2BE9B

Crystal structure of the ctp-liganded (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
148
Chain Sequence
MVSKIKNGTVIDHIPAGRAFAVLNVLGIKEGFRIALVINVDSKKMGKKDIVKIEDKEISDTEANLITLIAPTATINIVREYEVVKKTKLEVPKVVKGILKCPNPYCITSNDVEAIPTFKTLTEKPLKMRCEYCETIIDENEIMSQILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate carbamoyltransferase
publication title Crystal structure of Sulfolobus acidocaldarius aspartate carbamoyltransferase in complex with its allosteric activator CTP.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase
total genus 32
structure length 148
sequence length 150
ec nomenclature
pdb deposition date 2005-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
B PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 2be9B02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 2be9B01
4FYWB 1F1BB 2FZCB 1PG5B 5AT1B 2FZGB 2QGFB 1D09B 1AT1B 1RAIB 4KGZB 8AT1B 2FZKB 6AT1B 2H3EB 2A0FB 2QG9B 4FYVB 2ATCB 4KH1B 1RABB 1ZA1B 1RAHB 2IPOB 2YWWA 4E2FB 2AT1B 2BE9B 1SKUB 1Q95G 4AT1B 1NBEB 1RAEB 1XJWB 8ATCB 4WTOB 1TTHB 2AIRB 1RAFB 1RADB 1RAGB 2BE7D 4KH0B 1RACB 3D7SB 1EZZB 1I5OB 4FYXB 3AT1B 4F04B 4KGVB 9ATCB 1TU0B 2HSEB 4FYYB 3MPUB 1TUGB 1R0CB 1R0BG 4KGXB 7AT1B 1ZA2B 1ACMB 4AMCA 1RAAB
chains in the Genus database with same CATH superfamily
2HD0A 3PX0A 4DCJB 3OSNA 2IDEA 4ZVRB 1N48A 3GF5A 3N9UC 3LOUA 3MAHA 1U02A 1HYOA 1IQZA 5KFGA 3SDEA 2HWTA 1DLOB 1IKVB 1GXUA 2X3XD 1UVJA 2RRBA 3MCAB 4PXCA 1TK0A 4PWDA 4KJIA 2GMLA 4OMFB 3MUTP 2VPWB 2I5JB 4PYAA 2CAJA 2MKCA 4M5NA 4JZ4A 1V5IB 5GMKj 1M5PC 2NYSA 4V19J 2KHCA 1KDNA 5KFMA 2MSSA 1TL1B 1F1BB 3TSZA 5BYSA 5AT1B 1JWWA 1D1CA 1QVFS 4Z89A 2K9GA 2XTJP 2KG0A 4OZLA 4ECWA 1SKWA 4FW1A 2HBQB 1SUQA 2HAXA 2DZCA 2YWGA 5AJ3F 3RU0A 4IUUA 3ZNJ1 3EXCX 2GNKA 1PG5B 1GX5A 2AWZA 1BBZA 3CSKA 1D1AA 2DGVA 4EK2A 3RBDA 4DV2F 4EZ9A 1GL5A 2VOOA 2EPDA 1H2UX 3S1TA 3PYEA 3GOXA 3IC1A 2K7KA 3ITHB 4ZVOB 1AA1B 2ACYA 2M51A 3O2IA 4QWAA 3CXCA 4K4SA 2IVYA 3ZZUA 3LF0A 1ZLMA 5KG1A 3IAM9 2DGQA 2CUYA 1K1ZA 1DTQA 2XYGB 4GVBA 2HQIA 3CJQA 4C92B 2O4XA 4DJBA 3R5BA 4LF4F 2DRKA 2XI3A 5CAAA 2JLGA 4I2PB 5CKFA 2Y9HA 4AFSC 4LDVA 3WXMB 5CK9A 2AJFE 2VG5A 2YY3A 5E3CA 3Q8UA 1M1GA 1VRUB 5D6GA 2UXDF 2BACA 1LCKA 1R8HA 2E6ZA 2ZH3A 1LJOA 4HVWA 2AKLA 2QV6A 2FB7A 4J9QA 2HNYB 1YJ9A 1G83A 2HQFA 3IRXB 5H9EJ 4NLVA 1ABQA 2B9EA 1FJEB 1RWXB 1SJ3P 1G8XA 3G8QA 4B9UA 2KRNA 3K5NA 5DQHA 5IHNA 2AT1B 3QSUA 3OL9A 1BGXT 3TUIC 3TR5A 2DFUA 5ETRA 4LF7J 1VBYA 2COLA 3HD1A 2DB1A 1T8EA 1FWKA 4XTZA 4EBDA 1UMJA 1VBXA 1GTHA 5EDWA 5J2QB 3MCNA 2VQEJ 4JI6J 3TVKA 4OI3A 3NGPA 3VAJA 3MEKA 3QKJA 1T94A 3VS3A 2UVWA 2Y4XA 3AJDA 4N4IA 1UVNA 2PA3A 1XTDA 1YJUA 3I4PA 1UFLA 4C8ZA 3UWNA 2KXFA 2F2XA 1Q7YC 3JSRA 4PXBA 1VQNS 2XI9A 2IMOA 3HHLA 3SSQA 4B3SF 3PX4A 1WF2A 4PPDA 3OSSC 3DCAA 2DO0A 4I7FB 4LQ3A 4DR4J 4KRWA 4M7AD 2N3LA 4LR8A 3UD4P 1KJWA 3SFUA 5DG7A 1F5CA 2RQKA 4RKUE 2QYGA 3Q8PB 2IA0A 2VKZG 3W66A 4E7IA 1HQEA 2QA2A 2W2MP 2D7SA 3EHQA 1VRQC 1VIXA 3GJTB 2W9CB 1UJYA 3OQ5A 1R8CA 1FJGF 2R2TA 1N36J 4OYOA 3GPLA 2E1CA 2RF0A 3CCMS 2BOAA 2W9BB 3RB6A 2E9RX 2A08A 3K58A 2XDPA 3A12A 1WLPB 3KK2A 2FHOB 2BZYA 2XI2A 1RTIA 2LEBA 2E7XA 2DGOA 3THTA 1Q7LB 3U02A 1S0VA 2CYZB 4F4YA 4FPRA 2YLCA 3SEMA 2DGWA 1RT1A 3JCMh 4DPUA 2GA7A 2K06A 2XK0A 4BLGA 3RR7A 3R5AA 3T9ZA 5KFQA 2VQFF 4GLMA 2WOMB 5KG3A 2VWFA 3EFSA 3TEHB 2HW3A 3CW2C 3PGGA 3CCVT 1AYEA 4O3OA 4N47A 3AXMA 1M90C 4B9LA 4IOBA 1FRKA 1ZM3A 3CJ5A 3GNGA 2J6OA 2HG4A 1T9VA 2YPZA 3RB0A 3OTOF 7AT1B 2RSQA 2CPEA 1W2BR 4C8MA 4NL2A 1ZSZA 2RB7A 4OFZA 2DH8A 2EYQA 3MM5B 2GJFA 3BO4A 4B3MF 2BANA 1KQ1A 1U8SA 3UCGA 3GE9A 4ZP7A 1RAEB 5IT9E 3CD7A 3EHRA 2V4JA 3S3NA 2VB6A 2IRUA 1T05A 4RW6B 3J7AF 5DJBA 4PJLA 3N5BA 3OS0A 2DHHA 1W2BA 3EGDB 4CZCA 1N5SA 5EUHA 1SB6A 1R8PA 2GO8A 4MMKA 3CPFA 3ZXWA 1KNZA 1XBWA 4H4MB 5B0BA 2CQHA 4HKEA 4J6XA 4KYZA 1O6XA 5CXTA 5ITHA 1GBRA 4NXNF 4RBTA 2PO4A 4DR5F 3TEEA 4M77G 2C2EA 1T3SA 4IG0B 2RQMA 3JTOA 4JI7J 3BN4A 5CR2A 1HWJA 2DR8A 1S9GB 1WA7A 3F73A 3D0IE 2CQPA 3EG2A 4M7AE 3HKWA 1N8RU 4Z2XA 4DV1F 2XLJA 3CCTA 2C3UA 1F2HA 3ENWA 2VUGA 2V34A 1W4SA 4V19X 4DLGA 2V69A 4BE2A 4Y2MA 4FNIA 5IS2A 2RI5A 2G0IA 2J76E 1K8AT 3V6JA 4C8QC 2RILA 3R7NB 3SFMA 1T9WA 4H4OA 1KIKA 2M16A 4XTXA 5IT4A 2BOPA 2FHJA 2QQBA 4USMA 2UXBJ 1DAXA 4I0WA 4DPYA 2KM8C 2RMOA 1UZDA 3SCKE 1H38A 2PI5A 1G1XA 2UUBJ 5KYXB 2NUTA 1RAHB 3PKYA 1CQNA 3TWZA 5KFAA 1W70A 2E3HA 1F9HA 2L9NA 4FSXA 5A0GA 4CRIA 4OV1A 1U8RA 4KO0B 4OYWA 4M77A 3JCMQ 5CZXA 3KK3A 2V4QA 2VKNA 5B0GA 3GLXA 3RAMA 1UUEA 2LCLA 1JNRB 2HL3A 2V94A 1NDCA 3DU6A 3OTBA 3MOZA 1LVKA 4Y2KA 5A8RA 4Y3CA 1ICEB 1U1MA 4ED1A 4DEZA 3HSDA 4JLGA 1FK9B 2QDYB 3CCVQ 1NMEB 5MAOA 2JUFA 3G6EA 1DTTB 3PO5A 5HL7Q 4DG1A 1NZ8A 1EJ7L 2QEXS 4OGCA 4Z88A 4RW4B 2IC3A 4MK7A 1VQ7A 2DA9A 2C3PA 3ENVA 4TYAA 3MPUB 1YJNS 3OS2A 2KSSA 1RLQC 4G65A 3NNCA 3W60A 2BQRA 4P2MA 4NLDA 4FF3A 2XMKA 5JVGQ 2BJEA 4XAKA 2G6FX 1QLNA 4FXVA 2QQRA 3GU0A 2E66A 3J80U 2YUNA 2PI4A 3D5MA 3NL0A 2F9JA 4BC9A 1S9EB 2RUSA 4ZGDB 1EKSA 2GTJA 1FWPA 3GLJA 1KD1T 3NGKA 3PYGA 3JCMb 1Q81R 1NG2A 3ILOA 2X1FA 6AT1B 1Q53A 2WVFA 2OPSA 3GFHA 1JMTA 4Y34A 1WHYA 1M5KC 2LXUA 