2BE9B

Crystal structure of the ctp-liganded (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
148
Chain Sequence
MVSKIKNGTVIDHIPAGRAFAVLNVLGIKEGFRIALVINVDSKKMGKKDIVKIEDKEISDTEANLITLIAPTATINIVREYEVVKKTKLEVPKVVKGILKCPNPYCITSNDVEAIPTFKTLTEKPLKMRCEYCETIIDENEIMSQILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Sulfolobus acidocaldarius aspartate carbamoyltransferase in complex with its allosteric activator CTP.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase
molecule keywords Aspartate carbamoyltransferase
total genus 32
structure length 148
sequence length 150
ec nomenclature
pdb deposition date 2005-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
B PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 2be9B02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 2be9B01
2AIRB 2BE7D 2FZCB 4FYXB 1XJWB 4KH1B 2ATCB 1D09B 1F1BB 1Q95G 1RAIB 1RAAB 1RAHB 2BE9B 2IPOB 4KGZB 1RACB 1EZZB 7AT1B 1R0BG 1ZA1B 5AT1B 4AT1B 1RAGB 4WTOB 2YWWA 1ACMB 1TU0B 4AMCA 2H3EB 4KGXB 2A0FB 4FYWB 8ATCB 1AT1B 1SKUB 2QG9B 1TUGB 1RAFB 1NBEB 1PG5B 1I5OB 4FYVB 1R0CB 9ATCB 1RADB 4FYYB 1RABB 2QGFB 4KH0B 2HSEB 4F04B 2FZGB 3D7SB 8AT1B 3MPUB 4E2FB 2FZKB 6AT1B 3AT1B 2AT1B 1TTHB 4KGVB 1ZA2B 1RAEB
chains in the Genus database with same CATH superfamily
1FO1A 4OHZA 2H5EA 4NPOA 2GHWA 4OMFG 3LGMA 2W25A 3J81U 3MM9B 3M6XA 1HWKA 1VQ6S 4ED6A 2BMBA 5LSOA 5H1SV 1KLMB 1A6LA 5CYJA 3NGPA 2GQQA 4ID5A 4TU8A 4ED7A 5LXRA 4NMLA 4EMKC 2JEFA 2B5JB 2K2PA 1SL1A 3TOQA 3K7RA 5F8MA 4A4GA 3NTHA 2X51A 1OPIA 2FJDB 4DR4J 2PD1A 1RAGB 2B56A 1H6KX 4P52A 1YJWA 3Q8RB 1AT1B 3BN7A 1RU2A 2DNZA 1TS9A 2VKNA 1WSVA 4AL7A 4W98A 4OF1A 1KR4A 5LMUF 1SQFA 2FVPA 1GAOA 4HEA9 3D6TB 5GANj 2YKNB 3KNAA 1HNXF 2DKGA 2MQLA 1OWXA 1ZM3A 2HVEA 2E1MC 1OY6A 4GLKA 2V4QA 4ZGDB 5FU7C 5L1IA 1KQ1A 2FPEA 1BYMA 3T1YF 3I56T 2E65A 2QT7A 2HEKA 3RB3A 2VXEA 1FWPA 2V2QA 2KROA 2MJNA 1NKEA 3CIMA 2K57A 3MCNA 4DSLA 1RTDA 3CCRQ 1RJJA 3N4WA 1E6YB 1VCTA 2PDAA 2OD6A 1X2QA 5CKDA 1C6VX 1ZA1B 2BYCA 3H98A 3AODA 4YB6A 2XWYA 3TVZA 2IVMA 3T9ZA 2HFSA 2ZUGA 3META 1OZ2A 1XEZA 2LP5A 3MEAA 2ZHOA 1K73U 2UUTA 1RAAB 2HIQA 1A7GE 2JW4A 5E3RA 1XMQF 2CJ9A 3VRZA 3AOBA 4I68A 2CPYA 2VDHA 4IKAA 4DU8A 4PJOF 3CULA 5ITHA 2BX6A 1REGX 2VOPA 1YBYA 3VAIA 2UUCF 2ZC3A 4DR7J 1XR7A 2X3GA 1YRUA 3FMWA 4EBCA 3M8SA 5C42A 4DL3A 4TNOA 2IDEA 5AXNA 2OHDA 4AFSC 2P4RA 2PUOB 3H2UB 4OX8A 3LP0A 3PCOB 2A28A 4FVMA 2B8AA 4TY8B 1JNRB 3M7VA 5C2CA 3TVTA 5IHNA 1IKVA 2OPQB 1OI1A 4LF5J 1U1SA 1RHKB 5K14B 1DJ0A 2IJNA 2VQFF 2DAQA 3G6YA 4DWIA 3HVTB 2Q6CA 4CNZA 3MR3A 5KFMA 4KT0E 3VV0A 1QE1A 3JB9k 1Q0NA 1WTFA 4R0JA 3L95X 1VK3A 1SJRA 3TR5A 2HBPA 4DV2F 1X9SA 3K2YA 3QBCA 2FEIA 4CI0C 1ABQA 4X64F 2P84A 4JDSA 3RRKA 1YBUA 1U2CA 3IC1A 2CSQA 3ET6B 2B6AB 4A4KA 1C1AA 5A0GA 4EFAC 1SB6A 4WE1A 4KYZA 3FZBA 5HSPA 3G2XA 3O5ZA 3ZZTA 3PKMA 2RIJA 4LF1A 2CJBA 1ZX6A 3C6UB 1H98A 4DJBA 1FERA 2XNQA 1V9OA 2BKNA 5IT0A 4LFCJ 1Q81T 2H8HA 4HHHA 3GLJA 4DV2J 3MM5B 1N9RA 2VODA 5LJ3Y 3W64A 3UWNA 1JB0C 2X4YA 1WF1A 2FG0A 1VQMS 4C92C 1NHVA 4MKVA 3L2WA 3DLLQ 4M78A 4LJMA 3OYCA 4X9DA 2OFHX 3CBMA 3V4IB 2DBMA 1WC0A 5M2PA 5HL7Q 2JFKA 5AXLA 1MROA 3UA6A 4NLTA 4DMZA 2EVZA 2K3XA 1LV5A 1RTZA 1S6PB 2CVEA 2WW8A 2AD9A 5LJ5e 2RM4A 3JSBA 2VFTA 2QEXQ 4GY5A 3VUBA 3MR6A 2QMWA 1F60B 5DM6Q 1OS5A 1NKBA 4HH1A 3EXYA 1RZMA 3OTOF 1YRTA 1UFFA 4HI2A 2LYVA 1RHRB 1AWWA 4B9SA 1EX8A 5DRKA 1EP4A 1PCAA 5IC6B 3KOAA 2XMFA 2XO7A 3S01A 2Y0BB 1RTHB 3ZTRA 3NY0A 1QUVA 4OX9J 2ASYA 3RUBL 5GMKe 4C92E 2BZ2A 5GANe 1TP7A 2ZM6F 2JL9A 4M94A 3ILOA 3JCMJ 2EYQA 1Q7YC 2E1RA 4DR6F 1HQUB 4DV0J 2VA3A 4ZPWR 2V9KA 5KFAA 4NXNJ 3D28A 5FU6B 2ZPHB 2AW0A 4Z88A 2RS2A 3C14A 3OYKA 2L08A 3WX8A 1AEYA 1G8XA 2NLUA 3DRPB 3GCXP 1VQPQ 5H9EJ 3ZBDA 2QG9B 2CDTA 2MKYA 1S79A 4CTAB 2W10A 2DZCA 2DXTA 3H2LA 1YX2A 3HSJA 1WHMA 4I6AA 3QGPA 2O88A 2H9ZA 2OPPB 3CD7A 2CJYB 4PAAA 3LA0A 1H2TZ 2YNHA 3DGPB 2XICA 4DPOA 4GVBA 2VIHA 1PWTA 4ECXA 2KO1A 