4NT6B 4KZDL 2B0SH 2X6MA 4OLZL 1H3VA 4Z78B 4OIBA 1SM3L 3UYRL 5K59E 3PL6B 4ZO9A 1A6ZB 4KU1A 4OV5B 5C86A 5EFIB 1YNKL 5E8PA 1INEH 2NY1D 1R5VB 3QJFB 1II4E 4GKOA 2P8MA 4TPRH 4KZEH 3DVNB 2JB6B 2JK5B 4Y19E 5FM5O 3BZDA 2GITB 3GB7A 5CJ8A 5HXMA 2BXYA 1QO3B 3MLSL 3ZO0A 2L0DA 5GPRA 3NMEA 4A6YB 4LVOB 3V2AR 3FT2B 3SE4A 1A1MB 1KJ2L 4YPGB 1ZT7B 2ORBH 4HIEB 1RUMH 3FO2A 3VMPA 4R7NA 4CVZB 1R5WB 4LHUB 2NLJB 2JJVA 1ZANH 1NDMA 1FDLH 1CK0L 3L3JA 4HIHB 2R69L 3WKMH 4OKVB 2RGSA 2IBGA 2YPLB 1U8KB 2YD1A 5IEKA 5CGYC 4UUJB 4H20L 1HYSD 1HEZA 1CFVL 1OT2A 3MREB 4M9PA 4KVNL 4M1CC 2ERJB 4DOHB 3MRFB 3VD7A 4X8XA 2V9TA 1KEML 2OTPA 3QO0B 2CDFA 1IAII 4KROD 5DQ9B 4XPBH 3W5MA 3F65A 5C0CB 3QEUB 3RNKA 3NTCH 1Q9LA 1VHPA 4H25A 4XMKL 3DPBA 3HZMB 3X3FL 3FB7A 2OJEB 2X4UA 3GSXB 1B6DA 4V1DE 3JSSA 5FF6B 3E3QE 2EEDA 3N9GH 2GFBA 4B7LA 3HPJB 4E41B 1MCPH 1LE9A 3NZ8A 3AS0A 4JFFD 4NWUH 4PGEB 5KVFL 3C5SA 3R8BB 4DEPC 3JVGC 1PSKH 1BWWA 1XF4B 1F4YH 1HZHL 2FL5A 3UMTA 1PX4A 4QCIB 4RAUB 4JO3H 3OXRA 3MGOA 3BE1H 2Y06H 1JPTH 3LEYL 4JQVC 5EO0A 3MA7B 5DZNA 3T09A 3PWJB 5CGTA 2VDLL 4WHTB 3DV4B 4BK4A 5B38G 4WCYH 3VXRA 2QKIA 4ZO7A 2CKNA 3QDJD 4FFVC 4DGIH 1S7UB 1IGCH 3MLWH 1XF3B 3SBWA 5CZXD 1RJZA 3E6HA 4Y19B 3QJHA 3MRPA 1Q9KA 2FZ3B 5ENWB 1IGFL 1INQB 2AJXH 4HQQH 5DURB 3MOAL 2NY1B 2E27H 4KMTL 3ZTNL 4HFUH 2DLEA 5AZ2H 4RWYL 2AXGB 3H3KA 4QXGL 4Q6IB 1GZPB 4WVRA 4HK0A 4GXVH 3KPQB 4WU5A 1K5NA 1A2YA 1WFTA 4LDEB 1L9MA 5F1IA 1D5IH 4F2MA 1VPOH 4M7LL 3O2VL 1U3HA 1JI2A 3R4DA 2DIJA 3GSVA 1S9YA 2Q87A 2NZIA 1KG0B 1TTGA 3BESR 3MODH 4M6NL 3VXOA 4CN1A 4OB5H 3GKZA 5K59F 4PJIA 3TZVA 1BJ1H 2FX8H 3OBAA 4OCSL 3U46A 2QHRH 4YBQD 2YWYA 4HHAA 1UEYA 3S36X 1GZQA 3WSQL 3ZYIA 4K9EL 4P4KB 3IAGC 5E5MA 4G80B 5DVLA 1QYGH 3DX6A 3WHE1 3QNYA 3HR6A 2A77L 2H8PB 3PUCA 1T5XA 1F3JA 5T33H 5AD0B 3IJSA 3RNQA 1S7SA 3LY6A 4V1DB 1FL3A 2NY0C 3PDDA 4D9QD 4GRLB 1OAQH 4U2YA 2UZXB 1RUPL 4KKAC 4HH8A 4YHOL 4OLWH 2ZJSH 4FMKA 1X6LA 3MRGA 1UACL 2IPTH 2R1YA 1JYXA 4F8QA 1T4KB 2VSDA 4JR9L 5E08L 1SEBA 3D39E 1CWVA 4N0FB 3KPPB 5DO2D 4R2GC 5GGSY 3ARWA 3NZHH 5F88A 2A6KA 5CUSL 1LMKA 3EIFA 4NQDE 5DMGD 4FQXD 4HJGB 1RUQL 3QIWC 4QT5B 1Q0YH 1H3XA 2X4NB 3MGTA 1VADA 2M1KA 3EYQC 4ERSL 3D3VD 1YJDL 4LMQI 1ZGLA 2Z8WC 5LXGL 5FUCC 3CFCL 3GMOB 4JDTL 1JHKH 1OP9A 1KLGB 3T1WA 2EKJA 4Y2DD 5DUPL 2B39A 2NY2C 1UA6H 3MUY1 4MZ3A 4GRMA 4GW4B 4UBDC 1ZTXL 1HNGA 2VWEE 4KJPC 1UXSA 5DD6B 4JZJA 2PYFB 2ZUVA 3PXJA 4GH7B 1F4WL 5DJ8B 3WNKA 1B88A 2NTFB 2H2PC 3SJVA 4JKKA 5F1NB 2BVQB 4JFQA 5GGSA 2BVTA 1SJXA 3HLAA 3PIQB 