2BE9B

Crystal structure of the ctp-liganded (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
148
Chain Sequence
b'MVSKIKNGTVIDHIPAGRAFAVLNVLGIKEGFRIALVINVDSKKMGKKDIVKIEDKEISDTEANLITLIAPTATINIVREYEVVKKTKLEVPKVVKGILKCPNPYCITSNDVEAIPTFKTLTEKPLKMRCEYCETIIDENEIMSQILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate carbamoyltransferase
publication title Crystal structure of Sulfolobus acidocaldarius aspartate carbamoyltransferase in complex with its allosteric activator CTP.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase
total genus 32
structure length 148
sequence length 150
ec nomenclature
pdb deposition date 2005-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
B PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 2be9B02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 2be9B01
3MPUB 2QG9B 4KGXB 6AT1B 4FYVB 1R0BG 3AT1B 4KH1B 1TUGB 4FYWB 8ATCB 2ATCB 1RACB 1RAIB 3D7SB 1RAHB 2FZGB 1SKUB 1R0CB 1TTHB 5AT1B 2H3EB 1NBEB 2A0FB 1EZZB 1XJWB 1F1BB 1PG5B 2BE7D 1TU0B 2FZCB 1RAGB 2YWWA 4F04B 4KH0B 1RADB 1ZA1B 8AT1B 9ATCB 4AT1B 4AMCA 7AT1B 2HSEB 1RAEB 1D09B 1ACMB 2QGFB 1I5OB 2BE9B 4E2FB 1ZA2B 4WTOB 2AT1B 2FZKB 1RAAB 1RABB 2AIRB 1RAFB 2IPOB 1AT1B 4FYXB 4KGVB 1Q95G 4FYYB 4KGZB
chains in the Genus database with same CATH superfamily
2E41A 1RT7B 2WSEE 2OD6A 1CVJA 1ZQ1A 2VH7A 3JTOA 4A8YA 2GF7A 2HBYB 3SV4A 4J37A 5JJBA 3IRXA 4UTGA 2FYKA 2X3DA 4Z8AA 4C8QA 1Y7XA 3M2VB 3G8QA 4L73A 3RUXA 3JSRA 4I7FA 1WXBA 3OTEA 3UF4A 3D0IE 2EKYA 4IRCA 1NK7A 1ARKA 3RRGA 4RUBA 5IT9Y 2LJ3A 3DNCA 1N6AA 3IR5B 1EKSA 4K4TA 4J8OA 2H8HA 2JFKA 4FZVA 2BE7D 3RBEA 1SL0A 3JCMX 1E6GA 2QMXA 4Y6IA 4ED3A 1AZSB 4OZNA 2XNQA 2J9CA 2W01A 4KHMA 2E7WA 1WWHA 4K2XA 2SRCA 2NYSA 2R58A 3FEYB 1QM9A 2EGCA 3DI6B 1VYVA 2RHYA 1PILA 2G0JA 3U1MA 4EMKC 3Q83A 2CP2A 4HXJA 3U02A 1SQGA 2OIHA 2HHWA 2MKHA 1FNOA 3BKFA 3EDQB 2QJ3A 3RGIA 3C4SA 1WLPB 1NDKA 3GFZA 4X64F 5A0YB 3I5BA 2CZ6B 3B4MA 4A53A 1WKKA 4L3NA 3MM8A 2BJ9A 3JAMY 1LW0A 3AY0A 1ZBTA 3OTBA 3M0RA 3DLKB 5IXUA 1Y00A 3O1LA 3OL6A 1JJCB 2RQVA 5FU7C 1VQKA 4CO2A 5HQ8A 4RTVA 2GQQA 1D0ZA 5F8HA 2JX2A 1RCXB 2FLOA 2LXFA 2RDJA 3V6DB 3L7UA 2UZAA 2JEJA 1F9HA 1RT2B 2J0XA 2VBZA 4B3RJ 4N4IA 2KM8C 2XK0A 1HQEB 3KG0A 3AXMA 4JI0F 1FXDA 2YKMB 1UHFA 1UCNA 3QYGB 1IWAA 3KLHB 5U47A 4CO4A 2R2SA 2F1FA 4C98A 4HHHA 2PVDB 4RW7B 5GAGI 4ZPWR 3SCIE 4I2QA 4PRFA 4HKEA 1TL7A 5D8HB 3BSAA 4FIBA 4PXCA 4CH7A 2DVJA 2VC1A 1RWMB 2QFIA 3MCNA 4KQZA 2DEQA 1ZM4A 4ELZC 4NS5A 4F4AA 4DBFA 2BACA 3URGA 2V1RA 2AYMA 2YNFA 2KFYA 2CSIA 1OMSA 4MZMA 4J90A 3W5ZA 5GAN2 3VS2A 2CQGA 3N6NA 4ZP7A 1ULRA 1D3BA 1JXVA 3D0GE 3MECA 4D8DA 5HMYA 2KRSA 2HURA 3BN7A 4FSSA 1RT7A 2YSQA 3ZZTA 3Q2TC 2EAYA 1RBAA 4M5LA 3IAM9 4NX9A 3CEDA 2A37A 3GF5A 2IC3B 4PG4A 2B51A 3M2VA 4J9VA 5B0EA 2PEHA 1H74A 3E3XA 1M5SA 2WHOA 4O5VA 3P8DA 2H9ZA 1N56A 4USHA 1YNZA 1N32J 1K0SA 4IFVA 4TNOA 1OWXA 1BB9A 1DJ7B 2KI7A 3WX8A 3U1LA 1YITQ 2C3UA 2HL3A 2V5HG 4JI6J 1JLGB 2OGUA 2LQJA 1AZSA 5FIIA 3WXMB 3ZZYA 3Q86A 4NCAA 2QE5A 1VLYA 1B07A 1AFJA 1SUQB 3TJ8A 3I96A 4JPBW 5K8NA 4ZP9A 3DI6A 1RI9A 2DBBA 5IM0B 3IBWA 1PGZA 1P6TA 2DHAA 1TMMA 2B86A 4XO0A 3MJXA 4HR2A 1SSFA 2XZDB 1Q79A 4FDFA 2FZKB 2E9ZA 4OI1A 4GKKJ 3MR5A 1T3SA 5A0YA 3MAQA 3NAIA 3BO4A 3RU0A 4C8NA 2QC3A 4A4KA 2RS2A 1JK9B 3B4DA 3BDLA 4USIA 3PYFA 4EUVA 1KQFB 1Q8BA 1UWBA 1IQZA 1ZSZC 1G7CB 5B0FA 1S1TB 3EVOA 2HFZA 5KG0A 3DLKA 2MZQA 1HYSA 3OY9A 4JI5J 2P84A 1YJ7A 3MAHA 3DGPB 4DR2J 1SV5B 1KFDA 2GQIA 4NEZA 2Y1IA 2MQ8A 1ITPA 2Q79A 2RMLA 5BYRA 1DTQB 1QY7A 3HZEA 1GFCA 1VQ9T 4C8OA 3V6DA 2AMCB 1WA7A 2HHUA 4A48A 1RT2A 2MI6A 1KTQA 5LSRA 1JLBB 2X4XA 1HQEA 1VQYA 1D9AA 3THTA 2YKMA 4M77G 1QTNB 2JC0A 3KLHA 1KQ1A 4P2FA 2WTFA 1NJIT 2BJ3A 2Q3PA 2PI4A 3Q24A 3I56S 1H8KA 4NLSA 2VFUA 4RW7A 1V1CA 1NO8A 1N8RT 3OS2A 2D7SA 3D66A 1V5IB 2PUKB 2F8MA 1S9FA 3D67A 4U7CA 4BWMA 1Q16B 1UVKA 4C8QF 1YK9A 1PG5B 1X8DA 4A63B 2RHZA 5C7PA 2FY8A 2HVZA 1S97A 3DRSA 1RTHB 5M2UA 1SSHA 2O3DA 1YJ9S 2DD4A 1ZM3A 3R1LA 5CCAA 2B4OA 3PW5A 1IM6A 3PZPA 2KSSA 1K73C 3S6WA 5C5JA 1Q5VA 5KFTA 1K73R 3VAHA 2VC0A 2AGPA 2IM0A 5B0BA 2HRYA 3CT9A 3BQ1A 4Q0BB 3GJRB 1JIHA 2WAQD 4ZLJA 4VUBA 3FVYA 4OMQA 4OV1A 4IR9A 3PGGA 5A76A 1ZAVA 2VQFJ 4EI2A 1RAIB 1W2BR 2IC3A 3KBGA 1UEVA 2AK5A 4DPUA 2QT7A 1UJ6A 5F0WA 3QFHA 3GJQB 4OFZA 1GXIE 2B9YA 3I6PA 2OPRB 3TX8A 2YT6A 1GTEA 2CIMA 3I9QA 1T9VA 1F5AA 3CCJT 1CSJA 1YP5A 4DBRA 2Q6BA 3M0TA 2B9EA 3CIZA 1JLGA 2FJXA 4ZA1A 2VVKA 3T6JA 2EW3A 1XERA 3FGVA 2CQ0A 2YPZA 3JSBA 1CLFA 3CC2A 1AOJA 2GV1A 2KGTA 3QGPA 5IM0A 1N32F 1YIJA 4X4NA 4KIAA 1VQ5T 2NS1B 3PKYA 4QVDA 3IA0A 3AA9A 1D0EA 4FNIA 3A8EA 3EDRB 4JI6F 5G4DA 3OYAA 5IXBA 1VHFA 2Q66A 2OTLQ 5E7OB 1NH7A 1LW2B 3CNQP 1C6VX 4F02A 2H1YA 4MK8A 3UDCA 2BW2A 3HRUA 1S1TA 2HGLA 2HQDA 3M6WA 4NRUA 2EQUA 5L9NA 4RTUA 3DGPA 2W4DA 2VC8A 1F60B 1CQMA 4DXLA 1WJSA 4F2RA 4IQXA 1SV5A 5IAYA 1SC3B 1N9RA 1BE4A 3PRBA 4GKKF 3EH1A 4YS2A 3HMJG 4TLRA 1REGX 4OGEA 4ZGDB 1G2BA 1DTQA 2C2EA 2V0NA 1PYTA 1NBEB 1NEBA 3A8MB 1KLMA 1CS4B 3AODA 5AXNA 1FI4A 2EK6A 1JLBA 4JI5F 1T0TV 3WVDB 4DR2F 2HNIA 4Y3CA 3UW1A 1UVLA 4WZQA 2L3SA 3BE3A 5GANe 2DIVA 3CXCR 4J9KA 4MIAA 