2BDXA

X-ray crystal structure of dihydromicrocystin-la bound to protein phosphatase-1
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
293
structure length
293
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Protein Phosphatase-1 Bound to Motuporin and Dihydromicrocystin-LA: Elucidation of the Mechanism of Enzyme Inhibition by Cyanobacterial Toxins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine/threonine protein phosphatase PP1-gamma catalytic sub
total genus 101
structure length 293
sequence length 293
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2005-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2bdxA00
1XZWA 1NNWA 2WDEA 3H64A 3C5WC 3HVQA 3QG5C 4IYPC 2Q8UA 1MF8A 3LL8A 2IE3C 4KBPA 1JK7A 3IB8A 4YKEA 4TUGA 4H2IA 5INBA 2NYMC 2IAEC 1S3LA 4DHLA 2HYPA 3T1IA 3E7BA 2Z72A 4V0XA 2USHA 3GVEA 1S95A 1QHWA 5IOHA 3H61A 4LTYA 3E7AA 4Q7FA 4ZX2A 1W24A 1S70A 2ZBMA 1SU1A 3P71C 2IE4C 1M63A 5EQVA 5HPEA 2NPPC 3ZU0A 3K7WC 2QJCA 2A22A 5B8IA 4XPNA 4ORAA 4LU9A 3H66A 3FGAC 4JA9A 2BDXA 4JA7A 1HP1A 4UT2A 4O43A 1FJMA 1U32A 3QFNA 1KBPA 4ORCA 2HY1A 5JPFA 3N5UA 4O4KA 1WARA 5J28A 4V0WA 3RL3A 3IVDA 3THNA 2WDCA 1S8EA 4H1YP 5F3WA 1T71A 4LACC 4B2OA 2CV9A 3TGHA 1S3NA 3JYFA 1QFCA 2QFRA 3QFMA 2WDDA 3IB7A 2HYOA 4HD0A 1IT6A 4G9JA 3RL5A 5JJTA 4I5LC 2Z06A 3EGHA 4MOYA 2AHDA 3ZTVA 1T70A 2QFPA 3KBPA 2O8AA 3H67A 4O24A 4DT2A 4UT3A 3PSOA 4H2FA 4H1SA 2P6BA 3ICFA 3QFKA 3QFOA 2GJUA 5DNYA 4UWQA 4FBQA 3H63A 2XMOA 2WDFA 1XM7A 4M0VA 1USHA 4ZVZA 2NXFA 4O5GA 1HO5A 4OR9A 1Z2XA 3RL4A 3AV0A 4TUIA 4DSYA 2BQ8X 1AUIA 3CK2A 1II7A 1HPUA 4F0ZA 2DFJA 2BCDA 3IVEA 1Z2WA 3THOB 4FBKA 1UF3A 3PSNA 4FCXA 5GTUA 2NYLC 2KKNA 3AUZA 3K7VC 4V0VA 3C9FA 2R17A 3H69A 1S3MA 3H62B 4UT3B 2O8GA 4MOVA 4WWLA 1UTEA 3DSDA 1WAO1 5JPEA 1OIDA 3DW8C 1V73A 4NZVA 4ORBA 5C1VA 3RQZA 3DSCA 4MP0A 3V4YA 4H2GA 1OI8A 3H68A 4IL1A 3H60A 4J6OA 1OIEA 4KKZA 4FBWA 3EGGA 4H2BA 4I5NC 1TCOA 2YVTA 1G5BA 2JOGA 2Z1AA
chains in the Genus database with same CATH superfamily
