2BE9B

Crystal structure of the ctp-liganded (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
148
Chain Sequence
MVSKIKNGTVIDHIPAGRAFAVLNVLGIKEGFRIALVINVDSKKMGKKDIVKIEDKEISDTEANLITLIAPTATINIVREYEVVKKTKLEVPKVVKGILKCPNPYCITSNDVEAIPTFKTLTEKPLKMRCEYCETIIDENEIMSQILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Sulfolobus acidocaldarius aspartate carbamoyltransferase in complex with its allosteric activator CTP.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase
molecule keywords Aspartate carbamoyltransferase
total genus 32
structure length 148
sequence length 150
ec nomenclature
pdb deposition date 2005-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
B PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 2be9B02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 2be9B01
1TU0B 1R0BG 1RAEB 2QGFB 1RABB 1Q95G 7AT1B 4F04B 1D09B 4FYYB 1RAFB 2FZGB 4FYXB 2BE9B 1RAHB 1RADB 2AT1B 1EZZB 1XJWB 2FZKB 4AMCA 4WTOB 8AT1B 1F1BB 8ATCB 1RAAB 2BE7D 2A0FB 1NBEB 3MPUB 4FYWB 4KH0B 4KGVB 1PG5B 1R0CB 4KGXB 4E2FB 1RAIB 3D7SB 1ZA2B 9ATCB 2FZCB 1TTHB 2ATCB 2H3EB 1ACMB 1RACB 5AT1B 1I5OB 1AT1B 2IPOB 4FYVB 6AT1B 4KGZB 1ZA1B 2AIRB 4AT1B 2HSEB 1RAGB 1SKUB 2YWWA 1TUGB 2QG9B 3AT1B 4KH1B
chains in the Genus database with same CATH superfamily
4AFQC 4ZA1A 2PGCA 1R6VA 2DYAA 3G9CA 1VK8A 4C8QB 2XZDB 3PT9A 4Q45A 1E6HA 1HYSB 1RTDB 5LXYA 1LWFB 2CQ3A 3IRXA 2AV5A 3M2VB 2DT9A 4RO0A 3JAMY 1V3ZA 2B51A 2IG0A 4Q8FA 4I64A 4RTVA 3KLFB 4F25A 3P96A 1GEHA 4RG8A 3H5UA 2WW8A 2Z57B 4OJGA 1WI7A 1GX6A 2HMIB 1G3SA 4IH6A 3KHHA 1TV6A 4HKEA 1GMUA 1IHWA 1X4DA 3EDQB 4GRSA 2CQ1A 5C24A 4WK3A 3SCJE 4PQUA 2HG4A 3BBBA 5MLCV 1YWOA 2CNLB 4E7KA 4F3QA 1K0VA 1IHVA 3M8YA 2RK1A 1QP3A 4DR5F 1KTVA 3I0RB 1SV5A 3QMQA 1YJUA 4QWEA 1M5KC 3IAM9 1T0JA 4ZPTR 2AJ1A 2XGQA 3HVAA 4JRKA 1QKWA 1XK8A 3KHGA 3FRNA 1YSJA 2CH4A 1NZAA 1W2IA 2ZBRA 4CM0A 1BMQB 4DQSA 4J6WA 2UUTA 3N6MA 4KKOB 4KO0A 3GJSB 2KFNA 2E5JA 3FBEA 1Q95G 1IRXA 2KG1A 2WBMA 5J2NB 1R8BA 4M8LA 1PYTA 5H9FK 1OYDA 1PG5B 1FDNA 1GT8A 4TY8B 4KGMA 1UZDA 4M77C 2HS3A 2PMHA 4ED6A 3QATA 4C0GA 2LA4A 3E2EA 4ZP9A 3OA6A 3QWXX 3LYIA 1RHUB 2CNNB 1NAQA 4K4VA 1NEBA 4F7UA 4YTLA 4J9RA 2R5AA 3FNNA 1CJUA 5GAGI 3O3LA 4DV3F 5G4DA 5KFLA 3GIRA 3SQGA 2F2WA 1T9XA 1G2EA 1R0BG 5DQHA 2A10A 3HP6A 1X4BA 2EQUA 1PAEX 5K8MA 2ZH1A 5EC7A 5LMNF 1A7GE 3ZC4A 3RNJA 2B5JB 1SH0A 4K59A 3H0IA 1NJZA 3I55T 3OTBA 5D4LA 2DEIA 3H7HB 2CKWA 3ILJA 2L3SA 3P5BP 3JYTB 3BEGB 4NYOA 1H92A 2P0PA 5LJ3Y 2DNYA 4DBQA 5M2UA 2D3OR 3A98A 1MN7A 3KK1A 1QVGS 2CWKA 3ET6B 2DXFA 1Y96B 4E7JA 2Y0SD 3OT9A 2B9XA 3D6TB 5KT4A 4AL5A 1PSDA 2B8PA 1T9TA 2K7KA 3ER0A 3A4TA 3NAHA 1VQ8Q 4W92B 1JU5C 1RYRA 1ELOA 1HWIA 3IRWP 3PJ9A 7AT1B 5LSLA 4J9KA 2XCPA 1UCNA 1JB0E 3F0NA 4YFUA 2JZ5A 3QT8A 2IC3A 2UV8G 2RDJA 1YX2A 3T1HF 1TK8A 4AQYJ 3D2WA 2DGVA 4QZVB 3W2VA 1R8OB 5HBMA 5LJ3g 5FLXE 3PDNA 4U96A 3K17A 5H9FJ 5GANg 2ZBIA 3ISZA 3OL6A 2BIVA 3HKSA 4C8QD 1NLKL 1ZBJA 1BUXA 4B3RF 2HL3A 4OV1A 3H8ZA 2JSXA 3IC1A 1B3TA 3B4MA 4F2SA 4TYAA 1VGYA 1T9UA 1VS3A 4F4XA 3T6BA 4ZCKA 3VS4A 3D68A 3MEUA 2I5JA 2QAZA 4OL8A 4EMKA 1JK9B 5E3CA 2M9KA 1U1SA 2BOAA 2VOOA 4CNZA 3VVTA 4CRIA 5L1JA 1NZ8A 3O44A 2ED0A 4F02A 1R0AB 4MZTA 3MCAB 1M9SA 1S72Q 3TAPA 1TUDA 4JOUA 4F14A 2RIJA 1SJFA 2EQMA 5DQIA 3GV7B 3AB4B 3SHWA 1MWQA 3F70A 1UWAA 2EW9A 2H4YB 3ITHB 3DN9A 3DRPA 2HZYA 5F8GA 1U1MA 3J7A1 1ZQ1A 2E65A 2EWNA 3MZIA 2D0NA 1VQMT 4M5MA 5KCHA 1YBAA 4M75D 2G2ZA 2IHR1 3VAGA 4HH0A 3ILOA 2LYVA 5B08A 3KLGA 4FDFA 2BJDA 4OMMA 1QWEA 5C25A 4M5DA 1ZA1B 2R42A 4EEYA 1UKUA 3CJ0A 5F9NA 3VZIA 4PFPA 2D6FA 2P9CA 5SZTA 3KWMA 4DR1F 1CC7A 4L74A 4LF2A 4WKRA 1NLPC 1JRIA 1KQFB 2C2MB 4QVZA 2B0GA 2JMCA 1VQ4T 4MJKA 2DK3A 5U47A 4NLPA 4P2MA 3CT9A 4M5JA 3EUNA 2D1XA 4MKVA 2MY8A 3M8WA 1C1BB 1U1TA 3I5CA 3VS5A 2V8JA 5J2QB 3MEDA 3QO3A 1REVA 5KYYB 1FKOB 2P6TA 3GIKA 3R97A 1WUUA 5F3TA 2FJVA 2LQWA 1K47A 2RHSB 1M5SA 1S4FA 1TKTA 2DE0X 2A3JA 4JI2F 1FKOA 1DTQA 3W7BA 1ULRA 1X43A 2HQGA 1VQSA 4KGXB 2BACA 3OYLA 5KFWA 2EK1A 3KHRA 3M8PB 2YUNA 3UF4A 2ZBCA 1SC4B 5KFMA 2BJ8A 2E5LJ 4J9GA 1N6QB 2E5KA 3SYZA 4B6MA 1T3LA 3S3MA 3CPWR 5FD1A 3UI3A 3M8QA 3A3NB 2CQIA 2VG7B 3A1PA 4IFYB 2KROA 2LNVA 4HCCA 4FKYA 4ZPVR 2OLWA 2AYBA 1V6HA 3LGFA 2NUTB 2E5HA 2DNHA 4EMGA 3CXCS 4ZHRA 2NUPA 4QPTA 3JTNA 4ZVHA 4EGLA 2QTVA 2PFFB 4C97A 1YITQ 1X01A 4KJIA 3NMAA 4WCIA 2ZE2A 1PAUB 4ITSA 2W10A 2R2SA 1FFSB 3U1MA 3ONQA 2OPQB 2BJ1A 3KBGA 1C0MA 2FEIA 1JB0C 5HKCA 1WDXA 4E7LA 3EVOA 2W7OA 3UD3P 1K9AA 1OQKA 4A8OA 2P0KA 4LDYA 3W61A 1Y57A 1S1UA 5L1IA 4M5NA 3MFIA 1W25A 3LGMA 5LMNJ 2DL7A 3E9FA 3QYGB 4USUA 2EK6A 2MI6A 1VQ8T 4OHZA 1D0EA 3CJ8A 2QQSA 2BANB 2AK5A 1N54B 4M5GA 1Q7LB 3C6UA 4HDGA 5IC4B 1PBUA 2DRAA 3HHLC 4L59A 3BFMA 3LGNA 2UU9J 1QLNA 3IM8A 5CD4A 1H2VZ 4OLOA 1OZ2A 2AKWB 1WDTA 1J3TA 5IOLA 3ZZTA 1F9HA 5HK4A 2V2QA 1K0SA 3FVYA 1U49A 1BQXA 1KLMB 3M56A 4LFAF 3KDOA 1FD8A 2VC1A 3DLGA 1VLYA 4XTTA 5E3RA 3H0PA 3MO8A 2KVQG 1IBLF 1VFJA 2GW8A 2O01E 1UB4A 2ERRA 3EGZA 2CJKA 4M7AB 1VUBA 3H9NA 5A0DA 2KXHA 2VWFA 2PQWA 3BO4A 1VDHA 3T1HJ 2BJ3A 3S7RA 2WOMA 3H5SA 3MPDA 2W9CA 1TL7B 1RWNB 9ATCB 4JI8F 1N36J 1DARA 3RIRA 1HI8A 