4GO7X 3W7BA 3OSPA 2V8DA 1PBAA 1NMEB 3T1AA 1Q53A 3OR2B 3Q83A 3K59A 2DY9A 2KRRA 1JJ2P 3QJLA 4X64J 2D69A 1BE4A 5CA5A 3DYAA 2QC3A 3A8HB 3AJ1A 3AQPA 4EYHB 2HMAA 2HW3A 1YJNT 5KFOA 1YJRA 4GKKF 4LDXA 2W4PA 1FWKA 4O0IA 4RTUA 5J2QB 4DR7F 4OFZA 3EGDA 1C0TB 5EUHA 4DF4A 1G3WA 2AF6A 4QIFA 3KK2A 3L09A 3DDNA 3CEYA 1FRHA 2N3LA 3KUHA 3BYRA 2D0QB 4BWJA 2FHMA 2DL3A 2V0NA 4ECZA 3SQGB 1JLQA 1HBNB 1KN6A 4ATNA 3BS9A 1AWJA 1S9FA 1NHUA 2MSSA 2ZOGA 1FJCA 2QEXS 3FJ2A 1TUVA 3M32A 3KUEA 2J6SA 1LWFA 4DV7F 4BDPA 2MDAA 5ETSA 3IS9A 1UJ4A 3MUTP 3KLHB 1NPKA 2R7OA 4QWDA 1AUSL 2PFDA 1UHCA 2O1PA 2UV8G 1YJ9T 1WQ7A 2K3BA 3FDRA 3HZGA 2M52A 4KQZA 5M9OA 4B3MJ 3JCMe 2HHSA 2VQEF 2LLZA 4ES1A 3AQOA 4CLPA 3HHLD 2I2YA 1DTTA 1Q95G 3H8YA 3TCJA 2LRQA 1AA1B 2E66A 2POKA 2R2RA 1NXIA 2NZ4A 5L1KA 4ETXA 3CCLS 4QCLA 2FHOB 3JSRA 2V26A 1VQLS 4IKFA 2RF2B 3DXBA 1FE4A 2RNEA 5HP1A 1U1NA 5T7LA 2ESWA 3BDPA 5ADZA 4NL5A 4USVA 1CQNA 3LAMA 1RWWB 1M5PC 4M7DB 5FU7B 4RU9A 2C0TA 2KN4A 3IAM9 3H0IA 2BM0A 2DEQA 3N01A 2EQJA 4K2JA 1VQ9S 5D6XA 3GFXA 2G2ZA 2BW7A 3KLVA 2N4CA 1EQMA 4Y0FA 2C2OB 3M8RA 4NLOA 4CLWA 3RKYA 5GANf 1YLXA 2DERA 3GV8B 4PJLA 5B08A 4A8FA 3MP1A 1PM3A 1UAWA 1IKVB 2OPQA 3DRRB 2EJGA 5K14A 1ZBTA 1AUDA 2DGXA 2KJWA 4ZGJB 3C46A 1LWXA 2RJZA 4OL8A 1BWVA 3QG1A 2VYTA 4EDUA 1UEBA 4CLZA 4J5OA 2HMIB 4WIQA 2QQ9A 1D9AA 1QE1B 2CRLA 1ABOA 5IT4A 3FNNA 2VWFA 1SVDA 2UP1A 4ECSA 1WWHA 1T95A 2RD1A 1IJFB 1HD3A 3TWZA 3OYJA 1JJCB 1QLYA 4UUWA 5GAN8 1ZM9A 4ERDA 2O31A 1QVGR 3UNGC 1OU8A 4QVDA 2I1RA 4QIEA 1U47A 4CLSA 3F44A 3DU5A 3S7RA 5AXKA 3IO1A 3EG9A 1RT3B 4LIWA 1S49A 2E1CA 4CLUA 2MZJA 3IFEA 2AX0A 2JN0A 2RS8A 3TJAA 1Y07A 5A8KA 4WXOA 2CH4W 3R1HA 5D0RA 2R7TA 2CA9A 3AFGA 2R7QA 1DAXA 3MM5A 2CJKA 2WZ1A 2AP6A 4JOUA 2Y0SD 3KJFB 4L75A 2OUGA 3IR6B 1I8FA 1SHGA 4XDCA 3PYDA 4WP3A 3WBZA 1OIAA 5KFUA 3BPDA 3GV5B 3UDVA 3RKXA 2EYXA 5A6WA 1VC0A 3H0FA 5GAGU 5CKHA 1U0HB 3RAXA 4LF8J 1V29B 1IREB 4MIBA 3PE0A 1SC1B 4RBVA 2AJ1A 1X4CA 4UF4A 2MF2A 5ETLA 2JEIA 4N56A 4I6YA 3QDRB 3W9HA 4ZCLA 2VVKA 4OI3A 2J6FA 2QL9B 1HJDA 2OP5A 3I87A 1Z2ZA 2ZBRA 1VA7A 4RW9A 5FWCA 3BE3A 5DS7A 3OYHA 4TYBA 3HD2A 1KP6A 5AXMA 2O5DA 2ACMA 3M57A 3BGFA 3CDUA 3F73A 1TAUA 2CNOB 4OVAA 2WAQD 2W9CB 2RQRA 1ZS6A 5E3QA 1R8BA 5E3PA 3EFSA 1VYTA 5GANh 1KIKA 5GAMj 5LT5A 4VUBA 4DS4A 3FDSA 1RHUB 4F4KA 2O4XB 3TAPA 4HTIA 2C2RA 2XULA 5CQGA 4DUYF 3JCMc 2ZE2B 1VQPT 4MK7A 1M1GA 4MMLA 2HNDB 3FK4A 3UD3P 2J9CA 3KTQA 1YQHA 4ME7A 2WHOA 2KR3A 4OMPA 3L1AA 3VALA 3VQSA 2FLNA 4LDYA 4M7AE 3QO3A 4BI3A 4C8QC 1RTIB 5KH6A 3N28A 1ZOTA 2V50A 3R27A 4USWA 4NZ0A 1HNIA 3TZZA 4C8ZA 1LJOA 2YNFA 3TUZC 3TO8A 4ED5A 1LFWA 4GC7A 1PAUB 2W9AA 1B0PA 1H2VZ 2LEAA 4N41A 4GVLA 2DTHA 2V2VA 3NRBA 3DOMA 1JB0E 1WUUA 2A3LA 2MYSA 2KT5A 2BXJA 2N7CA 3DYAB 4XU2A 2QA2A 1HW9A 2IAJA 4HT5A 3OMGA 2KM8C 3TVYA 5HBMB 1TG0A 3GZ7A 1VQ4T 4ZVEA 2VV5A 3W5ZA 3R7SB 5FWBA 3D9BA 1RLQC 4LE9A 1UL3A 4NOHA 2EQKA 2XDBA 1WHHA 1FD2A 3PTAA 2GQCA 2J7IA 3V8JA 1UP1A 2PA3A 2F5TX 1IBLJ 1UW4A 4TXSA 2I8EA 2R8KA 4GRSA 1M30A 1AFIA 2VJUA 2DNHA 1SH3A 3UVJB 1KC8C 1GT8A 3JB9J 2X4JA 3HRTA 3X20B 5J2PA 3TI0A 1K8AT 3CD6Q 2A36A 4DBFA 2KRSA 2K5FA 2BQRA 2W2NP 4DL5A 3IRXB 3RU0A 1U1KA 2MKHA 2DL5A 4XQ3A 3M2UB 4DPUA 1E6VA 1R77A 3AOAA 7FDRA 4M78G 4MK8A 3WIVA 1CJUA 1H3ZA 1H7XA 2IMWP 1QQJA 1FT8A 2VQEJ 4PZVA 1IHWA 2DYBA 4PLIA 3J81j 4EMDA 4CRIA 3W63A 4DPYA 3BBFA 4OMNA 4PG4A 4JI3F 3IG1B 3H90A 1Q86U 3REAB 2KYMA 1K0XA 2KZMA 5ECAA 1KHIA 4D8DA 1CS4B 3OTDA 3G6ES 2F9JA 5F9NA 3AHPA 3C6TB 4CC4B 5CIUA 3LP2B 2UUBJ 1RTJB 3RAQA 4JZ3A 4L3KA 1VHFA 4PKCC 2AX1A 4N8NA 5A0DA 3I0RB 3NGKA 4C8QA 5AE1A 1F3VA 3EGXB 1S72S 2C3PA 2BE2B 2FJAB 2KT2A 3QT6A 3CXCP 3GFHA 1D9DA 2DR9A 3BB5A 4M5DB 3PR5B 2BEFA 3Q0AA 5IWAF 1OPZA 2J5AA 5L46A 2AJQA 1O51A 4OZ2A 1WKLA 3K8WA 3IMQJ 1KQGB 2CQPA 3MEDB 1UVMA 4ZCKA 2Z8QA 2HRUA 2VL1A 3HO1A 5AE2A 4R5PA 2AHJB 2LU1A 4LSZB 2HVZA 1W2BS 5L8RE 5B0BA 5IQQA 1QWFA 4Q2LA 2F1LA 5J1EB 4FXVA 2XMKA 4NL3A 4PEOA 4TU7A 5JVHQ 2WRMA 4FM4B 1D3WA 