1CJKB 1UW4A 2LQBA 5I42A 2DR7A 4LUDA 3TJAA 3DB4A 2VG6B 1NDLA 3BYRA 2C2MB 4FYYB 2M0YA 2CWKA 3HHNB 1B3TA 4FVCA 2EBGA 4JOUA 4PJNA 4C0BA 2PZ1A 1URRA 1S1NA 1FRMA 1XOVA 1FD8A 5CKDA 3BBBA 4HHJA 3P8HA 3GYGA 4B9LA 3GYNA 4PLIA 1TK8A 1XNRJ 1MSWD 2JUFA 2RRNA 1VQOA 5EWEA 1S99A 2LQWA 2EGEA 4Q0BA 1TAUA 2A1BA 5DGBA 2DHSA 2KYXA 1PAEX 2XM3A 3V7CA 2AGQA 3V8LA 3PYDA 1W70A 4DR6J 3FDRA 4YP3A 4GLKA 2J06A 1C4AA 1FMKA 3I55A 1KBRA 3CJ8A 3TCJA 4C5HA 3CCLQ 1YG0A 1HNZJ 1PSDA 3D1HA 4V1Ak 2F9DA 3OLBA 3AT1B 2V4RA 8RUCA 1T11A 5DGAA 2O1PA 2OPRA 1TOVA 1UTIA 4QIEA 3A1PA 3HSGA 3TRGA 1MLAA 3TAPA 3FEOA 2DETA 1FD2A 3D6HB 2VQFF 2QG9B 3N5BB 4MKBA 2YNGB 1R8HA 3QJLA 2DNPA 4LF2A 2RJFA 4M5KA 1SC1B 2EQMA 4F4YA 1FWKA 1I81A 2ZBPA 4M78G 2DJQA 1EQ0A 4CRIA 3CCMS 1C0MA 5C42B 1TZ0A 4A8OA 1BY9A 2R7OA 1RQ0A 1G3OA 3CCVA 4E98A 3JRZA 4UOCA 4P6QA 1BI1A 1BLUA 4PG8A 4MT1A 4CLZA 1FRXA 3L7OA 3RAQA 2KVQE 1LW2A 5KT7A 1BYMA 4PPZA 2PNIA 2CH4A 3DFEA 3DRPB 3TAMB 4UT4A 2OTJA 4B9SA 4TVAB 1A0OB 4II1A 4K2JA 2A3LA 2V2ZA 4ZMMA 1MV0B 3FZ2A 5CCLA 5DM7Q 1QP3A 2DRDA 1ZA1B 2A6MA 1ZM2A 3KLIB 2FC9A 2DGUA 3HULA 4LF6J 4Z7YA 2W25A 3LF0A 5D0HA 1CS4A 4USUA 3W2WB 3MP6A 4Z7CA 1FKAF 4CLTA 1V9OA 4CO5A 4PAAA 3WX4A 2DCUB 4F26A 2UVWA 2KEAA 4JRQA 1IZ6A 1KHVA 4KGVB 4MFBB 3OB9A 2RRAA 1Z4UA 3KNAA 2ZDPA 2CG8A 3O8VA 3V8JA 4TXSA 2XDBA 2MQNA 2VG6A 2HWTA 2QA1A 3H5UA 4LUBA 4OJ1A 1JQGA 2M8HA 2BUNA 2MJNA 2JH3A 4YDXA 2JOQA 3VWSA 2RQWA 2Z2MA 2SEMA 1JJ2R 1RUSA 4P2MA 3NAHA 1HHQA 1Y96B 1B3QA 3JSCA 5KYYB 4BY6B 4M77D 2RN8A 1U26A 2OPPB 3NEKA 1NH8A 1S7HA 3GYXB 2M9KA 5CAIA 4DEZA 5CR2A 2OMOA 2VF3A 4BACA 3X28B 2DB1A 3IN5A 1MHNA 2BM0A 3CJRA 1XNRF 2AIRB 2EFNA 3X25B 1OU8A 3CJ3A 1FJGJ 2XCAA 3ISND 2CJXB 5FWCA 2M1HA 2DEUA 4NPOA 2DYIA 4DZDA 1VR6A 1TUVA 2HG4A 1Y3JA 3GBQA 3CW2C 3B54A 2HZYA 3N5BA 2K3BA 1JMTA 2YNGA 3TANA 1JU5C 1R31A 1HNZF 1U8RA 3CCTA 3RR7A 2R8JA 3OL7A 4M94A 2ZPHB 4AYBD 3U1NA 3VAMA 3KLFB 3R5CA 2BZ8A 4CLWA 3H6ZA 2BRKA 5D78A 1MN9A 4NL3A 4ZP8A 2DERA 2PUOB 3EX7B 1Z2ZA 4EMDA 3CCQQ 3M2UB 2BEFA 1KQSR 2IRXA 1Q7YU 2DVIA 2RUSA 2VASA 5H9EK 3OMCA 4EZ6A 3PFSA 3DRPA 3TAMA 1H6KX 1N33J 3DMJB 3G7ZA 2RA2A 2UUWA 2F4VJ 2F2VA 2J6TA 3DYAB 3J81E 3JCMg 2DR9A 1LFPA 2EQIA 2EQJA 2B8AA 5I11A 3K57A 1EETA 3KLIA 5J1PA 2FPDA 2COWA 2HAIA 2X3WD 1O51A 4OVAA 1VIEA 2DT9A 3GCWP 3R6GB 1X9WA 1MV3A 4N76A 3W2WA 3CMAS 3TP2A 4DU8A 2XNRA 1S9EB 5L1JA 1R8CA 2KDSA 1ICEB 3HDSA 2YQ3A 2ED1A 2B9WA 4OMNA 2RS8A 4EPCA 3VS0A 4URSA 3QXEB 3I0SA 5KFFA 2QLJB 1IGUA 2HFOA 4J9UE 4LF6F 5K14B 2LA4A 4MFBA 3SBMA 2AT1B 3G4SQ 3RIRA 1FF2A 3W64A 3ZNJ1 4ILLA 1KSWA 5GAOl 5KG5A 5L9XA 2E9RX 4ECUA 3EM1A 2UXCJ 1VIXA 2IAJB 4DSLA 2CXEA 1UEBA 2GMHA 3K89A 1K1ZA 3FKBA 3GR1A 4I6WA 3CWJA 4JRKA 3GV7B 1VQ4A 5ETQA 1CKBA 1L3VA 3DXSX 4DV2F 3SIPB 4ICLB 1KSPA 5FU6B 4NCGB 1Y96A 3M1VB 3R1HA 4C92B 5KYYA 1RUWA 2CA9A 3CC4Q 1FKPB 2OPPA 4ED1A 3A98A 4PPDA 3E01B 1EX4A 2DR6A 3H2UB 1G83A 4DL4A 1HQUA 5FU6C 3E1SA 3RAMA 4KRWA 4WFAQ 2Y0BB 1OPIA 2O66A 1QAJA 2CRLA 3S6EA 4J9RA 1T05B 3FNNA 2R7UA 4TU9A 3DKDA 3TVTA 1RI0A 1T9YA 3TUZC 3NNCA 4DMZA 3P6YC 3T1AA 3GIMA 1WJQA 3JSYA 1K0VA 3K5NA 1H7WA 2H51B 4HCZA 1PYSB 1GFDA 2WSFC 3V6JA 1TMJA 1U6ZA 4HVUA 2HAFA 3T19A 2BE9B 1G1XA 2CQHA 2DL7A 4RMOA 1FJGF 4Y91A 1TG0A 4CTAB 1CKAA 5KCHA 3KLFA 2QMUB 3TYTA 5ETTA 3P5BP 2FEIA 3DB3A 2LCWA 3TREA 4Y2AA 1TS9A 3R97A 4J9BA 2CNNB 1RADB 2C2DA 1T3LA 1RZMA 2AWZA 2DNGA 4ZPDA 3TEGA 3M2UA 4DX7A 4QWDA 3LTOA 3HT3A 2EJFA 3G6VA 3HVTB 2CUYA 5CD4H 1VQMA 1UUEA 5DLOA 3M8YA 4XAKA 3TVZA 4P2XA 3HKZD 3DMJA 4Y2CA 3M32B 4PKDB 2PA3A 4CLSA 2JTMA 3CCSS 1NJWA 4P75A 1RHMB 3VV0A 4IR1A 3SDZA 1PNJA 1EIYB 3O3LA 2Q6CA 1EJ7L 3V7RA 2XC9A 2IVMA 4M78D 3LH2S 1XMBA 4JI2J 3QT7A 5H9FJ 4JV1A 2H54B 1AWOA 2HHHJ 3Q1JA 3EGXB 1V3ZA 1YJTA 4HDHA 3O5ZA 3QKJA 1G5VA 2E7XA 3OW2P 2FJBB 5LJ3Y 1S9EA 1N33F 2Y3YA 1NXIA 2F4VF 4TKTA 3GU0A 2Y1RI 3GNGA 1HNWJ 5KYXB 1VQ7Q 3FJ5A 3MO8A 1RCOB 2YKOA 2KMTA 1SHGA 2DYAA 1HR0F 1BK2A 5DZ7A 5K14A 1KD1C 3W9JA 2ZH5A 1C1BA 1KD1R 1CJTB 5KOXA 4PJJA 5CA5A 2MYFA 4WTOB 1IBLJ 4A46A 2BTTA 5D4PA 2ZC3A 2ZH4A 2C2KB 5HK4A 4WF2A 3JTPA 1O0PA 4Y65A 5DLGA 3SSSA 4F2SA 2WRMA 1UZHA 1M1FA 4KUIA 4C8KA 4TU7A 2FGCA 2AJ0A 2O88A 1PBUA 4ICLA 2WSFE 4NCGA 3M1VA 2XY6A 3J7ZT 4C92A 1SH3A 2I5JB 4XU1A 1Y07A 2UXCF 4M77C 4UZBA 1FKPA 3BDPA 1VGYA 1GXLA 2CP5A 3OSVA 1JJHA 3E01A 1FEHA 4G1IA 2W9BB 3EAEA 2ZJRQ 3PKMA 1UFFA 2MAMA 5K5MA 4LBIA 4PJLA 1T05A 3PG9A 3OXGA 3KTQA 1TKDA 5J1NA 4C7QA 4FCYA 5IV4A 4PYDA 3NGKA 2PGCA 3NGDA 2C3OA 2FJVA 2JEIA 5CKHA 1K0TA 3I56T 2E1RA 2DNKA 5I21A 1K8AU 1CC7A 1Q82T 4FM4B 5DY9A 5HK0A 3H5YA 2LEBA 4ZVSB 4MZTA 2XMJA 1I3OB 4LF1A 4CTAA 3T1YJ 3V6HA 2DRMA 4D8KA 4LF4J 1TL4A 2KT3A 3M53A 2XGQA 5LJ3j 5L8RC 3HHTB 1K9AA 1RBLA 4XTUA 4FU6A 4J5YA 1YJ9T 2R57A 5HY6A 1FERA 5KG1A 3A3PB 3ZFJA 4AUKA 5RUBA 5J2MB 1NZAA 5EN1A 5D7UA 1ZA2B 3HVTA 3ILLA 3OVAA 3CXCS 3MI7X 4IKFA 2RQUA 4EBEA 1R6YA 2XMMA 5GAHI 3M32A 2CQ1A 2HRUA 3NCQA 5DG9A 1AFIA 4OP0A 3BSCA 4PYAA 3BDUA 2OEMA 3G71Q 1UGVA 1DURA 1ZS6A 3UD5A 3EGXA 3ENQA 1U8SA 2E65A 3POTB 1TL3B 2MGZB 4DX8H 2L3PA 2BDPA 4PG6A 2J6FA 4K4SA 3R6OA 4M77E 1NPKA 5KYXA 4I68A 2XSFA 1VLOA 1WXTA 3SFUA 1GBRA 2IRYA 4FP9A 3M0QA 4O3NA 4DOWA 2BX6A 