2BDNL

Crystal structure of human mcp-1 bound to a blocking antibody, 11k2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
DIQMTQSSSSFSVSLGDRVTITCKATEDIYNRLAWYQQKPGSAPRLLISGATSLETGVPSRFSGSGSGKDYTLSITSLQTEDVATYYCQQFWSAPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure activity relationships of monocyte chemoattractant proteins in complex with a blocking antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Small inducible cytokine A2
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2005-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bdnL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bdnL01
5GISH 3NBNA 4LQFL 4JHZA 4JM2A 5HBBA 1OSZA 4X9BA 3MRMA 4JKLA 2ZWLT 2EDJA 3MBED 4M7ZC 5IFJB 1Q0XH 1W0WA 3ARBB 4JY5H 4RMRA 5EU7E 5GS2D 3QFJD 2GSIB 4M61A 2BVQA 4N8VB 5KG9B 2BK8A 2EDQA 2VB5A 1JZ8A 2E5EA 4YC2C 5E8PA 3WFEL 4EDXB 4ZFZA 3FT3A 2XZQH 1C7SA 2NY0C 5C6TL 4QOKB 4IIQA 1F3JA 4RISH 2Y06H 4N0UA 5J1TC 4LLAA 4LSVH 1T20A 3WFHA 4WI5A 1I8LA 4ALAH 1HYSC 4Z7VB 2QADD 1YUHA 4BQ9A 5JTWA 5JNYA 1MF2L 2BNRE 1CDYA 3MLSH 1YEHH 4AMKH 5FUCE 1F42A 3FB8A 1F90L 2DWDA 1KG0B 4OZIF 2DL2A 3TVMD 3WXWH 1DQQB 4LIQE 1ZTXH 3TZVA 3DVNB 3IAQA 3VXSD 2HTLD 4UT7L 4I3SL 4LCWE 3I6KA 5JUEL 3KS0J 2W91A 3OKYA 4J8RA 3V5KB 1X4XA 2DBLH 1DDHB 1DBBL 1AI1H 2R29L 4XRCB 3UCRA 5AG8A 4LSRL 4XPAH 5I17A 2QADB 1L7TL 4QYOB 2Z0BA 4FQ2L 4QHUA 5CJXC 3QUZD 4NO2A 4YHNA 2V9RA 3FQWA 3QFJE 4OLZH 4HC1A 1YY9C 1T04A 1N4XH 1G6VK 4KQ3L 1NFIA 1BFOA 1P53A 3A6CL 2C3VB 1TLKA 2X4OA 4LEOB 4EDWH 3RWHB 1TJIH 1ZLUK 3FOMA 2C4FT 2AEPL 3B8YA 3ARDB 4HKJA 3LKQA 4WW2B 3T0AA 3VWJC 3C09B 2FSEA 3GM0A 4OKDA 1UA6L 3KR3H 1I1AA 3TCXA 4LIQL 5B21A 4OCSL 3V95A 1KN4H 3EO9L 2WBWB 4PLOB 1T66C 4NDMA 2GSIA 4ZMAT 3KHQA 5D7JD 2FWOA 1TNMA 3PDOB 1IEAB 1HH9B 2R2BA 4HJ0D 3O2WH 2BVOA 3ULUH 2CDEB 3N9GL 1EIBA 4OI7A 4QHKJ 4DOHE 3KXFD 1L0YA 3HAEB 5E6YA 4IJ3C 4YE4H 2AAVA 4K7PX 3VXQB 3QZWG 5IBLD 3MODH 3PGDA 2NY0D 2RAMA 1JP5A 1PKQA 5TFSH 2P8LA 4ACPA 5KSBA 2PW2B 1MREL 1KPVB 1E4WL 2AKRB 3GHBH 5DRNA 2HT3C 4F7TA 4OQTA 4KVCL 3O6FC 3QIBD 4FG6D 5CEZL 4IS6B 3HNSH 5DI8A 5CBEB 3SJVD 2ZPKL 2DI9A 4NN5C 3RDTA 3BKYH 3MJ9L 3V0VA 5C07A 5IVXB 3HE6D 4PJHE 5F1KC 1W72B 3T09A 3UX9B 3DIFB 3NIFE 4JDVA 3SCMB 1WZLA 3QI9B 3FZUC 3GRWH 2DAVA 3MFFB 3D39B 3QH3B 4KK6D 4LEXH 1F58L 1GAFL 4OLVL 3V8OA 4NM4L 4MAYA 1PZ5B 4L9LA 1HWGB 5DK0B 3HE7A 2NY1C 1C1EH 2HFTA 5FYKU 3ULSB 5LKNA 3VXSA 3B5TA 1FGNH 4LSUH 5D2LE 3CJJA 1OGAA 1UH2A 1Y18B 4UILH 4LCYA 3RZCA 3MRNB 2CK0H 4FP8L 1RFDL 3H9SA 3NCYS 4F9PC 3WS3A 2NYYD 2PETA 5DK2A 1JV5B 2RBLA 4M6NH 3DGCR 1IM9D 2YPLB 3Q6GL 1A3RL 5JDJA 1AIFA 1WBXA 3QDJB 3SJVE 2EKJA 4JDZB 1JPSL 5FOJA 1AGDB 5K93A 1BVKB 5FECA 1IGTA 2R1YB 5CZVL 3T0EC 4JCMA 1J0ZA 1DQDL 1GOHA 2BCKB 3VFMA 1EEZA 3IFLH 1MI5B 3ROOB 4OZGE 4QO1A 1VERA 3DV6A 3QCTH 1JGDB 3N0PB 3MLXL 4P9HL 1JN6B 5FV1L 2DI7A 2EE3A 2C26A 5FA3B 2R9HD 3MXVH 2LTQC 4I0KA 1HIMH 3GBNH 8FABA 4JFQB 5AD0B 3VFPB 1S7QB 3QNXB 5C07B 5IVXA 5CJOL 5TPWH 1NFDE 3BRDA 3DWTA 1DQLL 1S9KC 3U4EA 4MSWB 3OAUH 1CL7H 1RZJL 4XMPH 2ID5A 5EBWA 1T2XA 4OTXL 5FUZL 3U9PH 1FPTL 4TTDD 1TZHA 1FLRL 1XF2A 1S7UB 4RWYH 5IF0A 1EHLL 5CBAB 5A2LH 2Z92A 3ARBC 4HUKB 3IJHA 1QHOA 3SDCA 2ARJA 1SVCP 5JO5A 4Z9KB 4CJ0A 2BY0A 3AROA 1J10A 1Y18A 2JK5A 3BN9D 5IMLB 5LBSH 4PJ9A 3HUJF 5FYLE 1UB6A 4JRXB 4PY7B 3P0YH 4MQXD 2NY0B 1A6WL 1JUFA 3BYYA 2X10A 2HWZH 3NA4A 5C0DB 5EU6D 4KDTA 4U6XA 3AREA 5KSAD 4YDJB 5DFTA 5FGCB 5DF0A 1QSZA 3CMOL 2VXTL 4Z0BH 1GZQB 3KVQA 5IVXF 3OKMB 1LVEA 3ULVF 2OL3H 2R1YA 1UENA 4Z7NE 4K7PL 1JRHH 3BH9A 1XGRB 3KJ4B 7CGTA 2JJTC 5LCVL 5TE6H 1WV7T 1OAQL 5AEAA 5BV7C 3CVHH 1ZGLA 1OGAE 4HKZB 2YOCA 3IDGB 1ZTXL 3V79C 3MODL 3ZKMC 4ZTPL 2IPTL 2DQEH 3J7HA 1JZ4A 3BPLB 1CS6A 2J6EH 1LD9B 4YIQB 2QADC 4NO3B 3B9DA 1QFOA 1CK0L 3JBG7 1JVKA 2EDEA 1MF2H 3MJ8B 4KRNA 1NEZA 4PJGF 3ZTNL 2HJLB 3LKRA 3T3MF 5L2JB 1RSFA 3T3ME 4J2XA 1I1YA 1FFPB 1OAXH 5D6DA 3ARGC 4LSVL 2V7HA 3QEQA 2FL5B 2P43B 3THML 5LGKA 1ODAA 1T1YA 4WU7B 1INEH 4LL9A 2V9QA 4H1LA 3VH8G 4OT1L 4ISVB 1WBYA 3DX6A 4Y16D 2G5RA 4EVNA 1YJDL 3MRDB 3QIWC 2R23B 1K5NA 1AGCB 3KLDA 1MHCB 5JPMA 3ZSSA 1YN6A 4GG6F 3GMLB 4HF5H 1UFUA 5HDLA 1QSEE 1DEEA 5DJ8B 1U91B 2W60A 1ZLVK 1CTOA 4P9ML 3VWJA 3V0AC 1AKJB 1TCRB 4NT6A 1BECA 1A7RL 3CFEB 1AO7D 4MQTB 4YPJA 5KSUB 5KS9F 3RL1A 4PV8A 5BOPA 3BN9C 1MFNA 5DEGA 5JDSA 3BZEB 3T0XA 4O2CB 3DX8B 5DHVA 3ILPA 4W68A 5C0DA 3WIIL 2XI9A 3TV3L 2XPGB 4Y89A 1KCSH 1FGVH 4OFDA 1HOCB 5C71A 4YJZL 3RWEB 1RIUL 5IFHH 5ITBL 5EN2A 4BQBA 3VXRE 3BH9B 4HGKC 1G7LA 5DJZB 2CIKB 4WJ5A 3E0GA 2L7JA 3WKMH 1AJ7L 1MRCL 1OM3L 4DEPB 2CDFA 4FABH 3EGSB 3SPVA 3O11B 1CLYL 2CKBH 3PWUA 4NRZA 1UZ8A 3W5NA 1ZHLA 1SMAA 3QUXC 1F3DJ 4XHJD 5CWSB 3RWFA 5MEND 3WHE0 5E8OB 3MJ8A 1ADQH 3EKCA 5BQ7B 2HJLA 2FJGB 3AFLA 2HT4C 2NNAA 3RP1A 4MJ6A 1LILA 3LKPB 5C7XH 5INCA 5D1XC 2C1PB 1MFEL 2HFFB 4L3CA 5JOPE 3DX6B 3C5ZB 1HN1A 1CGXA 3MLYH 5IM7A 3T1WA 4HZAA 3T08A 5GJSH 3CLEL 1RUKH 1D6VH 2ZSWA 2D7QA 3CVHA 1EBAA 4TVPL 4YH6A 1CD9B 1S5IH 2H32B 4KHXH 4TSBL 2MJWA 3MRHA 3ULVH 4WI9A 3HG1A 3QUMA 1KC5H 4ZFZB 4PJFF 4E41B 1U3HB 2ICEA 4J3XA 3BMWA 4XMKH 1NUFA 1KPRA 5BZDA 