1XZWA 1NNWA 2WDEA 3H64A 3C5WC 3HVQA 3QG5C 4IYPC 2Q8UA 1MF8A 3LL8A 2IE3C 4KBPA 1JK7A 3IB8A 4YKEA 4TUGA 4H2IA 5INBA 2NYMC 2IAEC 1S3LA 4DHLA 2HYPA 3T1IA 3E7BA 2Z72A 4V0XA 2USHA 3GVEA 1S95A 1QHWA 3D03A 5IOHA 3H61A 4LTYA 3E7AA 4Q7FA 4ZX2A 1W24A 1S70A 2ZBMA 1SU1A 3P71C 2IE4C 1M63A 5EQVA 5HPEA 2NPPC 3ZU0A 3K7WC 2QJCA 2A22A 5B8IA 4XPNA 4ORAA 4LU9A 3H66A 3FGAC 4JA9A 2BDXA 2DXLA 4JA7A 1HP1A 4UT2A 4O43A 1FJMA 1U32A 3QFNA 1KBPA 4ORCA 2HY1A 5JPFA 3N5UA 4O4KA 1WARA 5J28A 4V0WA 3RL3A 3IVDA 3THNA 2WDCA 1S8EA 4H1YP 5F3WA 1T71A 4LACC 4B2OA 2CV9A 3TGHA 1S3NA 3JYFA 1QFCA 2QFRA 3QFMA 2WDDA 3IB7A 2HYOA 4HD0A 1IT6A 4G9JA 3RL5A 5JJTA 4I5LC 2Z06A 3EGHA 4MOYA 2AHDA 3ZTVA 1T70A 2QFPA 3KBPA 2O8AA 3H67A 4O24A 4DT2A 4UT3A 3PSOA 4H2FA 4H1SA 2P6BA 3FLOA 3ICFA 3QFKA 3QFOA 2GJUA 5DNYA 4UWQA 4FBQA 3H63A 2XMOA 2WDFA 1XM7A 4M0VA 1USHA 4ZVZA 2NXFA 4O5GA 1HO5A 4OR9A 1Z2XA 3RL4A 3AV0A 4TUIA 4DSYA 2BQ8X 1AUIA 3CK2A 1II7A 1HPUA 4F0ZA 2DFJA 2BCDA 3IVEA 1Z2WA 3THOB 4FBKA 1UF3A 3E0JA 3PSNA 2DXNA 4FCXA 2NYLC 2KKNA 3AUZA 3K7VC 4V0VA 5GTUA 3C9FA 2R17A 3H69A 1S3MA 3H62B 4UT3B 2O8GA 4MOVA 4WWLA 1UTEA 3DSDA 1WAO1 5JPEA 1OIDA 3DW8C 1V73A 4NZVA 4ORBA 5C1VA 3RQZA 3DSCA 4MP0A 2ZO9B 3V4YA 4H2GA 1OI8A 3H68A 4IL1A 3H60A 4J6OA 1OIEA 4KKZA 4FBWA 3EGGA 2YEQA 4H2BA 1TCOA 2YVTA 2ZOAA 4I5NC 1G5BA 2JOGA 2Z1AA
chains in the Genus database with same CATH topology
1XZWA 1NNWA 2WDEA 3H64A 3C5WC 3HVQA 3QG5C 4IYPC 2Q8UA 1MF8A 3LL8A 2IE3C 4KBPA 1JK7A 3IB8A 4YKEA 4TUGA 4H2IA 5INBA 2NYMC 2IAEC 1S3LA 4DHLA 2HYPA 3T1IA 3E7BA 2Z72A 4V0XA 2USHA 3GVEA 1S95A 1QHWA 3D03A 5IOHA 3H61A 4LTYA 3E7AA 4Q7FA 4ZX2A 1W24A 1S70A 2ZBMA 1SU1A 3P71C 2IE4C 1M63A 5EQVA 5HPEA 2NPPC 3ZU0A 3K7WC 2QJCA 2A22A 5B8IA 4XPNA 4ORAA 4LU9A 3H66A 3FGAC 4JA9A 2BDXA 2DXLA 4JA7A 1HP1A 4UT2A 4O43A 1FJMA 1U32A 3QFNA 1KBPA 4ORCA 2HY1A 5JPFA 3N5UA 4O4KA 1WARA 5J28A 4V0WA 3RL3A 3IVDA 3THNA 2WDCA 1S8EA 4H1YP 5F3WA 1T71A 4LACC 4B2OA 2CV9A 3TGHA 1S3NA 3JYFA 1QFCA 2QFRA 3QFMA 2WDDA 3IB7A 2HYOA 4HD0A 1IT6A 4G9JA 3RL5A 5JJTA 4I5LC 2Z06A 3EGHA 4MOYA 2AHDA 3ZTVA 1T70A 2QFPA 3KBPA 2O8AA 3H67A 4O24A 4DT2A 4UT3A 3PSOA 4H2FA 4H1SA 2P6BA 3FLOA 3ICFA 3QFKA 3QFOA 2GJUA 5DNYA 4UWQA 4FBQA 3H63A 2XMOA 2WDFA 1XM7A 4M0VA 1USHA 4ZVZA 2NXFA 4O5GA 1HO5A 4OR9A 1Z2XA 3RL4A 3AV0A 4TUIA 4DSYA 2BQ8X 1AUIA 3CK2A 1II7A 