1BB9A 1SBRA 2XY7A 2RB6A 2DO3A 3KMQA 5DLFA 2I2LA 3A8JA 1JQGA 5I42B 3OSNA 2OIHA 4DSKA 2GJIA 5B0DA 1TV6B 1IR0A 2R7RA 1R8CA 2B56A 2UUBF 4TYBA 2JMAA 2ILYA 4DLEA 1ICEB 4QYRA 4NLOA 4ZPCA 4CQ1A 4LF5J 3OHAA 1AZSB 4LRBA 4PXBA 2ZWPA 4WXWA 2WONB 1RWMB 2JS0A 4DBRA 1DHMA 1DLOA 1CVJA 1KR4A 3B8HA 1C6VX 2V68A 4CM2A 4RU2A 1YITA 2XNRA 4Q2LA 1PCXA 1DLOB 2HFVA 4OMFB 2KB2A 5DETA 4O4RA 3NOCA 1NDCA 1JQQA 1X6BA 4E98A 3U7JA 4XTWA 4K11A 2OTLQ 2XSJB 1FRLA 3VUBA 3QJPA 3C0CA 1FKPA 4C0HA 5I3PA 1TQLA 4O4GA 2C3YA 1KNZA 3KOAA 1NHUA 2VICA 3QPIA 2CP2A 2XMVA 2V1RA 1NSAA 4HA8A 4ED1A 2KGTA 3R27A 3Q83A 3M05A 4OX7A 5A8RB 4WFNQ 1H3ZA 3QIDA 2FRWA 5HQMA 3G87A 2M2BA 4HH1A 2XY6A 2I2YA 4OYMA 3JB9F 4F4WA 4KBMB 3EG9A 3CD6Q 1BI3A 2RS2A 2MZ1A 4DFKA 4BC9A 3TYTA 2LECA 3D1QA 5FRMA 2VFSA 2E5IA 2V8IA 3HSGA 4IRKA 3JSRA 1C0TB 3TVZA 2JTEA 2VASA 3CMET 4WJBA 3G6ET 2N3LA 2UUWA 3G82A 3G96A 4Y00A 3VGVA 2Y0BB 3UPFA 4QQ6A 4A4JA 1HBOA 3GV8B 1OU9A 3MMJA 2M4MA 1VRUA 1TELA 3VUZA 2H4WB 2VIHA 2XHCA 3RB6A 3CCSS 3TOQA 4JI1F 1P9QC 2B4OA 3OTDA 5D15A 3HHEA 2V9WA 4DBFA 5IC6B 1QCNA 2F63A 3M0PA 3M8SA 3UO0A 2DAQA 2LQ9A 5GAMe 2F4VJ 5J2PA 3OYEA 2VUBA 1KK7A 3S3NA 2QA4A 1RB0A 1YCYA 4LREA 4B9NA 2DXCA 3FC9A 1HWUA 2VC0A 3G8QA 2VFRA 1TWBA 2QL5B 1W2BS 1D3WA 1T3OA 4B02A 4DX8H 4J8OA 1OPZA 2FRYA 2H3JA 3VF0B 1VQLA 4DR2J 1U6FA 2E29A 2DHHA 2X1GA 4AFZC 1UWBA 3CDAA 1S57A 4UOFA 3A8OB 2K5LA 1T11A 4J9NA 1F5AA 1RHRB 5KFVA 2PA3A 5ETPA 1O51A 2NPFA 2QA4Q 3RW6A 3J7AF 2MMPA 3M4YA 1YBTA 3UT1A 5GANh 2MQPA 3RJMB 3GTYX 5LJ3h 4G6VB 4DR1J 4DI6A 3H25A 4D8KA 3FRZA 1OY8A 1HNZF 1X9SA 2UUCJ 4H4KA 2F4VF 2PUKB 1VK3A 2BRLA 3W63A 2DZCA 1ZTTA 2FC9A 2EFGA 5KFGA 2JEGA 2NPIA 3Q8UA 1NHKL 4DV7J 1SKRA 1HD1A 5CKHA 4A8KA 4K2JA 1D3BA 2RQUA 2JDJA 4HVWA 4H4KC 1LWCB 2GJ2A 4J7CA 3AB2B 3SFGA 2EFVA 2R7OA 1LV5A 4C92C 1H7XA 1IR2A 2RNEA 3BBCA 3IR6B 1CEZA 3FSXA 2RAQA 4GC6A 4RW6A 2XIDA 2R7UA 3D7SB 2ECZA 1AEYA 2ASYA 4N47A 1JLQB 3J7AN 4MZMA 4FP9A 1K76A 4P6QA 1L3UA 4NXNF 2FVPA 4C0DC 3V6HA 4L6V5 1VQYA 4WF9Q 5KOXA 3OFGA 2EIFA 2OFHX 4JDSA 3GCXP 3CC2Q 2DO4A 1BGXT 2OEJA 1HIYA 2RD1A 1RU1A 2IDLA 1S9FA 2GS8A 3AA8A 1FRMA 4DUZJ 3W2WA 4A47A 3PZPA 4NA3A 1YJ9S 4M75B 3QJLA 2JW4A 1YRUA 2DERA 4LFCJ 4C92E 3CMAA 1B70B 1EAYC 4E0DA 5KFYA 4FCYA 1U3OA 5I21A 4MKAA 4K4TA 2KQWA 1KSWA 1GXIE 5A8KB 1VQKT 3BR8A 3TUPA 5I3QA 4CLUA 4Q5VA 2OP5A 2I9SA 3QFHA 5A8KA 3V7RA 1AUSL 1QM9A 1JXMA 4DEYA 5MAOA 1DURA 5HLFB 2YNGB 2G13A 5D0EA 4OB0B 4PXDA 1EKSA 2BZYA 2YQ0A 2Y9HA 4XTZA 4X64F 3DU6A 2CUDA 2CPFA 2EW3A 2ZE2B 4RMOA 1OY9A 4Q43A 1YJNS 1CJKB 2MHNA 2OD4A 3TAQA 2V69A 2V8KA 1E6YA 2Q3PA 5KG3A 3BO3A 4ELUA 4KYZA 2XMTA 4WTYA 2UXDJ 3OR1A 4V2SA 2ZM6J 1X9MA 2EQIA 3CEYA 3LPEA 3I55S 4PJJA 1E6YB 1ZSZB 2ZITA 2DGSA 1PO6A 1FHTA 2NQPA 4ER8A 4ZVRB 1U09A 3PW5A 3V4IA 3MUVP 5B0FA 2NXUA 1VQKS 2W24A 4LR9A 2RF0A 4ZP7A 4F0MA 2DXTA 3HPOA 1KFZA 1IJFB 4DL6A 4FT4A 4NZ0A 1MNDA 3HKZD 4J7IA 4W90B 4J9IA 3TRGA 2NLUA 4P2FA 2GA7A 3HO1A 1PD1A 4ZVGA 2R7VA 3L2RA 1WDDA 4O44A 2ESWA 3CCLT 3QWUA 3DXSX 2DNKA 2E1CA 1V3RA 3KK3B 4QIWD 1C1CA 1XQHA 4JJNK 2CPYA 2HKQB 1T03A 1A9NB 4DR6J 4IFVB 4PL6A 1WG4A 2K06A 3G71T 2UVUA 5CA5A 2FUG9 3MAAA 3GIIA 2LU1A 4P5NA 3M55A 2ZHAA 3CD0A 1UGVA 4IR1A 3BSCA 2F5KA 1U48A 3OYGA 2NS1B 2VQFF 1SKUB 2KZZA 1YIJT 2JEJA 4XQ3A 2ABYA 1VIXA 5IAYA 1V3SA 5CKEA 2U2FA 2AZ3A 4EZ6A 4JI5J 1TSFA 2J6SA 1UETA 5LJ5d 3CBMA 3I55A 5E3PA 2YNIB 4C92F 4B3TF 4X9DA 4LFAJ 1BD6A 5LOQA 1JKHA 3R6GB 2XULA 4IKFA 2W2OP 1WELA 3PMIA 4Q2MA 1AD5A 3GP8A 3DDKA 3FSYA 4NLVA 3G6ES 4KHPJ 1KVJA 3FJPA 1FYNA 4USVA 2KXCA 3EGWB 4M7AE 3BREA 2L89A 1SSHA 2DRKA 2L9NA 3BDUA 2JRSA 2CG4A 4PPZA 3ZZRA 2HKEA 5GVQA 4C8QE 1U6BA 4QYZK 1VQ9T 1I1GA 2BM0A 2DVEA 2R2UA 2FVUA 3O5TB 2RRNA 2E64A 4GLKA 4DN9A 1OX8A 1WIEA 1WKJA 1HNVA 2PE8A 2AZ1A 4NEZA 3KLHA 2L41A 4PK4A 1LWEB 5GMKj 3L7OA 4JI3F 5H1SV 4LIRA 2XSJA 4M78D 2PN6A 1HHSA 1G5VA 3QYYA 1RAOA 1S79A 1MGQA 1FE4A 5IXFA 2MOXA 5GAOr 1ZM9A 2YX1A 3QLHB 4F36A 2HNZA 1WD6A 2JVVA 1YI2T 2SEMA 3RBXA 1HNIB 1PC4A 1PIEA 4RBUA 3TA0A 4AFFA 1KFSA 3I9V9 3VVUA 4LSZB 3NOGA 1U24A 3DB3A 4ZPDA 1KQSS 1X0FA 3R5GA 2LCWA 4F50A 1I51B 3AH6A 1FRIA 3KJFB 3QJ6A 3TQ7P 3H2UB 3OV7A 4C9DA 1RKJA 3W9IA 5LJ5f 1TKZA 3OTOF 4KC5A 1FMVA 4RKUC 3UR3C 6FDRA 2IA6A 3W64A 2BZXA 3MM8A 2AJ0A 1VQ5Q 5KFXA 4IFYA 1UMJA 1YK9A 2FVRA 3FK4A 2FIUA 1FK9A 3UCGA 3EZ5A 2UVRA 1TR0A 3G6VA 3S1TA 3PVQA 1BWVA 2HSPA 2E70A 5IT9U 4CTAB 4EYHB 1Y71A 3GR0A 2KYXA 3RB3A 3T6JA 4B3SJ 3SDEA 2NZ4A 3OVBA 3MTJA 4NYZA 3OMCA 2QGFB 2AX1A 4XTYA 5CYMA 3W62A 4BLGA 1OV3A 3HRUA 3D6MB 3HTRA 3IBWA 2VL1A 1K8AU 1R6YA 2F5GA 4F17A 4ICLB 3UDCA 4JYAJ 4DV6J 1UFKA 3SBMA 3K5LA 4OI4A 2HBPA 4RG2A 4KRWA 2CT3A 2GHVC 1JJ2A 3VV2B 4DSFA 1K44A 3MEEA 2NYIA 2EAYA 3L9ZA 3M30A 1Q8KA 2BANA 3CCUT 2CPIA 2NXJA 4L5GA 3PACA 3CXCP 4KHPF 1U8RA 2YUPA 4IKAA 3WQPA 3HSBA 2I5JB 2IM3A 1S6PA 3CTRA 2XLIA 3VS2A 3A8GB 3SMZA 2ZNYA 2HDAA 3META 4MIBA 2EC0A 3M1VB 5JJBA 3NL0A 1R0AA 3CUNA 2LDIA 1X27A 2NLWA 3R7NB 2ADBA 1NJIU 3MTKA 4HACB 1L5UA 4RTZA 2HRYA 1VQ5S 3QT6A 2NREA 3SXLA 4ETZA 2J6OA 1RWKB 4YEAA 2K3BA 2YHTA 1M90C 2QTXA 4M7AA 2ZH8A 1YIJQ 1PKSA 2XDDA 1Q81T 4LQ3A 3CCUA 3DRPB 4FT2A 4FS2A 5IV3A 1R8HA 3QIIA 1U8WA 