4ZP8A 1JRIA 1WD6A 1HI8A 2KMTA 1T0TV 3RBXA 1S1XB 2C28A 4LXCA 2HURA 4ZP6A 4QBUA 1OJ4A 1Q86R 4LRAA 2YNFB 4P71A 2ZDPA 1PSFA 2ZH4A 3G71A 2YKNB 3VVUA 1RAIB 3M2UA 3ZZOA 1APSA 3PW7A 1P9YA 4BB7A 4X4QA 1GEHA 4I6WA 3T5JA 5GAN2 1G2BA 3BSOA 2F8HA 5FWCA 4DV5J 4X9DA 2Z57B 4PJOB 4PCQA 4RW9A 3OXLA 3J80Y 2OO4A 1TFWA 2YX4A 1QVFR 1NDPA 1IVZA 1BD6A 1V6HA 5IOLA 5KOXA 2X4JA 2PU9B 3BH7B 4M8LA 5KYWA 3UQSA 3OA6A 4N8NA 2KGTA 1RT4A 3D67A 1H3DA 1NYFA 1X5PA 2DHXA 4RR5A 2JN0A 4F8RA 4XIUA 4WXWA 1C6VX 1CC7A 3SI8A 2KI7A 3FSXA 2H5EA 5FDLB 3OYEA 4B9VA 1YK9A 3IM8A 1QVFA 2O66A 1EKRA 1YCSB 1PILA 3CC2T 1ZX6A 2EGAA 4DCPB 3VVTA 1XN9A 2LU2A 2QA4T 3ZTRA 2X9HA 3TQ7P 2ZE2A 4XTTA 3CE8A 2KT3A 1YWOA 4M5KA 9RUBA 3LH2S 2ZPIB 3CMAA 2RB6A 2DR7A 3E51A 1RHQB 1F3VA 1QWFA 1N54B 1TXQA 4OZNA 3NLCA 2WB1D 3SWNC 3C12A 1WXTA 2AZSA 1FE0A 2F5GA 3EM1A 4ME7A 4BDYA 1VS3A 2HMAA 4LF5F 1HNWF 4DV6F 3T1HF 2VH7A 2V2KA 2ILYA 2H51B 3H5YA 3K5MA 5I2SA 2DO3A 1HWIA 2ZH2A 2EYXA 1S1VB 2DKOB 3MD3A 5K8NA 2H5IB 2V2ZA 4ZTFA 2VG7B 1NKEA 1NZAA 4RUCA 3H90A 3C6TB 3QAEA 2DL3A 5E3PA 1UFFA 1Q81U 1VQ6T 3TA2A 3S01A 3DOMA 4Z8AA 2R57A 2EBGA 3I4HX 3JB9J 4EMHA 1JXOA 1J2VA 2LRQA 2DYAA 2PE8A 3QBCA 2VVKA 1PBUA 5T7LB 3VUZA 1Q86U 3UVJB 2PEHA 1OULA 2V50A 4H4KA 2PSZA 5A8KB 2IM3A 4OYBA 4WFBQ 2ZWOA 1RT3A 4NI2A 4NYPA 2QO3A 3I35A 1MN7A 3NWGA 3BO3A 2MAMA 2MOXA 1M8VA 1XIQA 3HHEA 1RAFB 2E5JA 5DDRC 1T95A 5DDOC 1EX8A 3B4DA 1B0TA 5I21A 5M2RA 2Q66A 3KK1B 5GAOn 2CP3A 4IO1A 1Y5LB 4MYUA 2HIQA 1AXQA 3VHQA 1PIEA 5KFVA 1JJHA 3KUGA 4HT5A 1HQ2A 3G6YA 1WJQA 2D69A 4OHYA 3FDSA 2DNLA 3LGFA 3IM9A 4EBCA 4K4YA 1UVLA 1QVGS 3E9GA 3NFCA 2QGFB 2QL7B 3MEDB 4NYOA 1X2QA 2NUUG 5LT5A 2ZPHB 4WZMA 1NHKL 3NXZA 3RMQA 3FBBA 3BV8A 1U1LA 1VQNA 2B4PA 3L2RA 3QPIA 4J9OA 2DTJA 1R0BG 3ZFJA 5KYYB 3META 3M0RA 4DOVA 1P8GA 3CPWS 1X5SA 4KFBA 2CQGA 4QJVA 1MMNA 5ETVA 5E41A 3H5SA 2EQJA 5L1KA 1HR0F 3Q8SB 5C24B 1I1JA 3SD4A 2DZ9A 2V8GA 4RTTA 2HNDA 2DTOA 5IQ6A 4TY9A 1HMVA 5ETKA 1LOJA 1E6VA 4NMLA 4WXOA 1I3OB 3EAEA 2OTJT 1FF2A 2YX1A 4ZTJA 1IKXB 2ZPEB 3OLAA 3T6JA 2YUOA 4PFPA 5M2UA 1U45A 4OIXA 3CC2Q 3QSYB 4P2SA 4Y2CA 2X1BA 1PRLC 2MKYA 2QA4Q 3VV2B 2JSXA 5LMUJ 3S3OA 3PR5B 3J7ZT 4CNYA 2QJ3A 2GQ2A 3PKMA 2V8JA 2XMTA 2ZH7A 3EX7B 1LFWA 3OW2P 2VBZA 5BYQA 2HK3A 5LJ5e 2FD2A 1RYRA 1UECA 2Y1RI 3FEXB 1XERA 1YBAA 2CXEA 5FROA 3BREA 4Y28E 1FDAA 1TL7A 2V8VA 4C3MA 3V8LA 2HKNA 3H2VE 2KB2A 4JUZA 1Q8BA 2ZWPA 3OSVA 5I2MA 1N88A 5KH6A 3HT0A 1RTDB 2M8DB 2JW4A 1R27B 2QT7A 4JP8A 3C3LA 3N01A 2ZITA 2HBPA 3C16A 1VQ6Q 3L2QA 1PC5A 3DOKB 5KFTA 3W2WB 2W01A 3VU3C 2AW0A 5HP1B 2HLTA 1N32F 1SSFA 1D9AA 4ZJOA 4JB8B 1WYXA 5SZTA 2DGXA 3CCRS 4R5PB 2GFAA 2ACMA 2CPFA 5F8HA 1N52B 4M5DB 5FJ4A 2YH0A 5HMWA 5CQXA 4F2SA 5B09A 1AFIA 2EVZA 1FRMA 3EZOA 1N34J 3CC4S 3GYXB 4TKTA 2EKYA 5GAEI 1JLEB 1V9OA 1YTYA 3EDRB 2X3GA 4YS2A 3I55T 1RE1B 5I3UA 1RXOB 1TV6B 2G2YA 3QWUA 2W0ZA 1IXKA 3PYDA 5DGBA 3BDLA 3A1PA 3WVEB 4KUDK 4OZ2A 1K9MT 3NP5A 2VL1A 2JFDA 3OYCA 2GW8A 1RJJA 1Y96A 3DRSB 1FXDA 4Y0FA 2XULA 1X6BA 2AQ4A 4MMOA 1GMWA 2PD1A 3PW0A 4WU2A 4CLTA 2HRUA 1VJWA 3MDFA 4LDWA 4K59A 5CYQB 4C0DB 4W98A 2LQBA 1O5JA 3CCLS 4JS4A 2JLFA 2D0QB 3DDIA 2ED1A 1KHVA 2C06A 3THVA 1SKSA 1OMSA 1BC6A 1L3TA 3HFOA 3AT1B 5M2PA 2IY5B 2JXBA 4C8KA 3UI3A 5KG4A 1M5OC 3REBB 2BE2A 2M88A 1YGYA 4DU8A 1R0AA 1NH8A 2MLXA 4M7AG 2K3IA 2F7VA 2ZJPQ 4QR0A 4GBQA 4ZMMA 5HATA 5GANj 2EKHA 1JXVA 1B7TA 2P9CA 4IFVB 4KGKA 2OTJQ 5GMKe 2PUOB 3IS9B 1QUPA 1IGUA 2M9UA 5EG2A 2XDBA 3WHIA 1W6XA 1YJVA 4C0OC 2Q3PA 2WTFA 1QLYA 3OS1A 3W5YA 1V29B 4LSNA 4K4XA 4OP0A 5AJ3J 3SBMA 4C92F 1BMQB 2Z0WA 5HJYA 2MMPA 3J7AN 3OYDA 4DV2J 2HS4A 2DNQA 5HJXA 4GO5X 4M5LA 4C3KA 1MW7A 2MHNA 3FJ2A 1UCNA 3AOAA 2Q6BA 4ZPBA 3A13A 2XMUA 1RL2A 5HMXA 1IM4A 1H0HB 3KLIB 4OMFG 5KFWA 4DR7F 3MM7A 2DEUA 3DRRB 1O75A 2RQRA 1RAOA 2J05A 5I3QA 1P1LA 1K8AR 5F3TA 3OV7A 4F0KA 2RQWA 3R7SB 4ELVA 5C0MA 2QEXA 4DXLA 5FU6B 4LF4J 4RU9A 5J2PB 4WZQA 4L72B 4HL9A 1YJNA 4LJMA 1G5VA 2BEFA 4M7AA 3O5ZA 2NR0A 5J2MA 1KVIA 3FMBA 1QM9A 1K0TA 4XK8C 5J2NA 4DBQA 3RW7A 5EX3A 1K4US 3MAAA 1RI7A 3FC9A 1M30A 1NAQA 1FI4A 5KCOA 1FERA 3Q8RB 3EVOA 2YNHB 2BJDA 2A3LA 1XTZA 3CXCP 4F0MA 2NYHA 4XDDA 2KU7A 5KYUB 2VFRA 2GIFA 3TI0A 2LT4A 1U06A 3I55Q 2MDAA 3BDPA 3D9BA 1WJSA 5IN1A 3EGVA 4OZ1A 2FJAB 1VQ9T 3AD9C 1DLOA 1IKVA 3JCMc 2IAJB 2K2PA 3HSGA 4O44B 1Y11A 5IT9U 1YIJA 4RU2A 5GAN4 4RW8B 2I5JA 4IQMA 3LWIA 2NWMA 4QT7A 2BX6A 3G7ZA 4O0NA 4NOHA 4ITSA 2MQLA 4CLKA 3KJFB 3T19A 3VCDA 3WIUA 1TL1A 2L3QA 1K73R 3MPWA 2J6TA 3JSBA 4O23A 4URGA 3EZ5A 4B3SJ 2K3YA 3GJSB 1P9QC 3CB4A 2QYZA 4J37A 4WCEQ 2GFUA 3FB9A 2K2VA 4RNFA 2JHEA 3QIPB 2ZM6J 1S6PB 3EVWA 2JM8A 3TO8A 1IBMF 3HTRA 3RZAA 2JFKA 4DSIA 2HHQA 4DQRA 3QQCD 4DR6F 2IBKA 3QDRB 4FSSA 3R6NA 3ITHA 5DLFA 4DL3A 2R2SA 1E6YA 1K8AU 1FJGJ 2BQ3A 3ZEHA 5D77A 1Q7YT 5CA5A 2IM1A 1YFNA 1HD0A 5DY9A 1ZQ1A 5C6SA 1MU2B 3CDEA 4J9NA 5C42B 1OU8A 2GJ2A 1VOMA 1VRUA 3FZ2A 1FRIA 1U47A 2D6FA 3X26B 4FDFA 2EW9A 3QZ8A 2WVDA 3EE3A 2FY1A 3NMRA 3K57A 4F7VA 2EIFA 2HNYA 2VQFJ 5GAOl 3IRXA 4L6V3 5CYMB 2L3MA 1FHTA 1ZSZC 3R5DA 2RO0A 3QGHA 3A98A 2EC0A 4X4VA 2V26A 3OJSA 3BEGB 3THKA 1WOPA 3OTOJ 1CEZA 2H4YB 4X4RA 2X3WD 2BKOA 5ETSA 4BS2A 1KC8T 4ZLLA 