1HPUA 4F0ZA 2DFJA 2BCDA 3IVEA 1Z2WA 3THOB 4FBKA 1UF3A 3E0JA 3PSNA 2DXNA 4FCXA 2NYLC 2KKNA 3AUZA 3K7VC 4V0VA 5GTUA 3C9FA 2R17A 3H69A 1S3MA 3H62B 4UT3B 2O8GA 4MOVA 4WWLA 1UTEA 3DSDA 1WAO1 5JPEA 1OIDA 3DW8C 1V73A 4NZVA 4ORBA 5C1VA 3RQZA 3DSCA 4MP0A 2ZO9B 3V4YA 4H2GA 1OI8A 3H68A 4IL1A 3H60A 4J6OA 1OIEA 4KKZA 4FBWA 3EGGA 2YEQA 4H2BA 1TCOA 2YVTA 2ZOAA 4I5NC 1G5BA 2JOGA 2Z1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XZW A;  1NNW A;  2WDE A;  3H64 A;  3C5W C;  3HVQ A;  3QG5 C;  4IYP C;  2Q8U A;  1MF8 A;  3LL8 A;  2IE3 C;  4KBP A;  1JK7 A;  3IB8 A;  4YKE A;  4TUG A;  4H2I A;  5INB A;  2NYM C;  2IAE C;  1S3L A;  4DHL A;  2HYP A;  3T1I A;  3E7B A;  2Z72 A;  4V0X A;  2USH A;  3GVE A;  1S95 A;  1QHW A;  5IOH A;  3H61 A;  4LTY A;  3E7A A;  4Q7F A;  4ZX2 A;  1W24 A;  1S70 A;  2ZBM A;  1SU1 A;  3P71 C;  2IE4 C;  1M63 A;  5EQV A;  5HPE A;  2NPP C;  3ZU0 A;  3K7W C;  2QJC A;  2A22 A;  5B8I A;  4XPN A;  4ORA A;  4LU9 A;  3H66 A;  3FGA C;  4JA9 A;  2BDX A;  4JA7 A;  1HP1 A;  4UT2 A;  4O43 A;  1FJM A;  1U32 A;  3QFN A;  1KBP A;  4ORC A;  2HY1 A;  5JPF A;  3N5U A;  4O4K A;  1WAR A;  5J28 A;  4V0W A;  3RL3 A;  3IVD A;  3THN A;  2WDC A;  1S8E A;  4H1Y P;  5F3W A;  1T71 A;  4LAC C;  4B2O A;  2CV9 A;  3TGH A;  1S3N A;  3JYF A;  1QFC A;  2QFR A;  3QFM A;  2WDD A;  3IB7 A;  2HYO A;  4HD0 A;  1IT6 A;  4G9J A;  3RL5 A;  5JJT A;  4I5L C;  2Z06 A;  3EGH A;  4MOY A;  2AHD A;  3ZTV A;  1T70 A;  2QFP A;  3KBP A;  2O8A A;  3H67 A;  4O24 A;  4DT2 A;  4UT3 A;  3PSO A;  4H2F A;  4H1S A;  2P6B A;  3ICF A;  3QFK A;  3QFO A;  2GJU A;  5DNY A;  4UWQ A;  4FBQ A;  3H63 A;  2XMO A;  2WDF A;  1XM7 A;  4M0V A;  1USH A;  4ZVZ A;  2NXF A;  4O5G A;  1HO5 A;  4OR9 A;  1Z2X A;  3RL4 A;  3AV0 A;  4TUI A;  4DSY A;  2BQ8 X;  1AUI A;  3CK2 A;  1II7 A;  1HPU A;  4F0Z A;  2DFJ A;  2BCD A;  3IVE A;  1Z2W A;  3THO B;  4FBK A;  1UF3 A;  3PSN A;  4FCX A;  5GTU A;  2NYL C;  2KKN A;  3AUZ A;  3K7V C;  4V0V A;  3C9F A;  2R17 A;  3H69 A;  1S3M A;  3H62 B;  4UT3 B;  2O8G A;  4MOV A;  4WWL A;  1UTE A;  3DSD A;  1WAO 1;  5JPE A;  1OID A;  3DW8 C;  1V73 A;  4NZV A;  4ORB A;  5C1V A;  3RQZ A;  3DSC A;  4MP0 A;  3V4Y A;  4H2G A;  1OI8 A;  3H68 A;  4IL1 A;  3H60 A;  4J6O A;  1OIE A;  4KKZ A;  4FBW A;  3EGG A;  4H2B A;  4I5N C;  1TCO A;  2YVT A;  1G5B A;  2JOG A;  2Z1A A; 