2QTVA 3X3UA 4R0JA 3QGGA 4JI2F 4Q5VA 2HHHF 2XS5A 4PG7A 2E7VA 4C97A 2P9EA 2DFUA 1D09B 1RLQC 2IA0A 2XMWA 3ZZRA 1N8RU 4KR0B 2RI3A 4ZCLA 1KTVA 3CC7Q 1FRLA 1XNQJ 1SH0A 2J6KA 5CZVA 4CNYA 1UFWA 1H641 4C2MA 2UVUA 4LRCA 1FRJA 3OYGA 3DGVA 1Y57A 2EVZA 2QQ9A 2NXEA 1MMLA 5CO7A 1IBLF 5E41A 1AT1B 4HVZA 2CPZA 2I5JA 2Y8WA 4P7VA 3QZ9B 1OZ2A 2W7OA 3S8SA 5L8RE 3P45B 2J0QD 3NOCA 3KWMA 2W9BA 3AD7C 1FFGB 1IB8A 4ANEA 1DRZA 1JLFB 1WHWA 4TVRA 3VTIA 2I38A 2A08A 2QQSA 1FWLA 4J9QA 2RQMA 2AGOA 2AZ3A 3HPWA 2C2OB 2CZVC 1NSKL 2PN6A 4J9PA 4FYVB 2P4RA 2NUZA 4YMEA 1VQSA 4YOEA 2LCCA 4IG0B 5GMKl 4O44A 4DL5A 4F25A 2JVRA 5IFMA 1GMVA 4U8VA 7FD1A 5LXRA 2LX7A 1KHWA 1JNZB 1OI1A 1P1LA 2HKNA 3VYHB 1RWOB 1J5OB 1RHQB 4C11A 5AXKA 4R5PB 3QQCD 4WU2A 3TUPA 1E7OA 3NNAA 3E8OA 1NYFA 1RTZA 2MPUA 4DQ2A 5KFVA 4E2FB 3AH6A 2FHJA 5GMKa 4Q44A 1OSCA 2QYCA 2JNGA 2IMOA 4OYMA 2E5JA 3DLLA 2YTCA 2MQQA 2HBQB 4ALZA 3HSDA 5J2MA 2DNUA 4M7DB 3CCRQ 1SC6A 3RKXA 4DS5A 5D6WA 4K4VA 3TA2A 3W66A 3ADAC 3T1YF 1SKSA 1JLEB 2V69A 4LF4F 1L5UA 1RU2A 2P9GA 3DLEB 2KXCA 2YHTA 4DBHA 3N01A 1YJWS 3V8KA 3CC4T 3W60A 1ZPVA 4OYXA 2Z2YB 2KYMA 1TKZA 5HVHA 3EMTA 1WHJA 1CEZA 1JXEA 4KV8B 4M78C 2DTIA 2GIFA 3AD9C 1VQ8Q 2HNYB 4N4HA 2JW4A 2VU5A 1AA1B 3DXBA 2A10A 3OVSA 1JJ2S 4ID5B 1URNA 3POTA 1TL3A 1XMQJ 1NK6A 3RNJA 2GFUA 3LYIA 2RO0A 3H40A 1HBMB 2FJAB 1BGXT 1HWIA 1GX5A 1JKHB 3B82A 1QCFA 4C92F 4LQ3A 4F0KA 4NOYA 1RT6B 3E9GA 4DEYA 1ZAWA 2NR0A 4J7FA 3QRQA 4WIQA 1PSFA 3CCMT 1GAOA 1ZOTA 3OMGA 1OQ6A 3ZFVA 4LVNP 1HI1A 2DYBA 4PKCC 4DSFA 2KRMA 5LL6S 1VBZA 3OUYB 3SSQA 2ZEJA 3UO0A 2CQPA 4GLMA 5CYJA 2DD5A 2CAJA 3PNIA 4FVMA 2I0NA 4CM0A 1PYOB 1LJOA 3GSIA 4FYDA 2LT4A 5IXFA 2QDYB 1X75C 1GMWD 1WELA 2WBMA 3N0VA 3DLBA 4NL2A 2VA2A 1KP6A 1J3TA 3A8LB 3M8SA 5I2SA 1IO6A 2F7VA 5HAOA 1XNQF 1S49A 2QL9B 5BYSA 1UECA 1TUCA 5E0OA 3O5TB 2H3EB 1JLFA 3P4UB 2GQ2A 2E64A 2RQCA 5CYQB 2EEYA 5F41A 2KKHA 2MLZA 1KQSS 4A8XA 4F7VA 3VS6A 1VQ9A 3PW0A 1M0SA 2IMWP 3L2QA 5CH7B 3CGIA 2DTOA 3DRRA 1SJ1A 3OSSC 2GAGC 1B4SA 1WFWA 3MGJA 1I5LA 3VAIA 4EO8A 3QRRA 3M9MB 2JXBA 2X3XD 2BR0A 1J5OA 5GAMj 2L41A 3ZTPA 1XWLA 4R5PA 4M78E 4F0MA 2B6AB 4DSIA 1C0UB 4E7IA 4B9NA 1FRKA 2DMOA 1UWAA 4FSXA 2OLWA 1B0VA 4A4GA 5ITHA 2JVVA 1VQLS 1NPPA 3UPUA 2IVWA 5IS2A 4DPXA 1R8PA 1FDNA 2YNIB 2MZ1A 1X4AA 3DU6A 2F3JA 4M7DA 2QA4Q 4PJOG 4HI1A 4IUFA 4OHZA 1UPMB 4OZ2A 2DNHA 3JXOA 2LJ0A 4LRBA 3W7BA 3QJJA 3K7RA 3HFKA 2OI3A 1JLEA 2C42A 4FF1A 5IZHA 4M63A 5D6XA 4LIRA 1KS2A 3M0SA 3SWNB 4DV0J 4C92D 3KLVA 1OO0B 2W9AA 3CPWR 4GY5A 3TX0A 3H25A 2GNCA 3MCSA 1KK7A 2KL8A 3RB3A 2R8IA 5DDOC 5BXIA 2VXEA 4KV8A 3VUZA 2PVOB 2HNYA 2JDJA 1WQWA 4RNMA 4CC7A 4BDPA 2A28A 4I4BA 2BVZA 4ID5A 2NLUA 3QDFA 3LW5C 2N82B 2DAQA 2G0IA 3RESA 2XGPA 4X9DA 4P74A 3R9LA 4LXCA 2NSBA 2ZJPQ 4LRAA 2WVFA 3VRZA 1ZTWA 1R0CB 2Y90A 1HBMA 4RTTA 2LFVA 4M5GA 3DM2B 3CCJA 2LNHB 5EWFA 1N5SA 1LKZA 1N54B 4BWJA 2FVRA 5AJ3J 2MJUA 2CP6A 3FJ2A 1Y11A 1CULB 1RT6A 2QXFA 3M57A 3VGVA 3OYYA 2ZKUA 4ECXA 4YUDA 2FO0A 1XMQF 2QFJA 2LEAA 4B9WA 3ET6B 3K8WA 2HW3A 3JQJA 2VKRA 2K57A 3UPFA 1VQ5A 3NTIA 2MB0B 4Q8EA 3I5RA 3QO3A 1P1TA 5CYMB 2CS7A 4HTIA 2CYZB 2OI2A 1N36F 5D0GA 4TN2A 4E7KA 2CPDA 1R43A 4C8MA 1J5EJ 4NWBA 4WCIA 2PIIA 3OYHA 1VQPQ 1Q8KA 2IM3A 4BB7A 4RUCA 2DGXA 2K2VA 2BYCA 3GNFB 3MEEB 3BKUA 2BJ1A 3GFHA 4GVBB 2ILZA 3MCOA 4JI1J 3TZXA 2MY8A 4W98A 1X7VA 3CMAT 2VL1A 2FD2A 4N77A 4BC7A 1GEHA 3HHLB 5I2MA 3BH6B 1SEMA 1WJRA 1UTAA 2YUPA 1YI2Q 4ECZA 1KHCA 2K3YA 4M75F 4JLIA 1VRTB 4EMHA 5HSPA 3T3FA 3TW0A 1MG7A 4Z2XA 1WDTA 3M55A 3TQ7P 4YEAA 1UHCA 1YSJA 4RW4B 2H48B 1VRQC 3M58A 2ASJA 1UP1A 3GIRA 3LGNA 5KT2A 1WACA 3MF5A 4JJDA 3HFNA 2DLPA 2B6AA 2NUUG 1C0UA 3CMES 4ED7A 3R8YA 4DV4J 4X84A 4BE2A 3A8KA 3LW5E 3A3OB 4NL5A 1WSRA 4K11A 1RLDA 1VQ6S 3PMIA 3PVXA 4EYIB 2X4JA 3IFEA 5CKFA 1K76A 3SB2A 2CQBA 1BI2A 2KNBB 2XMTA 2YNIA 3ENAA 5C24B 5IT4A 2EWNA 2QEXQ 5CCMA 2DK2A 1DLOB 4URGA 5D6YA 2AJ2A 2HK3A 3U27A 3ZTQA 2RUGA 5BJRA 4ZJOA 3WC2A 2V2KA 1TTHB 3JV3A 3HFOA 2V2VA 5KFXA 3HZGA 3SWNA 4CCHA 2M5YA 2DR5A 1M1KU 3MFIA 4KHRA 1FDBA 2CDRB 4R0EA 2F5TX 1F3VA 2GS8A 2E1CA 1EP4B 3OV7A 2M0GB 3PW4A 2C22A 5E3PA 3CCUQ 4NA3A 1HK9A 5T7LA 3KLGA 2R5AA 3MPYA 2HBRB 2DXEA 5LJ3g 4N56A 2UUTA 1Y10A 2JHEA 1KQKA 4ZVPB 3AQPA 1LWFB 3NLCA 3MR2A 3OYKA 2NYHA 3FEXB 4DV0F 1SH2A 3FC9A 4EBDA 1Y5NB 2ASLA 2RQTA 1WF2A 5KG3A 5FD1A 4Q45A 1JRIA 1WC6A 3DM2A 1PCAA 3CCEQ 1X4HA 2L9DA 3HSJA 2MMPA 1CULA 4NI2B 1JXOA 2YH0A 3EYZA 2VXFA 3PYEA 2O9SA 1FX2A 4Q2LA 3R3TA 2EBPA 3MHYA 3MUTP 1JLCB 3ET6A 1FX7A 1KC8C 3R7NB 4NA2A 1KC8R 3FCWA 1G3WA 3CO9A 2CP7A 2XTJP 2L8DA 2VDHA 5AJ3F 5CYMA 2KO1A 2XYHB 2UXBJ 4M75D 5B09A 3T9ZA 3PEJA 5D4NA 2BMBA 1OY9A 3BPDA 4RTWA 1YJNS 2V94A 3CCST 5LJ3h 5M9OA 3FCHA 4DSKA 4UUXA 2E10A 3OYMA 2FHMA 3ZZOA 2UV8A 4U7UD 7AT1B 1M8MA 4OGCA 1RP5A 2XIDA 2NUPB 3QYYA 4X4PA 2ROLA 3MEEA 4OI0A 4GVBA 1I1GA 1FEEA 3R5GA 5J2NB 2V68A 1Q81T 2WSCC 4RNOA 3HHLA 2D3UA 2XWXA 3I9V9 4YDDB 2VG7B 3H5XA 2DH7A 3EGDA 2CJYB 4F7UG 2MYSA 3BS9A 1J5EF 2E12A 3QIIA 2RHUA 1Y4ZB 2UUAJ 1VRTA 1WTBA 2OH2A 2DO3A 2F8HA 4M7DF 2B3TB 1M27C 2WK4A 4USMA 3H7HB 5D77A 4C0DB 2MKIA 4RW4A 3J7AF 4JI1F 4OB3B 3M6XA 2NUHA 4NLOA 2VPYB 2PI5A 3D1OA 1IJEB 1U45A 2KJWA 