4NZ7A 5HROB 3OBIA 5HCKA 3U1NA 1X31C 5GAN8 3EJMA 4ZVGA 5DDPC 5J2QA 1QVGR 3PVLA 2KQWA 1X4FA 2GC8A 5HSPA 1AUDA 1S72S 3REAB 3DLEB 4JJDA 5HK4A 4NOYA 4DUTA 3FUYA 3N0VA 4QIEA 4ED5A 2DHAA 1IBLF 1IGQA 4QU7A 4II1A 2L2PA 2ECZA 4KIAA 1QVGA 1J27A 1WG1A 3B54A 3OFGA 1S4FA 3CPWR 1VQ9Q 1OSCA 4NXNJ 3ISND 2B9WA 2DRDA 2KHDA 2DMOA 2YLBA 5E7OB 4DR5J 4WP9A 2JVVA 2WBMA 2GNCA 1SC3B 3JSYA 5LJ5Y 2KR3A 2NLWA 3QRQA 4FXDA 4I7FA 3O8WA 2W8KA 1S57A 3G82B 3QAUA 2OAUA 1KK7A 2LNVA 1VMBA 4K5SA 1TL4A 4PEOA 3H0FA 2FLOA 3CPWA 1HPZB 4J9UE 3K5PA 3CD5A 2ZH6A 2BM0A 2XO6A 3MM6B 2RJDA 3GMGA 3CJ4A 4OMOA 1W2BP 4OX9J 4LF9F 2CQIA 5ECAA 3X1LB 1U1OA 3V7RA 2DE0X 2E5IA 1ULRA 1VUBA 3L2ZA 4CP5A 5KFYA 2EQKA 3R6OA 4IH6A 5GVQA 3SQOP 3TSWA 3LA0A 4JV1A 3MM8B 3MR5A 4RTUA 4J91A 4JOUA 1C1AA 5CABA 2DXEA 4C5GA 5GAMh 2CIMA 5IV4A 5CVIA 3GSIA 1QE1A 1VQLT 2VICA 3TARA 2HNIA 1WF1A 4NA2A 1PCXA 5FU7C 5KT3A 4DL7A 2MHEA 3PTWA 1H3HA 3EDQB 4GKJF 5IFMA 2UZAA 2GQIA 2J9DE 5DZ7A 3MM5A 4AFUC 2R8HA 2ROEA 4C11B 4Y2IA 4X4PA 2FLNA 5J1NA 2OD4A 3MFHA 3R7BB 3MM9B 4RW6A 3W62A 1TELA 2YXYA 2AV5A 4TNOA 1UA0A 2VC8A 2AGQA 2MY8A 2WSEC 3EGDA 1RWKB 4RW7A 4FL6A 1JK9B 2BABA 5GAN7 4LUEA 2HHSA 3W9HA 4QCLA 3A8MB 1B34B 4F26A 1JQQA 2RK2A 1AFJA 3NMAA 4OHVA 3R8YA 1S6UA 5K8MA 3H0IA 2GGRA 3HJFA 1YI2S 2ZKTA 3C2PA 3RR8A 2Z30B 5JMNA 3CD6T 5KTQA 4IG0A 1HK9A 2FZCB 3OYLA 2RKIB 4JDSA 5DM7Q 2EYZA 2GGPB 2ED0A 5H9EK 3D54A 4NLXA 5LL6S 4IRCA 4P10A 3QWPA 1QW1A 4A4HA 4PJOF 3CCEA 1M4ZA 3CCQT 1Q81C 2KYBA 3RBEA 4I2QB 2HYIB 4ZOSA 5ADZA 1WG4A 5FD1A 2KAFA 3ZZYA 3GIIA 3CWJA 1R3NA 2H1YA 3SDEB 1W7WA 3IR7B 3R1LA 2Q1LA 2P9GA 1Q86C 4PWDB 3CCLA 3D1HA 2SEMA 3UATA 2AKKA 3PMTA 3I9V9 3BFMA 2KKHA 2CT3A 3VAFA 1Z1ZA 1QUVA 1TK8A 2KO1A 3LUYA 1QAJA 1OIAA 1UVKA 2G0CA 2CG4A 3T5KA 3HFVA 2WW4A 5KYXA 1FVQA 3W63A 3FEYB 4U8YA 1ACMB 4ED4A 4D8DA 1XQIA 2A2DA 1JLFB 1IRXA 4KO0A 4M78B 2KI2A 3IO1A 1AZGB 2PC6A 3QATA 3AXKA 4YY3F 1LWCB 3JQMA 5GADU 3PY8A 2NXEA 4LD6A 2IM2A 4ZHRA 1H74A 2LP5A 2HRYA 1QJHA 1WNLA 2BUNA 4CH7A 1VLYA 4JI5J 1JX4A 2LJ3A 1EIFA 1VQLQ 3G6VA 1BI3A 5LM7E 5HLFB 3GJRB 1FK9A 4BY6C 4ILLA 2E10A 1DTTA 1CSKA 1DTQB 4GVBB 4JRIA 2DRMA 1IBKF 2O4XB 5T41A 1AUSL 2FPEA 1C2PA 4LF5J 1HNWJ 1MWYA 4RW4A 4DV6J 4ANEA 2CPHA 4DV3F 1ABOA 4QWEA 4DEXA 4HHUA 3J7YI 5GAMf 4N4GA 1WWHA 2W2OP 1MN9A 4F7UB 1TTHB 2K3KA 4P72A 5L9XA 3HHDA 2X4YA 3WZ0A 1QVFP 3RB3A 4LSLB 2B0GA 4QQ6A 2DBMA 4NLOA 3D6TB 2BDPA 3R6GB 2IM0A 1TL3B 2A3JA 2H54B 1S9EA 2I0NA 4RTYA 1Z4UA 2CP6A 5GMKl 4H4KC 4MK9A 4G1PA 1VQ8S 4CI0B 5HVGA 4CT8A 1U1SA 3I0RB 4DLEA 3LGHA 4M75B 4ZP9A 3BGLA 5IHKA 1OSDA 2PDAA 1ZZNA 1S1XA 1XNRF 4E47A 2ZC4A 2QE5A 2YNFA 5L38A 4A4GA 4AQYJ 2YKNA 3SB2A 4ETZA 3CD6Q 3QJJA 2ZBRA 3TAQA 3QG1A 3KXTA 3BSAA 3WX8A 2DNPA 1LW2B 4TN2A 1I8FA 1C1CB 1QAIA 1WQWA 1V5VA 4K2JA 4G3IA 1QCFA 1NSPA 3C14B 3FQKA 1NLOC 2JH3A 2WACA 4J6WA 2BMBA 2RDJA 3CCQQ 2HVDA 2AJ4A 2W24A 3MMAA 5DG8A 4PZVA 1D1BA 1QP2A 2ZPFB 3K5OA 4CO5A 1TVRA 1TKTB 2NS1B 2CJYB 3HHLB 1JLAB 1NM2A 1S7HA 1U1PA 4DL0C 1FEEA 3DYAB 2DNMA 4OX7A 1X0FA 4QW2A 4LIRA 4YMEA 2JVRA 3JCMJ 1F0XA 1SC1B 1BIBA 4M94A 5FDLA 2GZOA 3OYKA 3QJPA 3URGA 2POKA 3SSRA 4CLYA 4KR0B 2PFFB 1Q4RA 5CQGA 2CREA 1K9MU 5EWFA 4BACA 4MIBA 4ELZC 2F40A 2RMLA 5M9OA 2OGUA 1F60B 3HSJA 2UUCF 2JC1A 2BKNA 5JUMA 1WHXA 5KFPA 5ETQA 1QKXA 2PMWA 3BDUA 2XDDA 2DXUA 3CMES 3QGPA 2K6DA 4QVDA 2CGHA 2LJ1A 3AD8C 2RRAA 2ZZNA 2QLFB 3EFOA 3KUEA 3QYHB 3KG1A 2DIQA 1Q79A 4DV4F 3L2UA 2HQEA 3OMCA 2HIYA 1GXLA 4XU1A 8ATCB 1AROP 4UTGA 5GAMg 4P2FA 3ER0A 5MLCV 1S1VA 2CP0A 4ZPCA 3A3OB 1NJYA 1BQXA 2VG7A 1SQGA 1RZMA 2NSBA 1PC0A 3POTB 3C6TA 4CNZA 3QWXX 4IIOA 3ZC4A 2Y4YA 3B8HA 2CSQA 3MEUA 3PNWC 1S0NA 2KYMA 5FWBA 5IXBA 3K17A 2DNRA 2PMZD 4LN2A 3MO8A 4B9NA 2DAQA 1RA7A 2E9ZA 5KYNA 5T7LA 3UVJA 3PIPA 2YNIB 3OHBA 2D74B 2RHSB 5A8KA 2OMLA 4LF7F 1LWEA 3NCPA 2JDJA 2AEFA 3THPA 2VQEF 3U27A 2QASA 4B9WA 1S1UA 1GBQA 3EGZA 4HXJA 4DPXA 1YHQT 1KLMA 5GAHI 2N7YA 4J7IA 4ECYA 2R5AA 2NREA 1K47A 4WCIA 4Y91A 3EICA 2V68A 1WXUA 4ID8A 3DLLA 3M2VB 2F5KA 4C2MA 4Q8EA 4OJHA 4DPOA 2H5JB 4RKUC 2DBKA 1S72A 1NB7A 2QFJA 5KFUA 2GX8A 4J9FA 2O3DA 3MEDA 1QSYA 3LPYA 1H8KA 3H40A 4CLFA 3I56T 2ZCFB 4EYIB 1KONA 2LECA 1O9SA 3O3LA 2IMWP 2FDNA 1AEYA 1LWXA 1BQMB 2MPUA 2BRKA 2L08A 2E12A 4MZTA 1RHKB 2EW3A 5KYYA 2B4UA 5DDQC 3NNHA 4KY3A 2XMFA 3R6LB 3BS9A 2GAGC 3EGUA 4IG3B 3D7SB 1FWLA 4PWWA 3BQ2A 4CC3A 2Z56B 1Q5VA 5C24A 3V5RA 4C8QF 1Y00A 1NXIA 1ZETA 3GR0A 3DDKA 4CLWA 4USHA 3TUZC 5DETA 3ENAA 3OFHA 4IKFA 3HVTB 2LCWA 3A8EA 4H4OB 2JEGA 1S5ZA 3M9NB 3RR6A 1RWPB 1UGPB 1VA7A 5GMEA 5CD4A 4RUHA 3R5JB 4FP9A 1V3ZA 3NCRA 5DM7R 2NUTB 2BYCA 4Y6IA 1HSQA 3GG0A 2IJFA 2CPJA 3B6BA 2XICA 1Q16B 4NLPA 3QYGB 4ATOA 1TAQA 4LF6F 1WXBA 3IFEA 1QTMA 4PK4A 3MEGA 1HNZF 1M5VC 2C2OB 2CQ2A 3CCSA 4B9MA 4W92B 2ASYA 3E01B 1ZAXA 3FQLA 4EDUA 1IUJA 4ANCA 2E3IA 4RBVA 1R8AA 1KEKA 3HM9A 2VBWA 1RTDA 2HHXA 3KOAA 2AKWB 4OB0B 2QTVA 5A8RB 5GMDA 5GMKa 2K1RB 4RL1A 4M78E 3KFWX 1VQOS 1KKHA 3W5XA 1Y0MA 3DOKA 3W2WA 2G1DA 4B02A 4DG1B 4RG2A 1Q7YU 5HP1A 3O44A 2QL9B 4M4ZA 1UEBA 2VU5A 1N4LA 2ABYA 2MSTA 4DR7J 3RAQA 4ZK7M 4N4HA 1SHGA 4R5PA 3PDNA 2OELA 4M5DA 2VJVA 2QZ8A 3W3SA 3MPYA 4Q0BA 3P8BB 2AEMA 4RTWA 2DR5A 