1T9UA 2RDDA 4C0DC 2VFSA 5CCAA 1B64A 4JLIA 4IDKA 3UDCA 1Y71A 1ZM2A 1N8RT 4RNOA 4M5IA 1U24A 2VG5A 5KOXA 1S59A 1R0AB 1T3NA 2Y1RI 2M9UA 4HA8A 1K4US 2QFIA 1DLOA 2H54B 1QTNB 5BXIA 1VOMA 2OX7A 2MJUA 5D4LA 3JB9I 1BUXA 1Y10A 3SCIE 1TKDA 3OW2P 4HYKA 2VA2A 3CCWA 4RW4A 5IN1A 4JV5J 3Q2TC 1EQ0A 5LSLA 1WHWA 4CC7A 1VQOA 3NTIA 3GJSB 3VAKA 4Q8EA 5KFKA 5FW9A 4K4VA 2APOA 3VS1A 3CCUS 2IA0A 3RBDA 4J9RA 3NWGA 2CP3A 1G3OA 4E2FB 3J7YI 5A8WA 2YX4A 5GAOm 1HW8A 1FX7A 3ZO7A 3HFVA 5KFXA 2EFNA 2DISA 1W2BP 2X1FA 3V5RA 3G4ST 2V5HG 2LZ6B 3CBPA 1VQ8S 3KLIB 3FSIA 4CLKA 2MSTA 5CABA 3N6MA 4WPAA 3HPOA 3NGRA 3DLMA 1NLOC 4Y34A 2VPXB 2OTJT 2WSEC 4YHHJ 1R7IA 2KKHA 3MPUB 1HIYA 2GV1A 1YK9A 2SXLA 2FZCB 2I5JB 3V2UC 5J1NA 1HMVA 4O5VA 2GO8A 3JQKA 2OO4A 4FBUA 1G3YA 4B3TF 1WX6A 1VK8A 2DNGA 3BN4A 1KQFB 4A48A 5FJ4A 4J9FA 3VS7A 3DRSA 1M0SA 3UWTA 2QJ3A 2LU2A 2E29A 2MPUA 2RI2A 1WORA 4K4XA 1FKPA 2DMOA 2P9GA 4F2SA 3ZTOA 2DXBA 3K5NA 2COLA 1C1CA 3EJMA 4NLDA 1VQOQ 1WC5A 2A10A 3JB9F 2R8JA 4B9LA 3UI3A 3DHXA 1UGRB 5KYUB 4ENOA 2WACA 1R8AA 3KK1A 2QI2A 2DFUA 3CD6A 4AFZC 1XK8A 2WSFC 2KDOA 3MURP 1B3QA 3VVTA 1HNWJ 2GIRA 4RR5A 5I42A 2XYGB 2JSXA 2ZGWA 3PYGA 2GF7A 1V3RA 1RTIA 3NNAA 2OTLA 2ZNYA 1WOPA 3HKZD 4O4GB 2XLIA 2A1BA 1MNEA 2DYIA 1FRLA 4DV5J 4QIGA 2GS8A 3RYLA 3SWNB 4C8KA 3JTOA 2HFZA 2J05A 1LK5A 1BHNA 1Z9QA 1IKYB 2GQVA 1LWEA 5HROA 1VQ6Q 2CH4A 1M1FA 4ZMMA 1WC1A 1S1VA 1X6GA 3QJ6A 3VAGA 1NJIU 3CCJT 1RGVA 3LPYA 3OR1A 4C8QG 3ZEHA 4FVCA 1KFSA 2NUZA 2JC1A 1UWBB 4EPCA 3HVWA 5HBMA 1U5SA 4K5RA 4WWSA 3EDRB 3R5AA 2KYZA 2VFVA 4F0MA 3FMBA 2E7WA 5KFWA 3HHTB 4LUBA 1U7LA 2EFOA 1IBLF 2XGPA 4LF5F 2HQGA 2QMUB 3KLFA 3SSRA 4U67Q 2EQMA 1DURA 4J9UE 3BSAA 1JLFA 2HAIA 4QOTA 2HGNA 4UQTA 2B7CB 3QWYA 2FJBB 4NZ6A 1VJQA 4HT8A 4Z37A 4FKYA 4ZPDA 2ZZNA 5KYYA 2K5LA 5K20B 2CQCA 3LWLA 3TX8A 3LUYA 2W01A 2O3DA 4F25A 2FGCA 1WHLA 1MWZA 3QIDA 2QZ8A 1F9FA 4JI0F 1V6HA 2DJZA 4M75D 1X31C 1FRMA 3SV3A 2YLCA 2CQ3A 1ZHIA 1PBUA 2KM8B 2BKDN 2XO6A 3W5XA 1QTMA 3OQ2A 3OYLA 4V1Ak 3EG0A 1MWYA 3FGVA 3UNYA 4WIIA 3HFOA 2I2LA 3CC4S 3OW2A 3G4SQ 4F4ZA 2HHTA 2H4YB 2IM0A 4DN9A 2XMUA 2P8IA 2RKIB 2LCSA 4ES2A 3LP2A 2AIRB 1YITT 1GMWD 2X35A 4LVOP 5M2RA 1QSSA 3W2WA 1VJWA 3GJRB 4DSEA 1NJIT 5L9XA 3I0RA 2MKKA 4JRQA 1BI2A 1BI0A 2ZPBB 1H73A 4BHQA 2PSZA 4I69A 5IFMA 3I9ZA 2YKMA 4FT2A 1HBOB 2OAWA 2BUDA 4DUZJ 4NZ7A 2V8IA 1VQNQ 2AZ3A 1BQXA 3JCMh 3C66A 4M5DA 1OQ3A 3TAMA 1P92A 3G7ZA 3ZL7C 3GPAA 3CMQA 2UUBF 5L23A 3Q8PB 3GPLA 2YT6A 2E5GA 2O66A 1WHKA 4JI8J 5J2NA 3MHYA 4U9RA 3R5DA 5AJ3J 4UTGA 4J90A 3BJYA 2H5IB 4KT0C 2EYWA 3SEOA 3CCUT 2PFFB 2NLWA 3ZNUA 4ZVGA 3NNCA 1M27C 1RP5A 2CT4A 2XK0A 4ZITA 4AFQC 5H9FJ 4IDKB 2RILA 2F63A 2BE9B 1T9VA 2HSPA 3GCWP 5B0AA 1VYUA 2BKOA 2AZVA 4UQGA 3PIPQ 2VG5B 4NYOA 1WDTA 2RSQA 4RJVA 2WVBA 4O6JA 1X4AA 5DO2A 1TKTB 4JI6J 4H4KA 1Z2LA 1GMVA 3F70A 1Y11A 2COZA 1NZ9A 1NSPA 4A47A 1VQMA 2IBKA 4YS2A 3I9V9 4YY3F 1Q7YR 3MR5A 1IXDA 4K4YA 2HVHA 4NYZA 4I2PB 2GVDB 4C8QF 5KFDA 4DA4A 1NM7A 2GFUA 2HYIB 3FQLA 1J3TA 4M4ZA 3TZXA 4YOEA 4RUBA 3KHRA 1U49A 4AFUC 2A37A 2MAMA 3DB3A 3L7OA 1SKUB 4ECWA 1UGPB 4FDFA 2LQ5A 4FYYB 3GQCA 1GXTA 2RQVA 4CLYA 2OLWA 7FD1A 4C92A 4U6PA 4J37A 3HLUA 4F7UF 2P6SA 2VUGA 5GMKa 1K8AR 2J0SD 5C2GA 4M75G 3W2VB 4HHUA 3IP0A 5CYQB 3EVMA 4JI5J 5E33A 1HMVB 2YXLA 4RW8A 2R7VA 3NPFA 2R7SA 3VHQA 1OULA 4C0FA 5KFHA 1UEKA 2YUPA 1NJXA 5KG1A 1M4ZA 3PFSA 3I55T 3MR7A 3CJKB 4LDUA 4ZPVR 1B34B 1JO8A 4GO5X 2DLPA 2E70A 3V7RA 1FCAA 1WOSA 4HCBA 3TYTA 3FBBA 1EARA 2K7AA 3JB9H 5ETTA 1WEXA 2Z2LA 3AD9C 1RT7A 4CH7A 1RT5A 2PTKA 1WI6A 4CZCA 5HQLA 2IM1A 3FCWA 1BI1A 2OFGX 4IFYB 3J7Z5 1QSLA 4ZS6A 1HPZB 2MMPA 2DGOA 5LJ3h 4FPRA 4IUFA 2CZ6B 2WB1D 3Q86A 1VQKT 3H2VE 4TY8A 4DR1J 1QW1A 3TZWA 2QGFB 2ZUAA 1TK0A 5GAOr 5DQHA 3GIIA 3T5JA 1VQNT 5MAOA 3CCJQ 2RQCA 4C4WA 3HVTA 3RESA 3CCQT 3DHWC 5CKBA 3BYPA 4OZJA 2RJEA 3KBGA 5B0GA 1N5YA 2F40A 1OPLA 2RQWA 1TKXB 2HHPA 1MMDA 4Y00A 1HWUA 4N7TA 1GBQA 4OYZA 1FJ7A 1R0CB 4ECQA 3L4BC 1U09A 3TA0A 