5FYJE 2E7MA 2NY1D 1EEUA 3TCLA 3QA3B 1CIDA 3T0EB 1IFHL 2CSPA 5FUOL 2YK1L 3DYOA 5D6DC 3VCLA 1RURL 3C6SB 5JXAH 1JGEA 4Q0XL 3S36X 2CLRB 2IAND 4W6YB 2VRAA 2M1KA 3WN5B 4PRPA 3IS0X 3F5WA 5ESQA 1AE6L 2X1PA 3RWGB 1XF4B 2OX5A 3A0OA 1T5WA 4I9WD 3ZT5A 3QHFH 3QHFL 2VWEE 4U3XA 2PXYA 4JO3H 1WUNT 2GT9A 1T6VN 2ORBH 4F7MA 1FHGA 1NGPL 2HTKD 4HJJL 4NSKA 3QCTL 1JGUL 4PRBB 43C9B 4FOMA 2VYRE 2FJGA 1E4JA 3DECA 5TDOA 4I0PA 2BXZA 1EHLH 1JL8A 1AGEB 1P9MA 25C8L 3LKPA 3WFCH 3INUL 5INCB 3LDBB 2ZUUA 4G8EB 4XHJC 4UT9H 1JPSH 1E6JH 5C3TA 4NHUB 5FYJD 4XCCH 2QV2A 2XICA 4LHUA 5J12C 4HUUB 3P73B 3VXTA 3QDMB 1KELL 2XA8L 2A0LD 3OAUL 3QUML 2XA8H 3C5JA 4CN6A 1E28B 1I4FA 1P7KB 3DROA 1N6QH 4UU9B 4L4TD 3FMGH 4MDJA 3TC9A 3GJFH 2BRRL 4NJ9L 3DIFA 1F3DH 5T3XH 4J3WA 1G9MH 5AAWA 5GGVL 1WZ1H 4O2FA 4TNWF 1KF9B 1AXTL 3TP4A 3O2DL 2CDEA 3KDMB 2ICCA 3OPZH 4MGXA 5DD5L 1BREA 1JGUH 2XT1B 1RK1A 3SE3A 2MKWA 4X7DC 4ZO9A 1WAAA 1W72L 2B4CH 5CZXC 1T4KA 1U36A 4XNYL 3GRWL 5F3BB 3RZCB 3VI4E 5EC1B 2PW2A 3ZE1F 3VD9A 3HNVH 3OG4B 4QHMB 1QBLH 3D39D 3IU4L 2BC4B 3EYUL 4IS6A 1NAKL 2AEQL 3O0RL 1CI5A 1SBSL 1URLA 1HH6B 1XF3B 3SGKC 4ELMB 3CFBB 5C8JA 4JB9H 4DKDC 4DGYL 1CZ8L 3PWVA 4PJ8B 5DUML 5I1HL 2B8OT 2APXA 2J1KA 2ZOKA 1MIML 2VN7A 3SCMA 4Z6AT 5IFAL 4UNTA 1EVTC 3KYKL 4GS7C 1B0RA 3D85D 5E1HB 4JR9L 3O6LH 4Z7OE 2XQYK 3IS1X 3F7QA 3WUZA 4APQA 1OPGH 2ATPA 1MCQA 3AMLA 3SO3C 3T8XB 1MFAL 4CUCA 4MAYB 3PF2A 3QIWD 4L9LB 4NNXB 5DK0A 4HUXB 1HYSD 4QT5B 3RRQA 2EYSB 4TVPH 1A7QL 4Y7MA 5DS8B 2YA1A 1FYTD 1OGAB 1ZHNB 2CMRH 3V4PH 1MHHA 1CXHA 4HF5L 3MLYL 3FRUB 2EIZA 1RD6A 2ZJSL 4HS6A 2JB6A 3WDHA 4BFEA 1A47A 4JZNB 2XN9B 4ZFFB 3S36H 3VRIB 2YPLD 2Q7YA 5FECB 5I2IB 3MJ7B 4XHQA 3W9DA 1AC0A 2N56A 3BESR 3CK0H 3IJHB 5D1ZB 1LNUA 3VRLE 4PD4J 2YD6A 2YZ1A 1R3HB 4P2CG 4DEPC 4TUOA 4ZOAA 2P47B 4I18C 3P40A 3HR5B 5DO2C 5JXED 4FQXC 1DBBH 1EO8L 1TJHL 5D1XD 4HK3N 2P5ED 4I5BB 1IGCH 4O51B 5F7YC 3KPTA 5IFHL 5ITBH 4PR5A 2NY3B 3V6OC 2WZPD 4DAGL 1WFTA 4C57C 4F7CB 1HKFA 4XP9L 1UT9A 3MGOB 2GJ6B 5E00A 4H0IA 4W6XB 1KLFA 2YPVL 4R7NB 5HHNB 2PYFB 4YHLH 1ZHBB 1YMMA 4HJ0C 3IU3A 3M8OL 1P7QD 2ZG3A 4HKZA 4GG6A 1F2QA 5CBAA 1NAMH 5DQDL 4ALAL 4ZUTB 5ACZA 1VADA 4LAJH 2JELH 1V05A 2JK5B 3MNVB 1YEKL 4PJ5D 4O2EB 4HG4J 3ZE1E 5GRJH 1KTLA 1J05A 4K71B 3C5ZD 1Z6JT 3JZ7A 2J4WL 1YZZA 2QR0A 3ZKND 1TJHH 5E24E 3WNKA 3QDAA 4ERSL 5C0BB 1T7YA 2X4UB 4WDIA 1RUPL 4WUUE 1NBYB 1U3JA 5IOPB 1G7IA 4KJYB 2R23A 3S6CA 2GJJA 5D4QA 1CBVL 2B5IB 1ORSB 3KAAA 1SYSB 3W0WB 1TCRA 4XAWH 5D2LB 5TH2A 2ADFH 4MD0A 1PEZA 4OD2B 4R9HA 5JLZB 3WFEH 3D85B 4GKSA 4PG9A 2DQCL 3TIDB 5EOTA 3ZDZF 5JA8B 5FGRA 2WIIA 2GUOA 2WUBL 4UDUA 3BP6B 3HZYB 2D9QB 5C0ND 4Z0BL 1C7TA 1Q0XL 2VQ1A 3I84A 2VNCA 3FQNA 3N85L 5CZVH 3IFNH 4X6CB 1DBMH 3MJGX 4EUPA 1I8KB 4A2MA 3DI3B 3RIFF 3CZFA 3P77A 3VXUD 5HSFA 5ESAA 2A74B 4MNQD 1A7QH 5E9DB 5I71B 4LAQL 1NGXB 1FL5B 1I3RB 2VDRL 3QCVL 2F5BL 1WEJL 2D7TH 1OAUH 3LH2H 1OAKL 4G80A 1I7UB 4WUUD 5D8JL 1QVOA 5EFIA 3FT4B 2VLKE 5SWQA 1R24B 4GXUM 3KNBB 4S1DD 3T0WA 1XZ0B 2FB4H 2VXSH 4L8SB 2OMBA 2EDKA 1PG7H 1R3IL 3ALPA 3IJSB 5I19L 2BOBB 2MPAH 2Q76A 3FB7A 5EPMA 1YQVH 3AB0C 2F53A 2DL9A 2VE6A 1FPTH 1AO7B 2HJFA 3DX8A 2AEQH 3L5IA 4PJXA 3UXFA 3NOIA 2J12B 1S9WB 1DQLH 2W0FA 4H8WL 4NKIH 5EORH 3AS1A 1HDMA 3UDWC 5E6ZA 1Z5LA 5DQJB 3U36B 4NN6C 3X12B 2AABL 3AM8C 3RJQB 4XVUC 3HPLB 1ONQA 3QFDB 4TTDC 1NBVL 2VLRE 1JNLH 3EYSL 4OF5A 3MV11 4GQ9H 7FABH 3G5XB 2BP3A 3L7EA 3ZDXE 1UG9A 3F58L 3W82A 1AXTH 4NRXA 1BBJA 3ZE2F 4F9PA 4M5YL 4LVHB 2YBRA 2NY7H 2P44B 1FE8H 2I5YH 5EOTB 4O00A 1N5YH 1D5XA 1ZEAL 1MH5B 3QJFB 1CXLA 5I1KH 3LZFL 2V2WB 2YWYA 4JDTL 1X3DA 3MREA 2FO4B 2CK2A 4FTVE 1NCAL 1SJHA 2DTSA 3NIDE 4KK5C 2HKFL 5ISZB 2RGSA 3O3AB 2XY2A 2FR4A 4EOWH 4HUMB 2VL4A 4P2YA 2GEEA 4PJ8D 4W81A 1FORL 1BLNB 4QGYA 5GZNC 2X44D 2V17L 1I9JL 4JY4A 4UILL 4M9OA 1KB5B 2LVEA 4JKMA 4ODXA 4QY8B 4U3HA 3VFVB 1P1ZB 4OCSH 3SE8H 4MA8L 1B0GB 3GGWB 3QAZC 3PE9A 3VXPB 4MJIB 5J11C 4ELKA 1V3JA 1RJZB 1VENA 2F53B 1A2YB 3DV4A 2RIKA 3MLVH 3G08B 4GKNA 3NZ8B 4UB0L 3MLTA 4RDQG 1KJVB 2X4RB 4M9PA 4MNQA 2YD9A 4XVTL 5T1DH 1MLCA 3FB5A 2CD0A 5SWSB 5DEFA 4Z7WF 3ORJA 2BY3A 3WEXA 1HDMB 5CP7A 1EZVX 1VFMA 2PO6D 1KYOJ 1UCBL 5F9JB 1KBGL 5MEPA 5D7JB 2DLFL 4XWGL 4UNUA 4LKXA 3B8SA 4Y19A 2HLAB 4DVRL 4NBZB 3PXJA 3IFPA 3T4YB 3EJJX 2YMXH 1FNFA 5HYJB 4L1HA 1LO4L 4PJXE 1T7ZA 4QOKA 5C0AE 1M6OA 4G5ZH 2XZAH 4QRTB 4Y8AA 3IXAA 4HKXA 4KY1H 4JHAH 5DJYA 2XOTA 2CXGA 1S5HB 1UC6A 3VXRB 3W81A 3G5YA 4A6YL 1NMAH 5F3BA 4ZXBA 5FO8B 5I74C 1AGEA 4KZEH 4JZOA 3FQWB 5EZLB 3CH8A 5C7XL 5E2TH 4P2QD 2XACC 2QSVA 3FOMB 1BHGA 4XBEL 3TBWA 3KPMA 5T1KA 1BQHB 3D1MC 4F2MB 4WNQA 5HHMB 5DJCB 1UQSA 1TENA 1T1ZA 3E3QC 5GISL 3IDIB 2WBJA 4WEMB 2H1PH 4O2FB 4UBDC 2VDKL 1N4XL 4KQ3H 5F7FA 1CLYH 3PWNA 4JPKL 3B2VL 3QDGE 2BNRA 1CD1B 5DC0A 4Y5VA 4YNYB 1KFAH 3UPRA 4X5XA 3VWJD 1I9IH 1NC2B 5FK9B 3AU1B 3L1OL 5DMKA 2I26N 4FFWC 4U1IB 2IH1B 2R69H 4PJAB 4OZIA 1I9RL 4V1DB 3VE0A 1CE6B 1AQDB 1WCBA 2QTEA 5E2WH 3MA9L 4PJCB 4Z7QF 3HUJE 2I07A 4ODUB 1F4YH 1H3TA 1LEGA 3IDNA 3JV4A 3AXLB 1EHXA 1GYAA 3WNMA 2HLAA 1J1XL 4K3JH 1JK8A 4ODTH 2QQKL 1SBBA 4AMKL 3F7VB 3TO4A 1FBIH 4WO4D 4AIZA 