4J6YA 3CQTA 4HI2A 4JI4F 2R8GA 2H65B 3OS5A 1K8AC 2ZBQA 2MZTA 1KTVA 1WNEA 3CULA 2ENMA 1Y7PA 2LVMA 1I5LA 1JLEA 2YNGB 4Y2AA 2H8HA 1YHQQ 2LMIA 3DGPA 2G13A 4CO1A 3CJKB 1E6GA 3TUJC 2C2KB 1URNA 5CKHA 4H54A 2CZ7B 2KT1A 4UZBA 4DUZJ 4KH0B 2OPSB 1YI2A 4F7UE 3D3CJ 3LQVA 1X8DA 2D8HA 3ZZRA 4ZLJA 2HWHA 4O0IA 3PRDA 3DRSA 4PG8A 1JQGA 2LZ6B 3RDVA 1WI6A 3R5GA 1WIEA 5KFXA 2AIRB 1KC8U 2WSCE 3M2UB 3I56Q 5CYQA 2JWNA 4DEYA 2R8KA 3BGRA 5F8MA 4JI2F 1YBTA 3W65A 1YJ9T 2DIUA 2CNKB 2ALYB 4ZNXA 4M75E 2QG9B 3JCMX 2R2RA 2DNYA 2OTLS 3H42A 2AYBA 4KKOA 4K4TA 3H2LA 2A36A 3LYIA 4Q2MA 1ZBTA 2KRSA 3QLHB 4OZ3A 4JV5F 4KV8A 1WF0A 3OBYA 1B0VA 4YDDB 5LXRA 1RT2A 1TR0A 4UUWA 1RABB 4IFVA 1F9FA 4DV0F 3IAS9 3US5A 4ZIWA 1N6QA 4ZCMA 2C0IA 2HQGA 2J0QD 3IS9A 3HRSA 2J9DA 4MZPA 2LKZA 2V2QA 2FC9A 2HZVA 5GAN3 2DL8A 1X5TA 2RM4A 3VGUA 2RHXA 5A76A 2DKGA 1RISA 3JCMd 4WKYA 4W4MA 4ED8A 2BJ8A 2CDRB 3DRYA 5L23A 1K73C 2LQNA 3O5TB 4KAIA 2BA9A 1X4CA 2ZE2B 2MGZB 2XSFA 2KFYA 1ITPA 2J7UA 3C66A 1IBMJ 3OYFA 4BI3A 5L46A 1UGRB 4M5GA 1NHUA 4DR6J 4IR9A 3CCUT 1IR0A 4BDPA 3GCXP 2ZBCA 4C92C 3N5FA 1FXXA 4KGZB 2OUGA 5G4DA 3TAPA 3KLIA 1UFKA 2V5HG 2YHTA 3RBBB 4P6QA 3ZO7A 1Y57A 4IQXA 3BDEA 1M2OA 2FHMA 2ZH9A 1TS9A 1JKHB 2VFSA 4P7VA 2A28A 4A47A 3CBMA 2CZ9A 5F8IA 3HDSA 2GIRA 2DJQA 2GQVA 1IO6A 1VYUA 3FRNA 2RQ4A 4KPYA 2CQBA 2KXHA 4O5VA 1X4GA 3ICLA 3TQ1A 2O5DA 4F02A 2L0AA 5GAOm 4N56A 2UVUA 1F5BA 1WC3A 4A8FA 3G1JA 2W2NP 5GAOq 2ROPA 1M1KR 3ZTSA 1C1BA 3M8SA 4ICLB 1OY8A 4E6RA 2AGPA 5GAN6 2CSIA 4WF2A 1WGSA 3HJVA 3Q89A 3OFFA 4MZMA 1XR5A 5T14A 1N5ZA 1VQ8A 2COZA 2UXCF 1CJTB 4CQ1A 4C0ZA 1M9SA 1WPYA 4NS5A 4M7DB 1RBOB 2LDIA 3VGSA 4IUTA 3MPVA 1TH7A 4PJMA 4C8YA 3CT9A 3JTPA 2LVWA 4EBEA 4J9HA 1MMAA 2IAJA 4O44A 1XWLA 2B8AA 1YBUA 4Q44A 3IMQJ 4ZIVA 1FESA 3BQ0A 2L3PA 4RW8A 1REVB 5IM0A 2WCXA 4XPCA 4IO9Q 3UE2A 4KBIA 1RU2A 3R27A 1Y3KA 4QWDA 1H72C 3S8SA 5C2CA 3RRKA 1YJ9Q 5KFHA 1IBLJ 1F3FA 3C19A 1S9FA 2ASLA 4P7TA 3BR9A 1AT1B 1SH2A 2R7WA 1HNVB 5IT0A 4OL8A 4NCAA 1X4BA 3VZHA 1YWXA 3RGIA 3QIPA 1S6PA 2MF2A 2P0PA 1CS4A 2VFVA 2XWXA 2Q79A 5HO4A 2EFNA 1YJWS 2HNDB 2B8PA 2GQQA 3C94A 3HPWA 2QC3A 1E6VB 3CCJA 3A3NB 3M05A 2IIHA 1YBYA 2R58A 3D4JA 2QYCA 4XTUA 2EWHA 1QAXA 4AE5A 2CQ1A 1KFDA 1T03A 3TJ8A 3SZ2A 1LOUA 3CMEA 2JJ9A 5FLXY 2CQ3A 3KLHB 4TYBA 1JNZB 2CYYA 2QLBB 2AEJA 2L41A 2VC0A 1MU2A 2KEAA 3GILA 1QVGP 3VAHA 3QNWB 3EG3A 4PKCC 4A4KA 3SEOA 4OI6A 5C42A 5H9FJ 3OR2B 4CC2A 3CCUQ 3S7RA 1GAOA 4URQU 4DQQA 3H98A 4ZJQA 1KQSS 1BE4A 1RWNB 2MZQA 1WC0A 1UWBB 2K7AA 2AP6A 1TAUA 2X4WA 2LCCA 4LNPA 3JAMU 4EO8A 5A0LA 5CYMA 3V7SA 1WACA 2HNZB 2QMXA 5LJ3h 3CPWP 1UPPA 1RCOB 1OQKA 3HHKA 1P6TA 3QJ6A 3OMGA 2RDIA 3KHGA 3I5RA 3I9QA 2VPZB 3QO9B 4GKJJ 1HIYA 3C16B 3I32A 4PFZA 1YJ7A 1FDDA 2OHDA 2DPIA 3NGSA 5HROA 5HVHA 7FD1A 3GV8B 4HCKA 1OQ3A 2G2ZA 3VAKA 2J6KA 1FT8A 2ZPBB 3WC0A 2ZNYA 1UDLA 2OX7A 3CDWA 3SMZA 3QJYA 4A8YA 3UNGC 2BW2A 2ZFHA 1VQPS 2V1RA 5F8GA 3OW2R 1RUSA 4FBTA 4DCOB 3DLEA 1X4EA 4LSZB 2QIFA 4LFBJ 4DFKA 2JEIA 1G2EA 3JQJA 4MJKA 4CC4B 5KFRA 1PJ7A 1X9MA 2MB0B 1FA0A 4BWMA 3L7OA 4J9DA 1YZ7A 4LRBA 2HGMA 1F9EB 4PLLA 2Z8QA 3G6XA 3VRYA 4X34A 2QK0A 4DDFA 3G6ET 1BCMA 3CC7S 3VWSA 3HFZB 3I0SB 2L48A 2CVEA 4P5NA 3TZWA 1VQ7T 4EIKA 3K89A 2LDMA 1OEBA 1BB9A 1F6TA 3M4YA 4OB2B 2GMHA 2VBXA 3BN7A 3FRZA 5D4PA 4CO0A 5I42A 3GG1A 4RJVA 1NK8A 4E7HA 2HFVA 5ETLA 1HPZA 2ESWA 2XIDA 1P27B 2MKSA 2ZJRQ 3MM6A 3CCZA 2VZ9A 2P6SA 1D0YA 1VISA 2MQQA 2C2NA 1WKJA 3DRPA 4Y28C 2W2PP 5L1IA 4N5SA 1Y10A 2VFUA 3ZZ0A 3BF4A 5J1EB 1VQ5S 2LQ5A 3DLGA 3NY0A 2DITA 4R0KA 4X65F 4HH1A 2HDAA 2M7SA 3BYPA 5LJ5j 2LQJA 2L9WA 3MM8A 1WJ9A 1YCYA 3C8YA 1OX9A 3G71T 3VS1A 3OTCA 2GHVC 1L3VA 3HD2A 2RHZA 4ATNA 2GJIA 2ROTA 2QSWA 2K5LA 1VJQA 1W26A 2RQUA 2AYEA 2XHCA 3JS9A 5AYFA 3A8OB 4LT6A 1SKUB 4WPAA 3SSSA 3G9CA 4FKXA 2DPJA 3L2WA 5E3QA 4YY3J 1I5OB 1NK7A 1VQLS 3AODA 5G0RA 2V8DA 4BCAA 5J1PA 3EUNA 2X1GA 4QIGA 5A8WA 3MM7B 3HPOA 3RUXA 4USWA 1ZM4A 1VQOA 3W64A 5CKEA 2M70A 3MM9A 1RT6B 2FPDA 5DZ6A 2XSJA 2XYPB 3DHXA 1IBKJ 1L3KA 4WFAQ 1K1SA 1VYVA 4DV3J 2N4CA 4KSEB 1GRIA 3ET6A 4LF1A 4IUQA 3JCMV 4IFYB 1T0HA 4AFZC 3NPFA 1B34A 2F2WA 3D3BJ 2RIJA 2J6SA 4M7AB 2W7OA 1TL5A 4K4WA 5LJ3f 2B3TB 1M2VB 5J2NB 1HBMB 1VQYA 2FVPA 1DFDA 1R8OB 5GMKm 5SUHA 1TMMA 4RUAA 4F3MA 2XHWA 1EAYC 4K4UA 2UP1A 1KVKA 2RKIA 4ECXA 1S1TA 3QRRA 3UT1A 1AD5A 1WUUA 2DJWA 1U2RA 2E64A 4K2XA 5CD4H 1VQ4S 2D0NA 2VXFA 1C4CA 2VDHA 5CKBA 1IHWA 2OPRB 1IKYA 2CQ4A 4I2QA 3G6EQ 1XNRJ 3CD6S 3QIDA 2J0SD 1FMVA 1KHCA 4PJOC 2WZ1A 4PAAA 2RNAA 2LXFA 3CDBA 5KFIA 1R8BA 5GANh 2ZOFA 3LP0B 2RE1A 1VQ7Q 3UDVA 2J5AA 4ECTA 3GV5B 4ECVA 2KDOA 4EFAC 4EZ6A 1WI7A 4I4BA 2DVIA 3BGFA 4L3KA 5F8LA 2KROA 4F7UG 5KFFA 4X64J 2JEJA 2YQ1A 3HKSA 4UUXA 4M7DE 4ER8A 2SRCA 2OTLA 4DQSA 4GVLA 4ES3A 4U9RA 3X20B 2VASA 2MMYA 1T9TA 4NX9A 4OYPA 3W2VB 3ADAC 3KNGA 1RHUB 2E5LJ 3WVDB 4JUVA 4M75G 2CADA 3CXCR 2L3RA 3SXLA 1JLFA 1MV0B 3M8QB 4M78A 2IDLA 1SV5B 1UTIA 2ZHAA 3SV3A 1EARA 1LWCA 2B7BB 1O8BA 2CVIA 5DQGA 2EC2A 3G71Q 4AFFA 3OYMA 5A0YB 3SCJE 2O2OA 5L1LA 3H7HB 1BUXA 2UUCJ 1OOTA 2RPNA 4F67A 1RAGB 1E6YB 1Q1KA 2KRMA 4L76A 3MWBA 5HLFA 1VQNT 3JB9D 1AZSB 3M57A 1A6LA 3MPDA 3J7Z5 3VYHB 4MKBA 2JT4A 4N77A 