5E00B 1Z3GL 3W9EB 5ADOH 4XXCA 5J3HC 2LU3A 4JZNB 1R0AL 1LHZA 4LVNB 2ZUSA 2A83A 5KVGH 2R0WH 3UX9B 1YYLL 2LV4A 2O61B 2WP3T 5IB4B 3NN8B 1E28A 3U7AA 5DJZB 2VLRA 4UDUA 1A3LL 4LF3A 2UUDH 3OKNB 4YE4L 4LBEB 1RUKL 2O5XH 4XCYA 1RIHH 2ADGB 1MY7A 2IBBA 4B0MM 1JF1A 3IU3B 1JMXA 4HZLA 2JIXA 5DJYA 3WFEH 2NXZD 2YPVL 2PYEE 1D7FA 4O2EA 4HXAL 1YNLL 3SQOL 5I8CA 4K3GA 1K85A 5EWIH 5EZOL 1ZEAL 1KJMA 3FQTB 5FGBC 1IAOA 3VG9B 3QCTH 4X99B 4X4XB 3P77B 3JWDH 4PRHA 4Y5VA 4XAWL 4BM7A 3D2UA 4PBVC 2VDKL 3QUYD 2YHGA 3BZFA 3KLSA 3UTZA 2VISB 1B9ZA 3D39B 3ZYJA 4YDJA 1CYGA 1KN4H 4FFWD 3QPXH 5DQDH 5HGDB 5TJWK 3GMQA 4NQDB 3JV0A 4YUEH 2K9UA 5T1KA 4C56D 1ZK9A 4NDMB 1EEYB 1RD6A 1RULL 4PV8A 2W91A 5I1JH 4LLVB 4R96B 4FQXB 3P9LB 5F72S 1HILA 2HT2D 1JZ7A 1FNFA 4JRXA 3MUHL 3DUSA 2F54A 5LKNA 5C0RH 1P6AB 4GQ9L 1U91B 1J18A 2QHLA 4YHIB 3H8NA 5IVXA 3FHAA 4KQ4H 3QIUD 1AP2B 4ZNCD 1QKZL 3VXTB 4WEMB 1KXTB 1YEGH 4P46B 3ZKND 3MCLH 1RIVH 5IWLC 1I8IB 2AK1L 1TQCB 4MDJB 3SDYL 5MEOB 5B39A 4HWZB 2W0FA 5HHNA 3JWOL 4GG8A 5E5RB 3HRZB 1MCWM 2KBGA 4JFDE 3I02B 2ZOLB 3SGEI 3SKUD 3T77B 3RWIA 3OZ9H 1VERA 4HDIA 5GGVH 3WIHA 4ODUB 1NEUA 4BUHA 2DQCL 3MLRH 4F9LA 3REWA 3H9HA 3IDYC 3IS0X 4JFPA 4P99A 1CVSC 3BEVB 3MO1A 2HFGL 3P9MB 5EBMB 3BP4B 3U0WL 3KG5A 5EOTB 3MJGX 3O3EA 3QDMD 5HYQA 1IT9H 4YXLH 1G7QA 4U6YA 5I6XB 4R6UA 4NM8L 1AQDA 3WFZA 1PYWA 3RI5K 2PYEB 4RFEA 1GPOH 1Q1JH 3M45A 5E1AA 1WC7B 3UTSA 5C0GA 1OGAD 1HXYB 1NGYA 2JCCA 1ZLVK 4HFWA 2OP4H 1J0HA 4P23C 5E8DH 1EV2E 2ZCLH 4Y5YA 1PFCA 4KJWD 2YR3A 1YY8A 4H88L 3F5WB 1ZVYA 3DURA 5IJVA 1KEGH 3FOLB 1FV1A 3RP1A 1MWAL 1Y6NR 4RDQG 4PS4L 1CZ8L 5ID0A 4YQXH 2YBRA 3PWUB 1P4IL 3QDAA 1ONQA 4U7MA 1ZHKB 3T3ME 3U9UA 5E8EA 4Z77B 3HC4L 1UJ3A 1SJHB 3QQ3A 3WLWD 1LGVA 3G6DL 2X4PA 2A6IA 2B4CC 4R9HA 1ADQH 3IDIA 3PGCB 1TJGH 1M7DA 1ITBB 1MAMH 4NNYA 4YBLB 4QXTA 1KTDB 2W0KA 1H5BC 2F15A 5BV7L 1S7QB 3O3BA 3O3UN 1PG7X 1MQ8A 4GKZB 1G7IB 5ETUB 5B22A 2HKHL 3ECBB 1CDUA 2CO6B 4XCEA 4MD0B 5DEZA 4JFDB 1H8NA 1MHEA 3BJLA 4LCIH 5E7FA 3HMWL 4KUZH 3MNZB 1HKLL 1KGCE 1L4IA 1UH2A 2R1WA 4NC0B 4BK5A 4PG2C 5TF0A 1T03L 3MV7A 3S9DB 1VESA 1NGQH 2IPUK 3UROR 3GRWH 4OCNC 3MRLB 4LARH 4XCCH 4QXWA 4ODTH 1OTUC 4UT9L 4P9MH 3EO9L 3ARTA 5ERWB 4BZ2H 4U1MA 2AABH 3QUML 4ZS6D 5CFHA 2UWEA 5BO1H 5TFSH 2AJSL 3ARSA 1CDJA 5ICXA 4U1JB 4WUUD 4KY1H 1DBAL 5EO1B 1DDHB 2OZ4A 1SM3H 3UYRH 3QDMB 1KLUB 1K6QL 5GGUB 4DFIA 4GJTB 2NW3B 2P49B 4F7MB 4NKIL 3ARFA 1YNKH 2PKDA 4MA8L 3LQZB 3PWPE 1DLFL 4NKDA 3KS0H 4S1SL 2Q86A 3UDWC 2B2XH 2GEEA 3VXNB 1I1YB 3M1BB 4AM0A 1FP5A 