4NO0D 4TNWK 2IAMD 4WWKB 4U1MA 5KSVA 1IC1A 3NAAL 1HKLL 5T3XD 1CXKA 2Y06L 3AS0A 4NQDA 3DVFA 3UC0L 1EMTH 4HXBH 3RNQB 3TBVA 4YHKH 4JO4L 1D5BA 2CKNA 4UT6H 2APFA 12E8L 3SOBH 3EJZD 5FHAL 2XTJD 1KOAA 1HWHB 3EJYD 1RHHB 2YN3A 4GG8B 1JNJA 2P7TA 5TE7H 5BRZE 3KPMB 3FQRB 4RNRA 4LF3A 4MWFA 1LK3L 5FAAA 4BH8B 1UQSB 4HPOH 2J88L 1YMMD 5EZIL 4OKVA 3U30B 4RAUB 3GIVA 1CDBA 5BS0E 1RIVH 4OGZA 1MRDL 4CVUA 1HHGB 5CD3A 4M43H 1ND0B 4XPTL 5T5NF 4Y5YB 2A73B 2J2ZA 3VA6A 1PKQE 4KFZC 4E5XA 1S9YB 2X70B 3FONB 5HYJE 3GJFB 4PJ7B 4Y88A 3KYMA 2FATL 1K85A 2X6MA 4XTRD 5HDQH 3I50L 4O2EA 4PBVC 2JJSC 4Z8FH 2O5XL 2A9NH 3UZQA 2BY1A 2Q7NA 4L8BB 1EUTA 1OQOA 1OTTC 1P7QB 2IC2A 5C07E 2EDXA 1XCTA 4P5MB 3ZTJH 3N1QC 5DD1L 1CT8B 4XNZB 3KYOB 5B39G 3RJDA 4RAVA 2ED9A 5DRZB 3TJHC 1KJMB 3BSZL 3RVTD 2D03H 1MIEL 4XCNB 4OFIA 3Q1SH 5SWZD 3U7WL 2DLEA 3DXAE 2YA2A 5F1NB 4PTTA 4QRRA 4M7KL 4U1MB 3QYCA 1EAPB 4NZRH 4MA8H 1CE1H 3G6DH 3L3JA 1KENH 2C7UA 4R7DB 2JIXA 3O3UN 4U31A 1KCKA 4LLQB 4OIBA 1IGFL 1UJ3C 3RWJB 4HAFA 3D25B 4YHIA 3FO0H 3HS0A 2HFEB 1YUHB 4G43B 2G75B 2ICWA 1II4E 5JNYB 4XNMA 5CIPH 2VSCA 1DLFL 2XG4A 1A6TB 5F9WB 2R2CA 5CZXD 3WXVL 4JFFB 2LU3A 1NCAH 4FXKB 4Y2DD 1AR2A 2F58H 1C12A 4Q9RL 3X3FL 3PWJB 1NDMB 4JDTH 5GHWH 1KEGH 2DLGA 2BNUA 1G7HB 3MV9A 4AT6A 3LAFA 4P4RB 3HAEG 2R0KH 4YHOL 5IB1B 4ZQKB 4R3SA 2JCCE 4YC2B 2EEDA 5E9DA 5CD3B 1IARB 2Z8WC 2A9MH 4UIMB 3QI9D 4JFZH 2A6DA 3QDGB 3BH8B 3KJ4C 2AJSL 2VLKA 1QNZL 3GUTB 1FFQA 1Q9WB 2BY2A 1GZPA 1D9KB 1ORSA 3HLAB 2QSCH 1H8NA 4M1DH 2HJKA 3RWDB 3WO4B 2BOBA 1C08A 3WIHA 1KN2L 5BXFB 5T5FH 2C1OB 4YX2H 2DLIA 2IALA 2VAJA 35C8H 4BQCA 1CFVL 2NLJB 5JZ7D 3BPLC 4PG9B 1UH4A 1MQKL 4CMMB 1I7RA 2NY1B 1R5IB 3GI8H 5I8EA 1RZ8A 3H9SD 3ARTA 4AENA 2IH3B 5EA0H 5A2KH 1RULL 3RTQB 2WNGA 3HAEH 1AP2B 3MRRA 3CZFB 1I3VA 4KHTL 1KT2B 2XQBL 3VGBA 4ODSL 3QXUA 2EKSA 2VH5L 3VRJB 3TN0A 4CN4A 3SY0A 3AS3A 1UM6L 3LPGA 4LLUA 5D2NB 2HTKC 4P9HC 2V7HB 3QEQB 5K9JH 3GMQB 4NC2B 5TJWK 3D69B 3NCJH 1FN4A 1RUAL 3RPIA 5GJSL 3S37L 4U0RB 3U2SB 1PKQB 4NKOB 2XYCA 3HZKA 5EPMB 1EX0A 4A2LA 5KVFL 4DW2H 1BMGA 3LEXB 4FQIH 5HHPA 3C60C 3GSQA 2WUBH 1MUJB 3JWDC 2H8PA 1QR4A 2V7NA 4QRPE 5F71A 2B2XL 4HHAB 3T2NH 1JNHB 5CILH 2DLHA 5EU5A 1YNTB 2H45A 1SJEB 3NCEB 5I1EH 3TT3L 4RGNC 3SQBA 1RK0B 5FM5M 4YLQT 4OGXH 3GHEL 5EOQL 3QHZL 1KIPB 3LEYH 4I0CC 4U1NB 2A2QT 2BFVH 1CBVH 1T0PB 3HLAA 3UJJH 5C2BL 3BP5B 3QEUB 2AS5M 3G08A 1TQBB 3CFDA 4GKNB 3P2TA 5FGBC 1S7WB 4HK0B 4CMMA 2R2EB 5ENWA 1W2KT 5F88B 5IR1A 4WUUB 2J8UA 4XNXL 3VG0H 43CAB 5DHXB 3SPVB 3MRPA 1KCSL 4KDVA 3V6ZA 2XY1A 4UZGA 4UOW1 1U8IB 4J4PC 3KPSA 5KS9A 3V8CA 5HPMA 5EU6A 2P5EA 5D1XB 4P49A 3B83A 3QISA 1KIUA 1L9NA 5DJZA 2DIJA 2MQCA 1J9CT 1ZK9A 2AEPH 1FDLL 4PJIB 3BX7C 4PJCE 3ABZA 4U4BA 5CEYA 3QQ3A 3MX0A 5DC9B 4HMEA 1JTTA 3D69A 4JRWA 3Q5OA 4JRYE 4GW5A 3EYOB 5GGRB 1X7QA 3DHMA 2ICWJ 4LSSL 3PV7A 3O2DA 1P6FA 3ARSA 4HIHA 2EE9A 1CFSB 5I66B 1M7DB 1HILB 5GGTL 3REVA 3WS6A 2R29H 1JGDA 3TBYA 5T1LA 1TITA 1RJZA 3D0VB 2BNQA 4IEFB 4KV5F 2XN9D 3VXRA 2EDRA 3JTSB 2QQLH 4MYWB 4D9QD 1MJUL 2AK1H 3RUGA 2NXYD 2YD1A 4JE4B 1FH5L 3BWAA 1KIRB 1FFNA 3QNXA 1S7QA 3QFJB 3MRGB 1BJ1H 2FD6H 3FN3A 3S8WA 1D7FA 3QUKA 2Q87A 5IQ7H 1YY8B 4TULH 3JV5A 5D1QA 5BZWA 4GXUN 5IMKA 4GRWE 1TPXB 3UTTB 3G9AB 4G7VH 2VERN 1CIUA 4JM2B 1L6XA 3G6AB 4J4PA 4IMLA 2CLRA 1IMHC 4BJLA 3MR9B 1DQJB 3K4AA 4NM8H 4ZTOH 1FZJA 5IK3B 4YZFF 3LS4H 5C6WH 2R2EA 4G8GB 1OP5H 3QA3A 1IAOB 2X40A 4U1GB 4QHLB 4YXKL 4X6EB 5I6XB 1KGCD 4GAJH 1OAYL 3V6ZB 3EOTL 2NXZD 1F11A 2XG5A 1D3CA 4Z78A 1CE6A 4NZUH 4MXVE 4H0GA 4ETQA 3HUJA 3L3OA 3IGAB 4Y5XA 3K1KC 4LASL 4MA3B 4HT1H 5DT1H 4WO4A 1TTFA 2EDNA 1OPGL 5EOCL 5I73B 5JOEA 4PJDE 3IT8D 4QRSA 3SJVA 4I2XE 2EYTA 2X4PA 2P5WE 3V6OA 1LEKB 4HUUA 2C4XA 3AC0A 1G0XA 1E4XL 1R5VA 4NQDE 4PRBA 1I4FB 2J6EA 1MJ8L 3WUWB 3D0VA 3EJZC 2P24B 4PRNB 5TDOB 2IQAA 4G6KH 4Y5VB 4YNYA 1X5FA 2BDNH 1OSPH 4PB9H 4X5XB 5MENA 4G8EA 5E6ID 4NO2B 5L6YH 3MCLL 4G6KL 4YX2L 4P4KA 4GO6B 4D9LL 1YEJL 1CXIA 1B4JL 5DLML 5C0CE 2AERT 4PJCA 3L95A 1OD9A 4QCIA 1IGYA 4ONFH 3G04B 4QTHA 1BBDH 3I6GA 4NHCL 5GSRA 3ARFB 3MJ9A 3LQAC 1MHCA 5JPMB 5D72H 1LO0H 5C0FA 3O2DH 2DQHL 3VXRD 2OMNA 3RTQC 4TUJA 5CHNA 3KDMA 3SDAA 4OQTL 1DSFL 4NQXB 5BVJA 4X0KB 1YNKH 1NGZA 2XKUA 4X6BB 1GCFA 4YK4B 1FAKT 3KYMB 3LV3B 1EHNA 3FFCB 5GGQH 4M7LT 5DUPL 5DEGB 3IF1A 1A9EB 5EBLA 2J3SA 1MFBH 1JFQH 2B20A 2WINB 2A6IA 2EZ0C 3L3OB 4IBLT 5IESH 4M6NL 4TNVF 3BAEL 4IDLA 4S0SD 1IC7H 4KWUA 2CGRH 5I1GL 4M4PA 5L7XL 3QG7H 3QIWB 2C4FU 1YMHA 5DZNA 2DYPB 1I1FA 4JCLA 4JQVA 1QRKA 1FNSL 1UACH 5F1NA 3GI9L 1C1EL 4PJ8A 5DS8A 4NZTH 5ESVA 3L3DB 4Z7VF 1MEXL 4N0FA 3CMGA 3UYRL 2ZUXA 1OP5K 4OF0A 3U4AA 1FQ9C 3FFDB 4Y4KD 2ATPB 1CFBA 5L88L 4X4YB 5J4MA 4LSTH 4K8RC 5K9OA 3TJEL 2HFEA 4Z7UE 2PYEA 3BPNC 4U3CA 5FV2A 5E8OA 4Y2DC 4YDLB 1VKXA 1X5KA 3ZHKA 4MZ2A 5I1IH 5FO9A 2FBOJ 1PSKL 5GGTH 1LP9A 2ERJB 3O3BB 2R15A 1R3HA 4DUXA 4G6ML 3KYOA 1J0HA 4R3SB 4GW4A 4XCNA 3ZDZE 4TVPD 2VDPH 1MI5D 2V9TA 2ZSWB 1AR1D 1EO7A 1T1WB 3CH1A 2P45B 4Z7QE 4KHXL 2MFNA 4P46A 4QHNB 3CD4A 3CU7A 4FQJH 2JJTA 4D3CL 5EIIA 4YUEH 4H0HB 4JLRA 3PHOB 1S7XA 1IGJA 2YA0A 3NH7H 5BZDB 3NMEA 3FFCE 3TFKC 1GPOH 