3UWTA 4CT9A 5GAHU 2YKMB 4DV4J 2W25A 2ZPGB 5GJVB 4JRQA 1GXTA 2F69A 3NBPB 4QWBA 4F7UA 4J9RA 2CZ1B 2F8EX 4PG6A 5LJ3g 4HTJA 4LSLA 2WONA 1YWPA 3GIBA 4KB7A 4I1TA 1KQKA 4ZVTB 1TL3A 1PRMC 1KR4A 3CCMT 1ARKA 3A4TA 1NPPA 1XNIA 5DLOA 3RB4A 2J9CA 1N5QA 3MEEB 8AT1B 1VGYA 1U4BA 3RKXA 3I0RA 2CPDA 2RJCA 1Q5YA 3CMAQ 4M75A 3I5CA 3QGGA 2XG8D 3LWLA 1U25A 1B64A 1VC6A 5C25B 4QVZA 3H0HA 1H92A 2XNQA 1WDTA 2DK3A 1H2VZ 3Q83A 3X3UA 1W25A 3KMQA 4USIA 2E1RA 3CO9A 1LW2A 3HMJG 1KQGB 1C1CA 1U2FA 1YRXA 2ROGA 2KG1A 1NJWA 2AX1A 3BPDA 3JB9I 3EGWB 4JJNK 5IC6B 3BY7A 4XU3A 2CFXA 3C14A 4EGLA 3ZZPA 3D6FB 2KE9A 5A2QU 2HBYB 4HDGA 1RWWB 3FRYA 2R4FA 1S48A 3JB9k 4ZCLA 3QYYA 2KT5A 2E7WA 3BKUA 2DVJA 1TKTA 2VFTA 1NJIR 3CCUA 1JLAA 2N4DA 1U6FA 3TX8A 3DYAA 4D6WA 2ZM6F 5IH2A 4PKDB 1WHGA 3RMSA 1IREB 1YSJA 1B3TA 3EFRA 4E7KA 1WKLA 3M8ZA 4OLOA 2RJZA 5LSOA 4S0MA 4W90B 3H4DA 1S6OA 2ZKUA 1DRZA 2ABLA 4OGEA 3TRGA 5KG5A 2EQUA 2WW8A 4PQAA 5GANf 2Y1JA 2G4BA 4A8MP 3G4SS 4FCYA 5A2QY 1TWBA 1TKXB 1YJWA 2YPYA 3EXYA 4K5RA 4LVNP 3GIKA 1SPBP 4NLWA 2X7IA 4KQZA 1AHJB 2CP5A 2HPUA 3QT7A 1FNXH 3W1YC 4KGMA 1G3YA 3PMIA 4M1KA 2OLWA 2QX0A 2EG2A 2ILZA 2U2FA 2MYFA 1KQ2A 1KQSR 1KC8C 1JJ2S 2BZ2A 4M77F 1M1FA 1H73A 3QT5A 2CJKA 3POTA 2OI2A 2YRCA 1K44A 4RX6A 3FSYA 1VQNQ 4E98A 1PKSA 1PO6A 1WHJA 1QE1B 3OVSA 1GXIE 1OI1A 1SCJB 2B56A 1P1TA 2UU9F 2Y8WA 1KSPA 4LF6J 2BZXA 1BY9A 2NZCA 3ILLA 4NLTA 1KQSA 1HNZJ 2Z2ZA 1FRLA 1RAJA 1M3AA 3P5TL 3WIVA 3PHEA 2GO9A 1R43A 2YNIA 3X25B 5F3ZA 4AMCA 3ONQA 4A8OA 5KG6A 5L39A 1Y0HA 5KFDA 4WP8A 2OAWA 1UETA 2C22A 3TQEA 1J5EF 4NXMF 3UA6A 5DRKA 3NOCA 2XCPA 3MCSA 1XNQF 2MLZA 2ZH1A 4CO2A 3LAKA 1CULB 3VAMA 2NXUA 2JOYA 3TAMB 4RW7B 3M2VA 2JEFA 2FIUA 2EFGA 3M55A 2ASDA 4XQ3A 3FZBA 1S99A 1VQPA 1U8WA 4TQSA 4JI4J 3M0PA 2C0TA 3GYNA 3OR1B 3OYBA 2J0XA 2RD5C 2DNKA 4DFJA 2CWKA 1CVJA 2CQDA 3M0TA 3HULA 2VG6B 2HQXA 3O6QA 2BZ8A 3CC7A 4MIWA 3NGRA 1BQMA 3BKFA 1FDBA 2QEXT 4J5YA 1ZAVA 1TZ0A 2HQDA 1SJ1A 4NLGA 5D0RA 1V1CA 4AD6A 5J39A 1OPZA 2DXTA 4IG3A 5GANg 2DY9A 2EXUA 1KTQA 3M1VB 1YJNT 1RUWA 4AL5A 2OKQA 4IRDA 3VYGA 5F0WA 4OX9F 1EX4A 2E6NA 4BI4A 1U3OA 3KBGA 4PUOB 3FEOA 2KRRA 4RTXA 4F4WA 4ZPDA 4JI2J 3HVTA 4QYZJ 3MUMP 2IBOA 3G8TA 1AWOA 3NGTA 1WX6A 4N7TA 2E65A 3QT8A 1OQ6A 1N0VC 1D3BB 3H8ZA 3H2UB 4ECSA 1R77A 2JZ2A 4O4RA 3QZ7A 1LK5A 2OI3A 1PJ6A 1VQ5A 1EP4B 2GF7A 4JV5J 2FUG9 4G1QA 4WFNQ 4PR6A 1ZA1B 4DV0J 4IYQA 1XEZA 4CTAA 5RUBA 2VUBA 4KT0E 2WVCA 3E01A 1YIJT 1YQHA 1M5HA 1VQMS 3P8HA 4LBPA 3PCOB 3H20A 1VQKS 4ZHRB 2XMJA 4A48A 3TZXA 3MD1A 3MEWA 3OL8A 3FSIA 2VA2A 4X66F 1N5YA 2K1RA 1XR7A 2G9OA 2WVBA 4Q5VA 2KK4A 4JLIA 4M5HA 3CEDA 2Y8YA 3LW5E 2XCAA 4BE0A 4PYDA 1WC4A 1VFJA 4J8OA 1UG1A 1Y3JA 3EPGA 2R8IA 4A54A 3W9JA 1QKWA 1D0ZA 2GBQA 4ED6A 4CCHA 2JTMA 1K73T 2CZVC 4Y92A 3ZNUA 5ETNA 1WTBA 1G7CB 3IXQA 5CIUA 1RP5A 2YNGA 4ZPWR 3LH0A 1HW8A 2DTIA 2HFSA 4BWJA 2ZZMA 3CJKA 4GRSA 2P84A 2H48B 1BIAA 1ZPVA 3DDNA 2HRTA 5F8JA 2E70A 2AZ3A 2GQCA 4HHJA 3KG0A 1ZM9A 2WAQD 5GAGU 1M1KC 3TU4K 5B08A 4DR3F 2UXCJ 2HQCA 2VODA 3MJXA 1DY3A 2FJDB 4ZPVR 4KH1B 2PT0A 1VQ4A 3KLEB 2IHR1 3IR5B 1NPKA 2QEXQ 1S97A 1LK7A 1G3TA 2DHSA 2QRRA 4UT4A 1EFNA 2PVDB 4J9KA 1TKDA 2OFHX 3MMAB 5AE2A 3QLHA 4HYKA 1YJNQ 5K20B 3DB3A 2ZOMA 1TVRB 1AW0A 2YRDA 2FHJD 3RW6A 4WF9Q 2Z2LA 3ZTPA 2M2BA 4AYBD 3BBFA 1W1FA 1HNXF 3ZZZA 3UPFA 5L8RE 1VIFA 4DX5A 4LIWA 3SCLE 2DYBA 5LXYA 5GAMd 2M0YA 4DQ2A 2K4YA 3GWCA 1RK8A 3GFZA 2MGZA 4M7DG 3OVBA 2V8KA 4G1IA 1U0SA 1TK5A 3JCMe 3OL6A 4JI5F 3N6MA 3OFEA 5DG9A 3A1YG 1OY6A 3DXBA 5ETTA 3FFIB 3VUBA 2X1AA 1WEXA 2R7TA 3EFOB 1FE4A 2DGTA 3TCJA 2M4MA 2UUAF 4F17A 5IQQA 4LFAF 3PVQA 8RUCA 4ZCKA 1YIJQ 3QFHA 1HKAA 3BBCA 4I64A 1YNZA 3PG9A 4YP3A 4RWWA 4DN9A 1JKHA 1Q95G 3BZQA 2F5TX 2M3DA 2LYVA 3E9FA 3M32A 4WFYA 4E7SA 4WFZA 3J81U 2NPIA 2OD6A 1XQHA 5ETOA 3S3MA 3HP9A 2F1LA 1LW0B 4HH0A 1YITS 3LGMA 3HSBA 1N9RA 2ZOGA 2EK1A 2AYGA 4ICLA 4MAKA 4DFMA 3BBBA 5DQIA 3DLHA 2DL4A 1ZUKA 3HSZA 1ELOA 1O51A 3CIMA 2VBYA 2CDQA 4DPWA 1LWEB 1HBUA 4AQYF 1CJTA 1Q8KA 3OYHA 5ETMA 2EBPA 4K4VA 2FYXA 4Z7YA 5ETPA 4NL3A 4M7DA 4GO7X 1S1UB 2ASJA 1HWUA 4DQPA 4FVMA 1KLMB 1KLNA 4NCGB 1NO8A 2DH7A 3RTVA 1U24A 1PAUB 1WHVA 3A5ZB 3J80E 2DD4A 4N0AA 1REVA 2KYZA 3GYGA 4DL6A 1TFYA 2MCNA 4U96A 3TVTA 2ZBPA 1WDXA 2EK6A 1X5OA 1UB4A 2JS2A 2JL9A 2RNEA 3KJVB 2YKPA 1WC6A 4NLUA 2YRVA 4B3TJ 5DGAA 2EAYA 2NUPB 3DU5A 4LVOP 3A3PB 4XAXB 1HNVA 4RNOA 4Q43A 2D8JA 4DBRA 3CUNA 4A8SA 4M5MA 4LF2A 2DLPA 5GJWB 4O3QA 2F1FA 1O0PA 1TUCA 2DCUB 5HQMA 3PO4A 4RUBA 4C7QA 1RT7B 2OFGX 4ZCIA 4QU6A 3M9OB 2WVEA 1M5SA 5BYRA 2MQPA 1LNXA 3KMSA 4HT8A 4O3NA 1ZTWA 4BI8B 2QLJB 3G4SA 3HLUA 2IG0A 3A8GB 5A0DA 1U6BA 4AXIA 2PVOB 5D0GA 3EG1A 2KBTA 4C97A 3CCMA 2CS7A 3D1QA 1L3UA 3KFVA 1HNIB 2BTTA 3UR0A 3WDOA 3KLHA 1DJ7B 2EFQA 3T41A 4B9XA 4FYDA 3KDNA 1ZA2B 4WKRA 3C4SA 4R8UB 3CCET 4WYWA 1NZ9A 4X65J 3OR2A 4DSEA 3LP2A 1GCPA 2XY7A 1JJ2A 2RD1A 1CLFA 1CG2A 4CYUB 2MJUA 2QQSA 2GAHC 3MEGB 1ZSGA 4OYAA 2LX7A 3DHWC 3CCLT 1OYXA 1UWBA 2DXFA 2I0XA 2FVUA 4ZGJB 1UEVA 1VBZA 3JB9G 1Y4ZB 4DL2A 3DB4A 2HNZA 4QIFA 4F4ZA 2LQWA 2ZVSA 1YJTA 3PV8A 1Q82T 2OEMA 2CPXA 3PRVA 4X9CA 5KE3A 2APOA 3SIPB 2A6MA 3QO9A 9ATCB 4MFBB 4PABA 2ZDOA 3N4WA 4UW2A 