4ZK7M 1D9FA 3RTVA 4B6MA 2FVQA 4ETXA 3PV8A 3CCWA 3TJ9A 4KUDK 2XHCA 1NHVA 3C6UB 4NLWA 4QIVA 4RR5A 3V2UC 3LP1B 3GB0A 2NXUA 2DCLA 2ACMA 2HHVA 1QSLA 1DLOA 2FVPA 2AEFA 3TEHB 3HRTA 3BF4A 4JV0A 1YFNA 1F2GA 2WB1D 4MK9A 1GXUA 2VKZG 1WF1A 4ZHRB 1Q7YC 4DV4F 2KT8A 1S72S 1Q7YR 2HHXA 4PCQA 4WFZA 2KBTA 4N8OA 1QUVA 3EZOA 1BU1A 2F5GA 2CDTA 2UVVA 4CLPA 1EP4A 1PIEA 4ILRA 1RHRB 2BBEA 4X4QA 2C2RA 1FFWB 2ECZA 4N47A 1QVGA 4L72B 1HD3A 4AD6A 4IH5A 4PWUA 3M8PB 5KYNA 1WHGA 1LWFA 5KFOA 3DOMB 1R77A 4N7TA 1YRXA 1IUJA 3G6EQ 3VVTA 3OW2A 4M7AF 1M1GA 2PA8D 3R2CJ 1U1SA 3NRBA 2ZPFB 3LWHA 1VQKQ 3J80U 2KFZA 1X43A 4Y2KA 4L75A 3GQCA 1SXLA 2FJDB 2WSCE 3GSDA 3QZ8A 1KRPA 3P5TL 1HHSA 1JLCA 1TUDA 2G4BA 5KFIA 2KI2A 2CJKA 2VDIA 1IN0A 1GCQC 4RTZA 2RT3A 1T0HA 4HCKA 1QQJA 1GFWB 1X4FA 2AQ4A 5D15A 3I0RB 1SBRA 2RU9A 1UAWA 3FB9A 2AZVA 3EG0A 3M54A 3IR7B 2V63A 5MLCV 2DXUA 4BS2A 4P73A 5THWA 1YHQS 1FTCA 5KFMA 3N5FA 1HHTP 3FCVA 2NUPA 2GVDB 5HVFA 4LDXA 2NQPA 1RT5B 3WQPA 5J2NA 2XLJA 1NYGA 4BD3A 5EX0A 5IT0A 2QV6A 4L3KA 1OX8A 2VOOA 1FXRA 3JCMc 3MM5B 1HQ2A 4P52A 4OYOA 1BIAA 3LX7A 1U25A 8AT1B 1SL2A 3ZBDA 1YBYA 2XZTB 4PFOA 4WK3A 1KFSA 4C92E 5E2QA 3CJQA 4LDYA 2JTFA 1N88A 2JC1A 2HHSA 4B9VA 1Q82U 3LP2B 3K5PA 3K5OA 4RX6A 2CKKA 3HVAA 1QMCA 3GLXA 1GH8A 3ZZUA 1BMQB 1VBKA 2GVZB 2RHXA 3IM8A 2AZSA 2UUAF 3OHBA 3C6UA 2VJUA 1WDXA 5A2QU 4OLPA 3LP1A 2A2DA 3AB4B 3OA6A 2HGMA 1QW1A 3VV2B 4ZPAA 1NK8A 1BQMB 3H59A 1WYXA 2CJQA 2KDOA 3G87A 5KG7A 4DS4A 4ESRA 3MD1A 3NPFA 3DDIA 4XPCA 4ZHRA 4JV5J 2L08A 5A8RB 3MP1A 2OTLA 3CJTA 4M7AD 1R89A 1G6BA 1WKLA 2RD1A 3OT9A 5GJVB 2GQVA 3KJFB 4CI0C 1QSYA 3L2VA 2CQ2A 5GAMg 4X1VA 2K3KA 3DLGA 4FN5A 4DL7A 2MKSA 4OZLA 2XKOC 3RMSA 4FF2A 2DL8A 3TZZA 3LA0A 3M8PA 3FRYA 3MP8A 3QWPA 3DOMA 2F8EX 3LPYA 1OY6A 2BV3A 2Z0WA 2CQIA 4RTXA 3SQOP 1RSCA 4AFUC 4RNHA 2ABLA 3HHDA 5DM7R 1ZTTA 4KHPJ 3HM9A 4KGXB 3HX9A 3BV8A 2LU2A 4L59A 3EG1A 2AZ1A 1S1XB 4C3LA 2FJEB 1Y7PA 1XQHA 4K5SA 2P0PA 2HWHA 4G65A 2HKQB 2GJIA 1ZHIA 4AFSC 3CCZA 1AYEA 3NWGA 2OJ2A 5KFWA 1MMNA 4MAKA 3QSIA 4OMFG 1M5KC 1NJYA 3E51A 1TQLA 1CJVB 1N0UA 5F8JA 5MAOA 2EJGA 3P96A 2PFDA 4M75C 3SFMA 3I0RA 4B08A 3ETMA 2GHWA 2JLEA 2A6OA 1YJWT 4Z89A 3Q8PB 4XIUA 5GANj 4RLEA 3AAWB 2K5LA 4IO9Q 3JCMd 4O23A 1RAHB 4CLKA 2GVDA 5KCOA 1S48A 1RT5A 4RG8A 3TQ1A 3UDEA 4HCBA 2WBRA 3KJVB 1C1CB 2L3RA 1OS5A 4O4GB 3MM5A 1BCMA 3FQLA 1IREB 4CZCA 4I56A 4RG2A 4YN3B 1R0AA 1PJ6A 2RM4A 4QQGA 1KOOA 2KT5A 1X31C 3CPWS 1FRHA 1WG1A 2A7YA 1RAFB 1K8AC 2ZZTA 2GC8A 1K8AR 4MIBA 3LP2A 2QA4G 2IG0A 5KT5A 4LQ9A 2ZPIB 4ATNA 4A4FA 2POKA 1JX4A 1VIOA 4MMOA 3I4PA 1P9QC 3UWNA 3GIKA 4ES1A 2CGHA 4F3OA 3HKSA 3CXCP 2W2OP 2F1LA 4QU7A 3V7SA 2W0ZA 3HP9A 2LXIA 4M8LA 2MEWA 4ZS6A 3D2WA 1X9SA 5KFNA 2PT0A 1BQMA 3VUBA 1RXOB 1B34B 1W4SA 1NB7A 2O67A 4OYIA 2L0AA 5HO4A 3ICLA 3EFSA 5A8RA 4P5NA 2MQLA 3CC2Q 1REVB 4PXDA 5CD4A 1YIJQ 5DLQE 3O44A 2J9EA 1VC5A 3MUMP 3KK3B 1EZZB 1WC4A 4PJOB 4J9CA 3O2IA 3MEAA 4JZ4A 1ZZNA 4JV5F 1PKTA 4M75E 1RAAB 1AWJA 3MDFA 3REAB 4WYWA 3GG0A 4IDKA 2CQDA 1WPYA 1FRIA 1LNQA 5FLXU 3I56A 1M90U 3BY7A 2HQGA 3NGRA 5GMKm 1OQKA 2OELA 5L46A 1H38A 4RL1A 1S1XA 1FMVA 2EBEA 2ZPGB 1VQLT 5LJ5j 1TUGB 3J81Y 2C0OA 2DY1A 3GOXA 2O9VA 2WW8A 5H9EJ 3I87A 3JB9k 4BI3A 2ROGA 4MJKA 2F2WA 2VUBA 1GBQA 3M4YA 5LSOA 5ETKA 3DDNA 4X65J 2W2NP 2E29A 4BE1A 2IYGA 5SZTA 1CJVA 1UG1A 2DO4A 4KHPF 1M30A 1IBKJ 5ECAA 4FS2A 1M3AA 1L3KA 3BO2A 2HIQA 2ZE2B 2IRUA 4KE5A 1RLPC 2OUGA 3EGUA 2X35A 4P9SA 2BE2B 5M2RA 1YX2A 1KVKA 3WDOA 1D8YA 2YUNA 4QCLA 2YUQA 4PFZA 1CQNA 2K1RB 1BC6A 2CZ9A 4IUQA 4PEOA 1OULA 2B7CB 1U1TA 1LOUA 4KH1B 1WHHA 3AJ1A 4KPYA 1YITS 3MUVP 1RWXB 4U9RA 3M5AA 3UFCX 3KJVA 1C1CA 1QVFS 2JJ9A 1FE0A 2XCPA 1O8BA 4O4GA 1WGSA 2QQBA 2QGFB 2RB7A 1VQOQ 2KY9A 1NCLA 3D6MB 1ZBXA 2LP5A 1H98A 1TAQA 2E5IA 2EYZA 5L39A 1NB2A 2BXJA 1RT4B 1D1CA 2ZOFA 2D74B 5EWGA 3I55Q 4M1KA 1F6TA 1TSFA 3GWCA 2MIOA 3G2XA 3CD5A 3IO1A 2V8GA 2XMKA 3ELHA 1HBOB 1TL5A 2KXFA 1W1FA 2MZTA 1F2HA 4K8RA 4E0DA 4NYZA 3SQGA 1IHWA 2DNRA 1M2VB 2DJZA 2HNDA 3QSUA 2I2YA 2HCKA 2PMHA 5D4LA 3UE2A 2E1HA 2KZZA 2ED0A 1QVGS 1B34A 3TWZA 5KFRA 4CO0A 4XTTA 5E33A 2RHQB 2XMUA 2EJ9A 4M7AC 1REVA 4LBHA 5G0RB 4H4KA 4O3PA 3BSNA 2CP0A 5LOQA 1QVPA 2IJRA 4RBTA 1JJ2P 4I69A 3MM6B 3CCVQ 3KK3A 3HO1A 4MTPA 4PJOA 3GCXP 3W62A 3OD2A 4RW8B 1NM2A 2XYGB 3VGSA 2P9CA 4X4RA 2ZC4A 3U23A 2AEJA 3DKMA 3QLHB 5HATA 2ZH6A 2YWEA 4PK4A 2OTJQ 2VPWB 3EGZA 3OFFA 5B08A 3NOGA 2C2NA 1FVQA 4LD6A 3T5LA 3IWLA 2Z2ZA 4OHVA 1M3CA 1RGVA 2WVBA 1ZUYA 4RCCA 2IIMA 4IUVA 3B78A 5GAEI 4QT7A 4LFBJ 3D4JA 3CMET 5HCKA 3X24B 5GMKe 5KFLA 1SJRA 3DLMA 3EG3A 4TYAA 3HPOA 2MKKA 4O3OA 3MHXA 1DTTB 2DNNA 3PE0A 3EPGA 3PO5A 2Z8QA 1BIBA 3VS4A 1VQ6T 1H92A 2DL5A 4QYZK 2DBMA 4JZ3A 3HF5A 4C5EA 2D3O1 5HP1A 3MMJA 1W26A 3RDVA 1YCYA 4P10A 3ZO7A 1Y5IB 3THKA 3H4DA 2E3IA 4BC9A 1KD1T 4QKUA 2ERRA 2ZE2A 3OYCA 2CT3A 2K7AA 1DQ9A 1Y0HA 3H0PA 3AOBA 2BE2A 2CQ3A 4ME7A 2H5IB 3CVKA 2M88A 3PXGa 3H2LA 2K1RA 4WYLA 5CAAA 2DNZA 3C19A 2ZKTA 2XZWA 4EMKB 4J9SA 1KQSP 2DHHA 5D3GB 4X65F 3CC4A 3UA7A 2JZ5A 3DHXA 1IBKF 2FIUA 2YQ1A 2ZBIA 3R5DA 3D3CJ 3Q8RB 2HWIA 1HWUA 4JUVA 1U1QA 4C8QG 1OPZA 5ADZA 1MW7A 5J1EB 3V6KA 4DDFA 3IXQA 2ZH3A 4M7AE 3EFOB 