1SQEA 1VIFA 2EQUA 2ZC4A 4MTPA 3TZYA 4X4TA 2D9TA 3SSQA 5D6WA 1QVFS 1CG2A 5K8MA 4FNIA 2KDSA 1AYEA 2F3JA 4CO0A 1NH7A 2G4BA 3CCUQ 2KYBA 4IFVA 3G8TA 2PN6A 1TAQA 1C2PA 1D1AA 2L3QA 3V6HA 2BBEA 5KYWB 2JM8A 3S6EA 2RDJA 4DBQA 1NDKA 4F7VA 5D8HB 4DS5A 5CQYA 2NQPA 3RRHA 2I6WA 4X1VA 2GZOA 2XC9A 2AWZA 2L48A 4EUVA 5CCMA 2IMOA 3LGHA 3PXGa 1Y96B 2UV8A 2ABLA 2CZ9A 5FIIA 2EBEA 3HI9A 3PM9A 3KG4A 1UEVA 3LQVA 3B4MA 1WFWA 4ECYA 2Z0GA 1KVIA 1MROB 3EFRA 1PCXA 3H7HB 3X28B 2FTRA 4NRUA 1S9EB 2YRVA 1SCJB 3MMAA 2LQBA 5ETQA 1HBMA 2KI7A 4KO0A 2XS7A 1NNDA 3VYGA 2OEJA 5EX0A 4IO1A 3R2DJ 4BD3A 3C15B 1P9YA 4OB0B 4E7JA 4QJVA 3HSGA 1M2VA 2QN6B 4QWEA 3QJYA 1RHJB 2D1XA 3G1JA 4W90B 1N52B 2VPYB 1T05B 3IWNC 1W1FA 1VQ7Q 2D6FA 3UCZP 3TANA 5ETMA 3MZIA 2IFXA 4ZPAA 4F3MA 4QT7A 2I38A 4UOGA 1HWLA 1HQUA 2D9OA 1IM4A 5E2QA 1KOHA 3FKBA 2PO4A 5GAEI 3EX7B 1M90T 5AYFA 3PG9A 4K4WA 4FF4A 1U6BA 4M78D 3C14B 3CEDA 5GAMg 3C0CA 2XI9A 1TL3A 2K2MA 4LSNB 2E5QA 2ZPEB 2W4DA 4WF2A 2ROEA 3P5BP 4LFAF 3QYYA 1I4K1 3CC4T 4FW2A 2GIQA 3D3CJ 1RAIB 3DMJA 4FKXA 1M5HA 2BR0A 2QA4T 3QFWA 4F50A 3QFHA 1CPZA 4JI5F 4Y2KA 1SG5A 1UJ6A 4UT4A 1B07A 4E7LA 4OI0A 1Q8IA 1WNLA 1EETB 1J5EJ 4KTQA 2F7VA 1Q86T 1VMBA 2K2VA 1T0HA 2QQBA 3V6DB 5BR8J 5KFCA 3CGIA 4PJOE 3MCMA 1HWJA 4HVUA 2VG7A 4Y3CA 2XCAA 1NKCA 1VQMT 4QQ6A 2C42A 3GYGA 3V81B 2J8AA 2Y4YA 3FEZA 1V1CA 4CO1A 2J6UA 1F6TA 4NI2B 1FKOA 2CWKA 3R8YA 4BY6B 1RKIA 5CKFA 1ARKA 3RBEA 2EFPA 1IWAA 1M5VC 3VUZA 3T41A 1M5OC 3D5MA 1WA7A 2KVQE 4QYZK 2RAQA 1XMOF 2E9ZA 1CQMA 3MTJA 3O8VA 2P9CA 1P6TA 1OPKA 1WZOA 3FRYA 2DPPB 4OMLA 5J2QA 4MKYA 2BZYA 3CCJA 3P6YC 2HHVA 1RU1A 3OYMA 2NXUA 4YN3B 1IO6A 2RHUA 1FDDA 2QMXA 5ETRA 2VBWA 3WDOA 4K5SA 2DRDA 3UW1A 4DR1F 1KQSA 3M8QA 1S48A 4BS2A 2AJFE 9RUBA 3UDLA 2COWA 4O0NA 2AGOA 1VQKS 4KHMA 1M90U 2VBXA 3A5ZB 5CCLA 2O2OA 4DF8A 1AOJA 3HTRA 4XTXA 3DCAA 2YWKA 5CYQA 5A0YA 2CPHA 3J7AF 3DB4A 4DQSA 2DXFA 2FPDA 2IA6A 4QW9A 4USJC 3UF4A 3UT1A 1BCOA 2FB7A 1UUEA 4M75E 2YWWA 4RW7A 1AVZC 4PFZA 2UXBJ 1IQTA 2GQ2A 2GHPA 4IH5A 4IQMA 2A6MA 1DHMA 1W6XA 2DGVA 3Q24A 1XTZA 4M77B 3OFHA 1M3BA 3JYTB 4OMMA 2DM1A 3JXOA 2B86A 3BQ0A 4B9WA 3I56A 5F0WA 2L3MA 4NLVA 5DG7A 4ZHRA 1PKUA 1GX6A 1RT7B 1NK9A 2NS1B 1SH2A 2A08A 2WTFA 5T7LB 3EUNA 5D4OA 1I0CA 2YVSA 3OPKA 3WX4A 4YR0A 1KD1U 2PVOB 1X9WA 1C4CA 1URRA 1ZSZC 2DNLA 1JJ2A 4KGMA 4HHJA 5A8RB 1WHGA 4BE1A 4EU0A 2J9DA 2MCNA 5I3UA 4YEAA 2N82B 4JI1F 3CDEA 1CJKA 2JJ9A 3X1LB 3EG1A 1Q82C 3W9IA 1TTHB 3DRRA 3QPIA 2Z56B 1QVPA 4M7DE 4MZMA 4W4MA 1NPRA 3PNIA 4DZDA 4IUPA 4K0KF 4LNPA 2F2XA 1S0VA 1N5YB 1TQLA 5J1PA 3VF0B 1UFWA 3CJTA 2GJ2A 1BKBA 5J2MB 5C24A 2JXBA 2M16A 4MKAA 1TL1A 2GMLA 2XG8D 4PJOB 5CD4H 3HP6A 4CYUB 5D78A 1JWWA 4PNOA 4RTXA 4E6RA 2CPZA 2MB0B 1CVJA 2PMWA 1OOTA 3QZ9B 3BGOP 4KBMB 2EG2A 4ZA1A 2CNKB 5KOWA 2KB2A 2JHEA 4YMEA 1OJ4A 3HKWA 3TEEA 1FEEA 1RWNB 1TL5A 5IXFA 2DIQA 1WOOA 3L42A 4QR2A 5A8KB 1DBDA 1TL7A 3DXSX 5IOLA 4CO3A 1N32F 3MWBA 1DFDA 5C42B 3I96A 2QQRA 2QYGA 4I4BA 2QTXA 2QSWA 1FXDA 2M5YA 1LW0B 3OYYA 1WHVA 1VQ9A 4ZJOA 5DDPC 4ECUA 1Y96A 3M0TA 5GAN2 3AAWB 1HR0J 2CYZB 5CVIA 2ZFHA 3MP6A 4KKOA 5BYRA 3DLKA 2R2UA 4DFJA 3H5SA 3BY7A 3OFFA 3BQ2A 2AV5A 2LX9A 5LJ3d 5HI7A 4P2MA 2IVWA 3GV7B 2HHXA 4IR1A 5LM7E 3G71Q 5KT5A 3KG1A 3WVEB 2KK4A 1TMMA 2B6AA 3PIPA 2RI5A 4C92F 3MFHA 4LRBA 4M77D 1HQEB 1YKWA 5KYXB 1RSCA 1JX4A 2VC1A 2IJRA 2YPZA 3CC7A 2ZEJA 2JOQA 1Z4UA 4NEYA 4LBHA 5LL6d 2GO9A 3EMTA 2RH2A 3PW2A 5D77A 4WBFA 1CLFA 5KG4A 4RWXA 1C0UA 4X4SA 1X0FA 2PEHA 5KE3A 2DL8A 4M78F 1GCPA 3E01A 4O44A 1N5QA 2YBVA 3MUVP 3K5LA 2HQHA 4UY85 5CK9A 3SCLE 2KTQA 2VPZB 2RQUA 4NLPA 3VJPA 1XMBA 4EBDA 2HNDA 1TL3B 1HNXJ 4CWBA 2QA4Q 3OHBA 1YWXA 4F3QA 3QYGB 2DGWA 1VQNA 2XHCA 1ZQ1A 4ZVTB 4JS5A 4LR7A 2KG0A 2WCXA 3JCMf 4C92D 1T9TA 4QU7A 1B7FA 4WFZA 5HATA 1WJ9A 2V69A 2V8PA 1G5VA 1EETA 2Q79A 3MF5A 5KFYA 1JXVA 2R7RA 4G3IA 4M1KA 3CMAS 3M30A 2DJWA 3V6DA 2FJXA 1Q1KA 4S0MA 2MQ8A 2YQ0A 4L59A 4CRJA 2X1BA 4JI3J 4DQQA 3JRZA 2ZDOA 1V5VA 3UR0A 1HNZF 