3EYZA 2E5KA 2FJBB 4DA4A 3FEZA 4P75A 2YH1A 3PIOA 2A37A 2KH9A 4BD3A 4M7AF 3D1OA 4OMQA 3GB0A 3M53A 3LAMA 5HI7A 3KDOA 4Q0BB 1M3BA 3GV7B 2JX2A 4J9MA 4L3NA 5FIIA 1RHMB 1YKWA 2XGPA 5E3AA 2ZNZA 2J6UA 4CIOA 1FMKA 4EMKB 2DHGA 3DGPB 4ZA1A 1SL1A 4ZLNA 5L1JA 3PFOA 3CJ8A 5AE3A 3MTJA 3TUPA 4FF1A 3I0SA 3OBWA 5K14B 4K8RA 2XD0A 2I1RA 3M54A 1S7IA 4KE5A 1RTJB 3M6WA 4WTOB 2HGLA 2KT2A 1MV3A 2CJAA 3VS2A 1PKUA 1KQFB 2N82B 2M1HA 3RJMB 1JLCB 3BGRB 2V67A 2LU1A 4TU8A 4D8KA 3T9NA 4DMZA 2RS2A 2G3RA 2QTXA 2D1CA 1P92A 2L3SA 5KFZA 4KKOB 4EYHB 1KBRA 4XU2A 1PD1A 5J1EA 4OX6A 1YRUA 1RGVA 5CQYA 4NA3A 1PJ5A 1I81A 4KV8B 1MGQA 3VGTA 5B0DA 1GFDA 2HQ3A 4F3OA 2DNUA 1SQEA 3IBCB 1RTHA 1RT2B 3ASKA 4RCBA 5A6PA 3UA7A 4DS4A 4X4TA 3MR6A 4LMZA 1N6QB 2IRXA 2IVWA 2P8IA 5D0EA 2YQ3A 4M78C 4MKVA 1KSWA 4ZPTR 2HFOA 1AOJA 2B5JA 2XG8A 1X27A 3VAIA 3RAXA 4V1Ak 2MK5A 2KFNA 3CCEQ 3ZL7C 2MIOA 2I6WA 4YB7A 4L6V5 1FXLA 3PJXA 2QAZA 4ED3A 4RNNA 1VQMA 1VQKA 3CIZA 2KXNB 5CCAA 1BQNB 3BGOP 2O01C 3CCLQ 2M0OA 1PWTA 3X24B 1ZH5A 2Z0GA 1NUEA 1RT6A 5D6WA 2JS0A 3IBWA 2LQ9A 4OMMA 4KHPF 1FKAF 3I96A 2LEAA 1MNDA 1JLQA 4IFYA 4TVAB 3AQOA 3QUIA 2GHPA 5EC7A 1GX6A 2PVGB 2ERRA 5H9FK 2J8AA 2GIQA 4ELYC 2WSCC 2RJEA 1M2VA 2FLPA 1HBMA 4CI0C 3ILIA 4DUZF 4V2SA 3VALA 1HWLA 4LUDA 5D4LA 3VS0A 3N6NA 2O88A 3UDCA 1C1BB 3Q0AA 3TNVA 1QSSA 2VONA 4M75C 2AK5A 2L89A 4QVCA 1J5OB 1FDNA 1FCAA 2DTHA 5CCLA 2BJ9A 4R25A 1NEEA 4ENOA 3CMAS 4VUBA 2V4RA 2DT9A 4TQRA 1WTFA 2EEYA 5B0FA 4WIIA 2W4PA 1NSKL 2DGSA 4DWIA 2OPRA 2PA8D 4HR2A 3TX0A 3QPHA 1M3CA 1G6BA 3LP0A 3W61A 1T3LA 1GMWD 5HK3A 1SL2A 1RI0A 2IJNA 2QLWA 1CJUA 3GPAA 4PNOA 2YSQA 2AJ0A 2RDDA 5IM0B 3CBOA 1HYSB 3HHLC 2RU9A 3L42A 1DARA 4YB1P 1GMVA 4J9IA 1XC9A 1ZM2A 3GFXA 3WC2A 2ROLA 1R31A 4KHRA 4OHZA 3KLFB 5E2QA 1KN6A 4ZGEB 2LQKA 2CQ0A 3W2VA 4C0BA 2DF6A 1JB0E 1ZUYA 5KOWA 2F4FA 3FDRA 2RHYA 1NJIC 3M8QA 3EG9B 1WKKA 4NWBA 3HVWA 2D41A 1SV5A 1E7OA 3G2XA 3T3FA 1CS4B 1JLBA 4UQTA 1L5UA 2VPYB 3F44A 1S72T 2RF2A 5A0YA 5IT9Y 1SHFA 2J7WA 3BQ1A 1YRTA 2NUHA 1WI8A 4A53A 1T03B 2XMVA 2CJBA 4IH7A 2MKIA 1FD8A 2VV5A 1AZSA 3OYGA 3UPUA 1XR6A 2LFVA 1MMDA 4I68A 1CPZA 3OXFA 2FPFA 1LV5A 2YKMA 3TZYA 2GV1A 4DR2F 4DUYF 4BHQA 3NGUA 1EB0A 4F14A 2D9OA 3NBPA 1B3QA 2HKQB 3LH5A 4DOZA 4UOFA 3GTYX 4OJGA 4TLQA 2V0NA 4HACB 3U7JA 2OJ3A 3OL7A 4IDKB 1BWEA 4A4FA 3AH6A 3B82A 2EGEA 1U1TA 4EU0A 4A8QA 4MKYA 2UU9J 2VPXB 2RVJA 4F50A 1YITA 4J83A 3MEEA 4NZ6A 2KVQE 3KUFA 4ZN3A 4FS2A 1IHVA 1OZ2A 3M2RB 4O3PA 1IZ6A 4J9BA 1QD1A 3H25A 4USUA 2R7SA 5GMKi 5AXKA 5C25A 1N8RR 3VRZA 2MZJA 2K57A 2NXJA 3JQKA 2DVEA 1WHMA 1UGSB 3PACA 3L3CA 1T0JA 3FKBA 3C0CA 2ZJQQ 1J5EJ 4NXMJ 2VOPA 1TSFA 3CCST 2B9XA 4WFXA 4NPOA 5D8HB 2E5HA 1VR6A 1XNQJ 2RAQA 1FYNA 2YQ0A 3OTEA 5CKDA 4NASA 4P9SA 5IHIA 2K3XA 5EX0A 4HLBA 1L3SA 1K73U 2HVEA 1VIOA 2HHVA 3LPEA 3H59A 3LGLA 1KQSP 3PEJA 2HHTA 2V8PA 2HBZB 3QXEB 1OV3A 2KZZA 3TP2A 2A0FB 3E1SA 1IXDA 3IR6B 1SQFA 4YN3B 2F65A 1GCQA 4L73A 2OP5A 1OPKA 3PIPQ 5I42B 1M27C 4NLQA 3JYTA 1QMCA 3TA0A 2M0GB 2GFFA 1IR2A 2KVIA 4J9SA 1SJFA 1VYAA 2DNOA 1RDRA 4GC7A 1CC8A 3RYLA 1RWVB 3MEAA 1TKXA 4OYXA 4JI8F 3DRPB 3JTNA 3PJWA 5CHCB 1RQ0A 3EGXA 4FYWB 4PG7A 3DNCA 1YI2T 1FMWA 4ZVUB 3M8RA 3DLLQ 1VIEA 3DLGB 3ISZA 4YOEA 1S72Q 1XMBA 1SIWB 5AXMA 1HA1A 2AYMA 1TUDA 2XZDB 4WTYA 4JRPA 1RHRB 4FXWA 1I4K1 3PW2A 1KHIA 4C92D 1U1KA 2DM1A 3VS4A 1FFGB 2C2ZB 3NCQA 2FGCA 2B6AB 3P49B 3QT6A 1HWKA 2RH3A 1DQ8A 1NRKA 3UNYA 2DR9A 3UW1A 3L4BC 3P3DA 1SL0A 2DPPB 4C8OA 4M77C 4PL6A 3OT9A 1MMGA 2RI2A 1H2TZ 4GKKF 2EFOA 5HBMA 2EQIA 2GVDA 2KL8A 4B9SA 3MCMA 4FKYA 4QKUA 1JO8A 3G8SA 1XMOF 3BGUA 2MQOA 4QOTA 2MEWA 4FYVB 4J9VA 1N5TA 4UY8T 2VHGA 5G0RB 2VGNA 1QDUB 2FJWA 3CCVS 3S6EA 1UFWA 1FKPB 4URSA 3QFWA 3NOGA 1BYMA 5A8WB 1CBKA 3MAQA 4X66J 4QIVA 2Z4PA 3NAHA 1C4AA 5FW9A 4JRKA 2XSJB 3Q86A 1PHTA 1QQJA 4LFBF 1C0MA 1CULA 3TAMA 5FRMA 3ET6B 3CCRA 2BBEA 3M9QA 1FKOB 4YB5A 1RAAB 3FIFA 2KDSA 2PFDA 1HJDA 2EYWA 2MTLA 4CM2A 5CYJA 1K9AA 2PN6A 3IN5A 2CJ9A 3CC4A 4F16A 3HO1A 2K79A 1FFSB 3CCSQ 3OR1A 4LF8F 1SRMA 2BUDA 4ERDA 1JIHA 5KFKA 3CF5Q 2VG6A 2RT3A 4LUBA 2XS7A 3JXOA 5LMNF 2E1HA 3DLJA 1S1TB 1NB2A 5B0AA 3EG0A 4OB3B 1U09A 3UN5A 2WSFE 2R5MA 2E1MC 3M4GA 2HHUA 3VZIA 1AWJA 4ZDNA 1MWQA 2G2OA 2U1AA 3M1VA 1PM3A 1Q82R 4KGVB 4L5GA 2HK2A 3EZUA 1IKYB 2RN8A 2BM1A 4DQIA 3N28A 3PR4A 4DR3J 4A63B 1M0SA 5DO2A 1G3SA 5LJ5h 5CO7A 1JXEA 4PUOA 3S6WA 4LREA 2Y0BB 4TU7A 4B3RF 5KFEA 1MWZA 3UO0A 2O31A 1D0XA 1LFPA 3JCMf 1D3BA 3PX6A 4HCCA 4CLPA 1VQ8T 2HSPA 4ES2A 3AA8A 1SJRA 2NPFA 2MWPA 4BBYA 4X4UA 2DL7A 1JU5C 1NH7A 1EP4A 1QAYA 3ULRB 2D9PA 2HKEA 4OV6A 3RRHA 4C92E 4TY8B 2J7KA 3MKDA 1QY7A 2RHIA 2PUKB 1CSJA 4FZVA 1M1KT 2XWYA 3P4UB 3R2CJ 3SFGA 3IA0A 1YI2Q 2W4DA 4NEYA 3Q2TC 2X51A 3I5SA 1YLXA 4ECZA 3I5AA 2YWEA 3P96A 5KT2A 1HNXJ 1VRTB 2W7PA 1XMQJ 4ANJA 4QW8A 1RBAA 1UJ5A 5D6XA 2LT1A 4U95A 2HS3A 4OX8A 4FYYB 3UR3C 3ILJA 2W9AA 1R6YA 3MHXA 1LWFB 2I38A 3D66A 4PRFA 1UHCA 5LJ3d 3T1YF 3BO2A 4WIQA 2ADBA 5HN0A 1WC5A 2WHOA 3M30B 1YIJS 4PWUA 4OLPA 2XYHB 4ZVHA 3M56A 4LFAJ 2UUAJ 2CG8A 5K8PA 4OZJA 5LOQA 5KFCA 3QRPA 4YB6A 1F2GA 3PTAA 4JYAJ 3AOBA 3AQPA 4LDYA 2A2CA 2QL5B 2X3DA 4MK8A 2MZ1A 1N33J 4DX8H 2F3JA 1S49A 3KXDA 