4ZVEA 2GC8A 1FE0A 3BDEA 1D0XA 2JUFA 5BXIA 3OR2A 3FBFA 5SUHA 1YTYA 1K1QA 3CEDA 3L7UA 2JFKA 5HJYA 4M5DB 3E01B 4IG3B 1VHFA 1RTZA 1N5QA 3ZZ0A 4K4UA 2BW2A 4IG3A 2RMLA 4JJCA 5EWGA 5GANd 3CXCA 4DSEA 3TJAA 2O9SA 4A8WA 3KUFA 2M9UA 4RCCA 2AZSA 3OTCA 4M78C 2DF6A 2C0TA 1DTQB 2LFVA 4NLTA 5AJ3J 2M16A 1P1LA 1WOSA 1MMGA 4ORZA 1BK2A 1VQMS 3Q8PB 2AW0A 2UZAA 1UUEA 5KFZA 3OD2A 3FMBA 4RUHA 3J81U 2JVRA 4JS4A 2QX0A 5D6WA 1R43A 2QLXA 4F2RA 5F8NA 3PEJA 3CMEQ 4ZN1A 3T5JA 4MAKA 3M57A 1TMMA 3MEGB 4HVUA 2LJ0A 3FKBA 4DV3J 1XMOJ 2AZVA 2WBRA 2K3YA 3PXGa 4DV5F 3CCUS 1JLEB 2O88A 1B0PA 4EBEA 2FB0A 4Y34A 4FF1A 2W4PA 3SQOP 1ZOTA 1Q5VA 3X28B 3N5BB 1G6BA 1UJ0A 4OYOA 1S0MA 1CQNA 1F60B 2JWNA 4ETXA 4DZ6A 4DV4F 3DYAA 5D6XA 5D4PA 2YSQA 4OMPA 4X4QA 3R5AA 1CKAA 4LUEA 4UT4A 5ITHA 3DLKA 4M7DC 3M9QA 3WX4A 5T7LA 2IBOA 1TH7A 1G1XA 4DPWA 5B7WA 5C6SA 3OW2P 3JB9G 2NR0A 5E0OA 4EPCA 5GAGU 4KQZA 2QLWA 5JVGQ 2MWPA 2A28A 1QCOA 4KV8B 4PJOG 3VS7A 4LBHA 3IA0A 3R9LA 3DOLA 1ZTWA 3ZL7C 5KFEA 3OS2A 3NGDA 1ZX6A 2AQ4A 1RTHA 3GE9A 1ZETA 2SRCA 3R1HA 3FEXB 2XICA 1W7WA 3I56T 4IFVA 5J39A 5LL6S 3PNWC 1YRXA 2MKSA 1KHWA 4XK8E 5KG4A 3BGRB 2H9ZA 3KK3A 1Q0NA 4DS4A 2JL9A 4MMLA 1H2TZ 3V8LA 1IKVA 4U7UD 4PWDA 2YRCA 2O4XA 2LCSA 1SG5A 2CQDA 1TUVA 4FYYB 2XHWA 4ZVOB 5KG1A 2L48A 4LNPA 4WZQA 2CPXA 3A3PB 1Y5LB 5D4NA 1UGQB 4XTXA 2LT4A 4FXWA 4KBIA 2BVZA 4BI8B 1N5VA 3KNGA 1U26A 3CCRA 2R7WA 2DGOA 2LX9A 4FZVA 3TEEA 1UVLA 1BI1A 3C19A 1C2PA 4I2PB 3CD6A 4N0AA 1ZYQA 4OZLA 2OTJT 2M70A 4DZDA 2F9DA 2JVOA 5KYUB 1WEYA 1WG1A 3CCST 2RVJA 2AJQA 4CC4B 3JCMW 1APSA 3L4BC 2LQBA 2B6AB 4DUYJ 4ZLLA 2A1BA 1VC5A 2HAFA 3QRQA 4JPBW 1YJWQ 3SI8A 2E5LF 1UFFA 2E1AA 3S8SA 1T94A 1F9FA 3QSIA 1JLCA 1WSVA 1XTDA 2LP4A 3UWNA 3DC2A 1RQ0A 5HY6A 1WLPB 4DU8A 5GAMh 1FXDA 4U67Q 2OPSA 1M5PC 3QGHA 5D6GA 1YDLA 5LMUJ 3MHYA 2EJFA 4JI0J 2ROGA 2RHXA 2MIOA 1LWXA 1FTRA 2FD2A 4DQRA 3MMCA 5LJ3j 1HW9A 3GNFB 4LVOP 4OZ2A 2FVQA 2CADA 3MMCB 3PMTA 1NPRA 1H72C 2AEFA 1YJWA 1U1NA 2J8AA 4M75F 4IUQA 1GFWB 3DLEB 4O4GB 5ETVA 1WC0A 3W8PA 3S6WA 5GMKm 2MZJA 1V5VA 4ZNXA 2DL3A 2MCNA 2EFOA 3MM7A 4DA4A 1VQ9S 3DHWC 3MHXA 3HJFA 4HEA9 2E3IA 4LDUA 4U7UK 5EN1A 1N9RA 1NJXA 2YRVA 1ZLMA 1EHWA 1UJYA 2R8GA 5A0YA 4KGVB 2EBGA 4DL0C 3OL9A 5HATA 1X7VA 1KJWA 1AT1B 4LBIA 3BGFA 3EG9B 3FFIB 1WHHA 2CUBA 1BC6A 2GZOA 1RAEB 4DPYA 2CP6A 2V94A 4JLIA 4PPDA 1WHKA 1GMVA 2CG8A 3G71A 2AYGA 4D3HA 3HHDA 4LF1A 5EUHA 2DMOA 4H54A 4DV1J 1OIAA 2OTJS 3UD5A 3C8YA 4UQTA 2WRMA 3CCET 2FY8A 2AGQA 1S48A 2L3PA 1ZPVA 1ZPWX 5KE3A 2PVGB 2OX7A 5K14A 1QSSA 3HPWA 3OXFA 4RW9B 3TAMB 4ATOA 4N77A 5CYMB 3AHPA 3DOKB 2GGRA 3KJVA 2ZH3A 4K5SA 2QE5A 4Y2KA 2HIYA 3VAHA 4J9QA 3VU3C 2ZD1B 2HRUA 1UW4A 2JTFA 4QIVA 2XS5A 1X0PA 5KFQA 3HM9A 1FEHA 1T7PA 4JI1J 2ZC3A 5DGBA 1MSWD 3QBCA 3D0HE 3FEZA 3RR8A 2ASJA 2F69A 4LD6A 4C2MA 2QMUB 1U2CA 5DS7A 2RJDA 3OJUA 2V8PA 3TCJA 1GFDA 3GYNA 1Z9QA 4R25A 3T1AA 4ZCIA 3QYHB 4N0AC 2UUAF 1SQGA 1KN6A 1I1JA 1UFLA 1Q86R 4N56A 2E6ZA 5GAN2 4ZGJB 1U6ZA 2M3DA 2DPJA 5HANA 2GVDA 1KLMA 2A08A 5CKBA 1L3SA 3OPKA 3WIVA 3G1JA 2JC1A 2XBPA 4NLQA 2DILA 6AT1B 4LMZA 2CZ0B 4UOGA 1LWCA 3CF5Q 1RT1B 1IBMJ 1KKHA 1WHYA 3T5KA 1V1CA 4OMQA 4XIUA 4QQDA 2X1BA 1H3HA 1TL1A 3SCIE 2V67A 5EHHA 4MK8A 3F41A 3UN3A 1S0NA 1YHQT 5LJ5Y 1RU2A 5KG2A 2OI3A 1GXLA 2DXUA 1B34A 2QQ9A 2X7IA 1OPKA 1T9YA 1PKTA 2K3XA 1IM4A 1HSQA 2CFXA 3OR2B 4I6YA 4ED2A 2X9HA 2FZKB 3PYFA 1W70A 2F8MA 1MWZA 1OULA 2R4FA 3PIOQ 2R3VA 3Q86A 3FRYA 1TK0A 1Y9OA 3OYIA 2R7TA 5GJWB 1LPLA 1JXOA 1GTHA 3RMQA 3HSZA 4J91A 1N5TA 4WU2A 2M0YA 3W2WB 3DLLQ 4ECRA 2XZWA 3FZBA 3DI6B 4DQQA 3RZAA 3FQLA 1JLGB 1NH8A 3I82A 1YJ7A 3GG1A 2D69A 4DR7J 1UEBA 2D8HA 4NYPA 3RTVA 5CABA 3ZNUA 2YQ3A 2NXCA 2LJ3A 4DOZA 4Q0BA 1VC6A 4RLEA 1X2KA 2CQBA 3OSPA 1NUEA 3VZHA 2D1CA 3KHLA 1XIQA 4CLYA 3V8KA 1D1CA 5IXUA 2RD5C 5F0WA 2VPWB 3QLHA 5CYQB 1VIOA 2B9EA 2GTOA 4NLXA 3HCXA 1GH8A 4BD3A 4M7AC 3TZZA 3KKFA 1DFDA 1V29B 2NZCA 1FFWB 2JNJA 4E47A 2GHWA 2FDNA 1Y11A 2MKKA 2MKIA 1N27A 1NJIT 2ZC4A 3MAHA 4LQ9A 4OHVA 2UU9F 1R77A 3POTB 4A8SA 2C22A 2DJWA 4URSA 2JTMA 4OHXA 1Q82U 2J5AA 1ITPA 5HK0A 3TA2A 2H48B 5C42B 2GQIA 2W8LA 3HFOA 4XU3A 4B9VA 2BR0A 2P4TA 1P1TA 2DNRA 2CJQA 3OTOJ 2D9OA 4Y2CA 4GVBB 1B64A 5C42A 4USHA 3NG8A 2KY9A 4X4TA 4DFMA 3V4IB 1WA7A 3CJKA 1VQPT 3TWZA 4KV8A 2OUGA 4D8DA 1H641 4ZLNA 1D9AA 2XWXA 2J05A 1WXBA 4ZTJA 1VQOT 2COWA 3K5MA 3SD4A 2E7VA 2KT8A 1QAYA 2VPXB 5HBMB 1RTHB 5J2MA 3H42A 1S1WB 4LF8F 1GQEA 4Y2IA 3QKJA 1VQ7A 2R5MA 4U7CA 1F6TA 1JXEA 4A4FA 1OPLA 2UVWA 4OLPA 3J80U 2R9LA 1Q81C 2E7WA 2ROTA 4LRAA 2V2ZA 1QWFA 2JFDA 3M0SA 5E3QA 3NMZC 2W2PP 2ZBQA 3K5PA 2QO3A 2I38A 1BHNA 4RNHA 3IS9B 3V8JA 1M1HA 1FWKA 2HWHA 2O4XB 1FWPA 3R6OA 1IWAA 3FSIA 4FVMA 3H40A 2OTLA 5L8RE 3CCMS 2ZOMA 5I4MA 3CC4T 4KGKA 1SHGA 4O3OA 1N8RT 3QT7A 3HHNB 2K57A 2P4RA 5C0MA 2C2OB 5CK9A 2DHGA 3AJDA 4A46A 1S77D 3C16A 1LW2A 1WHXA 1N0VC 4HVZA 2COZA 2PT0A 5GAN7 1ZM3A 2MK5A 3K89A 3NBPB 4I2PA 2ZWOA 1YZ7A 4DQ2A 4OJ3A 2DRMA 3GWCA 4M7DB 2EJ9A 5L9NA 1V9OA 3MM5A 3GR1A 4C3MA 4M77A 3BJYA 1U4BA 1MWYA 3ENAA 2NCKL 2BM1A 1GNKA 1YBYA 3KLGB 2A2CA 3TVYA 2J6KA 2ZNZA 3MM5B 2L9WA 2HGLA 3VS3A 1YJWS 5GAN4 3DMJB 4LSNA 3OTEA 3DRSA 4NLSA 4I2QA 4OB1B 