1PGRB 3EOAB 1Q8MA 5F9OL 3MLSH 4RMUA 1JGEB 3QUXC 3KPRA 3KYOB 4JY4A 1DVFC 4N8PA 4P2CG 1KJ2H 2P5WA 3GSUA 2OLDA 4P5MB 1NH6A 3VA2C 4GLRI 4WI6A 2R2HA 1Z5LA 5CEXA 2BOBB 4NHCL 1D5ZB 5F7DA 3H2WA 5T3XD 3MRBB 1MY5A 2ZCKL 2R69H 4K3JL 1BOGB 5IFHH 3FQNB 3ZDYF 1YY9C 5JW5B 3DMMC 1MI5E 2PTTA 3ZE1F 1WZKA 1ZHLA 3FFCE 4OCWL 2B5IC 4NHUB 4GBXA 4H20H 5IW3A 2BFVL 1CFVH 4OGAD 1UXWB 5F8QC 5D1XC 3BD5A 1N0LA 2WINB 4KVNH 3DX8B 4NUGL 1U93B 4WI4A 3GI9H 2FX9L 3GSOA 1KEMH 4OGXL 2X4OB 5I1LB 5E6ID 3OKOB 4X7TB 5T1MB 1AGBA 3IXTA 2YD9A 3OKEB 4K94L 3MJ7A 3PJSA 4UDTB 4XMKH 4TN9A 5D2NC 3X3FH 5TDPA 5M7QA 4TUKL 1K3IA 3W39B 2Z92B 4JLRA 5GIRB 3T3MF 3SGKA 3TA3D 4DVRH 5EZLA 1LEIB 3V4VL 2KQNA 4Y4FB 2OBGA 5KVFH 4QRRE 5GGRB 3QCUL 4ORGB 4ZAKD 5TGBA 3HHRB 5IW6A 3OKKB 4QRSB 5D1QA 1FFNA 5KVEL 2XZQL 1U3ZA 3LEYH 5KAQG 3IF1A 2JKXA 4JREC 4PJAE 4DKFL 1WFUA 1I9IL 4QHLA 2VDLH 5HHVL 3TWCL 5JOPE 1V3JA 5CBEA 2FJFA 3VI4E 2ZKHL 4YHNB 5MEPA 1FVDB 4Z7OF 4I4WA 2IF7A 3D85B 3PWPB 1S7WA 2JE8A 2XV6B 2XXCB 5GS0C 1V7ML 1P7KB 3QUZD 3VI3F 2DQUL 3O3DB 3VXME 1IGFH 3MOAH 3ZTNH 4KMTH 2I24N 4RWYH 5E9DD 4QXGH 5GGQL 4F7EA 2CXKA 4I3RL 4JDZB 2WUBL 1NFKA 4UIMA 2V2XB 2VDMH 4XTRD 5FA3B 2VC2H 5IF0A 3LKNA 4N8VB 4X7DC 5I8OL 2BNRE 3TYFB 4QOKA 5L8JB 4ACPA 1HCVA 2AKRB 5A2LH 3SE3A 5GZNC 1MI5B 3T0BA 4M7LH 3O2VH 3FFCB 4M6NH 3PWNB 1CDCA 4LQ1A 1MLBB 2KKQA 4OCSH 1I85A 3DUUA 4AT6A 3WSQH 1QSFE 4K9EH 5DZOA 4L4TA 1EHNA 3C87A 3IXAA 3RWDA 1C5CL 2BSSB 2ZUTA 3C60D 2VLJA 3Q6FB 5I71B 4QRQB 1IM9D 5KSAA 2NTSP 1JPGA 4J8RB 3MV01 2YUXA 5DJXB 1GXEA 4MMZC 3BZ4A 4F57L 1IARB 2R15A 4IRJA 5BJTA 5L6YL 3MR9B 3VXSA 1RUPH 4C59B 1J05B 1RZGA 4NZRL 1OAUL 1YPZF 3DRQA 3TPKA 3BWUC 3BGMB 4QRRB 2Y23A 4PJ8B 1UACH 3P0VL 2AXFA 2DQJH 1TQBC 2IALB 4JR9H 4K7FA 4P9HC 1HSBB 1X5AA 2H45A 5SWZD 3ARBA 2NY3D 3HS0A 4O02L 5CUSH 3MRRB 4PJAB 4Y0GA 4NQXA 1TZGH 1BFSA 1R3LA 1EXUA 4DVBA 1RUQH 1BHGA 3QA3B 4X5XB 1URLA 4OF6A 3TIEA 3T2PA 1JYNA 4PJ5A 4L1DA 1A4JB 2IAMB 4NC2B 5LXGH 4NQCA 3CFCH 4OZ4B 3BP7A 4JDTH 4WIQA 5IMMB 4EOWL 1BZ7B 4H26B 3BX7C 2BERA 2UVEA 5DUPH 3VXMB 5A2KH 3FAWA 2D4FA 4XC1H 4KDVA 4MQXD 4C83A 1VFMA 1CICA 1ZTXH 3HE7C 1FSKC 3MBED 5HI5C 1NAMA 3B5HA 1NEZB 3IDNA 2BNRB 4PJ9D 6CGTA 3K8LA 2RR3A 1U8NB 4GKSB 5DK0A 3O11A 1Z3GH 5DGQA 3VFNA 1NBYB 5CSZB 4U1GB 1HI6A 4JO2L 2EZ0D 4M6OL 1R0AH 4JRYD 3H7LA 2YN5A 1WSST 2HKFL 3TO4A 4P5KB 2ATKA 4MXWL 5T1LA 4FRWA 1YYLH 3EUUA 3RKPA 1N6QH 5AZEL 1QSFB 4JQIH 5DC4B 3NIFF 2R1XA 4X5WA 5FDWB 3P40A 2V5MA 4EXPX 1EHXA 3MGAA 1A3LH 2R9HC 4JY6B 4YE4H 1RUKH 1E4XI 4M6AA 