4ZLJA 3NMZC 3MTKA 1K0SA 1FTRA 2EAYA 2QLJB 3ZZ0A 5LJ5h 2J6OA 2C0OA 1UETA 2ZZTA 2FY1A 2IYIA 1PG5B 1I5OB 2XI3A 2Q43A 4Q5VA 1ZETA 2HGLA 2BJ7A 4QWBA 1LOUA 1KDNA 4ETZA 3QWUA 3BO2A 1J5EF 1UFLA 4OHYA 1ZLMA 3CCET 5D6YA 4N0AC 4TN2A 4LD9K 3WZ0A 4DV4J 1YHQQ 2MLYA 4N5SA 2YRDA 3MM6A 4JI8F 4V19J 3LOUA 2KH9A 3JSMB 5I11A 5IV3A 1NO8A 1E6HA 2DRMA 3HF5A 5IT9U 5J3BA 2WOMB 4AL5A 1AROP 3CB4A 1NK8A 2FHDA 2G13A 4DX7A 2EKNA 2A7YA 2ROLA 1RT4A 3TQ7P 2CG4A 2OPPA 2XG8A 2KL8A 1HA1A 4H4OA 5J2PB 3SB2A 3U23A 5KFGA 3J7A1 5F3ZA 1BGXT 4CI0B 2JLGA 2R2TA 3CD5A 4YDDB 2DJQA 1DQ8A 1PJ6A 1NSQA 2QLFB 1WNEA 5A0YB 1S1WB 3DOKA 3M2UA 2EEYA 3A12A 4YFUA 1XQHA 4USMA 1JIHA 4M63A 5LMUJ 3I56S 4NX9A 4M7AG 1ZZNA 4OIXA 4HCZA 4ILRA 4QYZJ 3Q1JA 2QRRA 2ATLA 3AA8A 1S77D 4L74A 4M77A 4YR2A 3JYTA 2KXDA 4EI2A 2MZTA 4TVAB 2FLLA 1CS4A 4K4ZA 4CLLA 1FMVA 5HQMA 2BJDA 2DX1A 1F1BB 3NOCA 3CCLA 1EZZB 2ZD1A 1UA1A 2YNIB 3HSZA 3OL8A 3H4BA 3EZ5A 4YHHF 3W60A 2CG8A 2LQJA 3CPWA 1YJ9A 4X66F 2W4CA 2OTLQ 4MZPA 2HVIA 3M58A 4OV1A 4D8KA 3CJ0A 2GGRA 3TUIC 3L7PA 1FK9A 2BE2A 4I2QA 4ZCIA 2HKEA 2HFVA 2V9WA 3OL6A 3M05A 4FS1A 3D68A 3H42A 5F0UA 3T6JA 4WTYA 3NGSA 3FLGA 1QAJA 3PEHA 3TREA 3P4UB 4MK9A 3JCMb 4FYXB 1XNRJ 5I2MA 4DI6A 1TMJA 4JV5F 2RO0A 4RLEA 2F9DA 5J2MA 5KFJA 3HT3A 2E7VA 2LDMA 3U1MA 4F14A 1MSWD 1MU2A 4PJOD 2KE9A 3DLJA 5GADU 4Y65A 5J1EA 3MAAB 2ZPIB 4P7TA 2EJFA 1XQIA 4K59A 4X4QA 5IZHA 1HNVA 2V8JA 1GTHA 4XAKA 1Q82U 2VJVA 3I5RA 2HFOA 4QU6A 2A0FB 2UU9F 4FF2A 1R0AA 3DOLA 1RL2A 3TQ1A 1WI8A 4DV4F 1N8RC 1TL7B 1YITQ 2DNOA 3V7SA 1JBMA 5KFNA 2PQWA 3FVYA 2VQFJ 3BH6B 4NXNF 1VQ9Q 1LK7A 1L3VA 3CCMS 3MMBB 2OTLS 1R8OB 4KHPJ 2JC0A 3OFEA 1KSWA 1GBRA 1SJ1A 2CADA 2YWHA 3ITHB 4I7FA 3SI8A 4KKOB 1R8CA 3PHEA 4EEYA 2CWXA 1T3SA 3Q22A 3OVBA 3CMES 1RHMB 3M2RA 4UOCA 4WFNQ 2CKKA 4JYAF 1APSA 2FPFA 1QVFA 3I5CA 2RB6A 4PWDB 1JLEB 1N5VA 1OU9A 2A2DA 2HURA 3CQTA 4WZMA 2YX7A 3HKSA 1S72T 4NCBA 3N6NA 1AWXA 1X4GA 4OYIA 4H54A 4M77E 2CPDA 2WVFA 3K5OA 5T41A 1FRXA 3D7SB 3OYGA 3S3MA 3EG9B 1KC8U 1RT3A 4J83A 1RXOB 4MZTA 3VGTA 2MKIA 2OAUA 2H1YA 4BC7A 1GL5A 2OPSA 1CSKA 4AFFA 4GLMA 5E7OB 3CDWA 2ZZMA 1ZAXA 4FSSA 2LC4A 2CVIA 2XMJA 3CT9A 4OZLA 2D3O1 4O44B 5KT4A 2AJ2A 1K73T 3H6ZA 5HLFA 4K8RA 4KSEB 2JZ2A 3AJ2A 1C1CB 3EFOA 1UVJA 3OA6A 4NLRA 4LF9F 2WSCC 2EYZA 5I4MA 1WJRA 4BCAA 3KK1B 4TQRA 4Z2XA 4QW8A 2FC8A 3NAIA 3OHAA 4HT7A 3GWCA 2RK1A 3MECB 3KHHA 1H3HA 2DH9A 5KG7A 1VS3A 5IH2A 3HMJG 1MMNA 4MAKA 4OV6A 5KFQA 2VDIA 3IGVA 4AMCA 4F4YA 1VQ8T 3CO0P 2NREA 4DL2A 2W2QP 4ZLPA 1UFKA 2NXNA 2DNKA 3GJTB 2UVWA 1WELA 3B8HA 3NFCA 2A3JA 3ULRB 2XZTB 2CYYA 1FFWB 4EMGA 3CD6T 2BANB 3MD3A 3R5JB 4WP8A 2L2PA 1F3FA 3ETOA 1UHFA 4V19X 5IV4A 1PYOB 3QO9A 4U95A 3M8WA 3W61A 4PQUB 3T1HF 1NEEA 1UWBA 4DR4F 1UGVA 3A98A 3US5A 1D9FA 1Q5YA 1N48A 1WHXA 3D67A 4I67A 3TJ9A 4D6WA 2CPJA 3VS4A 2PVGB 1OSDA 1KHWA 4UZBA 1U1RA 3GE9A 2XKOC 2GJIA 3TP2A 1NRKA 1CJVB 2YQ3A 3BEGB 3DM2B 3MOJB 2X3XD 4LVNP 4KH1B 1RQ0A 4RW6B 1M8MA 1TH7A 4JB8B 2EWHA 1BWEA 2YPYA 4J7IA 2PC6A 2KG1A 2GMHA 3AXKA 1KVJA 1A0OB 2E44A 3MEEB 4FYVB 2LNVA 2DK3A 4DR3F 2D74B 1TVRA 3FFIB 2Z0WA 2HZYA 4HVWA 3WXMB 3PV8A 3HHEA 1VLOA 2F8EX 2YNFB 3CC7S 2X4WA 2DILA 2R2SA 4N47A 2Y1IA 4OYPA 4X4VA 4I0WA 5IM0B 1BQMB 2CDQA 4PLLA 1Q81U 1XOVA 4XU1A 5DM7R 3DOMB 4X62J 1FE0A 2GMJA 1NHKL 4B9TA 3NS6A 3N9UC 2GFFA 1VYVA 2Y9HA 1K0TA 3T3FA 2DRAA 2GIFA 1CKBA 2ZWPA 4JJDA 2UUAJ 1JLCA 2HNYB 3DLEB 3ME9A 4XK8C 3CCVA 2GFAA 4DV6J 4JI7J 3LPEA 4DCOB 3PDNA 2DD8S 2K7JA 3MCSA 3NBPA 1VI7A 4NYPA 2RKIA 2ZD1B 1MNDA 1UZHA 3OMCA 3KLEB 2CZ0B 2BQ3A 3V4MA 4HXJA 1Y3KA 1HHSA 1L3UA 1SQGA 4DN0A 5GAOq 3M9OB 2NYHA 1NJYA 3DI6A 2ASLA 1UECA 5LMNF 2WONB 1TR0A 2DE0X 4NS5A 5IHIA 1YWPA 2YY3A 4AXIA 4TLQA 5IXUA 2UXBF 1JNZB 3VGUA 1PD1A 1ZA2B 1VQ7A 5HKCA 1I81A 4XU0A 1W70A 1CJUB 3B82A 4O3OA 2NSCA 3AY0A 4WFXA 1JQQA 4KV8A 3HK2A 2B9YA 2V4JA 3BO3A 1MU2B 2ASJA 4PJNA 4A53A 2ZOMA 4IYQA 3MAAA 3HD1A 3P5TL 1Y4ZB 3ENWA 4XK8E 4EGLA 5ETKA 2E9TA 1HNVB 2WVDA 3CCMA 1ZYQA 1K73R 