1D5ZB 3M17A 2ZSVA 4HGWA 4OFYD 5JIIA 4WV1A 3E6FB 4HXAL 4G8IB 3TIEA 2LV4A 1JWMA 1XIWA 1E4XI 1H5BA 4FHBD 5IB2A 4HEPG 3DV6B 2NPLX 2K3TA 1R5IA 4KK8C 3MV8E 2XKSA 1IQDB 1CGWA 1A22B 3BKCH 4JFEA 4YXLL 4K71C 3UC0H 1JYVA 4W6WB 1AQKH 1E4KC 1UA6H 2YRLA 1FZMA 5E6IB 4YWGL 3DSFH 3BN3B 4PP2B 1BIIB 1EA9C 1OD7A 2N1KA 1LO5A 5AD0A 4R7NA 1WC7B 3LIZL 3VFPA 2PXYB 1NCDH 1EBPA 4O4YL 3NPZB 4CADB 4H26B 3DETC 2D9CA 1IM3A 3BO8A 4BFGA 4TVPE 3I2CL 1MI5E 4YDKH 4QGTA 3SKMB 1IAMA 3SDYL 1NBYA 4KU1A 1TPXC 1WQVT 5M95B 4NQSB 1RZKL 1WBZA 3CFKA 3NA9H 5KW9H 1T7XA 4OB5H 1FGVL 2AV7B 3TNNB 2ARJB 4HWUA 1JF1B 5CP3H 3VJ6A 4MAYC 3C6LB 1UH3A 5L8KB 1YNTA 4J8RB 4M5ZL 5E8NA 3H42H 1G7IB 4KJYA 4P2OC 3OR6B 1VPOH 2DQFB 3K2MC 4KJWC 4U6XB 1RZFH 4XC3L 3UJIL 3SY0B 3VFNB 4N1EA 3OKMA 3WJJA 1LE5A 4JM2F 4HKJB 1Q9LB 5JLZA 4LSQL 2GJ6E 2WWKT 4AEIH 1FZOB 2Y07H 1FN4B 3K46A 2H2SC 1H5BB 1RJYA 1N7MH 5HJ3A 1MAML 1ZGLB 3RBGA 4WUUA 1F8TH 35C8L 3GSUB 4A6YH 1U8JA 4M3JA 1AXSA 2NY4D 4EUPB 3MV8B 3MRBA 4LCUA 4P46D 5AZEH 3ARGA 4QWWD 3TYGL 3HC0A 1K8DB 5FB8B 4WFGD 2ZCKL 1C16A 3MQIA 1BAFH 1EJOL 3EDDA 3LD8B 2VR9A 3TWCL 4KC3B 3S3SA 1CGSL 5EFIB 2NTFB 1TTGA 4RQQA 1KBGH 3GK8H 3HPJA 1QFWL 4HCRL 1WITA 4B7IA 5I66A 3QXVA 5E99L 2LAGB 2CIIB 3VFGL 2PKDA 1RMFH 5D5MB 5ALCL 1N64H 2NY6B 5FGSA 4X7SH 1J18A 3ARDC 1HZHL 5F88A 5IR1B 4UTBH 3VWJB 1OP3H 5C0IA 5B4MC 3SE9H 2GJ6D 1FFNB 3MV01 4MVBD 3IB4A 3T1FB 1L7IH 3GBMH 5E8NB 1EHAA 3HI5H 2FX8H 1FRGL 4QXTA 1X9QA 4U1HA 5I1AA 1C5BH 3ULVD 1I7ZB 2MTPA 3GMRA 1U93B 2Y4SA 4JPVH 1U8MB 5IEKB 2P5EE 4TPRL 3BEWA 4G7YL 1RV6X 2V2WA 3RWCB 4JJ5A 4F58L 3RWEA 4NQVB 2EO9A 2ZG2A 1P4BH 4Z95H 3SO3B 1QHPA 5IVZB 5CEYB 5GJTL 3CX2A 4KI5F 3RL2A 2F53E 1NEUA 1JGLL 3S5LB 2JB5H 5BW7A 4P5TA 2CDFB 2GTZA 4OF6A 5EZJB 2ZNWA 2J8HA 2KZ1B 1T5XB 2VDNL 5E2UL 5HGAA 4D0CB 1P1ZA 4R6UA 1QLRB 4PP1C 4WI8A 5CEZE 1YYML 3O6FB 4NC0B 4RFOL 3HNTH 4OF7A 3DV4B 2HH0L 2DLTA 3MROA 2FNBA 3EW3B 1I75A 2V5SA 2HFFA 3QSKB 4ODXB 3VFMB 4LKCB 2EDHA 2YSSB 5LGHH 3SE4C 1MCEA 4HJGB 1XR8B 3DXAA 1DQJA 4UV7H 1LE9B 5ACZB 3QQ4A 3VA2C 1MCSA 1N6UA 4HUWB 2WAHA 4OLWL 4N8PA 5J6GB 3T1FA 1IAKA 4UT6L 1WISA 5E7FA 1U8QA 1KLGA 2X42A 1OL0A 1K6QL 3RVXD 3AB0B 3BEVA 4F8QA 4J6RL 4OF3A 2Q20A 5MEPB 1SM3L 4XP4H 5D8JH 4HS8H 5DJDA 1OTTD 3PABB 3WLBA 2YEZB 1U2HA 4GRLD 4X83A 3KLSA 4LPWA 1ZLWH 2Y25A 5JR1H 1DVFD 2QKIA 4RIRA 3FAWA 3FAXA 3S5LA 4I2XA 1LEKA 2QQNH 4HPYH 4HFWB 5FM4A 5GIRB 1NGZB 3RDTB 4M7JL 1DBML 4OIIL 3QEQD 1OCWL 3KXFB 1ZVSB 3PWPD 5DJXB 2W9DL 1T5XA 5D7SH 1NC4B 5DJCA 1F6AB 4JREB 1JWUA 4DCQA 2PTVA 3K4DA 1FIGH 3E8UL 3C8KB 4GBXD 4KVCH 4IMKA 5D9SA 4KMTL 1JNNH 1A6VH 3BD3A 3RVVC 1I8KA 4FQHB 1FIEA 1QA9B 5DHVH 3FQUA 5T1KB 4LKCA 2NW3A 2YSSA 3UTPE 4PJAA 4OZIB 5GS0D 1KJ2H 1NCCL 4GQPH 4N9GB 4G80B 1QUNA 1B4RA 1CDHA 2DN7A 3BKCL 3TYFA 1LE9A 3DO7A 4PRIB 4X6FA 2BNRB 4OLEA 1LD9A 4WFFE 2DM4A 2AI0L 5H8DA 5LXGL 1NC2A 5FK9A 4DN4H 2PW1A 4OFPA 2Q76B 3FB7B 2PYEB 1IAKB 1TFHA 3HG1E 3CSYA 1BD2E 2VXUH 1TVBB 2FGWL 3SQOH 1CICA 3QQNA 2AEWA 3R1GL 4XNUL 1OB1A 4XXCA 5CSZB 2NXYC 2I07B 4KI5D 2DQJH 1LEGB 5DJ6B 2XZAL 3DURA 3U6RB 4PRDB 1U58B 3ILQC 4IDJH 4FZ8H 2BSRA 3ROOA 4OGYL 1JK8B 4OBRA 3B9KD 3U36A 4Y8DC 3DX9A 1LO2L 3BISA 2P8PB 1A3QA 1TVHB 4YHLL 2HTLC 3CH1B 4XP1H 4QTIL 2VDLH 4HFWA 5GIRA 2BVQB 2E6QA 4N8VA 5DWUL 4QHNA 4YHML 5E70A 2HKHL 1A1OA 5MEQA 5EUOA 4DAGH 1DJSA 4PV8B 4QOKD 1Q94A 3OKNA 4I13B 5EWIH 2N4IA 3RNQA 3TBVB 5BCAA 1A21A 2EH8L 4HWBH 3HRZA 4NNPL 4U1JA 4WI3A 4DCQB 4DK6A 3ZKXC 3WFHB 1D5XB 4HUVB 3P30L 4ODHH 2AGJH 4WV1B 3X13A 1MH5A 2AJ3A 1JTOA 1KLUB 2ESVA 5D9SB 2B4CC 4F7EA 1PKOA 5KSBE 1WZKA 15C8H 2GIYA 2MCPH 1OTUD 4WFFD 4HMDA 5MP6H 2GITB 3QB7C 2XIDA 3RI5F 4BKLB 1I8IB 1R5WA 3HG1D 1NCWH 2O5ZL 5C6PB 5D7LE 1ORQB 3ZDYF 3LS5L 2OTUB 4PJGE 1MWAH 9CGTA 3A67H 1SVZA 3CLFL 1A5FH 4HS3B 3NABL 5KJRL 3SDXA 1KUMA 5JW5A 3EFFB 1RIHL 4H26A 2BX5A 1CFTA 2VDOH 5ALBH 4GBXA 4NUJA 3HZMB 1JE6A 4JZNA 4ELKB 4R4BB 1H9VA 5DJAB 3FHAA 2PCPA 4L3EE 5JPNB 1HEZB 1HCFX 3ZTJG 3H2WA 2Z8RA 2Q7YB 1WBZB 1EAPA 3O6ML 3OTTA 4XBGA 4WTWA 5HGDB 3K7UA 1INQA 1GGYA 5CCKH 2WWKO 5IVXE 4RWHA 1MAKA 5H37H 3LPFA 1K4DA 1MSPA 5TDNA 3V9FA 3PIQA 5J6HB 1NL0H 1TZGH 4ENED 1CFNA 4PTTB 1VSCA 2H32A 3BDBA 1NC2D 1PYWA 5I1DA 3MLRL 3WNOA 5D7LD 1MFCH 5EUOB 5KN5A 3CSGA 3O4LE 4QNPF 3RWJA 4I48B 1ITBB 4JQIL 3HI1B 1IM3B 3BO8B 5KTEL 2OI9C 1OT1A 3NN8A 1ZHBA 1XH3B 3FQXB 4F7EB 4L29B 1IL1A 1G6RL 2VLMD 1D9KC 5A1AA 1FVCA 4D0DB 4S1SL 4XNYH 1P7HL 3IKCB 5KVDH 3ARED 1YA5A 2AV7A 1CU4L 5I19H 1U8JB 2YD7A 3BKJH 1XGPA 1XF4A 3LHPH 1Q9OA 3VJ6B 1X5HA 3V4VL 1NFDF 4FFZH 5KVMC 1ZHKA 4KKCC 4YDIH 5ADOH 1SEQL 3P9WB 3OZ9L 4HFUL 1F2XK 1KJ3H 3LH2L 5HYSA 3BZEA 4UUJB 2CJUL 3CIQA 5F96L 5CMAA 4YGVB 1NUGA 3SKOA 3DRQA 3CDGA 1LDPL 2J8OA 4ZUVB 3IDJA 4DK3A 4K94H 4AENB 5HGBA 5F7NC 3D39A 2AJVH 1HOCA 3RBSA 3N85H 3TO2B 1F6LL 1KELH 2GSGB 3TNMB 1OAYH 1YQ2A 4LLDA 4LU5L 5IP4A 1LE5B 2W0LA 5A3ID 1E27A 5KANI 2E9WA 3VU2A 2YD4A 1RJYB 2ZKHL 1IE5A 3LVEA 5E5MB 3QIUD 3SDDA 1GXEA 1JPTH 4HIJA 3HC3H 3D85A 4GKSB 4LLVA 4XVSH 2CPCA 5MHSD 1UZ8B 3DJ9A 1WIUA 4JREC 3WN5C 5JW4N 4ODWA 5E5UB 3MYJA 3RY5A 4UDUB 4EN3D 3STZA 4X4XA 3K4ZA 4G6JL 4LHQB 4BZ2H 4YAQA 3O8XA 5LAXA 