5C70A 2DOCA 4JFYA 5DJAA 1H3TA 3WLBB 1DUYA 3QO1B 2YPVH 3ARED 1T1ZB 4HXAH 4PJXE 3QHFL 1YNLH 2P5EA 1IEBA 3C60B 3LV3B 5EZOH 1ZEAH 5M95B 4W6YB 4JVUA 1AY1L 4Y88A 5F93C 4TUJA 3IJYB 4ZFGL 5T5FL 5D7JA 1SQ2N 5FM4A 4CU8A 4XAWH 2VDOL 5J8OA 5CD3B 3K2UH 2VDKH 3NACL 4JM2D 4QHNA 5FDYA 3W2DL 3VWJA 4LVHB 4WTWA 3WEXB 4WTZG 1R3JA 1YMHA 5GZOC 5HHPA 4L3AA 2V2TB 2QR0B 3U6RA 4NRXB 1YEEL 3DTXB 1XIWC 2YD4A 1HQRA 1RULH 5D7LE 4WHCA 3GSRB 1G7PB 4NNXA 2FEDC 3PGDA 4NCC1 1JRHI 3DIFA 4OD1L 5BZWA 3WXWL 4GQ9H 5D6DC 1HHHA 3FMGL 2VXUL 1G0XA 3NH7L 3QXDA 5C9JB 1AKJB 5CIPA 5I16A 3L9RA 4ODBD 4L9LA 1WIOA 3DRTB 1IGIL 1M1SA 1N7ML 1Z2KA 2XZZA 1JP5A 1QLRA 2AK1H 5K9KB 1CR9L 1KV3A 4RFNC 1MFCL 3SDYH 1EAPA 4Z9KB 5K9OB 1C08B 2NX5D 3JWOH 2EH7L 4LSVL 4KI5C 4DZBA 3LKRB 5FECA 4G5ZL 5C0FA 3FO0L 1SEQL 2NX5E 1YEFL 4X9IA 1F45A 2RFXA 1XZ0B 2DQCH 2XQYK 3HI1A 1UC6A 1NCAL 3BPLC 2HYMA 4EUPH 3TCLB 5GS1B 2HFGH 3U0WH 1VSCA 4KHXL 4MAUL 3TFKC 3ESVF 1K8IA 5DJCA 1FIEA 5DUML 4R0LA 5AG9A 3QIBB 3X14A 4NM8H 1CDYA 1B2WL 4JVPA 2A6DB 4UI2A 4PJXB 3K81A 2G2RA 4KTYA 4Q97A 3RHWF 2LU7A 4UINL 5HTSA 2CKBA 3QAZB 2ZUYA 5CBAA 2G5RA 1MCIA 2G5BB 2R0ZL 3T4YB 4NQVA 4H88H 3WD5L 1WWAX 3EHBC 2VRAA 1JGDA 3LCYA 3CXHK 3JTTA 1YDPB 4K23L 3U36A 1MWAH 1LP9F 3TVMA 4PS4H 5BS0E 3T1FA 1CZ8H 4ZPTA 5DDHA 3RPKA 5AUMB 3V5KB 4YFLF 1P4IH 4PPTA 4W6WB 2DM7A 3HAEG 3X13B 5LQBL 5FYLD 1MFEL 4LLMA 2OQJB 3C6LD 2ADIA 4P5TC 5D7LB 4ZMAT 5IFJB 3HC4H 1I7RA 3OJMB 1OARL 3BHBB 3SGJC 5J9PA 3QUMB 1IQDA 2DQDL 3X3GL 4CRPA 2GTZA 4WTXA 1T1YA 4OI7A 1KULA 4MJID 3CFJB 5DJ6B 2G60L 4HIJA 3MRQB 5KN5B 1A14L 1MVUB 1T2XA 5I66B 5DLML 1X5GA 3B2UD 1RK0A 5BV7H 5GRUL 3VE0B 4D2NA 4GFTB 2X1PA 1F00I 4BFBD 4LCWD 2HKHH 2BSTB 2BRRH 4APQC 3ULUE 3RZCC 1N5AA 2GHWB 4EN3C 3QZWA 4S11A 1NCNA 1HHIA 4OD2A 4NCC2 3HMWH 4YHYB 3S35X 1HKLH 3W0WA 1KCRL 2NXYC 4JM2F 2ZWLT 1AGEB 3RVUC 4JKPL 4RA3A 1GGUA 2NX5B 3C6SA 5D1ZB 1T03H 1WGOA 2ED8A 4GUPA 3V6FA 5BZDB 5I75C 3BKML 3WNLA 3KR3L 1ZVHA 4UT9H 2PO6C 4AH2A 1TETH 2OXHA 1EEZA 3QUMH 3S96A 3QDGD 4MAYC 4RGMC 4RCAA 4Y16D 3JTSB 4KI1A 3VFWA 1C5BL 2AJUL 4JCMA 4CL7A 5JLZA 4D94A 1DBAH 4I1NB 3EJYC 3LDBB 2R2BA 1K6QH 4PTUA 3G6AA 1IKNA 5DMKA 4P2OD 2D7TL 5IGXL 4FFZL 1CFTA 1DLFH 3ZTJG 4S1SH 4BFIB 4WW2F 4MD4B 4C54A 1GRWA 4I0PD 2FIKB 5ICZB 1NC2A 5F9OH 5BS0B 3RY6C 1XFPA 1MHPL 2X2YA 3GMRA 5AEAA 3L1OH 1I8KA 2E7MA 1R3KA 1K2DB 3O3AA 3SE9H 3ARGA 4MD5B 4PBWD 2MHAB 1FNGB 4ZTOH 3CFDB 1RZ7L 4RGNC 4Z7VE 1G7LB 2C3WA 4W6XB 2YD5A 3DX9A 5D7KE 2ZCKH 1G7HA 3Q3GA 4K3JH 3N85L 5EOQL 2PCPB 1NJ9B 4H1LG 