3FLGA 1HBOB 3JB9H 4ES1A 2RS8A 3MCOA 1WHLA 3ZTQA 3CCJT 2GCFA 2WONB 1K0XA 3L95X 4WWSA 4KRTA 4LQ9A 4RWXA 3CMET 3GP9A 5KG2A 2GVZB 1RWMB 2E5GA 2RUGA 4USTA 4AL7A 1WQ7A 2RJFA 4QPXA 1Q82U 5HVFA 2CP2A 1SH3A 3LGNA 2JMAA 4M7DC 2MQMA 1BLUA 3NAIA 3QZ9B 2CQCA 4I6YA 3HZGA 1AZEA 4NL5A 3GJQB 3PFEA 3DLBA 5IAYA 2CDTA 1NK5A 3BPSP 3Q22A 1RI9A 2HBWA 2ZGWA 3KNAA 5GMKh 3KLEA 1UE9A 1S4EA 2CWXA 3GNFB 4EEYA 2LA6A 2XLKA 2NUZA 4YHHF 2WB4A 4N0AC 1OO0B 4X64F 3JCMg 4QZVB 1C0TA 4C3LA 2HFNA 1HI1A 4D3HA 1SEMA 4AG1C 2JOQA 3FGVA 2ZH8A 4QQDA 3EWGA 1VC0A 2YUQA 2W10A 3QDFA 4OHXA 4DZDA 1B4SA 3SQGB 4J9GA 3HK2A 1NKCA 4RMOA 3MECB 2E5LF 4ID5B 4DV7F 2HVIA 1HQUA 1OPIA 1T9YA 3TREA 1K0VA 3OYYA 2G0JA 1BCOA 4F25A 2KJWA 3VS6A 3HHNB 4OYIA 4ZS6A 5GADI 3Q2SC 1SIZA 5KCHA 4YR0A 4NA1A 1GMUA 3TEGA 5KFJA 3ZBDA 1VQ8Q 2DEQA 1J3TA 4ETXA 3DLKB 3FNNA 3LWMA 3PYFA 1FX7A 2A6OA 5LJ5f 2EI5A 1GFCA 2MQ8A 5GAMe 1XK8A 2GCXA 1QP3A 4OI1A 3FFIA 3N79A 5JJBA 2B43A 3VAGA 5LJ3j 4WU3A 4Q5WA 4ZN1A 2MYSA 1MSWD 3SV4A 3D2WA 2XZWA 3CC2S 1NHVA 4Q45A 3V2UC 2ADCA 2QA4S 4E0DA 2W4CA 1N9SA 2OPPB 1A7GE 4DX6A 3I9ZA 4R0EA 1IB8A 4QYZK 4R55A 3WX4A 4LR7A 2I9SA 4AFQC 4X4OA 1I94F 1UKUA 5D78A 2CP7A 4ORZA 3DN9A 2AZ1A 3BYRA 2YTCA 1NM7A 4UF4A 3R9LA 3HX9A 1NBEB 5GAEU 1JJCB 1LW0A 1UL3A 4OYZA 5C2GA 4ZLPA 2EVRA 4U67Q 3MP6A 3W8GA 3M6VA 2OSQA 3IGNA 2RK1A 5CAIA 2CUBA 3KJQB 2HHHF 2BE9B 2QTWA 1BKBA 1X43A 3V8KA 3CCJQ 2OEKA 1VQ6S 2V9KA 3RERA 3DXSX 1KWMA 4X1VA 1R0CB 3MURP 2MKJA 3D0GE 3CMEQ 2QLXA 4OJ1A 4PQUB 1N27A 1Y5IB 3IG1A 1V76A 1HBNB 2L5QA 1RLDA 2XZTB 4NCGA 1X9WA 4Q7AA 1I6JA 1HFEL 2XEXA 2VJUA 2MY7A 1IM6A 3T6BA 3KTQA 4U8VA 4J7FA 1JJ2P 1Y7XA 1PD0A 1FVSA 2KVQG 1C0UB 4FBUA 1U2CA 5GANd 4MDWA 4I67A 1OS5A 4PJOD 5I4MA 3M4XA 5BXIA 3M9MB 2NCKL 4QIWD 3KJVA 2JVOA 6FD1A 2HMIB 2C2DA 3FBCA 2NUPA 3KHRA 2MZSA 1VQOT 4TU9A 4K7QA 2EWNA 4HEA9 2GTOA 2CT4A 4DS5A 3I87A 2AMCB 2DIGA 5D4OA 2XC9A 4JI3J 3L2VA 1YG0A 2CZ4A 1NLKL 5LJ5g 5GAN5 2O9SA 4I6AA 1NSAA 1RT7A 3J81j 2FEIA 1BXNA 3K8WA 3SHWA 4DF4A 2IPOB 2Q6CA 3L9ZA 3EH1A 3D28A 4WE1B 3GSDA 3E8OA 1RA6A 4DI6A 5KFOA 3R2DJ 2DNGA 4R0JA 2K8GA 2RQCA 3HCXA 1GK8A 2ZH5A 3LALA 1WHKA 4ZJLA 1HNIA 3ZTOA 1OY9A 2LTOA 4HVVA 4ELUA 2DXCA 1SG5A 1PCAA 3HRUA 4WP3A 4R8UA 2YWKA 2K3BA 4MIAA 3C6UB 2OTJS 2E9TA 1FO1A 1NK0A 4G1QB 2JM9A 1MMLA 2V8HA 1K1QA 1Q78A 4CTAB 4CYUA 3G86A 1S77D 4ZVQB 5HAOA 2IYGA 1JLGB 4LD9K 4EUVA 3GP8A 3CCES 3H8YA 4WK1A 2WK4A 4YR3A 2OTLT 4J5OA 2DD5A 3E2UA 2J0WA 4GY5A 5F9NA 4CLZA 3GCWP 4ECUA 2VD3A 1H3ZA 1U1RA 4MFBA 4E7ZA 1N5YB 1SPKA 3A8HB 3TW0A 4JPBW 2JZ5A 1QCOA 3EMTA 3LP1B 4J9CA 4RLEA 4OYMA 3CCVA 1FTCA 4DBHA 3JCMW 2L9DA 3H6ZA 2CPIA 1D09B 4ED7A 4OHWA 2CUDA 2RQVA 4ZITA 4C8QB 3AJ1A 5D0HA 5CCMA 3AA9A 4F4XA 1FRHA 3MP1A 4OI0A 4M7AC 1S0MA 2JJ4D 2RQTA 3DKMA 2R42A 4N41A 2BKPA 2KM8B 4B17A 4KHPJ 2R7VA 3A8LB 3D6HB 3UCUP 4PJOE 4FW2A 2DBBA 2F4VF 1TQLA 4DU7A 4EMKA 3AB2B 4CLSA 3UDLA 2ZD1B 2HAIA 1T02A 3VQTA 1T9UA 1PNJA 2AX0A 3CEYA 3PE0A 3NKYA 5K14A 1TKZA 2Z2MA 4OZ5A 4B3OB 1RTJA 1U0HB 4DR1F 2YUPA 5HMZA 4U7UK 5GAOr 3ENQA 3FMWA 2XMWA 4O4GB 2IFXA 5KFNA 1ZTTA 2K2MA 2EKNA 3JSMA 3I55S 2YBVA 1K76A 3OUYA 3KLGB 1N56A 2C0OA 1JLCA 1VQOQ 3NEKA 3R1HA 2KXCA 2ZZDA 3V81B 4AG2C 2KYXA 2OH2A 4L75A 2P2CB 2UUTA 4KT0C 1G3OA 2O1PA 1CJKB 3H41A 2FHDA 1Z2ZA 4BDZA 4YUDA 4HA8A 4ED0A 2LP4A 2X4XA 2WBRA 3EPIA 4YTLA 1OX8A 1LKZA 2DEJA 3DI6A 4OMNA 3ZZTA 4LRCA 3OVAA 4C4WA 4RG8A 2UXDJ 3ETMA 1JXMA 3QJLA 3OYJA 4KPCA 4F4KA 2B86A 1OPLA 1VC5A 1UEKA 4UOGA 5D3GB 2BJ1A 1M8MA 4DFPA 3LW5C 4JV0A 3WBZA 3V8JA 2M52A 1ZPWX 4ELTA 1SXLA 4YFUA 1YDLA 4USJC 2V63A 3DM2B 2QSFA 4C92G 4C8NA 3UD5A 3M58A 4HCZA 5EWEA 1BQNA 2IRYA 4GC6A 1KOHA 4PFOA 4F0HA 3V6KA 3E2EA 1OZ3A 1PYSB 2LA4A 2DL5A 1PSEA 4YDXA 4Z7CA 1VI7A 2OTLQ 3CJ2A 4B08A 1WDDA 1FWZA 2DY1A 3W5ZA 5KFSA 3KHHA 3F41A 1NJIT 5DLQE 1NKBA 4P74A 1U7LA 4XTVA 2PMHA 4DR2J 4DUYJ 5J3BA 4Q2LA 3BKTA 1A0OB 4J9PA 1RT5B 3K8VA 3M32B 1X0PA 1VK3A 1YJWT 5LSLA 3M6UA 2XU8A 1JXLA 3UF4A 2DNZA 5HANA 2R2UA 3B78A 4QQBA 2FVRA 1EETB 1QCNA 3AAWB 1J5OA 2OMOA 3NRBA 1KD1R 3FK4A 3MP8A 4OVAA 3OYNA 2ZZTA 1YJRA 4JI1F 1BK2A 3FJPA 1HBUB 3P45B 1UGQB 3M0SA 3MMBB 1FRJA 4CO4A 2R7OA 1ZBJA 3ETOA 2W2QP 2I2LA 1RKIA 1CJVB 4ZPAA 4J9LA 1RBLA 2QA4G 2DETA 1AB8A 2ZC3A 3TZZA 1KFZA 2EFIA 2BRLA 1VDHA 2YT6A 1N8RC 3SWNB 4C92A 2A7YA 5L8RC 4HT9A 4FVCA 3DGVA 4LR9A 4I2PA 4NLRA 4CLLA 5J26A 4JS5A 3PXGa 4F4AA 4IUVA 1WSVA 1UW4A 4QR1A 5THWA 2FHKA 1HYSA 4JJCA 5HMYA 1U1QA 3D68A 3Q8VA 4E2FB 1B7YB 3FBEA 3EVMA 4UOCA 2C3MA 1VQ9S 3KLFA 4C8QD 1WSRA 1UJ6A 3IRWP 2ZVIA 4DHVA 1GCQC 1S1WB 3OYAA 1S12A 4ZVPB 4A46A 2XY5A 1D3WA 2QMWA 2EPIA 1CQMA 3CTRA 4IH5A 1MROB 3EG9A 5K5MA 1WOSA 4LDXA 1X4HA 3CVKA 1X6OA 1VQPT 1FNOA 2HBRB 1IQTA 2XQCA 2EG1A 3ME9A 4B3MJ 4KC5A 4FU6A 4NRTA 3QIIA 2DCLA 3LLRA 1N6AA 2M8HA 4MT1A 1D1UA 4WK3A 3T5HA 1RACB 4WBFA 2HSEB 4QWCA 2XGQA 4JI8J 3DOLB 3MMCB 1SJQA 2R7QA 4ILMA 3R5CA 3CC7T 1JEGA 2FZGB 2X35A 1B7FA 3CC2A 3I6PA 2R8JA 4KTQA 1IN0A 2QA4A 1VCTA 5LSRA 3V7CA 1M90T 2DILA 3LP2B 1SI9A 4K11A 3RESA 1M1KU 1OYEA 1T11A 3PW5A 3TVYA 4HACA 2D3O1 1UA1A 2HHPA 1KD1U 2MQNA 4IDKA 2CZ6B 4JV2A 2LMJA 1KVJA 1NEBA 1VHIA 3V6DB 1VLOA 4GKKJ 1TU0B 1YN8A 1NU4A 1R89A 3MEVA 1QTNB 