2W8KA 1B0TA 2HBZB 3FZBA 4NASA 1RT4A 4M5NA 3JSMB 2FHKA 5FU7B 5BYQA 5DDRC 1M9SA 5FRNA 2UUBJ 3M4XA 5KFDA 4BCAA 2OTLS 3CJ0A 1HBOA 2VJVA 3CCMA 1RWWB 1DARA 3ZNUA 4RTYA 1XR7A 2KM8B 3GR0A 1Q8LA 1GTHA 1M2VA 4IUTA 2HVHA 2OSQA 4IH7A 5HJYA 1GL5A 3LQVA 1YJNT 5CIUA 2ALYB 2EG2A 5SUHA 2BJDA 4JDSA 2LXUA 2P4TA 2EPIA 1E6VB 4DU7A 3KMQA 4I67A 2L48A 2W7PA 3QYHB 1FYNA 4ELUA 2HYIB 5G0RA 2PMZD 1KKHA 1PRMC 3DOLB 2Z56B 1PM3A 3H8YA 1WHMA 2AJFE 3X20B 1DZ5A 3MM6A 2CNLB 3N9UC 3T6BA 3KUEA 4ITSA 5DS7A 2AYGA 2HK2A 3CJ4A 4NZ6A 4RW8A 4A8KA 5CHCB 4F3QA 2D69A 4X4TA 8ATCB 2HNZB 2Q1LA 3QLHA 2OMLA 2ASDA 4F17A 1VYAA 3BGRB 5K9FA 4DG1B 2PO4A 2IA6A 4AFZC 2AYEA 2RQKA 1LCKA 4Z02A 1I07A 4XPEA 3RRHA 2KXNB 1IKXB 1XEZA 4QR2A 4W90B 3QGHA 1VQ7A 2D1CA 1PCXA 1DTTA 4A4HA 2NREA 4J9LA 2ZM6J 4B02A 2GNKA 2GAHC 3TZWA 2EFQA 3RAXA 1FX4A 2MZRA 3F73A 2VBXA 2XS7A 4Y00A 3LH5A 3K5LA 4LFBF 4ELVA 4Z37A 1S72T 1VQNQ 2R42A 4N0AC 1UEKA 2RH3A 3DOKB 1U48A 1ZAXA 3CCLS 3QSYB 3ZTOA 3PM9A 2C0IA 1TP7A 2K8GA 3MD3A 4WU3A 5HQLA 3RR8A 3W9HA 3H42A 2ESWA 4EMKA 3K8VA 4ZPBA 5D3GA 1FESA 5IC4B 5K8MA 3LGMA 2Z4PA 1VQ4Q 1N52B 1VISA 4CC2A 3SD4A 2O01E 2COYA 2O5DA 4ZVFA 2GA7A 4F7UE 1U1NA 4NXNJ 1X5TA 3NTHA 1Q81U 5J1EA 2GGPB 4ZVOB 1RLCL 3EFOA 2DBKA 2KT1A 4AMCA 2IM2A 1ZSZB 2G3RA 4ELTA 3OFGA 2K7JA 1YWOA 3KFVA 2ZHOA 3I32A 1H72C 2P6TA 3JSMA 5KTQA 4DFMA 2BKNA 4OI6A 3J7AN 1FE4A 4CQ1A 3CJSA 1F9FA 2ADCA 3PIPA 2DEIA 2FG0A 4A8FA 3FDSA 3DLHA 2X7IA 1JJ4A 3LGFA 1TFYA 1NUEA 5KG6A 2RRBA 2FC8A 3CE8A 3CIMA 4X4UA 4GMKA 2UUBF 1E6VA 1R8BA 1YHQT 3PFEA 1Q78A 2HLUA 2KB2A 4KBIA 3DOLA 3JQKA 4UQTA 1RT3B 1QLYA 4DPYA 1FNXH 2A0FB 1M1KC 5KFBA 2HS4A 1M1KR 2DY9A 3QIPB 4UOGA 4OMMA 1IBMJ 3PIOA 1EB0A 2HNZA 3PY8A 2CH4W 3RERA 3CMAA 1VQMQ 2GFFA 4B3RF 4ZITA 2CKWA 2E3HA 1EIFA 3BGRA 2BJ8A 2VG5B 4DG1A 1FK9B 2YLBA 1IKXA 3R5AA 3TSZA 1LWCB 2FGOA 1NSQA 4NLRA 2JS2A 3AOCA 4A54A 1BBZA 2J8SA 2DF6A 3TEEA 4F4ZA 1YBAA 1KVJA 3KHLA 1UB4A 2HBWA 4OMPA 1EAYC 1UL3A 3AB2B 1LVKA 1ZETA 4X4OA 2A18A 1NKBA 2YRCA 4QWAA 3OPKA 1FFSB 5HL7Q 4J6YA 4DZ6A 2JM8A 3EXYA 2ZH1A 4N5SA 3EZUA 4Y0FA 2ZHAA 1NPRA 2GTOA 1WQ7A 3DOKA 2G13A 4QWBA 3ISZA 1X27A 2RJDA 1RB0A 1VUBA 2PC6A 2P6SA 2ZM6F 4A47A 2ZPBB 3UNGC 2CPXA 5DDPC 4CLFA 3EICA 3ZC4A 4DQSA 3FIFA 2F63A 2YLCA 2ZUGA 3RB6A 1SUQA 3CQTA 4RBVA 1TUWA 1XIQA 3R7BB 2EW9A 2B56A 4FF4A 5GAHU 2EIFA 4WE1B 3SMZA 3IG1B 2GGPA 3AFGA 5AYFA 2B4VA 1R8AA 2X4WA 1ZSZA 3FQKA 1QUPA 2J0SD 2V34A 2DHGA 1YKWA 1FDDA 4GKJJ 3DLJA 2RPNA 1Q1KA 1MMAA 1U49A 3CCQS 2CWXA 3EE3A 2IIHA 4NXNF 1FXLA 3KUGA 2X51A 4C0OC 3FMBA 3MEGB 1R8OB 1U1RA 2EFVA 1VMBA 2ZNYA 4JRIA 2ZBCA 3DN9A 1EX8A 5EG2A 2H65B 2LC4A 2EYYA 3GV5B 4JB8B 4KBMB 4C8QD 3NGPA 3JB9J 2VIHA 3GIBA 4OI4A 2GHPA 2HMIB 1BCOA 5GMEA 4WF9Q 2V8PA 1CJUB 2M51A 3KXDA 3GILA 3VVUA 2DPJA 5J26A 3CCSA 1RT3A 2M70A 1D1BA 2P8IA 3QAEA 2YWGA 1SQFA 1RE1B 2I6WA 4Q8FA 1OX9A 4B9XA 3QIPA 1KDNA 4XTYA 3HHEA 1GT8A 2DZCA 4N4GA 1OY8A 2QA2A 4MDXA 2DL4A 1IGQA 1OU9A 4ECSA 1ZUKA 4RNNA 3OBWA 3G4SS 1TKXB 1P8GA 2LQ5A 2VG5A 4J9EA 2YWKA 2CT4A 2XG8A 4F4KA 3EVMA 1RTHA 2XY5A 2PSZA 4WP3A 2M2BA 4E6RA 1W2BA 5E3QA 1IJFB 1IBMF 1Q7LB 5BR8J 1O9SA 1PAUB 3M4GA 2WVCA 2NWMA 5GAN8 2ATLA 2EC0A 2DNLA 3AHPA 3RBZA 2ZOGA 1VC0A 2VPXB 2R8GA 3RZAA 4IYQA 3QIDA 2MZSA 1X4DA 3CC4S 2D3OR 1RL2A 1F9EB 2XWYA 1C2PA 4PQUB 1HXDA 4KFBB 3ZL7C 2K5IA 1TV6B 4OB0B 2CVIA 3CO0P 1RTIB 2QAZA 3VS3A 2AP6A 4U8YA 3IWXA 4B9TA 3DHWC 4ATOA 5DM6Q 2KG1A 2GFAA 5C6SA 4FYWB 1S6QB 3UD4P 4R56A 2RNEA 3Q23A 2J7IA 3CB4A 3QT8A 2X1BA 3CEYA 4EFAC 5LJ3d 3PO4A 5L38A 1VI7A 4WE1A 4LT6A 1X6OA 2I2LA 1FA0A 3IG1A 3M7VA 2YQ0A 2HHPA 2JTEA 3KUFA 3SZ2A 3N79A 1UA0A 3OL9A 3RKYA 2ZH2A 5IC6B 4DUTA 4CH0S 4L6V5 1KQ2A 2YX7A 5A8KB 1S7IA 1RWPB 1S1WB 2EQKA 1U3OA 2O4XB 3DRXA 4KKOB 4LNPA 4B3TJ 1X4EA 4DA4A 2LDYA 3PEHA 5B7WA 5LJ5e 2V50A 3RBBB 1H2TZ 1NLOC 3C94A 3M8WA 1PSEA 1I6JA 1HSQA 4DV5J 2EYXA 5GAN6 3W8PA 2RK2A 4GKJF 2U1AA 4X66J 1RWNB 3RRKA 5IHIA 1A9NB 5HQMA 3CXCA 2HMIA 4WFXA 1CJUA 4KC5A 2HS3A 4P71A 3VJPA 3CD7A 3QJ6A 2LLZA 7FDRA 3J80E 4DUYJ 2QLXA 2LA6A 3A8JA 4ZPTR 4ORZA 2GO9A 3A3NB 2RD5C 1YITT 1N9SA 2K4YA 2LVWA 4DOZA 1W25A 3DLLQ 4X2BA 3JB9F 1CJKA 1EKRA 1VQ7S 1LK7A 2C2ZB 4QWCA 2KR3A 1MMGA 2Y1LB 2IVYA 1X2QA 1T8EA 1UKUA 2DHXA 1TKXA 2I1RA 1GNKA 2L2PA 3MTJA 4NYOA 1NKCA 2GZOA 2R7RA 1NU4A 1S79A 2W1BA 3KDNA 1X69A 3H5SA 4QW8A 3Q8UA 5ETMA 1IBCB 4UZCA 2XMAA 3MM9B 5J3BA 5KT4A 1S9GB 3L1AA 4HT7A 2CZ0B 2HDAA 1HI0P 4YB5A 3HJFA 4GC6A 1NHUA 2CUBA 2LDIA 1YQHA 1YZ6A 1ABOA 3MPUB 3WVEB 4DV3J 4OZ1A 4KAIA 3WIVA 1HNIB 1U1KA 1B64A 4HVWA 3D5MA 2W4CA 2DL3A 4WXWA 2QLBB 2B9XA 3QJPA 4OX7A 2P2CB 2YWHA 2P5VA 1WSVA 5KG2A 1SQEA 2QIFA 1RHJB 5BR8F 2K5FA 4KFBA 3OFHA 2VFSA 1TV6A 1S4EA 1RTIA 3D1QA 1KC8T 4DR6F 3Q22A 5HMZA 3OQ2A 4QPTA 2HVIA 1S6QA 1UZDA 5DO2A 4CDIA 3GJSB 2LDMA 3ZEHA 2ZGWA 4S0MA 2IM1A 3LH0A 3QUIA 4RO0A 3CPWP 2V67A 3FFIB 5C42A 2OAWA 5KFQA 5IT9U 2D0QB 3NS5A 1UMJA 1Q86C 3TAQA 2RHSB 4QYRA 1PJ5A 1Q86R 3NTKA 2XLIA 4BI4A 1H2UX 5AXLA 1VFJA 1S1WA 5F8GA 4E7LA 5LXYA 4YB1P 4Y2IA 2O4XA 3M56A 4KKOA 3VAKA 1UJ5A 3TA0A 3P3DA 2V1QA 3AHUA 4J9MA 3FBEA 3JB9D 1VQ9Q 4J9GA 4YR2A 3RR6A 2VQEJ 2IFXA 2FZGB 1T95A 2KROA 5J2PB 1MWQA 3JTNA 2VGMA 1EHWA 4D6WA 