4JO1L 4OCWH 4MNGE 4RQQB 5DFVC 1CG9A 3A0OA 3K2MC 2BFVH 3K7UA 2HA1A 2JJTA 4PRNB 4NUGH 1EMTL 4DK6A 1ODAA 2FX9H 1ZLVH 5CWSA 4LDOB 4AQ1B 3QFDB 3H9ZA 4Z95L 3BN9C 4CW1A 4PRAB 2Z93A 3TBTA 5IMKB 3F12A 1Q9OB 1OD7A 4K94H 2LAGB 3UC0L 1S8DB 4XNMB 4YWGL 1MELA 1T1WB 5SV4A 2BY3A 3SDAA 2HLFC 2HFEA 1J8HD 1ZSDB 4KWUA 3TH3T 3V4VH 2VLMD 4LLWA 2YK1L 1UCBL 4CJ0A 4MB5A 4MJ6B 3QCUH 5BVPL 1S5HA 2V6HA 4X8JB 3SDDB 5LBSL 4QTHB 1LEKB 3PHOA 5KVEH 1X4ZA 1IKFL 2XZQH 2VLME 1B0WA 5D96B 3SDXF 3LSOA 2HRLA 4OF5A 1HK6A 1J1XL 1DQJB 4WI5A 5IESL 1IAKA 4TSBL 3RWGB 1NFIB 5HHVH 1CIUA 3TWCH 2BY2A 3NCJL 2J8UF 3QDGB 3S37X 4BUGA 5HD8D 3ROOB 5I9QC 5F7HA 2Q8AL 4JHAL 2ZKHH 4MS8D 5CGYD 1CVRA 4J2XA 5JO5A 3QG7L 2V7HB 4M3KB 2Z31C 2IQAA 4POZC 5HVWA 5KS9F 4M1CD 1V7MH 2DQUH 2A73A 2EYSB 1Z0NA 3MNWB 1P1ZA 2XWTA 3PWVB 1MCDA 1PKOA 4QNPF 3CSYB 3AC0A 5L0QC 1S7RB 4I5BA 3R8QA 5GGQH 1MREL 3MUGB 1I75A 4I3RH 2FH6A 2WUBH 2CLVA 4I0PB 4PRPE 3UZEA 3P4OB 1W0WB 5I8OH 4Z7VB 1WVZA 4NO2A 4CDHA 5IVNA 3KWWB 3P0YL 2BOCA 3LAFA 2IH3A 2VITB 4YHPB 4MNGB 4Y4HA 3PDOB 4U2ZA 1GGTA 1QLFB 4QRTB 5CJXA 1I1AC 1KPUA 1U58B 3V6OA 5TDOB 2OS7A 4PY7A 4XNQB 4XMLL 2NMSA 2VZ1A 4YDLB 1XCQB 4IOSD 3ZYZA 1NGPL 1UGNA 1AGDA 1HHGB 4HPOL 4XRCA 4FFVD 1KIUA 4KRPB 4OFPA 1LWRA 2GK0A 2J6EL 4EVNA 4F57H 2YD8A 2D7QA 5L6YH 1OSZB 4HCRL 5IQ9B 2ICWI 5CINL 4PR5B 2AJ3A 5ALBL 4NZRH 1OAUH 3WMSA 1WJ3A 4L8DB 2FO4A 3BQUB 3FT4B 15C8L 4KDTC 5LCVL 5J56B 4L29A 3RPIB 1WBXA 1FVEA 3T0EE 3H7BA 3QNZA 4F58L 4HUWB 4X6BB 1EAJA 4BSVA 1U8OA 3FB5A 4O02H 1KIQB 2XN9E 2GTWA 2NY7H 3RTQD 1CU4L 1U8HA 3IFOB 3P4MB 5HHOD 1V8HA 3TN0A 2ESVA 3PWLA 5DJDB 1A6TB 4HV8A 2A6JB 4F7PB 2DYPD 5I8EB 4LSPL 4PIRF 5HHME 4IS6B 3BRGC 1YN7A 4FQHB 2F9BT 5D8JL 4EOWH 1HH6B 4J4PC 5J12C 2E7LC 1MCBA 4WUKL 3CJJA 5EOCL 2W1NA 3T4AB 3O6FB 1LK3L 3AB0C 1NCBL 2GAZB 5FHBL 1IC7L 4PRPB 5GSVB 2NY0D 4DGYL 2GY7B 3GI8L 5DA0B 4YXKL 4KKAD 2MCPL 1BZ9B 3GSQB 1R5VA 3AS2A 4WGVB 3LIZL 4JO2H 3DVNA 3JV4A 2HMIC 2WBJC 4M6OH 1V7NH 3VXQB 5HBBA 2PXYD 3P73B 4L8BB 3IFPA 1FN4B 1OWWA 1S9XA 4MXWH 1MFBL 2CIKB 2QSCL 5GHWL 4YDVA 4UQ3A 5ESVB 1GGBL 2N1KA 3V7AG 3FONA 4NQEE 5HJ3B 4FG6C 1IZKA 1E6JL 4OT1L 4NN5C 4DCQB 4HBQA 3FQWA 4WW1B 4D8PB 1I8MA 4IOFD 2NLJA 4K3EL 4YIQA 4C55A 4OKVA 3EYQD 4MNQA 4TVPD 4PRDA 3ARDD 2X4TA 1EGJL 2B1HL 3QHFH 5BCAA 4RMQA 1E4WL 5A40E 3VH8A 1JZ8A 4PUBL 3VA6A 3ARYA 4UUJA 1AY1H 4ZFGH 1N2RB 4OZIF 5FM8A 3MREA 1D5XB 3KPSE 1P9MA 4XVJH 5FAAA 2NY2D 3IGAA 2VDOH 4N0UA 4RMVA 3NACH 3AXLA 3JWNC 4JZOA 2CIIB 1JN6B 2WIIA 2AJYL 4KJPD 3W2DH 5C0IA 4P3DA 4FZEL 