2V63A 3OVAA 3V2UC 4WIQA 2L3RA 4F67A 3PX0A 3E01A 2FJAB 1F2HA 3LAMA 3JB9D 2MKCA 1FKPB 4YOEA 2AYEA 4B3MF 3QJJA 5GAOn 1VQ8S 1NG2A 4QWDA 2VDHA 1REGX 1KC8U 1X4FA 4PJOD 4ES1A 4ALZA 1C1BA 3RUXA 4DV0F 4JV5F 4QR2A 1RTJB 2M51A 3JCMX 4MIWA 1B3QA 2AHOB 4BCAA 4RR5A 2C3UA 5KG5A 3CCVQ 1OJ4A 1YRTA 3G71S 3CBOA 1F1BB 4GKKJ 1G3OA 3CMQA 1KFDA 1U47A 4LF6F 5GAHU 2KEAA 1H0HB 2XG8A 2KRNA 1OEBA 2Z2YB 4WFAQ 3OUYA 1WC5A 2BV3A 2QG9B 3OYJA 3P5TL 3I35A 1FNOA 1M90R 2J06A 1RT4B 1YI2S 3KDNA 3GONA 3QGIA 1B0VA 5D3GA 1RAAB 3DGVA 3D1OA 1N9SA 3VS0A 5D77A 2HGNA 2VJVA 4M7AD 1Y96A 3FCHA 2HNDA 1CPZA 3GJTB 3CC4S 1TK5A 1VRUB 1OI1A 1F5CA 1M2VA 2YNGA 2XMFA 4A4GA 1OSDA 1RGVA 4DG1B 2VG7A 3PW7A 2FHDA 1RAFB 2SXLA 1JXVA 3PV8A 3WVEB 2AEMA 2YLBA 4ELTA 5FWCA 2RE1A 3V4MA 2E1HA 3MM8B 1HXDA 4BC7A 2CP3A 4M7AG 5J2PB 4EU0A 4PJOE 3MAQA 1KD1U 1MROB 3SIPB 3FUYA 2IYIA 4BI4A 2QLBB 1G3YA 4G3IA 4PYAA 3L2WA 2ED1A 4ILMA 1L3TA 5HP1B 4KH0B 2L08A 2KHCA 2LEBA 2OD6A 1M5OC 3CMES 3T1YF 1G83A 4ZPWR 5E41A 4TU9A 1KONA 2DHXA 5J1EA 4ZVFA 3SCKE 5JXSA 4J5OA 2Z0GA 2IAJA 5HN0A 4JI8J 2J6FA 2DNUA 2LX7A 4LRFA 4OI6A 4AYBD 4JJDA 1XWLA 3PHEA 4RWXA 3CCJT 3BH6B 4AL7A 3I5AA 1J27A 4C8QA 4DJBA 5K8OA 2EGEA 5LJ5g 4C5EA 5KCOA 3MEAA 1JLAB 3HF5A 4P52A 2IRUA 3JB9k 5C2GA 2APOA 5FLXU 4DQPA 3CCTA 2RKIB 3DRRB 5CAIA 3E19A 3E1SA 2PA8D 3M1VA 1XMQF 2ZH4A 2DIUA 4RX6A 2KI7A 4ED7A 2XY5A 1U7LA 3PE0A 3ITHA 1RTDA 4JI0F 5HROB 1Q1KA 3UNGC 1Q5YA 5CCLA 1ZAXA 1B0TA 1Z4UA 3QXEB 1SEMA 4LUDA 1TKXB 5DM7R 3I56Q 1I5LA 3QZ5B 1NJWA 3S3OA 2AIRB 4KTQA 5C25B 1C4CA 3AFGA 3LW5C 5ETMA 4PFZA 1NH7A 5F8MA 4B3TJ 2M8HA 1ZZNA 1TXQA 4CO3A 4CLLA 3QZ7A 5GAOq 1SJ4P 4O6JA 3MR7A 1T9WA 4UTGA 3RR7A 2P2CB 2EGAA 4B9UA 1SV5B 3MP1A 5KYWB 2CGHA 4PAAA 1S6QB 3H41A 5KG6A 2KE9A 3UFCX 3GZ7A 3GPAA 1X2QA 2FGOA 3V6DB 2B4UA 2DVIA 4K50A 4J9BA 1RHMB 1TKTB 1YVFA 1CJTA 1GXUA 4CT9A 5ETLA 5DZ7A 2XU8A 2MY7A 2V9KA 2BA9A 4ECWA 3JCMd 4PXCA 4YB7A 4GVLA 1CJTB 2P6SA 1YKWA 1VQOS 3QNWB 2V34A 1VQMA 4M63A 1N34F 1Q7YC 3WBZA 3SB2A 5DM7Q 1UGSB 1HR0F 1RBAA 3KK2A 3M9NB 4LF9J 1A0NB 2HNYA 2I6WA 4F7UG 1HPZA 3BKFA 3G6EQ 2DISA 4A4KA 2KM8B 1KQSP 3CCRS 4HTJA 1QUVA 1FX7A 4NRUA 2L5QA 4H4OA 2A3LA 4LR7A 5CCAA 4PNOA 2XM3A 5L39A 1I8FA 2N82B 4R56A 5DG7A 3PFEA 2FHOB 1N56A 2E6NA 4BY6B 2FO0A 2PO4A 3RB0A 2V8DA 3G4SS 1HBUA 1TU0B 4DMZA 2Y1IA 5FU6B 4BI3A 4ZIVA 4HL9A 1DQ9A 2YWEA 1M2OA 4NLGA 3H5YA 1VQLT 3G6EA 3EDRB 1N6AA 3OSSC 4EUVA 1W1FA 4KR0B 4F8RA 3TZXA 2IPOB 2FJBB 4EWTA 4IDKA 4ZVQB 2MQLA 3QZ8A 2PMZD 1ROFA 3CCQQ 5FLXY 5C5JA 4C3KA 4C8OA 2HYIB 4WFZA 3QRRA 2EFPA 4MTPA 5HVHA 2UV8A 1YNZA 1UW9A 3J81E 2KDOA 2VG5B 5F41A 4ANDA 3F44A 2KT5A 3P4UB 4DQIA 2XKOC 4ZGDB 5IHKA 2ZZDA 1VMBA 4EK2A 2QA4T 2VA2A 2WVCA 2OEMA 2RUGA 2RI2A 5D8HB 2LU2A 4F4YA 1HMVB 1MUZA 5RUBA 2CXEA 4X1VA 3RBEA 2V1QA 3HHLB 3EFRA 2ZHBA 4F0KA 2JEIA 4FW1A 3RBZA 4PWWA 3VV0A 3P8DA 5T41A 4A8QA 4HT8A 3BYRA 3HHLA 1WF2A 5ETTA 1YIJA 4NLRA 4B9WA 4JV2A 3GYGA 3AOBA 4CDIA 2G4BA 1WPYA 2V8GA 3CCUQ 1O9SA 3SWNA 1RI9A 4UQGA 2HQIA 3W9HA 1KWMA 2HSEB 2YTCA 2XYPB 3CXCR 1M1FA 4B9MA 4FU6A 2VPYB 3OXLA 3NCQA 5DG8A 4E7SA 4KFBA 3M2UA 4QKUA 2HHQA 3UWTA 1C4AA 4EO8A 3RDVA 4NCGA 1IKYA 1CJVB 3HD2A 2RB7A 2FZCB 3I0SB 2QSFA 2DIVA 1GTEA 1S97A 1PBAA 5M2PA 4D3GA 3ZTQA 4GBQA 1QAJA 2WZ1A 8RUCA 1RK8A 2ZPEB 3ZXWA 1JJ2S 8ATCB 2ALYB 2DGXA 4F7UE 4UY85 3NBPA 3J7Z5 3EH1A 1OSCA 1HNXJ 2GIRA 2JC0A 1HR0J 4ELVA 5GAHI 1Q86T 4DR3J 2Y1JA 1P9YA 4FS1A 4LXCA 2UXCJ 3G7ZA 2M1HA 3L2VA 1KC8C 2HBWA 3HX9A 2JM8A 3URGA 3NGPA 4C0FA 4CH1A 2KM8C 3CSKA 1K73R 3DRSB 2AU0A 2W4CA 1X4HA 3CCSQ 1REVB 2JEFA 4DL2A 2XCAA 2K1RA 2ZZTA 2LKZA 2IMWP 2HZCA 4OZ5A 3P8BB 4YHHJ 3V81A 3BQ2A 1JX4A 1AXQA 2UXCF 3RAXA 1VYUA 2PZ1A 3REAB 4CI0C 3RKWA 1FXRA 2EYZA 1R7IA 1SB6A 3DLEA 3OFFA 2A18A 4LDWA 1NJIR 2FLLA 4CO2A 4NASA 1RT4A 1GCQC 4Q8EA 5K5MA 4KAIA 2JH3A 1YJRA 2AJ4A 4XU0A 3MDFA 2MB0B 4BWJA 1M8VA 2FJXA 5D0RA 3OXGA 1VQLS 4FKXA 2NUTA 3AD7C 1S1XA 3N9UC 3CCLS 1JJ2P 1R8AA 3PYGA 3MD1A 1GBQA 1RP5A 1RWXB 2LA6A 4J9MA 3JCMg 5CYQA 1N33J 1K73C 3PNIA 1BCMA 3LF0A 2PMWA 2DTJA 3M58A 2RJFA 1OX9A 2O1PA 2IC3B 3UW1A 3QJYA 4ZJOA 1IJEB 2ZH5A 1TFWA 3HFNA 3R3TA 4ECVA 2HQXA 1N34J 3TX0A 1VQ7T 1OOTA 3LA0A 2AMCB 1SIZA 4EBCA 4ZTFA 4C8MA 1ZH5A 4OF1A 3OYHA 1NNDA 3BDPA 4DL3A 3I6PA 3M9OB 5LJ5j 2E7XA 3SV3A 1X75C 3OW2S 2COYA 2F5TX 1O8BA 3GLXA 3EVWA 2N7YA 3PIOA 2BJEA 3ENWA 4OMFG 2D9PA 3P45B 2MKHA 3UR0A 1M90T 3C15A 3O1LA 3CD5A 1O0PA 4W4MA 4J9UE 4Z89A 3G4ST 4CIOA 4IG0A 3U23A 2RKIA 2CP5A 1LWFA 3M32A 1H8KA 1XR6A 4I67A 2CYZB 4A8YA 4BBYA 2CZ7B 2HFNA 3C14A 2QTWA 3GJQB 4OHWA 1NK7A 4WE1A 2Z2MA 2AT1B 4QBUA 3TVTA 4R8UA 3W65A 2HHHF 2PD1A 4PJNA 4J5YA 4QW9A 3PIPA 2KT2A 2I0NA 2GFUA 2QA2A 1PCAA 2IY5B 3M0UA 4KHMA 1TVRB 3I5RA 3MUTP 1ZBXA 4PWDB 3ZFJA 2QT7A 5EGYA 1E6GA 3A12A 2OMLA 5GAEI 2XC9A 3MKDA 4X66F 1S4EA 4C4WA 3QSUA 1TVRA 2ZPBB 4DFJA 3ASKA 2FJDB 6FD1A 4L75A 4NWBA 1YJ9Q 1VQNS 1KQGB 2IYGA 4FF4A 3BSNA 3HVTB 1B34B 2ACYA 3C4SA 5GAOp 2IVMA 1RT6B 3R7SB 4I6AA 5GMKl 1SCJB 1VJWA 3EHQA 4ZCMA 2AJ2A 4PG5A 3GFZA 3HVTA 3VYGA 5GMKa 3C95A 1RWPB 1S6QA 3VJPA 4A8MP 2ZUAA 4USMA 4QWBA 2B3TB 4CT8A 4ZK7M 4LF5F 4LUBA 3MECA 1YJ9A 2AGOA 2HHXA 2KFYA 3D6HB 1SL0A 1X6OA 3KJNB 2QA1A 