5JORB 2KBGA 2E6PA 4JRXD 3B6SB 1CCZA 4JKWA 3OV6A 3H3PH 1FSKC 1C5CL 5KZCD 1FH5H 3PGCB 5A2IH 2AJUH 3Q6FA 1QSFD 2CO7B 1AD0B 3P4NA 4LPCA 1ETZB 5GRJL 2UWEA 5JW3H 2YR3A 3I75B 3L3HB 5BVPH 5HHPB 2I27N 3CVHB 3V4UL 2CRIA 4U7KA 4A6YB 4Y2DA 1R3LA 3V52L 2ED8A 4BZ1L 4X6CF 5F9WC 4OGYH 4Y4HA 4M93B 1UGNA 5CUSL 4IDJL 5F72S 1BOYA 5C07D 4LDLB 5HGGS 2Z35A 2VZVA 1WWAX 5ACMA 2A83A 3T0EA 3BD4A 1BX2A 1J8HE 1U0QA 3KPSD 5SWZE 5I18H 4PRHB 4F9LC 5JXEA 5D5MF 2Q6WB 4JO1L 3RTQD 3DXAD 3BP5A 4PLKC 5D96B 3S35L 4MJID 1W8NA 5D1XA 2X09A 3VFUA 3QNZA 1T0MB 4Y19D 3KPRB 2AI0H 1XEDA 3RY6C 3NCCB 2IQ9L 4DN3H 1UKTA 5D7KD 4JFXA 3OKOB 1FZKA 4DGVL 5E2VH 1UM5L 5E08L 4NJAL 4PGBB 5KAQF 1IGMH 3BGFB 4LNVA 3SKNB 1NCCH 2FDBP 4JN1L 1XCTB 5GRVK 1Q72L 1A14H 1RVFL 3ZYJA 1PQZB 4GW1A 4NFDA 2FGZA 3STLB 3QJFA 3BZFB 2BHZA 1EUUA 3STZB 3RZWA 3T3PE 1CDJA 3JWOL 2EEAA 3SGJC 3OJDB 1IC4H 5J13C 4OCXH 3RUGB 2DYPD 4TSAL 3RVTC 4PJ5A 3AAZA 1CDCA 3LOWA 5CILL 4RIRB 3F65A 2JIXB 4OM0L 4Y16C 3CXDL 4EIGB 1BZ9A 1R3KA 3Q6FB 4P0DA 3BW9B 4MNHB 1CN4A 3L5WB 1G7JB 4L4TB 2UY7A 4Y4HC 3D25A 4F57L 1RIUH 5F7HA 4HWNA 3T2OA 3UYPA 3PWLB 3G5VA 4K8RD 5GS1A 1QFWI 3ARQA 1VCAA 4ONGL 3QXWA 2EXWC 5BMFL 3JV6A 4Y4KC 4LSPL 1P4IH 1P69B 2A77L 1DEDA 4GMTH 1YY8A 2ZOLA 2X4SA 3L3GB 3QDJD 5GRUH 3V0WL 5IJKA 5HYSG 2A6JB 2R1WA 4YHPA 4G8GA 2FL5A 4ZQKA 3FQUB 1NFDA 1QG3A 1YEGH 4KJQC 3H9SE 4NPYB 4U6TA 1MIMH 1RZGA 5EO1A 3LQAL 3A6BH 3CGTA 3QUZC 5IVNA 5I76B 3QEGL 2KQNA 1WFOA 2XZZA 4JFXB 4FNLH 3OKOA 3WD5L 5GXBB 2PTUA 1DVFB 5D1ZC 1O7VA 3TJEH 4DJMA 1C08B 1JBJA 2R0ZL 3PQYE 3QO1A 1PQZA 5FKPA 3HAEA 4O2CA 4I18B 3K1DA 4DQOH 5I8EB 5DJYB 4WDIB 3WUWA 4ZTPH 2IWGA 4QRQA 4IRZL 3RWIB 3VWKB 3T2QA 3G5YB 4UQ2A 2I60H 4FFYL 3KWWB 2HRPL 2GTWA 4QRPD 4PJ5B 4KZDL 1A7PL 4YHYC 5ILTH 4HUXA 3SJVB 3EZJB 5CINH 2EYSA 2NW3B 4K9EC 4L5FH 3U0PB 1DN0B 1ZHNA 1Z9LA 3KS0H 4MX7B 1N6QL 5C0AB 5BS0A 3GB7A 5EUKB 3TA3B 4KQ4L 1DLFH 1JGLH 1T2QH 5B39B 4BFIA 1LDPH 2WBJB 5D7IE 4OZGF 3DUUB 3H7BB 1B2WL 4WFED 2X4NA 4R4FL 3MYZA 3CSYB 5E95B 3WMSA 3V4UH 2GITA 1XCQB 3QO0A 3OKKB 5SV3A 3QNYA 4EQ3A 4GXVL 3HE7B 1JNHA 4FFZL 4N1HB 3VI4F 1LK2B 5I8CB 4JPWH 1S8DA 2IAMB 2IGFL 2Q3ZA 1RZGB 4AJ0A 4FXGA 1NCBL 5SWSE 3U6RA 2FBJH 4FQCH 3WKNA 3GSNH 2E7HA 4OCRL 4Y1AB 4EN3C 5I76A 3VFWA 5HTSA 4CDHA 2P8PA 3MRFA 1A3LL 4OCYH 3KNBA 5DGQA 4DTGH 2I24N 4P59L 3EYVA 4G6JH 4GLRH 1U3YA 3CX5K 1DBJH 4JQIH 4DTGL 5IFJA 2HFGH 4E41A 1WBXB 3QDJA 4QF1A 4TUKH 3O81A 3I50H 4ZSOA 3DX7B 3L6FA 5FKPB 1AGDA 2JIXD 3PQYB 4PJXB 3RY4A 1E4XH 3G5ZA 1IT9H 1QYGL 5ILTL 5HHNA 4AM0B 2IBZX 3QPQC 4OV5B 3P4OA 1YJDC 4P2OA 1EV2E 5DYOB 4LCWA 2AXHA 1DLHB 4LMQE 1EEYB 4M43L 4XPTH 3S4SA 1GGIH 2PYED 2NY4C 4D9QE 4F3FA 2RR3A 4P3CL 5EH1A 3DBXB 4XP6H 4P23B 3BDYL 4XP5L 1MHPL 1F3RB 1OARH 1RUMH 4LBEB 4WFHD 3EFDL 1WWBX 1MCLA 3GMPA 5I71C 1TTUA 1U42A 5H94A 2IG2L 4GMSH 3C5SA 3DTXB 1MAMH 4IIQB 1A64A 2KH2B 2OCFD 1F3JB 4AK1A 3FTGB 4NWUL 5E9DD 4N1CA 2AXFA 3EOYG 4JO2H 3W2DL 3FOLA 3AREC 3KLAA 1MCHA 5C2UB 4RMTA 3UO1L 4L8SC 2PCPB 3LRGA 3IRPX 3GSVA 4CW1A 5IOPA 1RFDH 3C2AH 3QNYB 1N3NB 4MVBC 4XC3H 4KKAC 2DMKA 4N0YH 4WTZA 3T77A 5HGDA 1NMBH 1T89C 5LGJB 2VXQH 2NX5B 3TBSA 3LS5H 1KGCE 1G6RA 4FXGB 1G9EA 4KUCD 1IC5L 2D31B 3D3VE 2X89D 1CLZH 3M17B 4M4RA 2X4QB 2F54B 4TQEH 1P7QA 4PRHD 5IMKB 2PYEE 3EYQD 4Y1AE 3PHQA 2YC1B 1YYLH 5MI0B 5KN5B 1JTPA 4ZFOB 5IK3A 1UWGL 4QRRB 2NY2D 5EWIL 3S96B 3OL2A 1FCCA 2P5WD 5DK3A 3VGFA 3D5OF 1OGTA 2GI7A 2BVOB 4QXUH 4I4WB 2W07A 4L29A 5F3HA 2FZ3A 2UWEF 1NDGB 4JFOB 4PV9B 5MERA 3K3QA 1BEYL 2V2XB 1V5JA 4JJHA 3FO9A 5J8OA 3F12B 1X5IA 3DVIA 4OIAA 1UVQB 4GMTL 4E41E 1FCGA 5L9DL 3PDOA 1MCFA 4PP1D 4XVJH 4PUBH 4NJAH 2WWMD 1Q1JL 4HBCL 1NEZB 1VGEL 4I77L 5B8CA 3HZVA 3MA7A 5FM8A 4OZIE 3O8XB 1U8OA 4TRPH 2EYTB 5LAXB 5C0NC 5JORA 1GGTA 4K8RL 5FYKD 5CMAB 4YGVA 1B90A 1T83C 3LQZB 3KYNB 4RGND 5DRXB 2ITCA 1GPOL 4OLYL 2VABB 2KZWA 3OB8A 4UTAL 4ZFGH 5IHZA 5LWYH 3L3KB 4NQED 3MRLB 3TNMA 1G0YR 1UWXK 3JSSA 2J8UF 4H25A 4G42B 2AK4B 4S1DC 1V7ML 2Y6SD 4NUGL 4PS4H 4GLRI 3VFNA 2QJDA 2HJKB 5GRZA 2WW8A 1LO4H 4A6YA 2X4TB 1SY6H 3O45B 4Y2DB 4YDLC 1AHWB 4P2QB 4UINL 1NKOA 3AY4A 4XC1L 3NTCL 3D18A 1U95B 1QOKA 4F80A 5TE6L 3CDYA 3P0VL 2OK0L 1RZ8B 2F54E 4PJHB 4NBYB 3RVXC 2LVCA 1AGBB 2XPGA 2IJ0C 3K80A 2DQIH 4GSDL 1INDH 5CJQL 3B6SA 3LD8C 4RRPA 4UT7H 3UBXG 1DP0A 1IQWL 2GFBA 3QNZB 5TF1L 1KB9J 1QBML 4ZOBA 1FNAA 3O3EB 5F3HB 4C4KO 2NXZC 4R8WH 1GHFH 3S4SG 2JJUA 4RGNE 3GIZL 1OAZH 1W0YT 4JY6A 3DUSA 2W0KA 4RZCB 1YEEL 3BWUC 3GFUA 3MNZA 1UVQA 1EEZB 4KK5D 4OCLC 3SE8L 3HPJB 3QUYA 3VXPA 4X7FC 2V17H 3GMOB 1UKQA 2DTMH 4WHCA 3MBXH 4AIZB 3K2UL 3RIFK 5GS0C 4Y5XC 4JDZA 5F7UA 4MJ6B 2GJ6A 5GGVY 1FLRH 2VL5A 4OLWH 2DQDL 2LFGA 4PGJA 5FYKL 3WJLA 4NWUH 2IAMC 1J8HA 5HHOE 2VABA 3CFIC 1RK0A 1FVDA 4JG1H 2F54D 4OCMC 4MHHI 4EN3B 3RU8L 5E8DH 4L3EB 5DEZA 1JN6A 1RY7B 5DD3H 1ERNA 4PY8I 5F93C 1XF2B 2YPKA 2ADGB 4XP5H 5GGUA 1RHHA 1S7UA 5F9DC 2E7BA 2VLRB 4CVZA 2IBZY 3QPQD 4MWFB 1KTLB 4QXTB 1OW0C 3VFRB 1S7WA 3PL6A 2WK2A 5CJ8A 1TCMA 3U0TB 5ANMA 1IILE 2W65A 3HRPA 1R0AH 5J11B 4HKXB 4M7JH 3QZWB 3FKUS 1NGQL 1G9NL 4LLMA 1T1WA 2CRMA 3S9DB 5C9KA 4L3AA 2IADA 3X3FH 4JM2D 1Z3GL 2UZIL 1K9TA 