2Y0SD 4MYTA 4USKA 2JLEA 2AHOB 4CDIA 3O8VA 2H3EB 1VQ5T 1XMOJ 4DV1J 3M2RA 3KWMA 1MUZA 1KRPA 2W9CA 3LANA 1YJWQ 4B9TA 2QMUB 4OQJA 4TVRA 5D15A 5JVHQ 3CMQA 1VQ6A 2P0QA 3TJAA 2W9BA 4X4SA 2DNNA 1YZ6A 2M5YA 3P5BP 4OI4A 5I11A 2V2VA 2NZ4A 4LE9A 1I07A 1X9SA 4C0HA 4Z37A 4OZ0A 1S0OA 1SVDA 1IBCB 3GIMA 1NK4A 4NCBA 4ALZA 4M63A 4ECRA 2R7XA 4B6MA 2RU3A 2DIVA 3QWYA 3JAMY 5E33A 2I2YA 3MR7A 3DFEA 4Y65A 3GZ7A 2B4VA 4B3TF 5BR8F 3CCSS 2NSCA 4C8QE 1WEYA 2WOMA 4EMGA 2UV8G 3AY0A 4LF8J 1W2IA 4OB1B 2E29A 4PG4A 2EBEA 5HY6A 3MZIA 3TOQA 5LMNJ 2L8DA 1S1NA 5KT5A 2UVVA 5KAKA 1R6VA 2FO0A 2KRBA 1D9FA 3K0JA 2C1EB 2XB2D 3PHTA 2J8SA 2OIHA 2C3OA 2DR6A 3OTDA 1Q82C 1FD2A 2KXDA 2F9DA 3K5LA 1WZOA 1IKWB 3IWXA 1R7IA 1ZBXA 4B3RJ 3MF5A 4N8OA 3CJSA 2YX7A 3HVRA 5FLXE 4JJBA 1VQPQ 3M8PB 2LLZA 4UC4A 2DX1A 1UJ0A 2AJ2A 3C15B 2CRLA 2BV3A 4M78F 1RTHB 3W7BA 4H4MA 3QO3A 3J7YU 2OPQB 1ZUUA 2B6AA 2COWA 3V4IB 1ROFA 1VHFA 4FM4B 4K0KF 2AHJB 4CH0S 1VQ4T 1S6QB 1RADB 2OTJA 1E6HA 4CM0A 3CC7Q 3QZ5B 4KULA 2B5JB 1GNKA 2RI3A 1S10A 1HL6A 3DMJB 1MHNA 1S9GA 1TG0A 3CD0A 5KFLA 2EJGA 3FCWA 2CH4A 2VGMA 2NXNA 2UV8A 2LEPA 3BJYA 2N7CA 1TUVA 2EJFA 4CC7A 4YEAA 2E41A 3NG8A 1FKPA 3L7PA 1VYTA 3T1YJ 4F7UF 4A8WA 2CH4W 5EGYA 4RPFA 4DSKA 3LX7A 1IWAA 3AHPA 2DEIA 4JI0F 1SKRA 1H6KX 4IR1A 2FJEB 3PRBA 3SYZA 2RH2A 3P6YC 2HFZA 1VQ5Q 5IV3A 3H5UA 2BQUA 3KG4A 4I56A 2JNGA 1FKOA 1JLQB 2HVZA 2G1HA 4AT1B 4X62F 3PFSA 2NQPA 2FB0A 1Q0NA 3JAME 1B70B 4M75F 2KZMA 1TUGB 2W7AA 5E5NA 2KFZA 3A8JA 1NNDA 1RLCL 1SUQB 1V3RA 5D7UA 3HVAA 2EGCA 5KG7A 4DF8A 1F5AA 1X7VA 1G4CA 2DGUA 4BUGA 1SC6A 2VYTA 1REGX 1MG7A 4CRJA 1UW9A 3NTHA 4DSJA 4C0GA 4NLYA 3C95A 1K9MR 3RG6A 1NPRA 1XOVA 1I0CA 1UAWA 1LXNA 4LBHA 4C9DA 4PJOG 2YKQA 2XMMA 3OYIA 2GHWA 1HHSA 4LRFA 5FRNA 3I55A 4LFCF 3VS7A 4WYLA 4E8UA 3T1HJ 2W8LA 4AL6A 1DZ5A 1CJUB 1RU1A 3VV0A 4YHHJ 3QGIA 1WHHA 3CCQS 2FY8A 1SJ4P 2YWWA 2VG5B 2MKHA 5K8OA 3HFNA 4EWTA 1H7XA 1EZZB 5GAOp 3L1AA 4RNHA 2FRWA 4TY8A 2FPHX 4ED2A 2C2MB 5IWAF 4DN0A 2J6FA 4FPIA 1WOOA 3ELHA 4NE9C 3NWRA 2M9KA 4F36A 4DV7J 3CJ3A 4C48A 3RRGA 1Y07A 3UDEA 4IUFA 2D3ZA 2LCSA 4OJ3A 2Z58B 3LTOA 2JMCA 1VRTA 3KUHA 1OYDA 4A8XA 1B0PA 4NMXA 1JLBB 4NLSA 3HHTB 2RF2B 2LXIA 1LWFA 2CPZA 1VQ4Q 2FVCA 1ZHIA 2DXBA 1LQ9A 2LJ0A 4QPTA 4F04B 3D6MB 2Y1LB 1Y71A 2IVMA 3M30A 5LJ3e 1NSQA 4U7UD 2MI6A 1HLWA 1UHFA 4PJOA 5F8NA 2FG0A 3TJ9A 3KYLA 1SRLA 2N3OA 3M6XA 1RYSA 2XKOC 3BE3A 2VXEA 1U49A 4ZVFA 1SF9A 3UFCX 4MH8A 1I94J 4KUIA 1HBOA 1LXJA 1IJEB 2FQQB 4CH1A 2OEJA 2VC1A 1UWAA 1VK8A 1NK9A 3A8IA 3MFIA 4C5IA 2D1XA 2HAFA 2YWHA 3KJNB 1WHWA 3G4ST 3NTIA 2B7CB 1N0UA 3PVXA 3HT3A 4ESRA 5B0EA 2GVZA 1Y5NB 1JJ4A 2CA9A 2BJ7A 2CPYA 2MPXC 3DC2A 3JV3A 1HQEB 3CCJS 2XY6A 1PGZA 3Q1JA 2HHHJ 2YWFA 4DSFA 1HR0J 4PG5A 3LO3A 1N5VA 3UCZP 1HARA 5I22A 5EN1A 1GQEA 2C3YA 1DQ9A 2DO4A 3U1MA 3KK2B 3NS6A 1AWWA 1OWXA 1SC4B 4ZKAA 1NJZA 1JB0C 1H98A 1UVMA 4Z02A 4DBFA 1RTIB 3MI7X 3EGNA 4UQGA 4OI2A 4P52A 2LC4A 1QVPA 4DPTA 2CJXB 3H4BA 4UZCA 1RT1B 2FZKB 5D4NA 1WELA 2ATCB 3SQGA 2C42A 1RB0A 5JXSA 3OPKA 3CNQP 3GONA 3MECA 3W9IA 4ID5A 1SSHA 2DXDA 2BE7D 4IRKA 1VQ9A 4J7CA 4NRUA 1RCXB 1A0NB 1DJ0A 3G87A 5IC4B 4G6VB 2ZHOA 1D9DA 2H3JA 3U1LA 1RWOB 3OHAA 5KT4A 3JYTB 4PXDA 3CGIA 4QQGA 2HCKA 1ZSZB 1NLPC 3DLKA 2FRYA 4JBCA 2BANB 3QBYA 2P4RA 3QSIA 4BC7A 1FX4A 4M78D 1Q8LA 1V3SA 2QGGA 2HVHA 4JI6F 2HL5C 4CO3A 2V4JB 2EQMA 5DLGA 4KHMA 2MKKA 3KK1A 1MNEA 1T05B 3EGXB 2AZVA 3GR1A 1PBAA 1U48A 1UPMB 1KHWA 4FT4A 1N32J 3M0QA 2BKDN 1SH0A 3N5BB 4DOWA 4NZ0A 2R7UA 2OPPA 1Q7YR 3M0UA 4MDXA 1X01A 2CNNB 2P0KA 3DRXA 1H7WA 3TANA 2VIHA 5C7PA 3OY9A 3MXHP 1X6GA 4FS1A 2SXLA 2W1BA 5IZHA 3OW2S 1DURA 1Z9QA 4HHHA 2JTEA 4Q8FA 3KLVA 4DR4F 4ILRA 2QDLA 2AJQA 2D3OR 1X75C 2XBPA 5HBMB 2GVDB 3K59A 1M5Q1 5K9FA 4GLKA 2F63A 3B4MA 1G3WA 2HS0A 2QN6B 1T9XA 2CKKA 1N36F 3K2YA 1LPLA 4Y00A 2B9YA 2E1PA 4O3RA 2CZ0B 3HXMA 3G4SQ 2FGOA 3L7UA 2Z2YB 4M75D 1IKXA 4PQUA 2IYIA 3CCMQ 1KC8R 3NS7B 3NTKA 4DZ6A 4XTYA 1HBNA 1D8ZA 1BI2A 2JRSA 2P5VA 2BW7A 4PPZA 1Z9ZA 4L74A 4FNHA 3PJ9A 2MXYA 2EFVA 1WG5A 1JBMA 1C0UA 5KT7A 4FF2A 1NJIU 4CWBA 3F0NA 1FX2A 4EMKC 5CH7B 4FIBA 1FEHA 1VQMT 3T1AA 4LRDA 1M90R 4KGXB 1VQKT 1YHQS 2LNHB 5GANe 4FT2A 3IQLA 4NYZA 3IWNC 2HMIA 3OQ2A 2F4VJ 2E4HA 3RKYA 4XDCA 2FLLA 2FVQA 3JCMP 2DH9A 2DJZA 1HXDA 4HI1A 2A18A 1UTAA 5F0UA 4M77B 3HHLD 2PEBA 3M5AA 4QW9A 3IWLA 1AVZC 3KK3B 5FU7B 3JRZA 3GIRA 5I3PA 2BXJA 3MOJB 4C0DC 4DR1J 5CZVA 3AJ2A 3PEHA 2QQAA 3VGVA 2KNBB 1BWVA 1X4AA 3I56S 2BR0A 4J9EA 2M02A 1RWUA 5L9NA 2Y90A 3H0PA 2B4OA 4RBUA 3PIOQ 1VBKA 4QR2A 3FBFA 2BVZA 3OLBA 3DLMA 5A2QE 4C8QG 2HZCA 2DYIA 4WE1A 5BJRA 2IC3B 1UZHA 1ZS6A 2CNOB 5KE2A 3HRTA 1I1GA 2IIMA 4A4JA 3H5XA 4KBMB 2DISA 1WC1A 3C6UA 2K7JA 3MGJA 1HHTP 1OU9A 2DNHA 2O01E 1YVFA 2ZUGA 2BJ3A 4NEZA 4JI7F 1EHWA 2KTQA 1YP5A 3EH2A 1AWXA 1TV6A 1QSLA 3RIRA 4A8KA 1JLGA 4MMLA 1U1NA 3G96A 2AU0A 1RSCA 1LEOA 2D3UA 2V9WA 5AXLA 2ALZA 3M8WA 2LX9A 2PQWA 1PKTA 3F70A 4M5JA 4MKAA 2NLUA 1D8YA 1RKJA 5DS7A 3TA1A 4N76A 1WORA 4GMKA 2RRNA 4XK8E 2PZ1A 2LDYA 3LWHA 2E44A 1VQLA 1D0EA 4LDUA 3LP1A 2QFIA 2V1QA 3VS5A 5FU6C 2YVSA 3F56A 1BI1A 3AHUA 2UXBF 4RW9B 3ISNC 1PYTA 3JSCA 4C8QA 1M90U 3OSPA 2IJRA 1WFWA 2HGNA 3H9NA