1Y00A 3TANA 1NZ9A 4N8NA 4J7FA 3DI6A 1Y5IB 4RJVA 3TZYA 1QQJA 3WX8A 3TQ1A 2JJ9A 4AMCA 3DDIA 3JCMe 3LX7A 4E8UA 1M5HA 2CPDA 4WIIA 3QWYA 4OMNA 2EFQA 4IQMA 4UUXA 3A8KA 1M5VC 1K73T 2IIHA 5HLFA 1WEXA 3BSOA 3BH7B 3GF5A 1J5OA 4YR3A 1WJRA 2XMWA 4LFBF 2R8HA 2BUNA 3HDSA 3KG4A 3CCZA 4C8QF 2PVOB 2PNIA 4PR6A 5A8RA 1J5OB 4ZHRB 2F1FA 1HI0P 2JM9A 3G86A 2QEXT 1L3VA 3QG1A 2F9JA 5FJ4A 3MXHP 3IWLA 2EKOA 3X20B 1W6XA 1RADB 4X9CA 1QVFS 5FU7B 4ZJLA 3I32A 4ZCLA 5D3GB 3JYTA 2PTKA 3OYNA 2YKAA 4DR7F 1Q7YT 3KXTA 1K1ZA 4IOAQ 3HKWA 2PDAA 3CCQA 3G82B 2ZAEA 4HT9A 1IQZA 2ADCA 2X51A 3I9ZA 3QT5A 2Y4YA 3CJQA 3G4SA 1G2BA 4Y3CA 3MUMP 5CKDA 1SKSA 2HQDA 2J0XA 1VQ4S 3MR6A 4Q7AA 4HDHA 1WTFA 1Q78A 3EHRA 3OSVA 4ZGEB 4CTAA 3DLLA 4M95A 3JCMJ 3LWIA 2W7AA 1QSLA 2EBEA 1SIWB 4K8RA 2QFIA 4NL2A 1UHCA 4F4AA 1VLOA 4DV2F 5GJVB 5DGAA 3NGKA 5KAKA 2KT1A 3B54A 4J9SA 3BKUA 3MOJB 4X62J 1IKVB 1MLAA 5JUMA 1BWEA 1NJIC 2GFFA 2DNGA 1U0HB 3GFYA 3VS1A 3ZO7A 2ZOGA 1ACMB 2E41A 1K0XA 2AEJA 2AWZA 4DL7A 1YBUA 2W2QP 4RW8A 1TP7A 4OX6A 4IUUA 1R27B 1NKBA 4PZVA 3CE8A 3MEEB 3T1YJ 4J9OA 1YHQA 2C2RA 2DR9A 1LJOA 5A8WB 1Y3KA 2CZ9A 2V0NA 4OJ1A 2UUCF 4A48A 1KBRA 2Q6BA 4RW4B 4J9PA 4CLPA 3A8IA 2MYSA 2QMXA 1KOOA 1U02A 2KVIA 2YKQA 5D7UA 3C16B 3G6YA 1WHWA 1EKRA 1N52B 4A8FA 2HLTA 2RQTA 1IBLJ 4CC7A 3BGUA 4HXJA 4EMKC 2RRBA 2V26A 3CQTA 1MN9A 2V4JB 2W0ZA 1D3BB 3ZTPA 1Y0MA 5L23A 2WTFA 3N28A 2HWTA 3LGHA 1U25A 1FX2A 2J7UA 2E9ZA 4AUKA 2ZKUA 5LJ3d 4RW6B 1WHVA 1NKCA 1X9WA 1FJ7A 2ZZMA 1SF9A 3QWPA 3JAMU 2F4FA 4OGCA 2QA4S 4IRDA 2VC8A 3M4GA 2YX4A 2YKNA 3X3UA 4DPUA 4ECSA 2RQMA 4FF3A 1KQKA 2DXDA 1O6XA 4E6RA 4UZBA 2F3JA 4RNMA 4YDXA 3MURP 3H4DA 1NSQA 1RT5B 1HARA 3VGSA 3T5LA 4RWWA 3DNCA 2DPIA 4XO0A 4C5GA 3SWNC 5HQLA 2CDRB 3D0GE 3M2RA 2PEBA 2O01C 5FWBA 5A0YB 5D6YA 4CZCA 4RW7B 1RZMA 3I4PA 3TA1A 4MK9A 2VQFJ 4M77D 3HL8A 2DH8A 3HI9A 2H8HA 1SH3A 3PCOB 4IRCA 2MLYA 2YVSA 3CPWP 2IM2A 3KYLA 2WSFC 2RH3A 2LQNA 4CC2A 3CCWA 1FK9B 5M2RA 1SHFA 4CLWA 2BBEA 2FVSA 1QMCA 4C11A 4O3RA 3QDRB 1WSRA 1SJ1A 4B08A 2G9OA 3M8RA 1LOJA 4JLGA 2DXEA 4V1Ak 2GGPB 4JV1A 3I56A 1NO8A 4C11B 2CSIA 1Q16B 1P8GA 2GBQA 3QRPA 2GIFA 1VBXA 3QGGA 4RNNA 3PTWA 3PO4A 1SJRA 4ID8A 2XG8D 4NCBA 2ZH6A 2DRBA 1ZSZA 1M3CA 2IAJB 2WSEC 5KT6A 1QSYA 4I4BA 3CJ4A 1FMKA 1YI2A 3MGJA 2QI2A 3I87A 1XR5A 3C3LA 3AHUA 1FXXA 4CWBA 2YY3A 4BWMA 5I3UA 2BUDA 2H5EA 2OHDA 1BQMA 3MEWA 1KD1C 4V19X 2DH7A 4IOCQ 3KMSA 3BGOP 3D6FB 2X35A 3PM9A 5AYFA 2DR6A 1S7HA 3EG1A 4IIMA 3RRKA 4G1QB 2C2KB 5AE3A 4PABA 5GAMd 3BN7A 2KO1A 3NGRA 4PXEA 3OHBA 2EWHA 2W9BA 5CQYA 2NSCA 4ATNA 3BQ1A 1G3TA 1M4ZA 2DRDA 1NE8A 4ELYC 2FHMA 5THWA 3TUJC 2XMUA 3C2PA 2HEQA 5GAMg 3CCQT 2HBYB 2V50A 2C0OA 2JLEA 4M78A 1IKWB 1CS4B 1FESA 1BIBA 2XB2D 1H3DA 3MM6B 3LP2B 2KNBB 1F9EB 3EGVA 1UVJA 1RXOB 1X4GA 4Z2XA 4Y6IA 2Z58B 3T9ZA 2GQVA 1HWLA 3MM6A 3ZZUA 3VQSA 3MPWA 5I22A 3X24B 1VIFA 2HFUA 1Y07A 5HI7A 1N5ZA 3JCMQ 3OY9A 5DZ6A 1RBLA 3TARA 4YR0A 2LJ1A 4P74A 2FL7A 3NS7B 1VHIA 2VBWA 3R5DA 2DM1A 2N3OA 1O5JA 4P72A 3I0SA 2AJFE 4FYXB 3DRYA 1XNRF 3C6TB 3CC2T 2QSWA 3PW0A 1QP2A 4M94A 1U1LA 4TQSA 4DV4J 2HVIA 2RQKA 4ZS6A 1XERA 3N01A 3MPVA 3M0RA 2JOQA 4JUVA 3A8EA 3DMJA 1NDKA 1H7WA 5A6WA 4LSNB 2OSRA 3KLHB 1YHQS 2GF7A 2FLNA 2BKDN 1RL2A 5E3AA 1WC1A 4FYVB 3GNGA 3DXBA 2DD4A 4OZ0A 3HHTB 2JHEA 3GILA 2EKYA 5B0GA 4F7UB 3ZTRA 3LO3A 2PIIA 5GMDA 2J0QD 2ZVSA 3THVA 5CIUA 1HKAA 2RU3A 1LWEA 2YNFB 1FKAF 1NK9A 4NXMJ 3CJSA 3HULA 2X3WD 3FMWA 3QGPA 2O31A 1KTQA 4M78F 3MWBA 4MDXA 3WDOA 3DM2A 2PI5A 1DTTB 1K0TA 1BU1A 2ABLA 2L0AA 2OELA 1HPZB 3Q8SB 2M5YA 4CH0S 1Y7PA 4GC7A 1TKZB 2MLZA 1VQ4A 4JJBA 5KG0A 2AD9A 1KC8R 5F9LA 1I3OB 1F5BA 3PYEA 2IVWA 2LVWA 3PW2A 1N32J 1ZUKA 5BR8F 4C0BA 4Z02A 2DL5A 4X4NA 5AE1A 3CCMQ 1HBOB 4LF6J 2ZCFB 1HWJA 3PYDA 3HRTA 2PFDA 3IXQA 4FXDA 4Y0FA 1VQPQ 1HQUA 2J9DA 3NGUA 1AWOA 2BE2A 3SFUA 4XTVA 2E66A 4A4HA 4JB8B 4O44B 4DX5A 2FJWA 1X4EA 5KOWA 2QL7B 5BYRA 5LL6d 2VUGA 1QUPA 2K2MA 5KE2A 2FYKA 4KH1B 2VONA 1VIEA 1UHFA 3GJRB 2DNMA 3IWNC 1TMJA 2VH7A 3HFZB 5DLQE 5E33A 1JJCB 2M52A 4QPXA 3IO1A 1JO8A 3DRXA 2OH2A 4MKYA 2KXDA 3J81Y 3RU0A 3FIFA 5CXTA 5KT5A 1M1KT 2OAUA 3DB4A 4AG2C 4WFBQ 1YP5A 1R3NA 3PFSA 2EI5A 4PFOA 3SFMA 1PJ7A 3HP9A 1XMBA 2OJ2A 1U0HA 3BN4A 3U27A 1UWBB 1XNRJ 1PGZA 1I81A 1S9EB 5A2QU 3N5FA 2KHDA 3X26B 2AYMA 1Q86U 4ZN3A 3RERA 4EMKB 2XLJA 4X4OA 2HD0A 3RAMA 4M5LA 2IRYA 3R6NA 4DF4A 2EYWA 2JX2A 5KT3A 2QL9B 2WVFA 3TQEA 2EKHA 4MFBB 2CJBA 5KFPA 4DUTA 4P2SA 3D54A 5DG9A 3EFOB 1HHQA 4BB7A 3W66A 4DV1F 1VYTA 3CCVA 3UCUP 5I11A 1Y10A 4P9SA 1HD3A 2AP6A 2UP1A 3LWMA 3LWHA 1OYEA 4OX9F 1M3AA 1JLCB 1OO0B 3NNHA 1Q82C 2ZDOA 2FY1A 2ZDPA 2Z0WA 3PEHA 2W8KA 2EG2A 1HHTP 1U1QA 4UUWA 2LQKA 3CC4A 2KKHA 2XDBA 2PEHA 1OQ3A 4LFBJ 2DNNA 3TEGA 4ERDA 3SCLE 1Q86C 2YRDA 1QE1B 3JS9A 3L42A 1OPIA 2IMOA 1T8EA 2DLPA 3PG9A 2CQ4A 4W98A 4NL5A 1U2FA 2F8EX 1WQWA 1EX4A 2QDLA 1VBYA 4F4ZA 3US5A 3D1HA 1UGRB 1I94J 1X5TA 4WP3A 3QIPA 4J6XA 3R8YA 1NB2A 3H0FA 3GCWP 5FDLA 4F4KA 3TREA 1LFPA 2POKA 4PLLA 4DOVA 3V6JA 2G0CA 2JT4A 5FROA 2QDYB 3QO9A 4RW7A 4ID5B 2VQEF 2HFOA 1UAWA 4JP8A 2RO0A 3DCAA 3LAKA 2YLCA 2ZJPQ 4LRCA 2V5HG 1M0SA 1CC8A 4C8LA 1UJ6A 2YNHB 1RACB 4OJHA 4PG4A 4N5SA 4AD6A 1FJGF 