1OPLA 1T3OA 2D8HA 1SI9A 4C8YA 4C8QC 2NCKL 2EK1A 5EUHA 2YRDA 2KE9A 4MMKA 3G71S 4XTVA 1TFWA 4I2PB 3OSPA 4Y2MA 4B3TF 1T7PA 2DNOA 4FL6A 1YJWA 2E44A 4WTYA 4X64J 1IXDA 4DV5F 4HI2A 3JAMU 1R6VA 3BBCA 4IUPA 3ILIA 2D9OA 3OHAA 3GV8B 4X66F 4DEXA 2DM1A 4ENOA 3MCAB 2KTQA 1JJ2A 3WC0A 2RI5A 2D3ZA 1Q7YT 2OPSB 1WOPA 4DUYF 3OTDA 3D54A 4I6AA 2M9UA 1HWLA 2NYIA 3UN5A 5GVQA 4FBTA 4UY85 2LQNA 2CPFA 3CC7S 3PT9A 1TL1B 3MM9A 3JCMh 3PHEA 1LW0B 2ZVIA 2OTLT 1V6HA 1S9GA 4DQRA 1ABQA 1M90C 4F3MA 2AX0A 1M90R 3CCEA 4E7JA 2CNKB 2EWHA 3BJYA 4A4JA 2DNQA 3IBFB 2KAFA 1MUZA 2IHR1 3RW6A 1HNIA 5K8OA 4ZCIA 2HHQA 3G82B 5L1KA 3CCJQ 3L7PA 1FWPA 3ENVA 2OSRA 1SKRA 3LOUA 2L3MA 3K17A 3SCKE 1WC1A 2VICA 1HIYA 4PFPA 3LUYA 4DLGA 1AUDA 4U7UK 2GJ2A 4ZLPA 4IKAA 4DV3F 2CDQA 4DF8A 1WORA 3NGSA 1U6FA 4Y34A 1XMOJ 1QVFP 3HCXA 3M59A 1UGRB 5GAMd 2VYTA 4E7HA 2NXNA 1VQ5Q 4E7SA 2QRRA 1JO8A 4IURA 4BI8B 5F3TA 3MMAB 3NNHA 3QFWA 5GADI 1KQSA 4C8QE 2N7CA 5A8WB 4UUWA 4DFJA 4F36A 2VBWA 4O3SA 3FFIA 4OB2B 2CPYA 4NLUA 2DX1A 3UDLA 1G4CA 2GIQA 2NXJA 2YNFB 4C5GA 3EZ5A 3KG1A 2XG8D 2CPJA 1NK9A 4DFPA 2L89A 3NL0A 1AW0A 3OYLA 1LQ9A 2ZH7A 1TU0B 3CCRS 5DETA 2PD1A 3NCRA 1VQLA 5LMUJ 4XDCA 3DYAA 3BGFA 1QVGP 2V8VA 2FTRA 5J2PA 1D0XA 3JCMf 2M16A 2DISA 3C66A 2LECA 4OYPA 3CD6Q 1IRXA 3CCLT 4IFVB 4OZ3A 5CK9A 4C0GA 5FLXE 1M2OA 4I2PA 4DR5J 2FYXA 1ZUUA 1VQ8S 1XTZA 3H0FA 3FK4A 3QRPA 1S0NA 1M5VC 2CFXA 3ETOA 2VQEF 1DJ0A 1YRUA 2BOPA 1Y71A 1K1QA 2LNVA 1YTYA 1W2BS 1UPPA 5DG8A 3VR1A 4H4MB 1K9MC 3MKDA 1K9MR 2WACA 4C0HA 2CPHA 4LR7A 3GP9A 2IAJA 3QWXX 5DG7A 2OPSA 2D9TA 4ZPVR 3MPWA 3KKFA 4KSEB 2RSQA 3L9ZA 3M9QA 2IDEA 3OYEA 4M77B 3GIJA 2ZDOA 2CUDA 3UCGA 2F65A 2OX7A 1TL1A 1UWBB 4RW6B 5IHKA 4W4MA 2ZCFB 4HVVA 1VJWA 1QLNA 1QCNA 1HYSB 3G6EA 4B3OB 5AE3A 3K5MA 1I8FA 3MEVA 3PJ9A 2J05A 4O0IA 1DAXA 5B0DA 3INZA 4PJMA 2AJ4A 4TYBA 3J7YI 1V5VA 2O2OA 4X34A 3BKTA 3I4HX 1M4ZA 4IRDA 4OYZA 4J9DA 3NGUA 4JUZA 3G82A 3SYZA 1WC5A 2SXLA 2EG1A 2EVRA 2ZBRA 2ZUAA 4B9MA 3GONA 2A3JA 4AQYJ 1WUUA 4OYAA 4J83A 3L42A 4FW1A 3ISNC 4OIXA 3TOQA 3GG1A 4RPFA 1PC5A 1VOMA 3P8BB 3E2EA 2DPPB 4C92G 4C8LA 1NE8A 4LD9K 2AKLA 3TVKA 4LDVA 3C16B 1DBDA 1E6HA 3RUBL 4QWEA 4AFQC 2IJNA 3MMAA 4AL7A 3EH2A 1N5ZA 2V4QA 2PU9B 1T9WA 2V26A 5A8WA 3NS7B 4I1TA 5IWAJ 5I3UB 3DRSB 2YKNB 2ZITA 1X2KA 2YXLA 1S6PB 3HL8A 1ZSGA 4LUEA 1XMOF 2VA3A 3H0IA 1OOTA 3A13A 1OPKA 2R7XA 1WHXA 1V76A 2WW4A 3BN4A 3CMEA 1QJHA 4DUZJ 1XNIA 2QA4S 1P9YA 1GXTA 3EWGA 2COLA 3VCDA 1HL6A 1VQ6A 1VDHA 2LMIA 1FXXA 2L9WA 2G9OA 3UR3C 5I4MA 1J27A 4F0HA 2XS2A 3WIUA 5HKCA 1HD0A 3OS1A 3ZZPA 1Y0MA 2PFFB 3SHWA 1IHVA 2HL5C 3BFMA 3VALA 4MK7A 4ZVEA 1K8AT 3CULA 2HVDA 2RQ4A 4WBFA 3SDEB 2CP3A 3FLGA 4J9HA 5B0AA 4ECRA 4O6JA 2H3JA 3HFVA 1VS3A 1YLXA 1QD1A 2MQPA 5LMUF 4CYUB 4J9FA 1BD6A 3L4BC 3G1JA 4P2SA 2XB2D 1QSSA 2HS0A 2KRNA 4OL8A 1WF0A 3MR6A 1CJTA 3OBIA 1NJIU 1LXJA 2J7KA 2WONB 4P72A 2N3OA 3LGHA 4H4MA 3OYIA 3TNVA 1TK0A 4ZN1A 4DR5F 1A0NB 1HNWF 3PX4A 5JVGQ 5LMNJ 1K1SA 3M9OB 2F5KA 4M77A 4CWBA 3N28A 2V9KA 4RW6A 1KN6A 3CCQT 2BKOA 3JCMJ 1BI3A 1P92A 5LT5A 1N27A 4IRKA 1NRKA 5E3RA 4UY8T 1IR1A 4B3OA 2UXDJ 1M3BA 1ZYQA 3QPIA 2V8KA 3O6QA 3F44A 5GAOp 2QLWA 2J7WA 2GCFA 4ER8A 5IQQA 4EZ9A 4K7QA 2CJAA 1KLMB 1YWXA 1KVIA 4J6XA 3BQ0A 1JWWA 4J9NA 5KFHA 4USKA 4CT8A 1VQPS 3H4BA 4PL6A 4OZJA 1YJNA 3RBXA 5CKBA 5ETSA 1JLQB 4B3SJ 1RKIA 4C0FA 3LALA 4WFBQ 4ZCKA 3BSOA 3L09A 1AVZC 3KLEB 1FO1A 2UVRA 2X3GA 5I42B 4KJIA 2N4CA 4OLOA 5HVGA 1YI2S 2XSJB 4HA8A 3C16A 3PFOA 1DQAA 4AQYF 3G4ST 3OTCA 1U2CA 2W4PA 2WVDA 3FBFA 4LSNB 4QIFA 1HI8A 2DKOB 4K50A 4HT9A 5I3UA 2V8HA 4QZVB 2YKNA 1H3HA 1U7LA 3BB5A 2G1HA 1B7YB 3MZIA 4HCCA 2BKDN 3CF5Q 2MQMA 1S6PA 2DXBA 1Q81C 1GX6A 2KRBA 1Q81R 1U6BA 2ZWPA 2LT1A 3HT0A 4J7IA 1U2RA 4NLQA 2JLFA 3TVYA 1WNEA 3PDNA 4Q2MA 2NPIA 1GRIA 1TXQA 4IQMA 2QEXS 4M78B 5IWAF 3A4TA 2ZH8A 2XULA 4M5HA 3IM9A 2FPHX 6FDRA 3UR0A 4DV1J 3CD0A 1RISA 5DDQC 2KK4A 3EGWB 1I5OB 2N4DA 1OSDA 3SDEA 4RU9A 1GK8A 5AE2A 1RHKB 3WHIA 2BUDA 4DUZF 2HKEA 3UQSA 2HLTA 3CCUS 2MGZA 4M75G 3ER0A 1S72A 1N0VC 3NKYA 4RNFA 1SG5A 4CYUA 4FBUA 4MZPA 1BQNB 5D4OA 1Q4RA 3FC3A 1IM4A 3UATA 3SXLA 2KU7A 3HLUA 4ES2A 1VJQA 3W61A 2WONA 1UW9A 4F50A 3CCES 3HSZA 3CDUA 4IIOA 3R27A 2VD3A 3SEMA 2QSFA 2W2MP 3SI8A 1BXNA 3LAKA 5I3QA 3NG8A 2JJ4D 4C48A 3RJMB 1GQEA 5HI7A 3NFCA 3HSBA 4L6V3 1NJXA 2K79A 1TR0A 2J9DA 4Q7AA 4AT1B 1F5BA 3HJVA 2EYWA 1WDDA 3VAGA 2B5JB 5LMNF 4ZVRB 1HD1A 2AX1A 1RACB 4NLYA 1XR5A 2JSXA 3GP8A 1APSA 1S6UA 3FMWA 3HKWA 2R7VA 2HEKA 3CD6T 4IG0A 2LRQA 3VS5A 2HAXA 3T1HJ 2KT2A 1JLQA 3HTRA 2UXDF 3RBDA 1M5PC 2PDAA 3KLEA 1YHQA 3CTRA 1VQ7T 2XSJA 3PVQA 1YRTA 2M7SA 4ZIWA 3MM7B 2C3PA 4WPAA 2QQAA 1EARA 2XO6A 2F40A 4EK2A 5A0GA 3LPEA 4LSNA 2OP5A 2R7WA 2ROTA 2RKIB 1B99A 4B3SF 1S6OA 2RF0A 2R7SA 3GJTB 2RJZA 5KAKA 3ZZ0A 1NK0A 4ZJQA 2XMVA 1U1MA 3TO8A 1H7XA 4DN9A 3OYJA 2MMYA 4QYZJ 3UI3A 4B17A 3NBPB 4OZ0A 4FKYA 2W8LA 1WZOA 1LXNA 1ZZFA 3H98A 5GAN5 4M78A 4ZJLA 1AHJB 3DLEA 4P7TA 1D1UA 4WKYA 2JWNA 1YN8A 2E4HA 2DGWA 3LAMA 1S12A 3KUHA 5C0MA 1SJQA 2KVIA 3W5YA 2JN0A 1NMEB 3IRWP 1VBYA 4M77F 4QQDA 4M7DG 2JVOA 1FT8A 4IOAQ 3D6FB 1BQNA 3NCPA 1MGQA 1UGPB 4DV1F 1NDPA 4FF3A 1JKHA 2EC2A 1NKEA 2ZWOA 4OMOA 