2AJVL 4WWKC 5F8QC 5T33L 1HXMA 3WL9B 4BM7A 3G9VA 3O4LA 1N8ZB 1QO3A 1V8HA 1DL7L 1BQLL 2F19L 1RZ7L 3L5JA 5DMIL 1BQHA 1CDIA 4OD1L 1CF8L 2JCCA 4U6HB 2DQTH 4NO5A 4R2GB 3LRHA 1HILA 3GJFK 4XXDB 2DM2A 2HP4A 2FX9L 3AREB 2OZ4H 4XZUB 3LN4A 1CF8H 2YXFA 3CXHJ 5IHUL 2A6JA 3Q1SL 4JHWL 1MNUH 2PTTA 2HN7A 3WIHL 3HMWL 3CAFA 5FUCC 5I8OH 1FL5A 1NGXA 1FNEB 5DA0B 2UZIH 3VG9B 1DN0A 3MZTA 1H15B 3I9GL 1NJ9B 5KTEH 1M7IB 1S7VA 1ZMYA 4UU9A 1TNNA 5F21B 4M8QA 3JV4B 3MSPA 1WBYB 5HHMD 3EDJA 2ESVD 4PTUB 4EVNB 2PR4L 4ZG1A 4MXWL 3RDTC 4NQEB 4IMLB 5F7EH 4ZS6D 1Q9KB 5F7EL 1C12B 1NDMA 3O6KH 4X6DF 4U7MA 4E42B 5L2JA 3LQMA 3TN0D 2NCMA 5SV4A 5IB1A 1U8PA 1I1AC 3GEWB 2E7CA 2VJXA 1KCUH 4I18A 3JTTB 1IAOA 4KKLC 1NCWL 3BVNB 5LQBL 4X5LA 3RKDD 3IVKB 3LPWA 4DZ8A 1BM3L 4KPHL 4R26L 2NY5C 4H88L 4ONHA 3BQUB 1A7OL 5DR5H 5IW6B 3HCVA 5DHVB 5EZOL 3ARVA 4R90L 3QDGA 1XGYL 1MNUL 2UV3A 3ZZ1A 2Q8BL 5TDPB 2NY5H 2VLJD 3WL9A 4LRNL 1EEQA 5B3JE 4KJWD 1BZQK 3FCTA 3EOAB 2GYSA 1QO3B 5DMYA 2IALB 4AH2B 3NIFF 4Q6IA 1ZLVH 1MELA 4KH2A 4BH8A 4LGPB 3GSXA 1DFBH 1MHEA 1G7MA 4ZXBC 4BQ6A 5DD0L 3BRFA 2Z93A 4NN7B 4PJEE 3I02B 5FHBL 2ENSA 4GRMA 1G7QA 2V2TA 2FH8A 4RSVA 3VFGH 1PY4A 2NXYB 2QQKH 5JW4M 4KVNH 3MLUH 1IBGH 3RUGE 5AYUL 2IPUG 4PJ7E 3DRTB 4LLYB 4XPAL 2IAMA 5BMFH 3CFCH 3ZT7A 3S34H 3FO2A 3V5HA 3MXWL 5EULV 1ZA6A 3HC4L 2P42B 2D2OA 4YHZL 1HI6A 3H9HA 3SGKA 1FFOA 4XPGL 5CWSA 5D71L 5EIVA 3PGFH 1KJMA 3FOLB 5GRYA 1KFAL 4R0LA 1AR1C 5IQ9A 1ZVYA 1WGOA 4U7SA 1CICB 3PNWA 2F53D 4ZOEA 1KJVA 3DMMD 4G3YH 4BSVA 3UBXB 4RFEA 3CK0L 5HYQA 4WV1C 5C0CB 3PJSA 4DZ8B 3DSFL 4MJ5A 4PS4L 4XPHL 5DURD 1Q94B 3OKNB 5HY9B 1AQKL 2W9LA 2WINA 4LGSB 2D31A 4GAFB 5E94A 5I1EL 1GJIA 4KUZL 1MY7A 5CEZD 2ICWB 5L2KD 3ULUC 2WBKA 4FQIL 1IM9A 3LB6C 2DYPA 1R5WB 1RPQA 3F7PC 3WN5A 4D8PA 5HYJA 32C2A 4G8FA 3NH7L 1KB5H 2WLZA 1FNHA 1YEEH 2CKBA 3LKSB 3FTGA 1T5WB 3SCMD 1OGTB 2GTZB 3GIZH 5E8PB 4M48H 4X9IA 1GHFL 4PYGA 2GT9B 1N5AB 3X3GH 2Q1EA 4U0RC 4OAWB 1AH1A 1NGWA 3U0WH 4RGOH 3GM8A 4OZFB 3O6LL 4GBXB 4J6RH 4BFBD 1T7WA 1CDUA 2DLFH 4PB0L 1UEMA 4QLRA 4XPGH 1GIGL 2DB8A 5H2BB 4C56D 4G8GE 2R0WH 2ZZUT 3OJMB 3UZEA 4XCYA 3K0WA 1HI6B 1IJ9A 3I3DA 1ZS8B 2QR0B 3VXMA 1A6AB 1FL6B 3HI6H 5B38A 3MGAA 5DRXA 3PIQB 5EBMA 4R0LB 2JE8A 3MOAH 3GSRB 5M7QA 2A6KA 3R8QA 1CLOL 3QQ4B 2Y5TA 4M61B 2XWBA 5BW7C 3V6FA 4G42A 1UM5H 5E08H 4IRSD 5HY9A 4U1IA 1U6AH 2X4OB 4LEOA 1KNOB 5D2NA 2X4TA 5E94B 1K6QH 4OFKA 1QPPA 4OD2A 5FF6B 1LQSR 2Z4QB 4MXWH 3E6FA 4Z7UF 1CFNB 2E27H 3T2PA 1IL1B 4YO0A 3UO1H 5K9QG 1BFVL 3TIDA 5E2UH 5HI5C 3U2SA 4JO2L 1K2DA 4PUBL 5DVKA 2Q8BH 3BIKA 1MUJA 1Q9OB 1V7NL 3C08L 3DGGB 3P77B 4WHDA 3FRPA 1T83A 2QSTA 4U6VL 5DR5L 4AQ1B 4C56E 1DTUA 1K3IA 3L7FB 3VXNB 1BM3H 1MHPH 2NY7L 4MAUL 4MHHG 4OQTH 1FC1A 4P3CH 1T4KB 4PJFB 4P57B 4CNIB 2D4FA 1N0LA 4M62L 1D5BB 1LO0L 3BJ91 4IM8A 1YEFH 3NFPB 3BRGC 1KENL 1U8NB 4XTRC 1DQMH 4O9HH 3LHPL 4LMQI 2HT3D 4HK3J 3S35X 3LMJH 4Z7UB 4L8SA 1YYMH 3U1SL 1FNGB 2XZCL 4JPIB 3S37X 4K7PY 5DLMH 4PJIE 4FFVC 4P3WA 4PGCB 4TUKL 3HE6C 2JLLA 3TGXA 1AY1L 4UDTA 2D7OA 2FJFA 3EAKA 3TZVC 1AD9A 4MNGB 3GSRA 3MFGB 4WW2C 2HT2C 4HCRH 3N06B 1RURH 1FVDB 4X6FB 5EUOF 2IANE 4DFHA 2RHEA 4EXKA 3C9NA 2X05A 4DKFH 4BYHA 3GMNA 3RGVD 4DKEH 4J3SA 5FF6A 4JY6B 3TLRA 4AEFA 1LDSA 3ULVL 4LNRB 3VXSB 4P2OD 3NACH 3PL6B 2ADIB 5DUPH 3QUYB 3CDCA 4U6VH 1D6VL 3WCYA 2W65B 1XGQB 3D48R 3DX9B 2AV1B 2WP3T 3O6MH 4UMGA 4NN7C 3RQ3A 2B0SH 4ZFFA 4XMLH 4JFEE 2Y72A 5SWZB 5ISZA 2R1XA 4RMSA 3GRWA 4DKEL 4LPXA 5TQ2H 3UPCA 1W72A 5HXMA 3OQ3B 2HYMA 1OWRM 4F33A 3HE6A 2EDFA 4TOYH 1RU9H 2FEEL 2FRGP 4WHYH 2DKSA 3ZE0F 1EFQA 3MFFA 4Y5VC 4L3ED 1KCRH 3S98A 3MBEB 4ZAKD 2R9HC 2OYPA 1B6UA 4ZUTA 4Q9QL 2DQUH 2Z31A 4YGAB 1FZJB 4TULL 5E8DL 1QLFB 3M1BB 4JRYA 3U79A 1MFDH 5DSCB 3BI9X 2P5WB 4HDIB 3MLRH 2PYFA 3QZWA 1MJUH 2AK1L 2UYLB 5DA4A 5I1JL 4U1HB 4FFVD 4CRPA 2DQDH 4NRYB 4BSWA 4MSWA 4N0CC 3TT1L 4Z78B 5T1LD 5F9JA 1VACA 4WEBH 3BKMH 4POZC 3OXRB 3D39E 2V5TA 3IGAA 3AVEA 1T0MA 3MRKB 1J1OL 3L9RA 4LKXB 1PZUB 3ZYZA 2DMCA 1F4XL 4ZD3L 5JA9A 1I1CA 4NNYA 5IF0B 4YK4C 1B2WH 1OQXA 2W38A 1IGTB 4OV6F 4AEHL 1N8ZA 2OP4L 1IRAY 4X8JA 5E5RB 4C83A 1BZ9B 1R3KB 2Y6SC 4WENB 4HMCA 3ILQD 3C09C 4PJ9C 1R5VB 3LN4B 3C60D 4WGVB 3G5VB 5A2FA 2HVKA 3FJTA 1T89A 1QP1A 1Z2KA 5E8EB 3P11H 5IW3A 2OBGA 2EYRB 3ZL4L 4KTEH 4JLRB 1JF6A 3VMOA 1ED3B 1OAXL 3GKZA 1NBZB 3WIFB 3TEUA 3EO0B 4KUCF 3I2CH 4YDKL 5EU7C 1EK3A 4KXZH 3DARA 1ACYH 3ULUE 1XGRA 2BSTA 1OVZA 3FQXA 4OD3H 2J5LC 4X5WA 2CDGB 2R4RL 15C8L 5HHXL 2R0LH 4CL7A 2OSLA 4MA1C 5C1MB 2ICES 4PJEA 3G6JF 4S1QH 3Q5TA 4TUJB 5CHNB 3CVHL 1XF1A 3QULB 3L3GA 2DQIL 1GGBH 4XGZA 3UTZB 3LRSA 1QFUL 4F7PA 4X6BA 4JZJC 3VXUA 4MS8D 1BF2A 2N7AA 4K9EH 1R3JB 4DUVA 1QFUH 1WJ3A 3HMXL 4PJGA 5D7SL 4XP1L 3FO2B 3P11L 2EDWA 3C8DA 4H1LB 2CLVA 4JFDB 4JO1H 1QVOB 5HVGB 3MLZL 1WWCA 5L88H 2GQHA 1MLBA 4POZD 5HI5D 3I6LE 1G1CA 1A0QH 3WV0A 4P48A 2OR9H 4P4KD 1QSEA 4XWOD 4XNUH 4HK0A 2VH5H 5KSVB 3VGDA 1S7TB 5A3IC 5TF0A 4RFEB 1ZA3B 4R97B 3ZL4H 5C0CA 4OI8A 4PLNC 1WWWX 5CS7A 1QACA 1HQ4A 3A6OA 5DMJB 3VD3A 5L7XH 2CGRL 3OAZK 3TBTA 3KWWA 3ALXA 5E4EB 1HHKB 1VGEH 3HE7C 4JKPH 4WO4C 5EU6B 3U9PL 2AJZB 4XVJL 3HPLA 1MQKH 