3PIPQ 4KRTA 1RTIB 2PU9B 2KT3A 5KFBA 2C0IA 1HJDA 4M7DE 4IUVA 4XU1A 1YQHA 3J81j 2K2PA 1UP1A 4DV2J 1DZ5A 4BACA 3LPYA 2HQHA 3Q2TC 2CZVC 1F3FA 4XTUA 1BE4A 2HK2A 2RJZA 2NUPB 3RMSA 1CULB 4IO1A 4UOHA 3LGLA 4OZJA 4IUFA 4IR9A 2P9GA 4FSXA 1GMWD 1YI2Q 3CCSA 1RHQB 5KG7A 3PX4A 1D9FA 2VZ9A 4O3NA 3OMGA 2OPRA 3TP2A 4DV5J 1AHJB 4WTOB 2CPEA 3G71Q 2CQ2A 3CCVS 2Y1LB 2Y8WA 2MTLA 3CCEQ 2CPJA 3DGPA 3O2IA 3OYDA 1NK4A 4WFYA 2HQFA 2EBPA 2VFVA 3DOLB 1YWXA 3DGPB 4C5IA 5A2QE 4PJOC 1GCPA 1VQ9A 3E51A 2W9BB 5GMKh 1RKIA 2A37A 2JJ4D 4F7UF 3I5BA 2C2EA 3JSYA 1D8ZA 2VBYA 3CC4Q 4WE1B 4AG1C 1SRLA 4C7QA 1EB0A 4LDVA 2MMYA 3M32B 3TSZA 2DNPA 3BGRA 2D3UA 4JI4J 3EG2A 4WK1A 2K79A 2N7CA 3EWGA 1AFJA 1IZ6A 1TS9A 4ED3A 1IM6A 1QVFA 4NI2A 3MAAB 2DK2A 4ZP6A 5HMWA 2GAHC 4OI2A 1E6VB 3TVKA 2HEKA 3LP2A 1UJ5A 2X1AA 3V5RA 2GO8A 3SWNB 2G6FX 1TTHB 2DIGA 1NJYA 4RUCA 1WTBA 1G4CA 4UC4A 3CPWA 2VD3A 5HAOA 2GCXA 3UA7A 2D3O1 1SUQA 3MM9A 4RBVA 3D28A 1ARKA 1CLFA 4GLMA 1S12A 1WGSA 1EFNA 1RBOB 2RH2A 3IR7B 2XSFA 1I07A 4FXVA 4HR2A 2YPZA 2G2YA 2I8EA 3FLGA 3ZTOA 4DSJA 3JQJA 1LW2B 1YJNA 3W5XA 4TVRA 5IWAJ 2OAWA 5KYUA 4DL5A 1WHJA 5LM7E 1YJ9T 2XZTB 4YP3A 5E2QA 3GG0A 2BRKA 2D0QB 4WP9A 3HT0A 2E3HA 1PJ6A 2Z2ZA 3Q8RB 3EG0A 1W2BR 4AXIA 1MHNA 1IUJA 4RTTA 5L38A 2CJAA 1U5SA 2LXFA 2DX1A 2KRSA 2CREA 2J7WA 1S10A 3AXKA 5L9XA 1IB8A 1NYGA 2AKKA 4KHRA 1U1PA 2OFGX 4NZ6A 3L2QA 5LXRA 2YKOA 3I9QA 4DBHA 4DPOA 4BDPA 2QFJA 2YXYA 2RDDA 3JSMB 2DNOA 3RR6A 3V6KA 3TNVA 3KK2B 5EG2A 3MM7B 4FYDA 2EQJA 2HQEA 1QVGR 1Y7XA 5F8JA 3QBYA 1JMTA 1VQ4Q 2EVRA 4II1A 2VBZA 1AWXA 2ZFHA 1CJUB 1FTCA 5CAAA 3A3OB 2F40A 2E1MC 4NS5A 2IRXA 3FFIA 4ANJA 1TL4A 4AFUC 2HHPA 3QZ9B 1HQEA 4GMKA 5A0GA 4G1IA 2P5VA 3KLEB 1S1VB 3GIMA 2RJEA 2A6MA 2MZQA 2MGZB 2MDAA 2MPUA 3NWGA 4JRPA 1N36F 3ELHA 2ROLA 1X31C 1M1KU 4HHJA 4NLWA 1F2GA 4NMXA 4PUOB 1SI9A 1S0VA 4L73A 1PJ5A 3KK1B 2EGCA 2M88A 2HHVA 3CGIA 3I96A 3AY0A 2V8VA 1A6LA 1HYOA 3EXYA 3BW1A 4PUOA 3SDEB 5IQ6A 1FFGB 3O5ZA 3DDNA 1LCKA 2GV1A 2X3XD 4M1KA 4BE1A 4RTWA 4YN3B 2CA9A 2CS7A 5K14B 4K2XA 1GXTA 2RQWA 5J26A 5LT5A 2CDTA 3OYCA 4F0HA 3THKA 4TY9A 2ZH7A 1LXNA 2FHJA 3LQVA 1FVSA 3AOAA 4KULA 2FPEA 3JQKA 1U0SA 1WI8A 4HLBA 3J80Y 3PO5A 5BYSA 3Q0AA 1NB7A 4DHVA 5D0GA 1OU8A 2QV6A 4O3QA 1B99A 2LLZA 1X6GA 2LCCA 2HS4A 3TJ8A 4U8VA 1EARA 2B8AA 1GBRA 4O0IA 5GAN3 2CZ6B 2MAMA 2KU7A 4K4XA 1FJEB 2IDEA 5KFSA 1MV0B 4QIEA 2BJ7A 4O5VA 2VG6B 1VRTB 3ZBDA 3H59A 2ZPIB 1HYSA 3KXDA 2NUHA 2E1PA 4PKDB 2DHSA 1FERA 2RS8A 4J9FA 2MPXC 3L95X 4RL1A 1IQTA 1TUWA 3ADAC 5BYQA 2O2OA 5KFHA 4D6WA 4P2XA 1UDLA 1Q8LA 4X64J 2ASDA 1KC8T 1WF0A 4ECYA 2CYYA 2FPFA 3Q2SC 1FRXA 3JCMc 1RT1A 4DV7F 3JCMh 1WOPA 5B0AA 2BKOA 1TL5A 3AA9A 1WYXA 1CG2A 2Y3YA 2GVZA 1BYMA 3JCMP 1NK0A 1QDUB 4K4YA 1S1TA 3D4JA 2OTJA 4DPXA 2DGWA 3ZNJ1 2XGPA 1UPPA 4USIA 3P49B 1UVKA 3MJXA 1VQ6A 3CCRT 3PR5B 4QYZJ 4JBCA 4KPCA 2F2XA 1HK9A 2E44A 3CWJA 3LANA 3LTOA 1N5YB 1TL3A 1LW0B 2G3RA 3EVMA 5D78A 2DJZA 1J5EF 1TOVA 3L09A 1AYEA 1SC3B 3TI0A 5C7PA 2GJFA 5KFDA 1K9MR 3D3BJ 1JLGA 2A0FB 1QVPA 3G8TA 1JJ4A 4QWAA 1I0CA 5F8HA 1KQ2A 2ASLA 3ZZYA 4YS2A 2VDIA 3MEGA 2YDLA 4BE2A 3L1AA 4LRDA 4JI3J 2XDPA 1F3VA 1RCOB 1WC4A 2DGUA 3IQLA 4EFAC 1N6QA 1WF1A 2BE7D 1LVKA 1VOMA 3PRBA 1VI7A 1NMEB 5ETOA 4X4VA 1DY3A 1RAJA 3FZ2A 3MOZA 3IG1B 3OQ5A 2EPDA 3K58A 3CMEA 3N5BA 1VBZA 2HFSA 3ICLA 2OEKA 3H6ZA 2HVHA 3GP9A 8AT1B 2BOPA 5B09A 4YB1P 4B3OA 1RT3B 4MIAA 2OTLT 5GANe 3OBIA 4OMLA 5AT1B 2KH9A 2WW4A 2D74B 2KK4A 1MROA 5KFFA 5HSPA 4B3OB 4J9HA 2E4HA 1Z1ZA 2FTRA 3EMTA 2IVFB 3U1LA 3EFSA 4TVAB 1ZAVA 2CPZA 1VQ6S 1KVKA 4J9CA 5KFUA 4OMOA 1P92A 2ZBPA 4Y2MA 4FPIA 1S76D 1NSPA 2BKNA 2FLPA 1RAGB 1C0UB 4UF4A 2QASA 5KH6A 2HQ3A 1NKEA 5E5NA 4CH7A 3L2UA 3TZWA 3OFHA 2R8IA 1M90U 2PSZA 5E7OB 3HVRA 1C0UA 4OZ3A 2FGCA 1IBKF 1BKBA 4NXNJ 3NNCA 1SL2A 1MU2B 1SC6A 4HT7A 5AXKA 2ZKTA 2DO0A 3TUZC 3CJKB 1BLUA 2JZ2A 2DR8A 4PRFA 1T9VA 2DEJA 1YIJS 3HZGA 5T14A 2A7YA 2ZPHB 1IXDA 2P8IA 3F73A 2PI4A 1VBKA 1LOUA 1H98A 1RLCL 2X1FA 3HT3A 3V7SA 3G8SA 3IBFB 3EE3A 1CS4A 3M6UA 1FRKA 2XMAA 3EGDA 1CKBA 1YZ6A 2DNQA 5AE2A 2HCKA 2NYHA 1WEZA 1I94F 1TKXA 1WHMA 2YUOA 1RT7A 4PG7A 3EPGA 5LJ5e 2HHHJ 2HMIA 4AT1B 4CC3A 1XBWA 1AA1B 1TUGB 1UECA 2G0JA 4TQRA 1OZ3A 1TL1B 4PQUB 1HWKA 5A8WA 2YNIA 4BHQA 2H5JB 1RAHB 3LLRA 3NTHA 4M75G 1SPKA 2XQCA 1AWJA 3NXZA 2DY9A 1IVZA 1YJNQ 1ZUYA 4OYBA 5DJBA 2DHAA 1XMOF 2MJNA 5CD4H 2M7SA 3M53A 4U6PA 2DR7A 2EXUA 1D0ZA 4M5IA 3ZZZA 1WXTA 2BYCA 1DQ8A 5LJ5h 5DO2A 3MR2A 1O75A 1FWZA 1CSJA 2L8DA 2KYMA 3CMAS 3DU5A 4ILLA 2RF2B 4N76A 2C28A 3ILLA 1QVGA 1D9DA 2K5FA 3JV3A 1HBNA 3CBPA 3CCMA 4M77G 5EWEA 3KJQB 3OS0A 3ISNC 2LEAA 3OYMA 4DEZA 2PUOB 3KFVA 2B7CB 4GKJJ 3PY8A 3CDEA 2CVIA 1DJ0A 5IM0B 1B7TA 4QWCA 5FW9A 3LOUA 3MMBB 2HFZA 3OVSA 2CZ1B 3LH0A 5C2CA 3BE3A 4RTYA 5IWAF 2XI9A 2BZ2A 2MQMA 4CO5A 3BYPA 3CW2C 4IURA 1VQKA 4P71A 5HVFA 4Q0BB 2HNZB 5K8NA 2KYBA 4ES2A 2VOPA 3PR4A 1FA0A 3GU0A 2UUAJ 1ZHIA 2W01A 1X8DA 4JI7F 1LKZA 2RJCA 5DLOA 1RABB 2YNFA 3RKYA 2CKKA 3MR5A 1MW7A 3H98A 1URRA 3GSDA 3N0VA 2W9AA 4VUBA 4WPAA 1VQNT 4CO4A 4X65J 1FX4A 3SDZA 2KRRA 3J7ZT 1IGQA 2LMIA 2WHOA 4I7FA 2DBKA 1KS2A 5IT4A 4OHYA 2KJVA 3M6VA 1U8SA 5LSOA 2R58A 4ED4A 1M2VB 3BY7A 