1FVSA 3V4IB 4QR1A 3G6ES 2K9GA 1I94J 2PE8A 3FRZA 4C8ZA 1MWZA 1NLPC 5ETVA 1OEBA 1VQKS 2XHWA 3B8HA 2X4YA 3OUYA 1IKWB 2JL9A 2XO7A 2AJQA 2XDPA 4EDUA 2FLLA 3X1LB 4QVCA 3CBOA 5C2CA 1YJUA 4ES3A 2RI2A 2DILA 4DCPB 3V81B 2PQWA 1UGQB 2NSCA 4R8UB 2PEBA 1X4GA 5IV3A 5J2QB 5GANd 1Q8IA 2IYIA 2B5JA 1EETB 5KH6A 2KN4A 1VHIA 3LANA 2CZ4A 1FDAA 2KH9A 5KFUA 3T5HA 2FJWA 3BM7A 1D3WA 2HGNA 2DITA 3ITHB 3V5RA 4A8SA 4NA1A 1Z9QA 4ZLNA 4OQJA 3W2VB 4IOBA 2FVSA 4M5MA 5CYQA 3G71T 3I56Q 3RKWA 1RA7A 2XI3A 4E47A 3PNWC 1ACMB 2VKNA 3EUNA 1OYEA 3UVJB 1KHIA 3I0SB 2ROPA 1UVJA 3KFWX 3L95X 1N5YB 3AJDA 1B7TA 4DV2J 3OS0A 4M7AG 2VONA 1UFLA 5GMKj 1NNDA 1CC8A 1HJDA 2CYYA 3BGUA 2GTJA 1RAOA 1U09A 1KC8U 4J7CA 3MM7A 1YJ9Q 4W92B 1O6XA 4LBPA 2RILA 2NXCA 2JZ2A 3T1HF 3OR2B 2FDNA 1HBUB 2M52A 3MCMA 5T14A 2RKIA 3PX6A 3J7Z5 1CSKA 3QBCA 2W2PP 3CC7T 4WXOA 4N41A 2I8EA 2LP4A 3CPWA 3NBPA 2EFIA 1EQMA 4ZVHA 2DGTA 3FBBA 2LCSA 3FSIA 3UNYA 5IHNA 4G3IA 4J5OA 3A8IA 4NZ0A 1HW9A 4WP8A 1JQQA 2E5LJ 1HQUB 3S3OA 1UETA 2KXHA 4DX5A 2JS0A 1Y9OA 4BY6C 3F56A 3PR5B 1KFZA 4BHQA 4Y92A 1XQIA 2OEKA 5HANA 1T9TA 2FVCA 2IJFA 5GAEU 2GX8A 3UD3P 1MNEA 1HNVB 3WZ0A 1HNXJ 2RDDA 4RCBA 2AW0A 1N34J 3TI0A 1TELA 2R2RA 1LNXA 5IH2A 4RU2A 4FXDA 2ASYA 2WZ1A 3GTYX 4A4EA 2YX1A 2M4MA 4EEYA 4XTZA 4IOCQ 2OJ3A 1WNLA 4IIMA 1Q53A 5ETNA 1JXLA 5LJ5d 3V4IA 4NRTA 1PWTA 4QJVA 3C14B 3TQEA 2HMAA 2ZZNA 5GJWB 2LYVA 2OKQA 1ZM9A 1OZ3A 3ZXWA 3JCMb 1IKWA 2FHJD 2DO0A 4WWSA 3G6XA 4F67A 1M1KT 2P0KA 3OS5A 4OB1B 4NLPA 3V81A 1CPZA 4TQRA 4R8UA 2D1XA 3CCRT 2K2MA 1I94F 2D8JA 3J7A1 5A6PA 5J2QA 4CT9A 5KFAA 2M8DB 2CREA 1HR0J 2N3LA 3MURP 1FWZA 3BYPA 1KWMA 1IWGA 4LJMA 3GPLA 2VV5A 3MPVA 3Q0AA 2R5MA 4XK8C 1AROP 2K7KA 1FJ7A 2HZCA 3ITHA 1YBTA 4DN0A 2GBQA 4XU3A 4YB7A 3W2VA 1ZLMA 1SCJB 3ZZZA 4OZ5A 1K73T 3JB9I 4ECYA 1VQ8T 3F41A 2DD8S 4ZLLA 2EYQA 3UVJA 3IQLA 2AKWB 2H4WB 2HSEB 1X01A 4JV2A 2RQRA 1BWVA 3Q8VA 1N5YA 1VQNA 2YDLA 1C1BB 3VYGA 2OPQB 1LK5A 3ZTSA 4RWWA 1NEGA 2FPEA 3W5XA 2HEQA 3LWMA 4NLXA 4K59A 4M78F 3QDRB 3VAJA 1YITA 3HRSA 2UV8G 1QVFA 5D0EA 3OR2A 1HBUA 4BE0A 2DXTA 4PNOA 5GAOr 4DL6A 4HACB 3BH7B 5CVIA 2BZ2A 5C24A 5GAGU 4DJBA 5GAOm 2E6NA 3PACA 1ZPWX 3CDWA 1NJZA 2MLYA 5D6GA 2FB0A 3FBCA 4QBUA 3T41A 5KFZA 2J0WA 3UWTA 3VGTA 3HD2A 1S10A 4C92C 2BQ3A 1SRMA 1HLWA 3NGTA 2B43A 2ZNZA 5DLFA 3H8ZA 3CC2S 3BEGB 1RBOB 2CQCA 4ED8A 3BREA 2QYZA 4LSLB 3NXZA 1YIJS 1HNVA 2Y9HA 2PTKA 1CG2A 2FY1A 5LJ3f 4DFKA 4R55A 2E5LF 3D68A 5KFSA 2C3YA 2DE0X 1AD5A 2LJ1A 1R3NA 3CCMQ 4JLGA 6AT1B 4XK8E 3M8RA 2K3IA 2MKCA 4ETZA 5HMWA 1BUXA 2HFUA 3MR3A 2ZVSA 1HNXF 4GO5X 4NI2A 2AU0A 3IGVA 3C14A 1PHTA 4QIWD 1N34F 2HQEA 4I0WA 2K2PA 1SB6A 3H90A 2XYPB 4FPRA 4NZ7A 1LEOA 1DHMA 1GMWA 3R6NA 1WXUA 2DA9A 3EFRA 4QVZA 2F69A 2M3DA 1AWWA 1QWEA 4M5JA 2DTJA 3LLRA 4M5IA 1LV5A 4K4UA 2QA4T 4DWIA 4M7DD 1U1PA 1T3NA 4OF1A 1AZEA 1IR2A 2AHJB 3V4MA 1UGSB 2WOMB 1JLAB 4XTWA 3A8OB 3K0JA 2QL5B 3D7SB 3W63A 2FB7A 2QK0A 2BABA 3W8GA 4LF7J 3I82A 1YDLA 3NMAA 1UJ0A 3D28A 1G3YA 1U47A 2UXBF 4J9OA 4QW9A 5JVHQ 5IT9E 1X0PA 2QN6B 4OJGA 5ETOA 1FTRA 2Q43A 2VG7A 5GAOn 5GAOq 5IN1A 1VRUB 1IR0A 3QZ5B 1VYTA 2FVUA 1RJJA 1W2IA 3SV3A 1H3DA 2MKJA 4C4WA 2OPQA 2FLPA 4HEA9 2EI5A 1VQOS 3JCMe 4DQIA 4CO1A 3C3LA 1QAIA 2BZXA 2P0QA 2EKOA 1WD6A 3KK2B 2XQCA 4X4VA 2WVEA 1KLNA 4NCBA 4HL9A 1RAJA 1ZX6A 1N5QA 5F9NA 3I55S 4UC4A 4HACA 1IKVB 4PXEA 3IR6B 2Z58B 2COZA 4R25A 3UCUP 1WEZA 2HRTA 5F0UA 4CI0B 4LN2A 3HI9A 3RYLA 2FZCB 1QAXA 1S0MA 3JAME 2KFNA 4EU0A 1WOSA 1NSAA 1U5SA 2HFNA 3N6MA 2RVJA 4DPTA 3MOZA 4PR6A 1X0FA 1E6YB 1KQGB 1VQPT 4O44B 4MDWA 1N4LA 1V29B 4LSLA 3MMCB 2R7TA 1X6BA 2K06A 1HFEL 3D0HE 3PX0A 1X4CA 2R9LA 3CCVS 3VHQA 5IOLA 2V8JA 4FPIA 2RJCA 1U1OA 1MNDA 1W2BP 5KYWB 3Q8YA 3M0UA 4QW2A 1S0OA 3ILJA 1YI2T 4KH0B 2NUTB 4C11B 3WBZA 1LOJA 3PIPQ 2B4UA 2OTJS 4WJBA 1D8ZA 3TR5A 3AD8C 1GCQA 4PABA 2B0GA 3L3CA 1BI0A 3QBYA 1NHKL 2LX9A 4XAXB 2WCXA 4CIOA 4K5RA 4M75B 3BW1A 1QKXA 2L3QA 2ZBQA 4CLUA 3EVWA 1K4US 4DHVA 3M9NB 5GAMh 2E5GA 2QEXT 4DR4J 4V2SA 3NMRA 3G8TA 3THVA 4I6YA 3J80Y 2XY7A 1Z1ZA 1FJCA 2WOMA 4XU2A 3PIOQ 3IWNC 1JLAA 2JNJA 1TKZB 3HXMA 3IBCB 3CMAQ 3GFXA 2FHDA 2DNYA 1K44A 1WKJA 3QT5A 2HPUA 5GMDA 4DPOA 2KJVA 3BZQA 2XI9A 4TQSA 1HARA 2CZ1B 1RWUA 4EWTA 4DBQA 2VB6A 3CCUT 4UW2A 4HLBA 4ECVA 2E70A 2EFGA 2LEPA 3UDVA 2GMJA 5LJ5Y 3CCLA 3CUNA 4U95A 4OHXA 4DX6A 2H5EA 1VRUA 2HQ3A 5HLFB 3RW7A 1RTDB 4LF7F 2YNHB 2MOXA 2J6SA 1SVDA 2RDIA 2R4FA 1UA1A 4LR9A 1JEGA 2A2CA 3CCET 5F8LA 2H4YB 3C8YA 4DSEA 2BA9A 3QAUA 3KK2A 3G6YA 2VBYA 3OR1B 1XR6A 2GVZA 2BJ7A 2LZ6B 2RB6A 3HHKA 2W7AA 4HHUA 5KE2A 3EHQA 1IKVA 5C2GA 3H9NA 5CKEA 1B70B 1VC6A 4DQPA 1QDUB 3KNGA 1FJEB 4EIKA 3NHNA 2VOPA 3A12A 4PG5A 5A6WA 2DXCA 4CNZA 1RI7A 4XTXA 3Q8QB 5L23A 2QX0A 4DPWA 1WEYA 4FNHA 4JI3J 2JM9A 1X5PA 1UDLA 1NM7A 2RIJA 4YTLA 9ATCB 2LQ8A 3VAFA 4ZVTB 4AXIA 1G3TA 3E19A 2PMWA 2G0CA 3THPA 2HQXA 1U2FA 1Q95G 3Q89A 2W10A 1N6QB 1LFWA 5A2QY 1E6YA 3PHTA 3K2YA 1SC4B 3MFHA 5GAMf 1KG1A 2QDLA 3MMCA 1Q86T 5FW9A 2DPIA 4MH8A 4DI6A 2DGVA 4MIWA 1WTFA 2JEGA 2B8PA 3DRRB 4N8NA 3HHLD 2V2QA 2YY3A 5KYWA 1SJ3P 4ID8A 1B7FA 4KY3A 4M95A 5CABA 4ED6A 3VZHA 2NUTA 1KNZA 3EGNA 5KFYA 4YHHJ 1KOHA 2DKGA 3G96A 4OI3A 3VQTA 1Q5YA 