4BDZA 1AWOA 1QAXA 1HI0P 3OS0A 4J9NA 1J2VA 3IBWA 4LQ9A 4DPWA 3MM8B 1DY3A 3DNCA 1YJNA 2X4XA 5DETA 3SD4A 2ZH7A 3I56Q 3CIZA 4B6MA 3OL9A 2Z2YB 4ZTFA 4XTVA 1T03B 1UGQB 4EMKB 1PC5A 1TKTA 2CDRB 2RNAA 4M7AD 3BW1A 2HQ3A 2EGAA 4A8KA 1M90C 3EGXA 1KD1R 3HDSA 1VQ4A 4X84A 2JUFA 4B3OA 3G87A 4MDXA 4E8UA 3BGRB 1KG1A 4O3RA 2R42A 5GAOn 3I9QA 3OSSC 3C4SA 4ORZA 3D6HB 1LNXA 2R7WA 1TK5A 3TNVA 2ROGA 1QP3A 1XR5A 1XC9A 1NUEA 1G1XA 3OXFA 3UA7A 3PTWA 2XIDA 2DYAA 1M9SA 3C19A 4J9LA 4K50A 4IUQA 3PW4A 2NUTA 1VBZA 3MEVA 3NS7B 3PX4A 1R0BG 1DQ9A 4KY3A 2XMTA 3A8GB 3HX9A 2MHNA 1KC8R 2FYXA 3PACA 2DGTA 3D54A 4IH6A 3GFYA 5K8PA 2DPJA 1G3SA 2DKOB 3PRVA 3H5XA 2XMAA 1F5AA 1GFWB 1K9AA 4TYAA 2LKZA 4EO8A 2HBWA 3CCSQ 2YWFA 3N0VA 1YJNS 1KLMA 2N3OA 4B3RF 3P45B 2DNMA 4NL2A 2D3OR 1KJWA 1R31A 2EK6A 2MQMA 1N33J 4EYIB 4M77G 1N5ZA 2RE1A 2RQKA 1K9MT 2HBQB 3P3DA 4DR6J 1ZTWA 3CE8A 4R55A 1YDLA 2WW4A 1MV3A 3QDFA 2HRYA 3R6LB 3OTCA 3MPWA 3EFOB 1FNOA 4AD6A 2L8DA 2CPFA 2CSIA 2GAHC 4IG3A 3QSIA 2ZH1A 3F56A 3G82A 2P6TA 4Y6IA 4O3QA 3R6OA 3OL7A 1D1CA 3OUYA 5GAGI 2L9NA 5DGAA 2EIFA 4QVZA 1YG0A 1WEYA 4X66J 4O3NA 2IRUA 2BJ9A 1T0TV 2D41A 3KLIA 5DLQE 3QGIA 1U1MA 5ETVA 2LA4A 4HT9A 4HTJA 3UN2A 2VG6A 4TY9A 4M78C 4AT1B 4CM2A 4II1A 1JLGB 2HKNA 2CQ4A 5KG6A 2VKRA 3ZTPA 4PG7A 3JTPA 3OTOJ 3KHLA 4Y92A 4USHA 2JEGA 4J9KA 1KNZA 1VQSA 2HS3A 2VU5A 2OIHA 4CC3A 2PA8D 3MO8A 1I1JA 3OB9A 4DFMA 3RMSA 4GKKJ 1R8HA 4C48A 1WACA 2LEPA 4Q2MA 3W8GA 1MWQA 2ZITA 4FF1A 3MPYA 2DHAA 3GP8A 2MXYA 2CQDA 4NRTA 5GAN7 5HMXA 2M51A 4IFVB 3HVRA 1UWAA 3M6VA 4C2MA 3AB4B 2FLPA 5CD4A 1QSYA 2ZJPQ 2V4RA 4YP3A 5D3GB 1JMTA 3SV4A 4N4IA 4HI1A 3FCVA 2JMCA 1RKJA 1KSPA 2EVRA 3CXCA 1FXRA 3O1LA 2H51B 1FNMA 3CJ8A 2MLXA 2XWXA 4LRFA 4J9EA 1RLPC 1X7VA 2K4YA 1UA0A 1IJEB 2F69A 1U1PA 1VQ6T 5GMKh 2CP7A 4URSA 2VICA 1IKYA 4ED2A 3CD6S 5IM0A 1BQMA 4J9OA 1LWEB 4X62F 2LCCA 1PRMC 4L3NA 1S1VB 1S9EA 2NCKL 4H4MB 4DR2J 5DJBA 4KO0B 5GANg 3R6NA 1W2BA 3DLEA 2HL5C 4A8YA 5D7UA 3NHNA 3PRDA 1JRIA 3R5GA 3PW5A 2VKZG 2XZWA 4OYMA 4QBUA 1N0VC 6FD1A 1YFNA 4USUA 2XB2D 4EZ6A 3ZTQA 1RWUA 2LQWA 1IBKJ 2DR8A 1RWOB 3KLFB 4JJCA 3M6UA 2R8GA 3EZOA 3O2IA 3RZAA 4YQWA 3GILA 1N8RR 4A54A 2FRWA 4DLGA 5IT9Y 3KLEA 2GA7A 1JLFB 3H20A 2EK1A 3NTKA 3DLGB 2AMCB 4K4UA 4W92B 1VYAA 2ZAEA 2F65A 1V3SA 1NBEB 3VR1A 2YH0A 1GFDA 1BI3A 3V4IA 4LF6F 2JS2A 2V34A 1BK2A 2OI2A 2ERRA 2RHQB 2CQ2A 3QAEA 3ISNC 1R8PA 2HNIA 5GAMf 4RTWA 1VGYA 2K06A 1YJNQ 1W26A 2FHJA 1H0HB 3KMQA 2IM3A 4KV8B 5GMDA 4DZ6A 1RLDA 4GKJF 3ER0A 3OBYA 4F4AA 3CCUA 1UB4A 3J80U 2N4DA 1SPBP 1H74A 1S7HA 3THTA 3QXEB 5E3CA 1WYXA 2G3RA 3G71T 3I4HX 1IVZA 1M1KT 1RUWA 3MM8A 5KFPA 2CPXA 2HZAA 1DTQB 1LW2B 2XNRA 3PO4A 5C5JA 3V81A 1NJIC 4J9SA 3EGZA 3OJUA 2DL4A 5EN1A 4OB2B 2V8GA 4N8OA 5F8IA 1LWCB 1U8RA 3A13A 4EMKA 3CCRS 1GMUA 4MMOA 3RBZA 2BZ8A 4PJOC 1HD0A 1T0JA 3SZ2A 3G6XA 1VC5A 3QRRA 2UXDF 1B0VA 2LA6A 1LEOA 3CUNA 2F8HA 1BIBA 4QKUA 1H641 4HVVA 3RW7A 3MMJA 3W66A 3THKA 2VFRA 3C95A 1ZAVA 3BGRA 4YR3A 2M02A 2UZAA 1OQKA 2B9EA 2FO0A 5J39A 2HRTA 3SFMA 2ZBPA 3MMCA 3DC2A 4M5GA 1S10A 1BIAA 4IG0A 5HJYA 1EKSA 3I6PA 2C2MB 3LH2S 1AXQA 4OQJA 2GC8A 4CT8A 4J9MA 4Q5WA 3UD4P 1VQPS 2MZRA 2V6AA 1D0ZA 2HSEB 3X3UA 4G1IA 3OSNA 3ENVA 1V76A 2EC2A 4WK3A 2QIFA 3CCST 2RUSA 1TUCA 1CULB 1AZEA 2H3EB 3FJPA 4C3KA 3Q8UA 1UPPA 2K5IA 2QYZA 4JI1J 1K1ZA 3CJ5A 4OX9F 3K5PA 2AT1B 1JXEA 3PGGA 3ILJA 2HLTA 1HARA 4ZN1A 1QCOA 4CC2A 2NPFA 5J26A 2FC9A 4JV1A 2V8KA 2B9XA 1X6BA 5LXYA 4WFAQ 4JV2A 3DU6A 5KFEA 2CNNB 1JJ2R 3EWGA 4M95A 4I2PA 1Q8LA 1X0PA 3OVAA 4P72A 3EHQA 1BQNB 3EGDB 3H41A 1BY9A 3HT0A 1UTAA 3KK2B 3CJ4A 4DLEA 1RACB 5F3TA 1FFSB 3JCMQ 3ADAC 3SQGA 3GOXA 3OUYB 3EGWB 3FCHA 4Q0BA 2DNUA 4JZ4A 2HAXA 3KHGA 1HK9A 4KPYA 3M32B 4Z89A 2P2CB 4FW1A 2KBTA 3Q2SC 1UTIA 2RHZA 3FUYA 5IHKA 1PKTA 2KVQG 4A4JA 3QNWB 3EM1A 4C92B 4DL4A 4OI1A 2J76E 3D0IE 2DVEA 4I56A 2KT3A 2Z2MA 4U96A 3CCQS 2IYGA 2W2MP 1DJ7B 3M53A 3JAMY 5B0CA 2MGZA 2P0PA 1RAEB 4QYRA 4O3PA 4M7DF 2DIGA 1ZUYA 2YDLA 