3R5JB 3C12A 2HK3A 2OTLS 3SZ2A 2ZZNA 3KLEA 4PKCC 4GVBA 3PVLA 4Z7YA 4HCBA 2YNHA 4IDKB 1QAXA 1U2RA 4QJVA 3R2CJ 3UA6A 3CD7A 1HFEL 1VQ5T 3RBBB 2GIQA 1T0HA 4DUYF 1S59A 3L3CA 3MEKA 2GO9A 3H90A 5BJRA 1TKDA 1ABOA 2NXNA 5A76A 4C8YA 2VKZG 2BE2B 4KSEB 5BR8J 4U95A 1QTNB 4KUIA 1VC0A 3RYLA 5J2MB 4DFPA 3ETMA 3H0HA 1HMVA 3GB0A 5KFCA 1TG0A 2GMLA 4I68A 4WP8A 1ZM4A 2RA2A 1N88A 3D0IE 4L6V3 3CCJQ 4R55A 4PG6A 2XO7A 3OL7A 3NAIA 4BY6C 4MKBA 4ICLA 5H9EJ 4WYLA 2NYSA 1AZGB 7FDRA 2ZJQQ 4LR8A 3CC7S 3DKDA 2DTIA 2ILZA 1S9EA 2WCXA 4B3MJ 1Z9ZA 3HJVA 4QQGA 3AD8C 2C42A 1QCFA 3SV4A 3AT1B 5M9OA 3M30B 1NK5A 4U8YA 4N8OA 3OQ2A 3D3CJ 1RA6A 2FHJD 2J6UA 4DR6F 1IKYB 2Q43A 3VKIA 2B8QA 1NU4A 2Z4PA 3GIJA 1KVIA 1JXLA 1I6JA 1S7IA 3N6NA 1XN9A 2K9GA 5F0UA 3DFEA 4K5RA 1FRJA 1K8AC 4I69A 3RG6A 1IBMF 3LP0A 2F7VA 4HVVA 4DEXA 4M4ZA 4YY3J 4LF9F 3K7RA 2KYZA 4ESRA 1SQFA 1KD1R 3CNQP 2RSQA 1XMQJ 4MMOA 1UTAA 3EZOA 2B7BB 2ZH9A 4PJOF 1UPMB 1OQ6A 1K8AT 4M75C 1FWLA 1RT6A 3ISND 4CP5A 1JLQA 2YT6A 3MD3A 1X5OA 2RDIA 2G1DA 1HBMB 3ZTSA 2YX7A 1WNLA 3OYFA 4EMDA 4YY3F 1NYFA 1NEGA 3VS6A 3CD6T 1BCOA 2C06A 5IHIA 3NKYA 3OYKA 3HXMA 4BE0A 4QR0A 2R8JA 4C8KA 2DD5A 2H3EB 4MT1A 5ETSA 3CC7Q 4X4PA 4DU7A 1HNWJ 2UXBF 5I2SA 3MECB 4DCJB 4ED0A 4HHHA 2YWWA 3CCEA 2KDSA 5L8RC 1GAOA 5KT2A 3EGXA 3QIPB 2J8SA 3OJSA 1WQ7A 3BM7A 2HAIA 2DNZA 4HI1A 1X69A 4JV0A 3BO2A 2NXEA 2QYZA 4XPCA 2V2VA 4Q5WA 3AOCA 3QO9B 1BIAA 2BEFA 4M78G 3OFEA 2H1YA 1FNMA 2DITA 2X4YA 2I0XA 2KZMA 5KYXA 1PRLC 1HD0A 2B43A 4C6AA 1PHTA 1FMWA 5FDLB 1W2BA 3UN5A 1D1UA 5KFRA 4ZITA 2RMOA 3MEVA 4H4OB 2FVCA 1N8RU 3E3XA 4PJOA 5HL7Q 2EC2A 4OP0A 1ZSZC 4HTIA 2ZPGB 3OW2A 4PCQA 2C2NA 3IG1A 2O3DA 4M7DG 4PJOB 2O67A 4Y92A 2LNHB 1VQPA 3ETOA 4QQBA 3TUIC 1YITT 4DR5J 4K4ZA 4ZDNA 1RUWA 4CLTA 2XS2A 3BS9A 4OI3A 1SH2A 2DD8S 1WKLA 2XTJP 3CDWA 4UW2A 1CJKA 1UEVA 1F0XA 4HCKA 4OYPA 1AROP 3FDSA 2IA0A 3UQSA 4B3SF 2WVEA 2HVEA 1WJ9A 1CULA 3MP8A 3TJ9A 2WSFE 2MZSA 2YQ1A 3EM1A 2HVDA 1Q8IA 1JLBB 2OKQA 1TAQA 3BKTA 4OIXA 1NLOC 2J6TA 2E10A 2YBVA 1IREB 4NEYA 3ENVA 4X84A 2QJ3A 3B4DA 3GLJA 3DHXA 1WI6A 4N7TA 2Y4XA 2DY1A 3C66A 4J90A 3VWSA 1EX8A 1BY9A 5EX0A 1JLAA 3MCSA 3QFWA 3GV5B 3NPFA 1YITS 1SQEA 3FEOA 2QA4G 3IRXB 3DLGB 1HNZJ 1RA7A 2RILA 2DPPB 3THPA 5A2QY 1IWGA 2VU5A 3A5ZB 4KT0E 2K8GA 2K2VA 3HHKA 1WKKA 1NDLA 3JSBA 4EI2A 2JXBA 2K4YA 1TZ0A 3FEYB 4ZP8A 3BQ0A 3EGDB 1YWPA 4JZ4A 1DAXA 2KJWA 1UVNA 1WHGA 4KFBB 2OO4A 3MPUB 1NBEB 2LCLA 4KIAA 3X1LB 1IKXB 2QC3A 5I42A 1E6VA 5DDQC 4FW2A 2ENMA 4OYAA 2MSSA 5AXNA 4OZNA 4GKKF 3HK2A 2VG6A 2QEXS 4NOHA 4USTA 4C48A 3ZFVA 2VQEJ 3HZEA 2FLOA 2K6DA 1Z2LA 1YJNT 4NCGB 5IV4A 1SUQB 3MM9B 1AZSA 2B9YA 2BXJA 3IP0A 3MMAB 5B0BA 4M7DA 5GAMf 1T05B 4OYWA 2VYTA 3R5CA 1XNQF 2XNQA 4R0JA 4K0KJ 4B3RJ 2RUSA 2CSQA 2M8DB 3NLCA 1T05A 1NRKA 3KTQA 1Y5NB 1M8MA 2XMJA 1R31A 4ZVPB 3VGTA 2QYGA 3R1LA 2HVZA 4CLKA 1K9MU 3W3SA 5CH7B 4LN2A 3GBQA 2Z2LA 4XK8C 1NSKL 4LDXA 3FCWA 3REBB 4DR3F 4OI1A 1KRPA 5IH2A 4R0KA 3Q8YA 4OV6A 5GMEA 1VQMQ 3EAEA 4DN0A 4JI2J 4LBPA 2MEWA 4JZ3A 1RLPC 4HI2A 2DEQA 4ED8A 4LF7F 3FBCA 3NS5A 1QVFP 4OX8A 1RTJA 1B7YB 3NRBA 3MMBA 3BR9A 1K4US 5B0EA 3UN2A 3AQPA 3Q8QB 1V76A 2YKMA 3KLIB 1AFIA 3UDEA 4MDWA 2LZ6B 2W4DA 3R7BB 5H9EK 3FJ5A 4IUTA 1HNIA 3O6QA 2CWXA 3DLBA 4B9LA 3R2DJ 3RB4A 4N4HA 2RHQB 2BMBA 2HW3A 3CC7T 3NGTA 2DBBA 2V4QA 4UZCA 4KE5A 2DVJA 1KQ1A 5KFIA 4LD9K 1EJ7L 4CLZA 4KB7A 3CMAQ 2DGQA 5ETNA 1YLXA 2BKPA 2MKYA 1Y3JA 1ZM2A 1RUSA 2MGZA 2VB6A 1AB8A 4X4SA 1N0UA 4OYIA 3K0JA 4TN2A 2CQHA 2HBZB 4IH7A 2MJUA 1R8PA 5DM6Q 1NK8A 2RU9A 1FRHA 2MQNA 3EJMA 4JI4F 4QIGA 2W2NP 4DG1A 4ZPAA 1NDPA 2KRMA 4PJLA 4NPOA 1AW0A 3VCDA 2MSTA 2DBMA 2JN0A 3GPLA 1ZBTA 3BGLA 3M0QA 3D66A 3KUHA 1WC3A 2FQQB 2U1AA 2O66A 2L9DA 3CIZA 4RUGA 1HNXF 4RUBA 1S72A 4AL6A 5HP1A 2KN4A 3P6YC 1FDBA 2ZHOA 2QMWA 2HURA 5GAN6 3OR1B 4DSLA 3CJ3A 2HKNA 1VQ6T 5DDOC 1VYAA 4RNOA 4YB5A 3FQKA 1RWUA 3FBBA 2GTJA 1EP4A 1NK6A 4RU9A 4DPTA 2IJFA 1UA0A 3NTKA 1AZEA 3AODA 4IG0B 2KRBA 5FU7C 2ROPA 2J7KA 4J9EA 5GAOl 3CDUA 1CBKA 4LFCF 4DX6A 2MZTA 3PFOA 3HRSA 1MV3A 3DLJA 3OYBA 1ABQA 4ECXA 3DLHA 5I2MA 2COLA 1VRTA 2OGUA 4DS5A 1D0YA 2RQVA 4M78E 3RESA 1C1CB 3NCPA 4ECQA 2CDQA 1Q82T 1Q7YU 2RQ4A 4L3KA 4WU3A 2EYXA 1KHIA 1SL1A 4OGEA 4XAXB 2C3PA 3C14B 2YWKA 2WSEE 4ECUA 1V5IB 2DCUB 2K7AA 4FNHA 1CSKA 4MFBA 2DNLA 1GRIA 4CRJA 4HACA 2C3MA 4OQJA 2EFNA 5JVHQ 4C92G 3EXCX 1DRZA 3H2VE 4EDUA 4BS2A 3CJTA 4YB6A 4K0KF 2B4VA 3BPSP 4A4EA 4X62F 4DSIA 3PRDA 4X65F 2OPPB 1UJ4A 5DDRC 1YJWT 2F1LA 3BBFA 2HHUA 2DL4A 1X4AA 1WACA 2X3DA 1LQ9A 2NWMA 2FHKA 2DKOB 3SSRA 1B07A 1RWOB 4OB3B 4Y28C 1SC1B 3HMJG 3CCJS 2WSCC 1H6KX 3H4BA 2VKNA 3I4HX 4Q44A 4XAKA 3GOXA 2DGTA 3OS5A 2C2ZB 3VRYA 1Q7YR 1M1KR 2RPNA 4UOCA 3Q24A 2H65B 2EYYA 2WSCE 5KYWA 4JRQA 2O9VA 3WXMB 3K5NA 3V81B 1XC9A 4I1TA 3NFCA 2DIQA 3JB9J 4ECZA 2VFUA 5CCMA 3LP1B 1SRMA 3JB9I 3J7YU 4DCOB 1LFWA 1L3KA 3HVWA 1VQOA 5EWFA 4XPEA 4M75A 2ZUGA 4GKJF 5KFJA 3M8PA 4TY8A 3NEKA 3GIBA 4ILRA 1N5SA 1FJCA 5IHNA 2EQKA 3TO8A 4P75A 1FXLA 4YMEA 1T3SA 3LH5A 2J0SD 3CD6S 1JLEA 3PKMA 1S1XB 7FD1A 5A6PA 2Y8YA 2QQRA 4X4RA 4YQWA 4J9LA 3WIUA 4C92B 2D41A 2GNKA 1EETB 3H2LA 3VAMA 2WB4A 4TLRA 5CQGA 2YWGA 1K8AR 5GAEU 3PVXA 3VALA 