3TBSA 3T0EB 4XNZC 5C0CA 3ZE0F 4WV1A 1P4LA 1WZ1L 3KYAA 1NFDE 1RPQA 2XN9B 2L7JA 3HZMA 3SDCC 4HK3N 2OJEA 1U36A 4QYOA 1YEEH 5B8CC 4PJDE 2YN3A 5FF6A 1S7VB 2XG4A 4U0QB 1D9KA 3KPOA 4EIGB 5HHMB 3L3OA 4KGLA 5HHQB 1UG9A 1SHMA 1TNMA 3OKMA 5DFTA 5HHOB 3RFZC 4OD1H 3V8CA 5EC1A 2EDLA 4QCIA 1YNTA 3EO0A 1EFXB 4E0RA 3EKCA 1FVCB 2VXUH 1NGWB 3NH7H 3FN9A 1B0GB 2Y25A 4JDVB 5FA4A 4XPHL 1IGIH 2AEPH 2UY7A 2ICWA 3RIAF 5I1KL 1QG3A 1L0QA 1MCLA 5INDB 1MFCH 3WE6B 5DSCB 4NWTL 1RFDL 1S9WB 4DQOL 4HS6B 2EH7H 4LSVH 4GOSA 1LVEA 1VCAA 4OCYH 4G5ZH 3G08B 5BOZG 2ARJB 2NY0B 3FO0H 1SEQH 5CJQL 3B8SA 1NUGA 1CD1B 5DMIL 2AXGA 4R7DA 2P8LB 1YA5A 4NQEB 5B38B 3RA7L 3OJ2C 4U1LA 1KT2A 4FQQA 1NCUA 1CE6B 4KHXH 3NFSL 1T21A 3I6GB 5C92A 3KPQA 4MAUH 1AI1L 5HGHB 4WFFE 1AO7E 4BH8A 3EAKA 1Y0LA 4O58L 2E8ZA 3OAUH 4R2GB 5DUMH 5E8NB 4PGJA 1HQ4A 4QHUA 5DZLA 2V2WA 5AAWA 3IDJB 3UJIL 2AEIT 5F71A 3QIWB 1BD2D 4GW5A 32C2B 4UINH 1QR1B 3KPSB 4ZFOL 4NC1E 4LLQB 5CSGA 3BEWA 5DS8B 2DKSA 2G9HB 5ACMA 2V5SA 3QH3A 1JFQL 2R0ZH 1BD2E 1MUJB 5C6PB 3VXRD 3WD5H 3IVKB 5CZKA 5DJ2A 2HVKB 4RAVB 2NY2B 4K23H 1NFDB 1CE1L 2X7LB 4M6ML 4Z0XB 3BMWA 4X6FA 3L3IA 4PJDB 4O2CB 2FB4H 4X4YB 1P6FA 3RGVC 1MFEH 1AC0A 4FQPA 4LIQL 1LD9B 1W0VB 3GKWL 1O7SA 1OARH 1T0NB 1M7XA 3X17A 4ODVH 3QEQD 4P9HL 2DQDH 2OL3L 3X3GH 3E1F1 1CFNB 3OKLB 3ZT7A 2WV3A 5BQ7B 2GSGB 3EYOB 4N0FA 3KPPA 5JQ6L 2W9DL 4JFFA 2C3VA 2BVUA 1XGQB 1A14H 1IE5A 3S6CA 3RY4A 1OPGL 5DLMH 3NCMA 3B9KC 5J6HA 1E4KC 4U1SB 3UTPE 5L2KE 5IHLB 3VGGA 3EYVA 3H3PL 4PTTA 3O8XC 4TVPH 2GJ6E 4JFZL 3KYKL 4XGZA 3EZ8A 2HT3C 1QFUL 3WN5A 3JV6A 1KLGA 3T3PF 4JFHE 4IM8A 4Y4KC 1KCRH 4HH9B 3TT1H 3QDJA 4QHKI 4N9GB 1FJ1A 2H32B 5D71L 4JKPH 3D1MC 4G7YL 4ORZC 1BQHA 3QDHA 5I0ZA 5DD6A 3WFBL 2KZWA 3G5YB 3BKMH 3JUZA 3PL6C 5C0EB 5DJ8A 4HS3A 3NGBB 4G43B 2FLBT 1AO7B 3RUGF 3L3HA 1NCWL 4KJQC 3IDGB 4GAYB 3PIQA 35C8L 5EORL 4WWKB 1ZVSA 2YZ8A 3S36H 1C5BH 2AJUH 4JZNA 4E42A 1G1CA 1MLCA 3F62A 4NZDA 4LVOC 5F7FA 3S3PA 1ZHBB 5GGVY 3N1FC 3WIIL 3WHXA 5HY9A 4PJBE 3MLXL 3BKJH 2D7TH 1P84J 4P2YA 1WZMA 4FFZH 1BD2B 5A43C 3GO1L 4U6HB 4LBEA 1IJ9A 2V9RA 3VFMA 5DEGA 4G3YL 4F3FB 5KSBF 1ZS8A 4MCZB 1CFQB 1LK2A 2XQBH 2FHFA 1EERB 1A0QL 4I3GA 4MHHI 2AQ1A 2C1OB 2CQVA 3FQTA 3RVWC 1Z0MA 3WNNA 4ZUUB 4M4PA 5IT2L 2ERJC 3DXAE 3HZYA 4G6JL 2PW1B 4HEPG 1W72L 2CUMA 5KZCD 3N85H 1OTUD 5EOQH 3SJVD 4F9PA 1YZZA 1WWBX 3UO1H 2VO5A 5E99L 2Q7YA 5TE4L 2D03L 4EZMA 3IDYB 5CGMA 5L2KB 3UZVB 3VFGL 5IM7B 3QNXB 1QSZA 3V52L 1A6UH 1IFHL 2GJ6B 4M43L 1T22B 2DLFL 3P0GB 3Q0HA 1X3DA 4LLVA 3CDFA 