2E3HA 4ID8A 4M78E 2RHSB 4P74A 3WHIA 3FSYA 1KRPA 4QIWD 3BBBA 2JVVA 4XTYA 1TV6A 1YZ7A 3LLRA 3DLBA 3CJKA 2NWMA 2VPWB 5C25A 4ZVSB 1B34A 1UDLA 1FEHA 2CP5A 2V2ZA 5IS2A 3GFZA 1VQKA 4OP0A 3W8PA 1YCYA 3MPVA 3IM8A 4IUUA 2QO3A 3UE2A 3SHWA 1Q8BA 4P7VA 2FRYA 3MEWA 2VOOA 3NGUA 2RB7A 2XMWA 2B51A 3LWHA 4K4SA 1QAIA 2LFVA 4M75B 2AEJA 1AD5A 4GMKA 2L41A 2E6ZA 3K57A 1RBAA 2B0GA 2ADBA 2JMAA 2OPRB 1HPZA 1B7TA 1YJ7A 2G2YA 3EGNA 1H2UX 3OXLA 1S6UA 3KJNB 2EYYA 3HRUA 5ETNA 2XY7A 2B8QA 4R0KA 4DCJB 2IRXA 1LW0A 1WHJA 4QR1A 1VQ4S 1G4CA 1IGQA 5FU6C 5F8GA 2MHEA 2XCPA 1LXNA 1XN9A 1SV5B 3A8KA 1HQ2A 3VAFA 4A8WA 1SC4B 4LF7F 3IA0A 4UOHA 2XZDB 1K9MU 1GQEA 4P5NA 3K8VA 4H4MA 2JEJA 1RT1A 2M88A 3J7AN 2DH8A 4Y2CA 2HQIA 1CEZA 4LF2A 4ZTJA 1VIEA 3CVKA 2E41A 5KFBA 1RCXB 2Y4XA 2NUUG 3CPFA 1YHQT 5E3AA 3QAUA 5F41A 4ZK7M 4ED8A 1WIEA 4DDFA 4LN2A 4LUEA 2B43A 2ZBQA 2ILYA 2M8DB 4OJ1A 4ZNXA 1HYSB 3KJVA 2RI3A 2C2DA 1S4FA 4KIAA 3PVQA 3LP1A 4ESRA 1ZUKA 1HLWA 1D1BA 1SIZA 3ASKA 2XHWA 5CR2A 1XERA 1GXIE 2V68A 2RPNA 1C1BA 3P8BB 3LW5C 4BI4A 1VRQC 4PK4A 1X4FA 3MDFA 2XYHB 5F8NA 4M7AB 1YJ9S 1OQ6A 1S4EA 4DBRA 1UVNA 3V8KA 3SQOP 2V1QA 3E01B 4YY3J 4HH0A 3LALA 1NU4A 4RG2A 1U06A 1VQ9T 4HKEA 4LRCA 2MQQA 2JJ4D 2O9SA 2DEJA 1RWKB 3RB4A 1KQSR 2DR5A 3ZFJA 1KVKA 2DCLA 3KFVA 5MLCV 3GR0A 2C3OA 5GJVB 1IXKA 3GIRA 2L5QA 4R0EA 4C6AA 2NYSA 4IUTA 1RT2A 2WVCA 4NA1A 1SC6A 4CLTA 1N34J 2OJ2A 2LXFA 2J0WA 1S1XB 5F9LA 3PJWA 4EWTA 3CWJA 5CZVA 1XNQJ 3CCVQ 4F67A 2OTJA 4U7CA 1S6OA 2IVFB 3UN5A 4PXEA 1BLUA 3GBQA 5JXSA 2AKWB 1U48A 4EZ9A 4M75C 4OB3B 2DHXA 2MKCA 2QA1A 2E5KA 1T05A 4FXWA 1BU1A 2XQCA 4F16A 4OYXA 3Q8QB 4YB7A 1NLPC 2Y90A 2ZHAA 1J5OA 2EW9A 4KFBA 2IY5B 4LQ3A 1SKWA 4C8MA 3G71A 4GBQA 2O4XA 1VQ5A 2IHR1 1F9EB 4Y91A 1YITS 1PSFA 4DHVA 3MM6B 1JLBA 1VQ5Q 4LF4J 1UEUA 2CS7A 1S1TB 2B4VA 4C8YA 4DBHA 4ES3A 2K8GA 4OZNA 1K0VA 1HHTP 2WOMA 1NK4A 3DMJB 2GHVC 1S0OA 3CXCR 1VQOS 3G6EQ 2CGHA 2E64A 2JVRA 2NXEA 3RW6A 3HRSA 2HBZB 3J81Y 2M0OA 2KHDA 4RWWA 4H4OB 5GMKl 4WXWA 5EX3A 4X4PA 1QP2A 1GXUA 3T5HA 3S6WA 3PNWC 1SJ4P 3FBFA 4ECTA 4RCCA 4C5HA 1SXLA 5DZ7A 3H4DA 3OTEA 2FPHX 2C1EB 1VUBA 2F4VJ 3TX0A 4DUTA 4F3OA 4F02A 1FFGB 3CC7T 2R8HA 2DVJA 1KWMA 4CH1A 3GTYX 4CIOA 3T1YJ 3ULHA 2YKPA 2A6OA 3INZA 3OYDA 1W2BR 3QHSA 1XNRF 1BQNA 4LIRA 3EH2A 2NYIA 1M3AA 3CMAT 2HBYB 5KG0A 2WSFE 4E7HA 2YKNA 3H40A 4KR0B 5AJ3F 4R25A 4DV0F 3HFNA 4BE2A 4J6YA 1WF2A 2FVCA 3N79A 3M4XA 5B0DA 1J27A 2HHHF 4UZCA 1BB9A 4L6V5 3OYIA 3OS2A 2UUCJ 2OH2A 3I5AA 4Q0BB 3HJFA 2E10A 5LJ5d 2MQNA 1LQ9A 1YHQA 1X01A 4OX6A 2KXHA 4N4GA 1QVFP 3TU4K 4A46A 5C0MA 3DRYA 3SEMA 3QT5A 3FBCA 2G0CA 3TA2A 3IBFB 2B4OA 4X9CA 4RKUC 3V8LA 4ZP9A 4IH7A 5GMKi 2PI4A 1B7YB 3IRXA 1UVLA 4E0DA 3F41A 1BBZA 3EG2A 4RKUE 1F2GA 3BGLA 5DDQC 1GK8A 4P9SA 1E6VB 2KU7A 2HK2A 2KFZA 2XSFA 3OYEA 3OV7A 2DZ9A 4H4KC 2YKQA 1VRTB 3JCMP 2MQOA 1WEZA 2MKSA 4KRWA 1X5OA 5DDRC 2BRKA 4ELTA 3VAMA 4C0ZA 5C25B 2X1GA 4PG6A 1ROFA 3IG1A 5B09A 4DSIA 1JKHB 2HEQA 2GX8A 3I4PA 4TLRA 1RI0A 2XBPA 3V7CA 4RBTA 3I0SB 3RGIA 1K9MR 4P6QA 2V63A 1S1NA 4PXCA 1S5ZA 3M8PB 3DFEA 3H9NA 5I22A 4DPTA 4FS2A 2J0XA 4LFCF 4CT9A 3O8WA 3G86A 1X6OA 5KCHA 2JOYA 2AKKA 1Q79A 1PYSB 2RT3A 1Q82T 1K9MC 2BKPA 2SRCA 5I3UB 1GX5A 2F4VF 4CDIA 1GEHA 3NCPA 2MZSA 1GH8A 4JUZA 2IIHA 3H5YA 2FVRA 4QPXA 1H38A 3QMQA 3PVXA 4KJIA 1KONA 4RMOA 5F8LA 2CQ0A 4LBIA 2RN8A 5GJWB 1JEGA 2G0JA 2Z4PA 4OMOA 1NSKL 3OXGA 5C24B 1MN9A 2MLZA 5K5MA 1U4BA 4FU6A 1JLEA 2HNZB 4PJOA 2PMZD 2KRMA 3SMZA 4Z8AA 1EJ7L 3HHLB 2D8HA 1PKSA 2CXEA 2HQDA 3N5BB 5D4NA 1PGZA 3J80E 2RH3A 3NEKA 1KHVA 2J9EA 3KJVB 2GVZB 3NG8A 4DR3J 4WE1B 1ACMB 3RB0A 1SC3B 2BA9A 1VBKA 2MOXA 2HWIA 2W7OA 3C6UA 2FY8A 2C2EA 2CKWA 1X9MA 1WTBA 2AEFA 1BC6A 2ZBIA 1M1KU 2EFGA 4NLGA 2E12A 3EPGA 2JLEA 3O3LA 4PUOB 5E41A 4L76A 3CC7Q 3G96A 1K76A 5IXBA 4F7UA 4ICLB 2F4FA 1YI2A 2KVIA 1HWIA 4C0HA 4BDYA 3M0UA 2D3UA 4XTUA 4ZP6A 2LCWA 3BREA 2WSEE 4DL0C 2QX0A 2UXCJ 2ZKTA 3KK3A 1R6YA 3KDNA 2QYCA 2C28A 3KUFA 5A8WB 3W3SA 3MECA 3CCLQ 