3DYAB 2UUBJ 2VHGA 2X3GA 3JB9H 5HMXA 1HBUB 5J3BA 4ELZC 2BQRA 4X2BA 2LQ8A 2OPQA 1EIYB 4I7FB 2GQCA 3OB9A 1RT2B 4WYWA 2IFXA 1K1SA 1HQEB 3J7YI 3VHQA 2L3QA 1I4K1 1YN8A 3BV8A 4MMKA 1PC0A 5K8PA 2RHYA 2DA9A 3OYAA 4N41A 3VR1A 2IM0A 1Q81U 3CC2S 1PWTA 4V19J 4R5PA 2QGGA 4X66J 3DLKB 3FCVA 2QLFB 1YGYA 3ET6A 1W4SA 3T9NA 5DRKA 2R7SA 3MI7X 3Q23A 1WOOA 2W2MP 2E12A 1EZZB 4OX9J 3IBCB 3R5BA 3UVJB 1SKWA 3TSWA 2QYCA 4NL3A 2A2DA 3OLBA 3HSDA 2H5IB 3W5YA 3CO9A 2KI2A 3NCRA 2VGNA 2GAGC 2J0WA 3IN5A 1SPBP 1MMLA 1T03B 1PSEA 1RHKB 1XQIA 1SJQA 3W9JA 5LMUF 4Z8AA 4KGZB 2BQUA 3P8HA 1VCTA 1RDRA 2GQ2A 3P3DA 4I6WA 4B9SA 3IMQJ 2CQ0A 1KP6A 1S1WA 2E9RX 4CLFA 2VVKA 2RQCA 2B86A 3JQMA 5HVGA 2D3ZA 4MH8A 1DQAA 2WVBA 2LXIA 2FB7A 4P7TA 4CO0A 2G0IA 1TL7A 1QVFR 2OMOA 1KD1T 3M2UB 3OS1A 4TXSA 1WJQA 1S72T 2CT4A 1R89A 4NOYA 2LDYA 1Q79A 1UFWA 4WFXA 3CPWS 1KG1A 5C24B 4FBUA 3EX7B 1S6PB 2KR3A 1WG5A 4LF4F 4TNOA 1IKXA 2KVQE 3FC3A 4RW4A 2RI3A 4M7DF 2FYXA 4DR4F 3UE2A 5HK3A 3CO0P 4ZMMA 3G4SQ 3KG0A 5L1LA 4F04B 4F3MA 1Y4ZB 3I56S 2R8KA 2LVMA 2WONA 2HS0A 2RF2A 3EFOA 4QR1A 2K3KA 2RM4A 4S0MA 1I5OB 1IN0A 1PNJA 5J1NA 2HZAA 2ZVIA 2R2RA 2A36A 4XU2A 1T3NA 4NE9C 4CLSA 2A6OA 2LRQA 1ZAWA 5F8IA 3WZ0A 5J2NA 3CCQS 2GVZB 1WZOA 3UDLA 2XK0A 4CO1A 3PTAA 1JBMA 3THTA 4HT5A 5KFAA 2LDMA 4FL6A 5CYJA 2L3MA 1PRMC 3BF4A 4P10A 1UG1A 2K1RB 1JLFB 3VAFA 4EZ9A 1Y0HA 3HD1A 2QLJB 3M59A 1IGUA 2P0QA 2AGPA 1KQSA 1UL3A 2KSSA 1RWVB 1JIHA 4CYUA 4BUGA 3Q8VA 1SSFA 1YHQQ 1JWWA 1S49A 2BW7A 3M2RB 1JNZB 5KFTA 1W26A 3NMRA 3ULRB 5KYNA 3CCJA 3W60A 4GY5A 3W5ZA 3OUYB 2CJXB 2GMJA 1U45A 1Q53A 1RE1B 3PKYA 3CMAT 2VF3A 1ZSGA 2YH1A 3I55Q 4KT0C 3QDFA 1SJ3P 2BX6A 2MQQA 3NTIA 5GMKe 4M7AF 4A53A 3BPDA 5ETQA 2BABA 1VQ7Q 4G1PA 1BQNA 2AKLA 1LEOA 2C2DA 1OY6A 1BI2A 1VQNQ 1IO6A 3L7PA 2ZM6F 1TUCA 2KTQA 3MCOA 1U1OA 1EQMA 1VRQC 2XO6A 2GHPA 3B6BA 1U1KA 1WWHA 4RUAA 3INZA 3UCZP 4F7VA 2R57A 3K59A 4NCAA 2BTTA 3W2VB 1KEKA 1KDNA 3ULHA 4BDZA 1XJWB 1XNIA 3GQCA 3GYXB 4C8NA 4OYXA 4DR4J 2MHEA 1WXUA 2OPRB 3AQOA 1K9MT 5IFMA 4H4MB 2W1BA 2D9TA 4C0DB 4WKYA 1S1UB 5DDPC 4ES3A 1ZA2B 4QW8A 2Y1RI 1S6OA 4R0EA 3A8HB 2DCLA 5GADU 4IOBA 3M54A 2KMTA 3J80E 1MNEA 2XYHB 4M77E 1BBZA 1P6TA 4R8UB 3CCES 4IYQA 1XNQJ 2LQJA 3D67A 4ZVSB 1J5EJ 1IKWA 3OYYA 3HHLD 2GQQA 1W2BP 3VRZA 3K5OA 2YKPA 3VYHB 4XDCA 4NMLA 1WFWA 2EJGA 4DX7A 1ZS6A 2KFZA 4O23A 2OPPA 2AHJB 2E5QA 3H20A 2GVDB 2DZ9A 4NXMF 2HRTA 1RLDA 3BB5A 2VA3A 5HROA 4NI2B 4OZ1A 4X4UA 4QIFA 1KHCA 2M0GB 1QJHA 1RHJB 3KLFA 2LXUA 2WOMB 1FD2A 5KFOA 3TW0A 2LTOA 3QAEA 3CVKA 3LP0B 4NX9A 1D1AA 1PD0A 4Z37A 3JXOA 2DTHA 4PQAA 1NCLA 3C6TA 1S9GB 5B0CA 3H8YA 3IR5B 1FF2A 2YWFA 1FVQA 1N32F 3R6LB 4TKTA 4KKOA 1RJJA 3JRZA 3MMAA 3EG3A 4KO0B 2OSQA 1S9GA 4JS5A 4LF8J 2KAFA 1UEKA 3B78A 2BJ9A 1VQKQ 2J9EA 5F3ZA 1HW8A 2B6AA 2VFTA 5J2QA 3MEDB 3ZEHA 1WORA 1BXNA 3CCVT 2RRAA 2XMMA 5D0HA 2IBKA 1WJSA 4DR2F 2BDPA 2XEXA 2DKGA 3TR5A 3IFEA 1MMNA 3ZZOA 4DXLA 2DJQA 1N8RC 3QAUA 4ZLPA 1PSFA 5IQQA 2M0OA 1AOJA 2R2TA 3I31A 4DLGA 1JEGA 3FB9A 2ACMA 4AE5A 1RSCA 3EGNA 1PYOB 2DETA 9RUBA 1B4SA 3NWRA 4OYZA 3E9GA 4ID5A 2F65A 1FO1A 1M1GA 4DF8A 3F56A 4Y65A 5LJ3f 1XOVA 1RI7A 2YKMB 3KLIA 5FRNA 4RBTA 3RUBL 5GANf 1VQPS 2W7PA 4C92A 1RLQC 2ATCB 4LE9A 3W1YC 5KYXB 2IIMA 2ALZA 4IQXA 2HBRB 4QW2A 2RQRA 1EQ0A 2FG0A 5G0RA 2CPHA 5AXLA 2HNYB 2O5DA 5KT7A 2M02A 1RT2A 1NPKA 4QOTA 3VQTA 3IGVA 2PC6A 4C3LA 3QQCD 5IT9Y 2RK2A 3OBYA 2CJ9A 4Y2AA 3Q1JA 3D5MA 4PG8A 1WHLA 2CP7A 2P9EA 1YCSB 4ECTA 5CZXA 4XDDA 1NEEA 2KG0A 4M77F 3FDRA 4AQYF 3WC0A 1MMDA 4FVCA 2RHZA 4WWSA 2QRRA 1WNEA 4K7QA 4NA1A 4QVDA 4OB2B 4USKA 3JCMb 2KXFA 4R5PB 3RW7A 1TAUA 2YXLA 2CQPA 5L46A 3RGIA 2VPZB 1X60A 1M27C 2BE9B 2HNIA 1NM2A 5AJ3F 4WF2A 3CCLA 3EPIA 1BQMB 1HQUB 3T19A 3I5SA 4RTXA 4URGA 5CKFA 3GFHA 2WB1D 2CZ4A 2QN6B 5ECAA 4GO7X 4G1QA 3RRGA 4NLUA 3SEOA 4ZVTB 2ZGWA 2K3IA 2MXYA 2NUUG 2LMJA 2VG5A 2YWHA 2ZD1A 1XR7A 3SSQA 2H51B 3UATA 3UDVA 4C0OC 3MPYA 4JV5J 1QKXA 3M2VA 3U02A 3PX6A 2UXDF 2G2OA 3QUIA 3K2YA 4K4WA 3SSSA 3CCLQ 5HMYA 2UVVA 1RT7B 2HHWA 4QU6A 1FDDA 4NLDA 1T02A 3EZUA 1OYXA 1RI0A 3MCNA 2CVEA 2F8HA 2HIQA 1PKUA 2K7JA 1VJQA 2XMKA 1Q4RA 1QVGP 3S01A 2QXFA 4E2FB 2MYFA 4WBFA 5J1PA 1GFCA 4C5HA 4OI0A 1AUDA 4P73A 5ETRA 4IH5A 3K8VA 1DJ7B 4WCEQ 3N4WA 1CJVA 2X4JA 2XLKA 3V7CA 1CQMA 2GCFA 3CJRA 2W25A 2YH0A 3ILIA 1IXKA 1FT8A 2V4JA 4MYTA 3NHNA 4L76A 4C98A 2FC8A 4I0WA 2D8JA 5DQGA 4FNIA 1YJVA 4MYUA 3ME9A 2R7QA 1H2UX 1XTZA 4FYWB 4CCHA 5JMNA 4TU7A 4TU8A 3CPFA 2IVYA 4NA2A 3PRVA 4I2QB 1AVZC 2HWIA 1NPPA 4FM4B 5IM0A 1YG0A 5HO4A 1FI4A 2YKNB 3OL8A 4C8QC 2V2KA 1J2VA 2E5GA 4DV6F 4YDDB 1U06A 3MP6A 3CIMA 5AXMA 1M5Q1 2J9CA 1C1AA 2HAXA 4EIKA 1Z2ZA 2QQAA 2ZEJA 2CNOB 1U1RA 2MF2A 3VAJA 2OPSB 2FPHX 1HBMA 2LEPA 4O3SA 2RNAA 3DKMA 3K57A 1X4CA 3EICA 3OLAA 1DBDA 1D09B 3CULA 1LW0A 1LNQA 1YFNA 4CYUB 1Q81R 1K73U 2Q1LA 2DXBA 2HBQB 4RPFA 3L2ZA 3LP1A 4ED5A 3WC2A 1S0OA 2B5JA 3CCRQ 3SEMA 2CRLA 2MQOA 4DWIA 1HNWF 2UXBJ 1SXLA 5HJXA 1S6UA 4LJMA 4DV0J 2N4DA 1IBCB 1OMSA 2P84A 3VGUA 1M30A 3T3FA 4ANCA 2J9DE 2XWYA 1GMWA 4YUDA 4J9DA 3A1YG 1X5SA 4IO9Q 4I56A 2QQBA 4N4IA 2HGMA 2JLGA 3Q22A 3AAWB 2F2VA 2XI2A 1BQNB 3M8QB 3C94A 1EETA 1RYSA 4U9RA 1HQ2A 4IIOA 3VAKA