2VZOA 5T5NG 1NBZA 3MREB 3EO0A 3QQ9C 1U92B 3UEZA 4AIXA 2NR6C 1U3HD 4HIIB 3MMEB 2PXYC 5GGQL 5CJOH 5IHBA 4WU7A 1ZA6B 1A7OH 4M1DL 1YNKL 2DWDB 4G8FB 3B4NA 4Q2ZA 2CIKA 4WJ5B 4HWEL 1J8HD 2H6PB 5D70H 4X5WB 3IDMB 5GS2H 4HIHB 1ACYL 3X14B 4JM4L 3R06A 1QQDB 3KHOA 5HDBE 3SDDC 5TE4L 4LOUC 1CXFA 4CJ1A 4Y19E 3LRSB 1A1MA 2HT2D 4OLXH 2WUCH 4BSVB 3RWFB 2ITDA 4P46B 1R3LB 3D9AH 5HHVL 1IEHA 4Z5RA 2R0KL 4YHOH 1HINL 2PN5A 1IKNA 1BLNA 4L9DA 1IBGL 2X4RA 1QLEL 5DDHB 5KVGL 3QT2A 4DOHB 4YFLF 4XMLL 2BOCB 2I9LB 1CVSC 4P2OB 5DYOA 1CR9H 4LCIL 3T65A 3FL7A 3GSWB 1B0GA 5IM7B 4HS8L 4XT1C 2E3VA 2XXCB 3INUH 2VN4A 1DBAL 2FBJL 1R3IH 2ERJC 1VFAB 1B3JA 1UADC 4Z7WE 3VXUE 2NX5D 2HG5A 4LBEA 1IGIL 5DFVD 5JIKA 3TT1H 4OUUA 2YKLH 3VH8A 2Y5EA 4X6EA 2R39A 1FVEA 5I1JH 4B5EA 3Q3GA 2F5BH 3X11A 4KXZI 3EYFB 5AUMA 3ESUF 3S4SB 4YHIB 4IOFC 1G6RH 4X7TA 4L8DA 1OARL 1U92A 4HBQA 2ZUSA 1RMFL 5C09E 5EU6E 2E7LA 5E03A 1K2DB 4QRPA 1AY1H 2G2RA 2OS7A 4MD5B 4QRUB 4P4RA 2L7UA 4XCYB 2HH0H 4XPFH 4YHYB 1S3KL 1L6ZA 4LHJB 3GSNL 4KRMB 3NIDF 4RFOH 3QXAB 3BGFC 4F7MB 1OP3K 1WZMA 2B7DT 4CW1B 1OLZA 4U1LA 3NPSB 1MY5A 4P57A 5GZOC 3ALWA 4PFEA 5GSVB 4CVWA 3RHWF 4KGJA 3HZMA 4DQOL 4F15C 3M07A 2FJHA 4YE4L 1Q9WA 3PWNB 2F8VA 2X4SB 4FFWD 2E7LC 1FAIL 3RU8H 3ULUL 1T3FA 4CU7A 3TCLB 5K59F 2OM5A 1Q9LA 4OCRH 4Y16B 5T1KD 4HFUH 3BPOB 2Y23A 4PLJC 5KAQG 3QIUC 5KSBF 4ZUUA 3DXAB 5H37G 2MNUA 4GXVH 5FOBA 2RJMA 3PP3H 5D93B 3RWGA 3DGGA 4NCC2 4PRPD 5CAYB 3D2UD 3TH4T 4LFHD 3GSNB 5GS0L 3QR2A 4HWZA 5JZ7C 1IVLA 4EDWL 3MOQA 1KIQA 2MQ3A 1UWEL 4L4JA 3CC5A 2B1AH 4ORGA 5FGBA 4LDEB 4L8DB 4WFEE 3MLZH 5JQHC 1MRFH 3U7YH 2AGJL 1I1RA 2YS4A 5FCSH 3IKCA 3F7YA 3VDCA 4OB5L 1N59B 4NNPH 4GRLB 1I1FB 4KKCD 4FQXD 4KZDH 1KPUB 1IGCL 3MV7D 3HZVB 1XGPB 2ATKB 1MCIA 1DVFC 4YHMH 5DWUH 4MX7A 3CFBA 3KYNA 5ICYB 4WWKD 2EC9U 4MNGA 3PV6B 1QEWB 1TXKA 4QWWC 5D70L 4HWEH 5I75C 1BVLB 2GK2A 5J12B 5IG7A 2NZ9C 4FZ8L 4RFNB 2AK4A 4QKXB 4R96A 4Z77B 1GC1C 3VWKC 1KTKE 2C3VA 3S36L 3TT3H 1QA9A 4QRRE 5E2VL 2FIRT 3D18B 2Z31B 4PRAA 3O3EA 2IQ9H 5EOCJ 3MRIB 5LXGH 3GIVB 1KSRA 5E5MA 3CLFH 3EDEA 4KZEL 2JKXA 2Z8SA 2BXYA 4L8BA 4LPYA 5AG9A 5FOBB 3ZSTA 3SKJH 4NDMB 4BSWB 1JUFB 3O6FD 3QIBC 4FG6C 5HPMB 4TSAH 4RAVB 2R1XB 2P5EB 5FO7A 3OXRA 1MWAA 4PJ7A 4FS0A 1MFAH 3MRCB 5DMGD 2VITA 1X5YA 1B0WA 1H3PL 3CC5B 4K3DH 4I3GA 1C5DA 4OZFH 3CZJA 3VXQA 3OB0K 1INDL 1YEIH 2XWJA 4HX1A 3UROR 3MOBL 5JXEC 1U58A 3REWA 1H3WM 4BUHA 4PJCF 4FQQA 1VFOA 1XT5A 3EHBD 3TM6A 4NNXA 1KPUA 3RNKB 1O7SA 1ACZA 4F7TB 3DBXA 2ZCLL 1UWGH 2VZ3A 4NKMA 4OCXL 5I8KL 3F62A 2ADGA 5GGUB 5GPRA 4Z7WB 3D0LA 1I85C 3UAJD 5CGMA 4R7DA 3S34L 2OTWB 5J6GA 5GRWA 3PWJA 4HS6B 3TPUA 4KVNL 2F5AH 2OJEA 2CUHA 4RX4A 5F89A 3N1FC 2DQJL 5C0EB 1YEDB 2WLYA 3P0YL 2NYYC 1CLZL 2H32H 5B38G 4G43A 3PGFL 1Y0LB 3RHWK 4OJFH 2X2YA 4Z77A 1TDQA 4HC1L 3TF7C 3CFJB 3UTTA 3PABA 2IBBA 4MQSB 4ZNCD 4IHOA 1LEIB 3MJ7A 4ORZC 3CVIH 3KPRA 3QG7L 4GKOA 3VFRA 4AT6B 5EC2B 1G9ML 4XVUD 3MRIA 3CFCL 2OTUA 6CGTA 2DJSA 4LCYB 4LCCA 5FUZH 1KXQE 1AKJA 4JHAL 4HH8A 4RDQF 4XMPL 3MCKA 4BSJA 1KJ2L 2J8UE 1A4KB 3B5HA 4WI7A 2VDML 3RIAK 3OR6A 5EZOH 4XBPA 4UNVA 4L4TE 2H3NA 2YC1A 4PGZA 4JFYB 1MAJA 3T04D 3OMZA 1VHPA 4MA3A 4WUKL 4ZD3H 4DZBA 3U9UB 2X9WA 5C08B 3VG9C 4FQXB 3GMMB 1J1OH 4EI6A 3MRRB 3VXSE 4XBGB 2HN7B 5FYKE 4N90D 5C0JA 5ID0A 1G1YA 1NBVH 1SYVA 4DKFL 1H3VA 3HC4H 4J7RA 5BS0D 1G7JA 1IT9L 1QYGH 1SYSA 1I7RB 3W0WA 4G9DB 1JJUA 1NDGA 1OCWH 4N9GA 3GMQA 2Q86B 5J6HA 5KVDL 3LSOA 3OWEA 3EOBB 4LSTL 4HPYL 1JI1A 1HQ4B 1I8MA 4PRIE 3MV8A 3IKKA 4LU5H 3MNVA 3MLVL 2BNQE 8FABB 4JAMA 1ZXQA 1KT2A 1MCCA 4K2UH 4F15B 5FA4B 2O5XH 1QPXA 1PG7W 3RVVD 1OY3B 5K59E 1R3JA 4FTVB 2ZOLB 4CDGC 5D7IF 2VXQL 4M1CC 5DD0H 3VXOA 1MFCL 2CJUH 3QDMD 3K74B 1DBKL 2ITCB 1E6OL 1FJ1A 4M8QB 4NQCB 1WFNA 2IGFH 2EE6A 3ARPA 1FVCB 1D5MA 4LOUD 3MLWL 1JI2A 1Z0MA 4M62H 3N1GC 1KIPA 2GJZB 4K7FB 1J7VR 1WEJH 4E42A 5EB9A 2NY6D 2O26U 3BE1H 5CFHA 2IG2H 4GMSL 4M1GH 3K8KA 4MA7L 4MCYA 3WFDH 3JTTA 4NGHH 1Q38A 3KXFE 3O45A 1FAIH 4JRXA 4CU6A 1JZ5A 3LV3A 4H5SA 2ZUTA 2HT4D 2M8XA 4D0BA 4HUNB 3BQUA 3O8XC 5IHUH 3BDYH 3HCVB 4M5YH 4GAJL 4MB4A 1I7ZA 1X5XA 3AY4C 4OZGB 2DOCA 1X5GA 4W70A 3J8F7 3SOBL 1S7SA 4HUVA 3X13B 5IHLB 4LGRB 4PRID 2DQTL 3LS4L 4N68A 4UV4L 5CP3A 3C6SA 1Z5LB 3EOAA 3BKJL 4JKKA 5DQ9B 5IKCA 2A74A 4XPFL 4PGDB 2E8YA 1U6AL 3QEHB 2AQ1A 1SYVB 4JHBA 2BJMH 5T33H 2CKBL 4JM4H 5HVFB 3UTQA 3G5XA 1FG9C 2EO1A 4AL8H 4BZYA 1CGVA 1P4LA 3VWKD 1N2RA 4LVNB 3EZ8A 3N1PC 3MRQB 1EPFA 3WIHH 1T20B 4M1GL 3P30H 4ODHL 4NSKB 2DJ4A 4BELD 4FTVA 1HEZA 4YR6A 3ARGD 1DQML 1EGJA 4ELME 1X5JA 1RIHH 4UAOB 3WIIH 2G2RB 2Z31C 1LHZA 5I15H 1C5BL 5GGRA 1WFUA 4Q9BA 2VDLL 1LP9F 1NMCB 3HB3C 5DHYB 5JHDA 1FFOB 4Y1AA 4NQCE 1ETZA 1WK0A 2EH7L 4M1CD 1LO2H 2VZTA 2GCYB 4UTBL 2AXJA 3V5KA 4PJIF 5C08D 2OR9L 2UZYB 3VFSA 4G9FE 1W0WB 3ARBA 1OTSD 3EYQC 1JMZA 3QUZA 4AIOA 4N5EC 1P4IL 2VLRA 4U6YB 5I1DB 4UBDD 1JZ6A 2FJHB 2YRZA 4HIEA 2BMKA 2DM3A 32C2B 1HINH 4GAYB 1JYNA 3JWNC 4ONGH 3CU1A 5TF1H 3DYPA 5JDSB 1EJ6A 2E27L 1FNLA 2ADJB 3RWHA 4GBXC 4MJ4A 2ZSVB 3BEVB 4HGWB 3ARDA 4XNXH 3VG0L 3OJ2C 4ENEC 4CU8A 4Z7VA 1HK6A 4NZJA 2ZCKH 4Y16A 4K07A 5D1QD 4JGMA 5J89A 5EN2B 5FDWA 