4MXQC 5ADPH 1J7VR 4FQXA 3P9LA 2HJLB 2WP3O 3AGVA 3UC0H 2J5LB 3BISA 1EIBA 4YWGH 1VFBB 4ODWB 4U3XA 3CK0L 5F70A 5C0AE 1MJ8L 4Q9QH 2Z91B 1D5BA 3SCMB 3D3VA 3ARVA 3CVHL 1DBBL 3FL7A 5FGCE 3LPWA 5ITBL 3WCYA 5I1CL 2NW2B 2YK1H 1UCBH 4P23B 5DF0A 3QUXD 1GSMA 5F9JA 1X5FA 4Y2DA 5IW1A 5FKPB 5BVPH 5MEOA 1KTLB 3EGSB 3QB7C 4MYWB 4S1RH 5LBSH 1FFQA 3HRZA 1IKFH 2CLRA 2D7MA 2ZOLA 1J1XH 3UPRB 3T77A 2OK0L 3S4SG 5IESH 1OOAA 4FQLL 4QRPD 3DMMD 5IROA 2P7TB 1OGTB 2UYLA 4LEXL 1UQSB 5DWUL 4JHAH 2FEEI 3BAEL 4PJBB 3P9MA 3GJEB 3QG7H 5EBMA 5C08D 1XGTB 4HUUB 5D1XD 1S9KC 5T1KD 1YMME 2GY5A 1ADQA 1FZJA 1KIRA 5CLWA 4LRIA 1KPRB 4ETQA 2ED7A 1F58L 2W9EL 4OF8A 1IZJA 1AHWA 2Y5TB 2VE6A 2H6PA 1FZMB 1I3GL 4MZ2A 2M8XA 1MREH 2F54D 4ZUTB 2EECA 1WBZA 5C0BD 1QBML 1T7WA 1EFQA 4OKDA 2ATPB 1HHJB 1FFPB 3AVEA 3DXAB 4P4KC 3G5XA 4J3WA 3ILQC 3P0YH 2AV1A 4LLUB 1QLEL 4U33A 4BSJA 3L7FA 5KTEL 3PQYE 3FOLA 4JHWL 5DQJB 5E2JA 4OJFH 2WNGA 3QG6B 1KSRA 3E3QC 3GRWA 1TVHB 4XMLH 2ZPKL 3HFML 5FO7A 4Z77A 3FQUB 3D0VA 1NGPH 3BYYA 2B4CH 4HPOH 5ACLA 3K8MA 4LCCA 4HKJA 3PGCA 4C56A 4XH2B 3P30L 2J6EH 5GS0D 4S0SD 4HGKC 3TNMA 4K71B 1KTDA 2X42A 3P2TA 3OXSB 4HCRH 2DM2A 2XIDA 5CINH 4ZOEA 5FGCB 5ALBH 2OR9L 4UV7L 1LO4L 2EDTA 4FZ8L 1BJ8A 5CS7A 5ETUA 15C8H 5LCVH 2D9CA 3ECBA 3TLRA 4K8RD 3V5HB 3H0TB 3QIUA 4U3HA 1P84K 5IK3B 3TIDA 4F58H 4OGZA 2VLLB 4JFDA 4LSSL 3IKKA 4IMLB 3CD4A 3B9EA 4OBRA 3FO9B 3GMLA 3MNZA 1DVFB 1JTOA 5I1IL 1CU4H 5E24E 5GZND 4GS7C 5JW3L 1KJ2A 1P7QB 1G9MC 1KNOB 5AG8A 2JTDA 3BP5A 1UWGL 3K4AA 4UT7L 1DANT 2J1KA 4LGRB 2SEBB 3FHQA 3HCVB 5EU3B 5F6HJ 1UEMA 4LSPH 5E5UB 5LG1A 1YMMB 3O2DL 2AW2A 5D8JH 4CVUA 3VGAC 2OI9C 4HGWB 1ZGLP 3VXUD 4WUKH 2B5IB 5FYKE 3MRDA 3V4UL 3ZSSA 4D0CA 2HFFB 1N8ZB 3T2QA 4LVNC 1LK3H 3GK8L 1JPSL 3QDMA 1KLUA 5FHBH 4GRWE 1IC7H 3TH2T 1W2KT 4DGYH 1X9QA 2DWDA 2X05A 3GI8H 8CGTA 4YXKH 5EUOF 2MCPH 4QWWC 5EIQA 1IRAY 2MKWA 3LIZH 5KVDL 1JL8A 4G8GD 4OI9A 3F7VB 1M05B 3M1BA 1BBJB 3PQYB 4HUXA 4Y1AE 3PF2A 1MF2L 4M1GL 3P11L 3LEXA 1MFDL 1MFBH 2QSCH 3RY5A 5GHWH 1GGBH 3S3SA 3MBXL 3WUWA 4LIQE 4Z7UA 1EO7A 3VG9C 3QI9B 1EHLL 1DP0A 1E6JH 3A6OA 4OT1H 3TT3L 1EX0A 1SBSH 3UYOD 4JPKL 4K3EH 5IBUB 2W60A 3MRBA 3G04A 3WNMA 1PG7H 5GGRY 4I48A 1S7TB 2EDYA 1EGJH 4NJ9L 1E4WH 2C26A 2DIAA 4PUBH 1QACA 4NHUA 3I75B 5HYJE 1UXWA 3B5GA 3TF7C 4X6CF 1X7QB 4KK5D 2CDGA 2WINA 4MMXC 4ESKA 4P2RE 1ULVA 2IJ0C 3LB6C 2H26B 2X4SB 3B3IA 4X0KB 5FK9A 2AJYH 3S35L 4YX2L 4CADB 3B6SA 5HI5D 4KHTH 1FZKB 2X70B 1FYHB 5JR1L 5JIKA 3HMXL 2XPGA 4HJ0D 5GRYA 1WZ1H 3GBML 3QQ4A 4MNHB 