#chains in the Genus database with same CATH topology
 1XZW A;  1NNW A;  2WDE A;  3H64 A;  3C5W C;  3HVQ A;  3QG5 C;  4IYP C;  2Q8U A;  1MF8 A;  3LL8 A;  2IE3 C;  4KBP A;  1JK7 A;  3IB8 A;  4YKE A;  4TUG A;  4H2I A;  5INB A;  2NYM C;  2IAE C;  1S3L A;  4DHL A;  2HYP A;  3T1I A;  3E7B A;  2Z72 A;  4V0X A;  2USH A;  3GVE A;  1S95 A;  1QHW A;  3D03 A;  5IOH A;  3H61 A;  4LTY A;  3E7A A;  4Q7F A;  4ZX2 A;  1W24 A;  1S70 A;  2ZBM A;  1SU1 A;  3P71 C;  2IE4 C;  1M63 A;  5EQV A;  5HPE A;  2NPP C;  3ZU0 A;  3K7W C;  2QJC A;  2A22 A;  5B8I A;  4XPN A;  4ORA A;  4LU9 A;  3H66 A;  3FGA C;  4JA9 A;  2BDX A;  2DXL A;  4JA7 A;  1HP1 A;  4UT2 A;  4O43 A;  1FJM A;  1U32 A;  3QFN A;  1KBP A;  4ORC A;  2HY1 A;  5JPF A;  3N5U A;  4O4K A;  1WAR A;  5J28 A;  4V0W A;  3RL3 A;  3IVD A;  3THN A;  2WDC A;  1S8E A;  4H1Y P;  5F3W A;  1T71 A;  4LAC C;  4B2O A;  2CV9 A;  3TGH A;  1S3N A;  3JYF A;  1QFC A;  2QFR A;  3QFM A;  2WDD A;  3IB7 A;  2HYO A;  4HD0 A;  1IT6 A;  4G9J A;  3RL5 A;  5JJT A;  4I5L C;  2Z06 A;  3EGH A;  4MOY A;  2AHD A;  3ZTV A;  1T70 A;  2QFP A;  3KBP A;  2O8A A;  3H67 A;  4O24 A;  4DT2 A;  4UT3 A;  3PSO A;  4H2F A;  4H1S A;  2P6B A;  3FLO A;  3ICF A;  3QFK A;  3QFO A;  2GJU A;  5DNY A;  4UWQ A;  4FBQ A;  3H63 A;  2XMO A;  2WDF A;  1XM7 A;  4M0V A;  1USH A;  4ZVZ A;  2NXF A;  4O5G A;  1HO5 A;  4OR9 A;  1Z2X A;  3RL4 A;  3AV0 A;  4TUI A;  4DSY A;  2BQ8 X;  1AUI A;  3CK2 A;  1II7 A;  1HPU A;  4F0Z A;  2DFJ A;  2BCD A;  3IVE A;  1Z2W A;  3THO B;  4FBK A;  1UF3 A;  3E0J A;  3PSN A;  2DXN A;  4FCX A;  2NYL C;  2KKN A;  3AUZ A;  3K7V C;  4V0V A;  5GTU A;  3C9F A;  2R17 A;  3H69 A;  1S3M A;  3H62 B;  4UT3 B;  2O8G A;  4MOV A;  4WWL A;  1UTE A;  3DSD A;  1WAO 1;  5JPE A;  1OID A;  3DW8 C;  1V73 A;  4NZV A;  4ORB A;  5C1V A;  3RQZ A;  3DSC A;  4MP0 A;  2ZO9 B;  3V4Y A;  4H2G A;  1OI8 A;  3H68 A;  4IL1 A;  3H60 A;  4J6O A;  1OIE A;  4KKZ A;  4FBW A;  3EGG A;  2YEQ A;  4H2B A;  1TCO A;  2YVT A;  2ZOA A;  4I5N C;  1G5B A;  2JOG A;  2Z1A A; 