4WHTB 2LTQB 3O3AA 1JZ3A 5D7JA 3OG6B 4S1QL 4JFHD 3WFZA 2OTPA 4ODBD 4PLKD 2VWEC 1QRNE 1L0XA 1ITCA 1FSKB 1BIIA 3LIZH 4JANB 3T4YA 2R0ZH 1HHIA 3KXFA 3C2SA 4YBLC 4DVRH 4OAWA 3PWVB 4GSDH 2F15A 4NQCD 2O93L 1F5WA 3JWOC 4GH7B 5LCVH 5HHME 5AWNL 3IJYA 3B2UC 5IBUG 3SKOB 4G9FD 2FYYB 5L8JB 4QHUB 2OL3L 1CFQA 3LN5A 2D7MA 3F7RA 3MUY1 2OK0H 1IAIM 4UIKH 2R8SL 2CXKA 2MHAB 4X6DB 1I85A 1DUYA 3BXNA 2ZUYA 2XWBB 1CVRA 5D7LA 5FYLD 1E27B 3QAZB 4QRSB 3U0WL 3OR7A 1PG7X 3F6IA 3MRJB 1QFHA 4WCYH 5DI8B 5CBEA 4FQJL 1MHHB 2A77H 4LQ1A 3R8BB 1CD0A 5K9JL 1E4KA 5FHBH 4HG4K 5DJ0B 4ZFGL 5AYQA 3JV6B 4AEHH 1YN7A 2AK4D 2XFXB 4JDVB 3OJVC 2VLLB 2BMKB 4GAYA 1F4AA 1QRND 1VB9A 4YAQB 5D7JC 1JHLL 2EZ0D 1W0VB 4TRPL 2R1WB 4QRTA 4WU5B 4JRYD 4OFYA 1OGAD 3IDUA 4OTXH 1KCVL 3TN0C 3IDXH 1N6VA 1RZJH 5EO1B 3PGDB 3HNVL 3H9SB 5EOQH 2XN9E 5J13B 1SQ2N 2ATKA 4Z7UA 1QD0A 1WTLA 4LCUB 1DZBA 3FCTB 1KCRL 5FO7B 4QXGL 1ES0B 5E4IA 4DVBA 4WRLA 1JHTB 3EYSH 5FYJU 4Y4FA 4Y4HB 1A9EA 3H3KA 5EBLB 4F7CA 4PJFA 4HXAH 1G0DA 1LP9E 5ESVB 3BYTA 5C0RH 4PD4K 2HVJB 4EUPH 3LQZA 5BOZG 4OIIH 4V1DE 5T1MA 2SEBA 4NC1E 4IOIB 1YY9D 3FMGL 3PXHA 3L3KA 5EG6C 2B1AL 4D3CH 2R4SL 4OZ4B 4IOFD 1A6UL 1Z0NA 3IYLW 1UWEH 1VADB 4NKMB 1MCNA 3MRJA 3RVWC 3AGVA 1NLDL 3U0PA 4Z7NF 4NGHL 1BWWA 3HMWH 1SHMA 2UVFA 3V5HB 3DNKA 2G60L 2FJFB 3KYKH 4C4KT 3R0NA 4CVXB 4N0YL 5SX5K 4RGMC 3L5XH 1FGNL 4LSUL 4M03A 5D5ME 4JFDD 1U93A 2ICWI 3OKEA 4G9FA 4WEBL 5DZLA 2VR4A 3RUGF 2X4NB 1TZHB 4JJ5B 5IB5B 1F58H 2F19H 2A73A 1RJLA 4EUPG 5IVZA 3H3PL 3KPRE 4X6CE 5HYQB 4KTDH 4S11A 3PJSB 1JPFA 3NFNA 4MCZA 4UOW0 4YFLI 1DBJL 4TQEL 1ADQA 2BHYA 3T4AA 4NQDD 4PJBA 2V6HA 3CXHK 4XP6L 5D96C 4V1DD 5EZJA 3RX7A 3MRFB 4ZUWB 1P5UA 4H1LG 1A3LH 4WTXA 5GS0H 1JWMB 1XIWB 4MXVF 1P84K 3O6KL 1NMBL 5IB2B 3U1SH 1ZKAA 1HH6A 1IM9B 1XF3A 2H3NB 3ROLA 4HEME 2GUOB 3C2AL 4HLJA 4O9HL 2PR4H 2HAZA 2NTSP 1IGJB 2C9AA 3HFML 1KACB 3TYGH 5IEHA 1QLFA 3M1BA 3W9EA 4S2SB 5EOCH 2VUYA 1OAUL 1K8IB 3I9GH 1JFQL 2SEBB 2H26B 5HI4C 4PREA 3U48A 4HGMA 2K7QA 5CCKL 3M45A 4WW1B 5DD6A 3T8XA 3ZDYE 4MQ7B 1V7NH 3C08H 4X6DE 4E5XB 1XR8A 3FO0L 2LU4A 5IWLA 3NACL 1WIOA 5E99H 1KJ2A 5FHAH 4HWBA 4JAMB 4PJ9B 4FXKA 2P5WA 4Y5YC 4PJFE 2DQCH 5KOMC 3S7GA 3O3DA 4Y4FD 1I8LC 1BBDL 3E1F1 1L0QA 3MUJA 4ZNEE 3IETB 1I1AD 4P2QE 3ARRA 1A5FL 1DBAH 2FX8L 1S3KH 4KK9C 3TH3T 1NSNH 3FO1A 1YEJH 3WDJA 3H0TA 4N0UE 1KCLA 2E9JA 3BOVA 5K9KA 2VOTA 4YPGA 1GZQA 3CDFA 4CKVX 4W4OA 4YEFA 4J4PD 4I9WE 1FC2D 3L3JB 3T77B 2OQJA 1OSPL 2F5AL 3OGOE 4Z18A 2NQCA 3GUTA 3BZ4A 4OQ1A 4F8TA 1U91A 2W60B 1IQWH 3CSPA 2DS4A 3EO1A 4HW6A 3D9AL 1CGSH 1F13A 1LGVA 5E7BA 5CJQH 5HHVH 5E2WL 1A7PH 5A43C 1PW3A 1NCBH 4FZEL 2ZCLH 1I9RH 4NRXB 3TA3A 4K3EH 2I60L 2NZIA 4G6FB 1A7NH 5J56B 1NGYA 1F97A 1IGIH 1JWUB 1NL0L 1YEFL 4BFIB 3LQAH 4XZUA 1TVDA 1A4JA 3LDBC 4PJEB 3QUYC 3MGOA 1I1YB 3MRBB 4I3RL 4FQHA 3VXOB 2IPKA 4FMFA 1BGXL 1QKZL 4H20H 3P0GB 3QWRA 2ZUQB 5EDXA 1WF5A 5H35B 5T3XE 4GG6B 2KDGA 4CNIA 1K5NB 3SE3C 1VEPA 5J06A 2A6DB 2V2XA 4ONOA 4WEUD 2BVEA 2VAAA 1P4LB 4X9FA 1GZPB 4RQQB 3MTRA 1MLBB 3K2UH 4HXBL 1EMTL 4NM8L 4ZTOL 3B2UD 4DN4L 2V5MA 4JY5L 5JIHA 4R97C 2V5YA 4NT6B 2XTJE 3SDYH 3O3DB 3C5ZC 5B8CB 4KUZH 4QF1B 3FFCD 3QWOA 5EIQA 3QXDB 3FRPG 5I1CH 3WO4C 1XIWD 4XPHH 4GG6E 5K9KB 3VXME 1OF2B 4LLWB 2IPTH 4E0RA 1EDQA 3CCHA 4JFED 5C9JB 3GHEH 2EE2A 1FG2B 1H3UA 1U3HC 1KTDA 3C9NB 3E3QE 3BIBX 4EBQL 5GZOD 1QSEB 3NGBC 4J1UA 3KLHC 3RWCA 1CD8A 4U49A 2R69L 4FN0A 3QEUA 1CZ8H 4HH9A 5HYJD 2HMIC 5GGSA 4MQXC 4P2QA 3FQTA 1BZ7A 1SBSH 3SGDH 5CGYC 4NRZB 2W9DH 1Z9MA 4UINH 4ZYKB 5IMOB 1MRFL 4PJXF 3U7YL 2AV1A 3LN9A 3WHXA 5IIEA 2R0LL 1KULA 1FLTX 4JQVC 1JRHI 4R4ND 3WSQL 2CR3A 4X4MA 5I1CL 3V7AG 3KPQA 1H0DB 1B9ZA 3D2UA 3P9MA 4XNQB 4JFFE 3R0MA 4KKNA 1YJDH 4GT7A 1OLLA 2VDQH 2O61B 4X98B 4GW5B 1WZ1L 3VXMD 3FT4A 5EA0L 4RGNB 2EECA 3MO1B 4KI1A 1M7DA 3W2DH 3MBEA 4U05A 5DTFB 4NKDB 2AJUL 5CJBA 2HKFH 2KL6A 1FP5A 1C5CH 3VI3E 5T3ZD 2HG5B 1KN2H 5FGCE 5I0DA 2OP4H 4BZ1H 5HHXH 3BWAB 3EFDH 1N5YL 4HDIA 2W0FB 3MRGA 4G6FD 4EI5B 3MRPB 1T2JA 1U8QB 1OAQH 2HA1A 3GSWA 5F6IC 4JZJB 1BWMA 3V5DA 4I1NB 3VE0B 1OSZB 1E28A 4PRPB 3VGAC 4K3EL 5DJ0A 3F12A 4X7TB 1XIWC 4ZFOL 3SHSA 5CD5D 1GOFA 3MBEC 3G6AA 3F7VA 3TO4B 4JFFD 4K23L 4LFHG 1RI8A 4Z7OF 5IESL 1KLGB 4PJAE 4ZDHB 4I2XB 3MACH 3QO1B 2F58L 1RK1B 2NY2C 3VGGA 1IC5H 1WAAE 4KROC 2JB5L 1UM6H 5FYJL 4UT9L 1VEOA 3WLBB 1F6AA 4MMXC 5BV7L 1QR1B 4Y5XB 3UTTE 1WT5A 4PJ8C 4MD5A 3QUKB 1RULH 3VXTB 4P2RE 3QIUB 1ES0A 1DANU 3UAJC 4H8WC 4JN2B 4RMQA 1RZ7H 5DMIH 3JWDH 3GBML 2LU7A 5B39A 1RUKL 2K9UA 5GGSY 1CR9L 1NPUA 4LCIH 4XPBH 1UXWA 2MQ0A 2DQUL 3MUGA 3I6LD 4AL8L 4KQ4H 3IFNL 1Z3GH 3ARZA 2MCG1 2BSED 3RVWD 1DE4B 2AJSH 4LLDB 4WTZG 1J0YA 3SO5A 4WU5A 4P9HH 1CGYA 4KDTC 2APBA 1SEQH 3VXUB 2L0DA 1F11B 1RU9L 4ETQB 1OB1B 4N0CD 3HUJB 3OF6D 1IGYB 4JFDA 3DUSB 2AXGB 5ABDE 4PRIA 4D9LH 4PRDA 1RIVL 2ZCHL 3T0DA 2MWCA 5DRWA 4MA1B 4BA8A 5EZIH 4POYA 2B1HL 2EDOA 3OHXB 4X4XB 2BDNL 4N5UA 2YHGA 4K94L 4P2RD 1H3GA 1U8PB 2E9IA 3BUYB 3IFOA 4MA7H 3WFDL 3IXAB 4JG1L 3OAZH 5CSZA 1WLHA 1P4BL 2ZUQC 4FNLL 4Z95L 4XWOC 3EBAA 4OV5A 4GKZA 4IOIA 2COQA 4KKLD 1EH9A 4WVRA 1YC7A 3MLWH 5GRVL 5ADOL 4UQ3B 4TUOB