3Q8SB 3IGNA 5HROB 2BIVA 5K20B 2QI2A 1DQ8A 2YUOA 1NJIC 3ULRB 2VUGA 2DXFA 3EJMA 1NJIR 4M75A 4MKVA 1U02A 3QT6A 3H2VE 1N8RC 2VODA 4NOHA 4OJ3A 2VFVA 1N8RR 3I31A 5GMKh 3MOJB 1JBMA 2CZ7B 2R2UA 3CCSQ 2R2TA 1W7WA 3TA1A 1L3TA 4RUGA 4OX6A 4HTJA 3I5AA 3QPHA 2OFHX 4M7DC 1ZH5A 2KRRA 2DH8A 4DR1J 1NK4A 1TK5A 4PWDB 1HWJA 1I51B 3SCLE 5GAN3 3K58A 4FW2A 1R7IA 3QO9B 4FXWA 1VQNS 2GCXA 1WJ9A 3TU4K 3HK2A 2GQCA 2CVEA 2MKYA 4FT2A 2J8AA 2HQHA 2HIYA 2RNAA 4L76A 4WP9A 4DR4F 4QQ6A 3BQ2A 3IAS9 2MWOA 4TU8A 1HKAA 3CBMA 3VQSA 5HN0A 1M90T 2J6OA 4YR0A 2QGGA 1VQ4S 5KOWA 1T03B 3BGLA 2HVEA 5HLFA 1RYRA 1IXKA 2ZFHA 1RTDA 4XQ3A 5H1SV 2J9DE 4OYBA 1X9MA 2YNHA 2G2ZA 3H20A 4RKUC 1N36J 3OTOJ 2DRKA 4LFAJ 2GIRA 1M5OC 3G6ET 1WC3A 5FRMA 4AXJA 1S57A 2ZOMA 1HMVB 2AEMA 5CQYA 4USVA 1VQKT 4C3KA 5JMNA 1F0XA 3OR1A 2OAUA 4D3HA 2DTHA 3KMSA 4ILMA 4QU6A 3KXTA 1ROFA 3KOAA 4V19X 2M0OA 5KFCA 4M7AB 4L5GA 3HD1A 5DQIA 1QTMA 1UJ4A 3PVLA 3GE9A 3KHHA 4Y28C 2LTOA 5T41A 4OX8A 3PMTA 1KEKA 3C0CA 3SSRA 4JI7J 1L3SA 2CADA 3CCQA 1S5ZA 4YQWA 4AL6A 1TH7A 4AE5A 3K59A 4XDDA 1O5JA 1N6QA 2ILYA 1S59A 1VK8A 4LMZA 4F16A 1S76D 3FEZA 2EGAA 4TLQA 2ADBA 1X4BA 2EFPA 4NE9C 2AHOB 4JI3F 4F14A 3X26B 4RBUA 2UU9J 3S3MA 4M7DE 2ACYA 4BLGA 4ZNXA 4LFCJ 2VWFA 2QL7B 2BOAA 3GZ7A 3UN3A 1TVRB 1VBXA 4OJHA 2CPEA 1VQMS 3QJYA 3OBYA 2DEJA 1WX6A 3M05A 3E2UA 3IP0A 4F8RA 4C5IA 4BDZA 2Z0GA 2ABYA 5HROA 1SRLA 2E6ZA 2XI2A 1PBAA 2KHCA 4RUHA 1RT1B 2E1AA 2AKKA 2GO8A 3MWBA 2RHIA 4FT4A 4YB6A 3G4SA 2JFDA 1VK3A 2BM1A 2RMOA 1NSPA 2O31A 3VS7A 4HYKA 1J2VA 3A1YG 4YR3A 2YWFA 1PRLC 4YHHF 3RMQA 3H41A 3C6TB 3EXCX 2R8KA 1WI7A 1U0HB 3G9CA 5KFEA 4DOVA 4RKUE 2MQOA 5KT3A 2B4PA 5FLXY 2OO4A 3C15B 2XLKA 1FMWA 4C0ZA 1K9MT 3EPIA 1WHLA 3KHGA 1U06A 4PWDA 3META 1QP2A 3BPSP 1C0TB 1BWEA 1K47A 5L1LA 1M5HA 3ME9A 3QO9A 3SCJE 4ZN3A 1NK5A 5T7LB 4ED2A 3KLGB 2MTLA 3OQ5A 3SWNC 4JBCA 2HSPA 4LR8A 1BQXA 2HQCA 1C1AA 4Y28E 2D6FA 5AT1B 4DR1F 2HZVA 1S77D 2QLFB 2DR8A 4KTQA 2CG4A 4EMGA 2CSQA 1MU2B 1T03A 1D1AA 3JB9H 1S4FA 4NXMJ 1AB8A 1U0SA 3CJ5A 1QCOA 4EGLA 1YBUA 4PXBA 5F9LA 3KG4A 4LF8J 2E1MC 1UVNA 4DSJA 2ZZDA 2MPXC 4G1QB 4DQQA 4X62J 3OXLA 4KPCA 1OQ3A 1HMVA 3MAAB 3LP0B 2BW7A 4D3GA 3HVWA 5KYUB 1SIZA 4F7UB 1WHYA 2EPDA 4HH1A 1V3SA 3OJUA 1HW8A 6FD1A 2WB4A 4M7AA 3CDEA 3OTOF 3DU5A 4LFAF 2YBVA 3M30B 2O01C 4EO6A 4JJBA 4KULA 1RAEB 4F4XA 3OVBA 3LGLA 2DK3A 3NY0A 1AUSL 3KHRA 2G2YA 2EFOA 1VIFA 2CPIA 2D9PA 3QWYA 2AV5A 4NLDA 2LVMA 1IKYB 4OV6A 4NMXA 2K6DA 3KJQB 2DZ9A 3TUIC 3VZIA 4I64A 3EGDB 3HP6A 3C95A 3W65A 4JI7F 4WKRA 4ED5A 4H4OB 4V19J 2GMLA 3CD6A 3HHLC 4CC3A 1TVRA 1WI8A 3RG6A 1SJFA 4LF9J 3R6LB 2J6UA 2KQWA 1WC0A 3P49B 3AXKA 4YFUA 3PW2A 2L5QA 4ZTJA 1MN7A 4AG1C 1XJWB 3T9NA 4JI4J 1RT1A 1YZ7A 3LO3A 2UU9F 3W9IA 2BANB 2DH9A 2A36A 2XD0A 4IUUA 4LFCF 3N6LA 3A5ZB 2RU3A 1U8WA 3L2WA 4ANCA 2VGNA 3EHRA 2FRYA 3B6BA 3OJSA 3JYTB 1QVFR 1SIWB 3I5SA 1UFKA 4KO0B 2ATCB 3C6TA 1YJWQ 3PJXA 5GMKi 1U0HA 2XU8A 4C6AA 4CO3A 1YGYA 2HFSA 3UA6A 4DF4A 4A8MP 5F8MA 1YVFA 2QYGA 1KR4A 3C15A 5D0RA 5GADU 2RE1A 2B7BB 2APOA 4O4RA 4OMLA 2MSSA 1C0TA 2YKAA 3TARA 2ZZMA 3CC2T 3OSNA 5L1IA 1GCPA 4DV7J 2NZCA 4IFYB 1YIJT 3JCMP 3FSYA 5DQHA 4ZKAA 4Q43A 4LDUA 5F3ZA 1UVMA 1Z9ZA 3C46A 2VPZB 3VF0B 2JOYA 1MU2A 3BBFA 1K73U 4LRFA 1QVGR 1WHKA 4JI8J 3ENWA 3SEOA 2KXDA 2JT4A 2CNOB 4NLTA 5I3PA 2ZAEA 3OYFA 2LQ9A 4G1QA 1Y5LB 4KT0C 2UUCJ 1PC0A 2E5HA 4X9CA 3MAAA 3LP0A 1RDRA 3UCZP 3M6UA 5KYUA 2GJFA 4IO1A 3OW2R 4JYAJ 4OHWA 5GANg 4PLLA 2IBOA 2UP1A 1RHUB 2KYZA 1QAYA 3GMGA 4F7UA 3MEKA 2E9TA 1XTDA 5ETLA 2JLGA 3VGUA 4L74A 2IY5B 4NXMF 3E9FA 1NEEA 5E3CA 4HT8A 5CZXA 4JS5A 5HJXA 2HFVA 4PJOF 2B8QA 4LF8F 5KFKA 1QWFA 3AOAA 4JP8A 1I4K1 3M30A 4PWWA 2AJ1A 2MF2A 4X62F 2QO3A 1ELOA 2XMFA 4WZMA 1RAGB 2E66A 3RB4A 1UVIA 1AWXA 2KHDA 2FHOB 3MR7A 1HWKA 3GPAA 3CDBA 4AL5A 2I0XA 4WFNQ 2FPFA 1IKYA 4O3QA 1P27B 1WEXA 2MSTA 4MYTA 3KDOA 2HD0A 2AD9A 2QMWA 3N4WA 5CXTA 2R7QA 2C3MA 4K4XA 1RABB 2Z57B 5M2PA 3OL8A 4DL0C 1OIAA 3G71A 2QSWA 4H4OA 3L2ZA 1JXMA 3C12A 4IH6A 5CQXA 5A0DA 3QHSA 5GANh 1VQOT 3J7YU 5DZ6A 1VQLQ 5DRKA 2MZJA 4AG2C 1Q0NA 2G1DA 4URQU 3BGOP 2Y4XA 4ZPCA 1OYDA 3MMBB 1FKOB 2ZPEB 1SF9A 3R7SB 4C0DC 3I55T 4ZOSA 1DFDA 2C28A 1NDCA 5EC7A 1YCSB 2BANA 1M1HA 2RF2B 2LCLA 1KONA 4CM2A 4LVOP 3M6VA 3PYGA 4NLVA 1HYOA 4N0AA 1XK8A 4EYHB 2YXYA 1HA1A 2CJBA 3JYTA 2YH1A 3A8GB 4LF9F 4B3MJ 4KO0A 3Q2SC 3CC7A 4ZDNA 4WK1A 2IVFB 2NPFA 3CPFA 1FNMA 4KT0E 3MEDB 4ECWA 4CH1A 4JI4F 2QTXA 3M8ZA 2Y1JA 2W9CB 1MROB 3QGIA 3PCOB 4WFYA 3MEUA 1PO6A 4IFYA 3DLGB 4BBYA 4LREA 1VYUA 3UN2A 4OMFB 1DY3A 3JB9G 4ZIVA 4KRTA 3KK1B 5LJ5g 3MTKA 1U1LA 1NZ8A 1UJYA 4AFFA 1YWPA 3CCVT 4Q5WA 4PJOD 4USWA 4TY9A 5EGYA 1JNRB 3GLJA 4GO7X 3T5JA 4M5DB 3W1YC 1H73A 2ALZA 2BRLA 1AZGB 4DV7F 2XBPA 2OTJT 5LL6d 1XC9A 2ZHBA 4WCEQ 4GBQA 1T94A 2BQUA 2GHVC 1I1JA 2JMCA 1S1UB 3ULHA 4K4YA 3NMZC 3PRVA 2VFTA 5LM7E 4DCOB 5FWBA 2C1EB 1MWYA 3M8QB 4KYZA 4FYXB 1PKUA 3FUYA 2QQRA 2VFRA 1NZ9A 4U96A 2DVEA 5E3AA 5LJ3e 5GAN4 4M4ZA 3BDEA 1RTJB 3OYBA 2CQ4A 2VHGA 3UT1A 5GANf 2DGOA 4JI8F 3G8SA 1SPKA 4ZGEB 2ROEA 4KB7A 1FHTA 3MPDA 2VZ9A 1PJ7A 3JS9A 4JJCA 3NS6A 2HHTA 4KGZB 1VQ9S 1M8VA 2UUCF 2MWPA 4B9UA 1U24A 2R8HA 3S3NA 4TY8B 5LJ5h