#chains in the Genus database with same CATH homology
 1XZW A;  1NNW A;  2WDE A;  3H64 A;  3C5W C;  3HVQ A;  3QG5 C;  4IYP C;  2Q8U A;  1MF8 A;  3LL8 A;  2IE3 C;  4KBP A;  1JK7 A;  3IB8 A;  4YKE A;  4TUG A;  4H2I A;  5INB A;  2NYM C;  2IAE C;  1S3L A;  4DHL A;  2HYP A;  3T1I A;  3E7B A;  2Z72 A;  4V0X A;  2USH A;  3GVE A;  1S95 A;  1QHW A;  3D03 A;  5IOH A;  3H61 A;  4LTY A;  3E7A A;  4Q7F A;  4ZX2 A;  1W24 A;  1S70 A;  2ZBM A;  1SU1 A;  3P71 C;  2IE4 C;  1M63 A;  5EQV A;  5HPE A;  2NPP C;  3ZU0 A;  3K7W C;  2QJC A;  2A22 A;  5B8I A;  4XPN A;  4ORA A;  4LU9 A;  3H66 A;  3FGA C;  4JA9 A;  2BDX A;  2DXL A;  4JA7 A;  1HP1 A;  4UT2 A;  4O43 A;  1FJM A;  1U32 A;  3QFN A;  1KBP A;  4ORC A;  2HY1 A;  5JPF A;  3N5U A;  4O4K A;  1WAR A;  5J28 A;  4V0W A;  3RL3 A;  3IVD A;  3THN A;  2WDC A;  1S8E A;  4H1Y P;  5F3W A;  1T71 A;  4LAC C;  4B2O A;  2CV9 A;  3TGH A;  1S3N A;  3JYF A;  1QFC A;  2QFR A;  3QFM A;  2WDD A;  3IB7 A;  2HYO A;  4HD0 A;  1IT6 A;  4G9J A;  3RL5 A;  5JJT A;  4I5L C;  2Z06 A;  3EGH A;  4MOY A;  2AHD A;  3ZTV A;  1T70 A;  2QFP A;  3KBP A;  2O8A A;  3H67 A;  4O24 A;  4DT2 A;  4UT3 A;  3PSO A;  4H2F A;  4H1S A;  2P6B A;  3FLO A;  3ICF A;  3QFK A;  3QFO A;  2GJU A;  5DNY A;  4UWQ A;  4FBQ A;  3H63 A;  2XMO A;  2WDF A;  1XM7 A;  4M0V A;  1USH A;  4ZVZ A;  2NXF A;  4O5G A;  1HO5 A;  4OR9 A;  1Z2X A;  3RL4 A;  3AV0 A;  4TUI A;  4DSY A;  2BQ8 X;  1AUI A;  3CK2 A;  1II7 A;  1HPU A;  4F0Z A;  2DFJ A;  2BCD A;  3IVE A;  1Z2W A;  3THO B;  4FBK A;  1UF3 A;  3E0J A;  3PSN A;  2DXN A;  4FCX A;  2NYL C;  2KKN A;  3AUZ A;  3K7V C;  4V0V A;  5GTU A;  3C9F A;  2R17 A;  3H69 A;  1S3M A;  3H62 B;  4UT3 B;  2O8G A;  4MOV A;  4WWL A;  1UTE A;  3DSD A;  1WAO 1;  5JPE A;  1OID A;  3DW8 C;  1V73 A;  4NZV A;  4ORB A;  5C1V A;  3RQZ A;  3DSC A;  4MP0 A;  2ZO9 B;  3V4Y A;  4H2G A;  1OI8 A;  3H68 A;  4IL1 A;  3H60 A;  4J6O A;  1OIE A;  4KKZ A;  4FBW A;  3EGG A;  2YEQ A;  4H2B A;  1TCO A;  2YVT A;  2ZOA A;  4I5N C;  1G5B A;  2JOG A;  2Z1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...