4IHOA 1XR9A 2D0GA 2OTUB 1IILE 2VLKE 3EW3B 1Z9OA 5GIRA 2MQ0A 3L5JA 5BRZD 4P46C 3WIFA 3KPRD 3QQ9D 3X11A 3FTGA 2VR9A 1J10A 1UB5A 2XACC 1JIBA 5I1GL 2DQIL 4D9RE 3MV9D 3AU1A 3BDYL 4LPXA 4GBXC 3FAXA 1ZWIB 3DECA 2BDNL 1KFAL 1UKQA 2R9HD 3MNVA 3I3BA 3FRPA 3KDMA 4XPHH 2I07B 2R39A 4GRWB 1U8PB 5ESQA 5I1KH 2XOTA 4OIIL 4I18B 2UVFA 2EXYC 5MERB 1NGXA 1VGKB 4MQ7A 1RFDH 4FS0A 4DQOH 3D85A 1BFVL 5GS0H 3HC0A 1UFUA 5H35A 1P7KA 1V3LA 4Y1AB 2JB5L 1H3PL 1PY9A 5CJQH 1MPAL 3HNVL 3GDBA 2WLZA 5DMIH 4D0BA 2Y7QA 4EEEA 2P24A 2W59A 4JFED 3BRDA 3CFBA 5ESAB 3RA7H 3STLB 4JDZA 3B2VL 3NFSH 4P2QD 4WO4C 4N8VA 1AI1H 1YPZA 4LNVA 2OL3B 1HWGB 4WNQA 1XIWD 2P8PB 4O58H 3VFTB 3KLHC 1CDHA 3UTTE 2CK2A 3TGXA 5EC2B 4JFEE 4PREB 1ZLWK 1FNEB 4WDIB 3JV5A 3UJIH 4DFHA 4LLDB 5D1QD 4GRWF 3H42H 2CR6A 4LU5L 5HYJB 4GRWH 4P2RB 2DJSA 2X4RB 5MP6L 2APWA 3FO1B 1EO5A 1L7TL 1F11A 2CD0A 3RKDC 3OR6A 3S34L 4HKXB 4LLYB 3TBWA 3PXHA 3ZKQD 5IVZB 1CE1H 4M6MH 1UB6B 4WEUD 1UH4A 3ARRA 3HE7B 1FSKB 5DJXA 4KI5D 2VLKB 3GNML 4JANB 3SKNA 5E6IA 4AYFA 3CXDH 1A47A 5CHNA 4PGBB 4PLKC 4E9LA 3AM8A 3GKWH 2XFXA 1NCDH 3HE6B 3SEPA 3BGMA 2E7HA 5D4QA 4P9HH 1QFWM 1DEEB 3O45B 5IVOA 1PLGH 4YGVA 1LO5B 5EG6C 4UIKH 3TA3A 5JQ6H 2W9DH 3TFKD 1ZHNB 4QOKD 4Q0XH 4WFHD 4YPJA 4Z7WE 4LL9A 1OTTD 1QTYT 2V5RA 3MRRA 2JJSA 2MJWA 3MA9L 4ZAKA 1FO0B 3X12B 3HA0A 5LGJA 4HKBA 1U8JA 1S7XA 3MV9B 4YFLI 1F8TL 3FT3B 4AEHH 4JFZH 3KYKH 3S3JA 4WFHE 1TCRA 1LNUA 1QFUH 2KL6A 2HTKC 4ZNEE 5CEYA 4X6DF 1BZ7A 1EDQA 3UPAA 3O9WB 2DLHA 4FQIL 3VXMA 4D0DB 4PJGE 3O41B 3C5JB 4G7YH 3EHBD 2AK4E 4XZUA 3LKSB 3MJ9A 5I8KL 4ELME 1TZHA 3GMMB 3MX0A 4DGVH 5IJKC 5IHZB 1QNZL 1NEZA 5SWQA 5CZVL 1A7BA 1NCWH 1RMFL 4GKSA 5SX5H 4P5TD 3UTTB 5E9DA 5JHDD 35C8H 1NBYA 5EORH 4JFEB 5I18L 2DQFA 2FGZA 4Z5RB 1RZFH 3ES6B 2VKXA 5HDLA 3OAZH 3HB3C 1UKSA 5JDSA 3MRMA 4HBCL 4OQ1A 4I2XE 2V7NA 3WIIH 4XWOC 3CNKA 1R3HB 3MLXH 1VFAB 2DLTA 2YC1B 4GW1A 3SOBL 5DHVB 3CH1B 1J87A 5IB1B 3ZKMC 1EJ6A 3D25B 4EN3D 3VD9A 3K1DA 1A0QH 2VKWA 3C60A 2ZG2A 5EU6E 3HC3L 2NXYD 4YDKL 5A2FA 2P45B 1UM4L 4RFNB 5BW7C 3F7YB 5IFAL 3RVUD 1IM9A 3HR5A 4G6JH 1NDGA 1JK8A 4G42A 1W72H 2BNQE 2ADJB 3BUYA 2PO6D 4FMFA 1IGYB 3SGDH 4IIQB 5TQ2L 2CRMA 4Z7WB 2MNUA 3CH8A 5E99H 3VFPB 2D03H 4XC3L 3T65A 1J88A 1XH3B 5K33A 4L4VE 4EUPA 5SWZA 1DUZB 5BXFB 1IFHH 4M43H 2X41A 4HLZH 4Y4FC 2IANE 1G7JB 1OY3B 2V9QA 3JUYA 4G9FE 3FRUA 5F89B 2FYYB 5DHVH 4Q74A 4OUUB 3CK0H 2EDQA 1MJ8H 1ORQB 2X9XA 4PJGB 5T5NG 5C9JA 5C07D 2AK4B 2VAAB 5BOPA 3QEHA 3CVHH 1ACYL 2VABB 5GXBB 3DRTA 3NCBB 4ELMB 1QQDB 5ITBH