4RNNA 3BGUA 2BIVA 4DL6A 4XPCA 4OLPA 2DGSA 4PJOG 5DLGA 2F5GA 3BSCA 4LRDA 2PVDB 4DG1A 1CJTB 2EKYA 5KE2A 2WK4A 4KHPF 5KYNA 4OHXA 2I5JA 1HQEA 5KYXA 3RTVA 3IM9A 1ZZFA 2DXEA 3BM7A 4DSKA 4CNYA 1I94F 4M7DC 3M4GA 2ZVSA 4OJHA 5RUBA 4JI7F 2FIUA 1YRXA 3Q8VA 4NLUA 2J6TA 1FRJA 2VUBA 2A2CA 4MIAA 4BACA 1C0UB 1J5OB 4PFPA 4LFAJ 4NA3A 1H72C 8RUCA 3HXMA 4J5YA 1FKPB 5I3PA 1H3DA 2FUG9 5I21A 2KFYA 2G2OA 5CYMA 4ELZC 4M7AF 1CJVA 2OJ3A 1RLCL 2XY6A 1JLBB 3KYLA 2HZCA 4F8RA 1JXLA 3R7NB 1ZPVA 3DRPA 3G6ET 5HVHA 1KD1C 2CJXB 2VXFA 3ZTSA 1WQWA 1Q81R 3UPFA 1DRZA 1V3ZA 1T9WA 4K4TA 3HHLC 4Y2MA 1N36F 1VQ8A 5DLFA 4DV1F 4O4GA 3TA1A 3KKFA 2H65B 3CJQA 1AZGB 3LO3A 1EIFA 3RKWA 1YNZA 2ZM6J 2RDIA 3VGSA 4F36A 1FESA 4BWMA 4LDWA 3NCRA 3LWMA 5HROB 2IBOA 2UVRA 1O8BA 4J7FA 4PPZA 3E19A 1ZSGA 5HY6A 2KXNB 3SXLA 1S0MA 3LW5E 2L9DA 4L72B 4LDVA 2EI5A 1JLCB 4DQRA 4MFBB 2HL3A 2XDDA 3L2UA 1P8GA 2HNYA 4Y2AA 2AYGA 2HQEA 3W9JA 2OD4A 1O6XA 2Y8YA 1GCQC 2LJ3A 2EPIA 2YSQA 3KXDA 3RIRA 1NCLA 1RAOA 2DO4A 2VHGA 1E7OA 5FRNA 1N0UA 1N6QB 2DD4A 3UQSA 3JSMA 1GMWA 2QTWA 1VQPA 4DFKA 3MKDA 4DCPB 4GC6A 1CBKA 3GNGA 1TXQA 4B3MF 1GRIA 3H0PA 3W62A 4ED4A 5B0EA 3RDVA 1VQLA 2HQCA 4NXMF 1Q8KA 1LWFB 4DV5F 4DV3J 4M5NA 3EHRA 3OW2R 4M77F 2LVWA 4WTOB 4ILLA 3M56A 1KEKA 2FHKA 1NJWA 2OSQA 4NCAA 2AYEA 1YN8A 5DDOC 4TKTA 4IIOA 4J9BA 2KNBB 3CCVS 4N76A 1FVSA 4OMFB 4Y2IA 1X5PA 1VRTA 3A8OB 2NUPA 4MJKA 1EAYC 5GAEU 1DTTB 2O67A 3IQLA 4C0GA 3M0QA 2ZH8A 1EIYB 3CW2C 1FI4A 2Y1LB 1X4DA 3HM9A 3TARA 1JJ2S 4LSLB 2VBYA 2K3YA 2RF2A 2OTJS 1YWOA 3FEXB 3C16A 2JVOA 4X4RA 4MYUA 4FNHA 5CKEA 3TEGA 5HP1B 2BABA 4IIMA 5KT6A 4DV7J 4MDWA 3HSBA 1VIOA 1TKZA 1A0NB 3W2WB 5B7WA 2DO3A 3G8QA 3NAHA 2IC3B 2CUDA 3L7UA 1U1OA 5GMKj 5HVFA 1UVIA 4PXBA 4AG1C 1FK9B 3WQPA 3CCMT 4ZP7A 4UUXA 4B3OB 4F0HA 3CCZA 2Q3PA 5DG8A 4RU2A 4D3GA 4WFBQ 2FYKA 2VF3A 2XY5A 2Q1LA 4QQDA 1B0TA 1WXBA 3U1LA 1B99A 3VQTA 3M2VA 3OQ5A 4PKDB 4KH0B 1SRMA 2L3RA 3R9LA 3OYBA 2OSRA 3GMGA 5KFFA 4OB1B 3T9NA 2KAFA 2HNZA 2C22A 2HWHA 2P9EA 5JUMA 4ZOSA 1AHJB 3HHLA 2CUBA 3VV2B 4DQPA 4OHVA 4U8VA 2E5JA 2QQAA 2XS2A 2UUWA 3CBOA 3DLHA 1SSFA 3BSNA 4DFPA 4G1PA 2QGGA 1RWPB 1TZ0A 4HDHA 4B08A 1HYOA 5A0LA 3CMEA 2K3KA 3JSCA 4FYWB 3MGJA 1VRUA 4AUKA 1X43A 1SEMA 5DM7Q 2KY9A 2GCXA 3H8ZA 4F7UB 2XU8A 1B70B 1UG1A 2N7YA 4J6WA 2PGCA 4RTTA 3D0HE 4CCHA 3OLBA 3IN5A 3VKIA 3EGUA 5HAOA 3L2QA 1FHTA 3ITHA 2EKHA 1REVA 2HZVA 2DIVA 4WF9Q 2D9PA 5EWEA 1LOJA 3E8OA 1T3LA 2OKQA 4IO9Q 3KK3B 5C7PA 3VZHA 3LH5A 2EPDA 2J7KA 2QA4G 3FZ2A 2QDYB 2MTLA 3N6LA 4LRAA 1VQLQ 2IG0A 1LCKA 1WJQA 4ZKAA 2RQMA 5G0RB 3JAME 5HO4A 3VAHA 2E5IA 4R56A 3ZZPA 2ROTA 4MYTA 5A2QY 1CJTA 2B9WA 2FJVA 2VG6B 4ELVA 2BM1A 2IVYA 1RUSA 3PO5A 1TSFA 4RW9B 2K79A 3BR9A 3WIUA 4A8QA 1JLGA 7AT1B 4ANJA 4RW8B 3JCMX 3SFGA 2MIOA 4CQ1A 4B3RJ 2V8VA 2DRBA 4OYAA 2XD0A 2HVDA 5D0EA 1SUQB 4YUDA 4PCQA 2ZH3A 2D1CA 3OVSA 4ED1A 1F9HA 4WKRA 4KULA 2DBBA 2ZVIA 3SCKE 3CJ2A 4LR8A 1YCSB 4G1QA 1FDNA 1Q5VA 2XTJP 1AFJA 4WK1A 2CP2A 2DR6A 3PYEA 4XPEA 3REBB 1FRKA 3M9QA 5HLFB 3VTIA 1ZAWA 2ZE2A 2ZH2A 1SRLA 5H9FK 1P9QC 1OO0B 5DY9A 2L3PA 3MAQA 1P1LA 4BI8B 3VCDA 3HHKA 1N33F 1VQ8Q 1RT6B 2W8LA 1FJGF 3L9ZA 3A8LB 2EC0A 2RMLA 1Q86C 1HNIB 1YJWQ 2AJ0A 3BV8A 2C06A 4C0DB 4FT4A 2ZH9A 1OYEA 2LXUA 5AE3A 4RUGA 1SPKA 3CCMQ 1IBMF 3PT9A 1VQ7T 2BANA 2FJEB 1I6JA 2F5KA 2RQ4A 1NH8A 4F04B 1M5SA 4MT1A 3NP5A 3FQKA 4QIVA 3RAMA 4NLXA 1KQSS 2YKOA 2JWNA 1AW0A 2YUQA 3P8DA 2FVQA 3VWSA 4RCBA 1XTDA 3K89A 1IZ6A 3QZ8A 2AEMA 2ZJQQ 1PNJA 4PWWA 2K7KA 5L8RC 1NB7A 2XLKA 4JPBW 3GR1A 2RU3A 1TOVA 2XLJA 5KFRA 5FLXY 3ETMA 1C0MA 4FBTA 1KFDA 2L3SA 4JI4J 3QRPA 2QXFA 3A1PA 4EO6A 4A8OA 3BDLA 3LGLA 1IN0A 1X5SA 1V5IB 4IOCQ 3T6BA 5GANd 2G0IA 2IRYA 4PWUA 1RB0A 3DLGA 3UVJA 1SSHA 5LJ3g 3HFKA 2QLBB 2MEWA 2DEUA 2FDNA 4N0AA 1TK8A 1VQMQ 4M8LA 3LF0A 1G7CB 1M8VA 3SSSA 1VQ7S 1NAQA 2HK3A 3CCTA 1NJZA 2E5LF 2JT4A 3MAHA 3WC0A 1Y0HA 4B02A 2PI5A 3B78A 3GP9A 1XMOJ 3O44A 4YB1P 3LGNA 2O01E 3OY9A 3CC2S 2J6KA 3RB6A 1HBMB 1TFWA 8ATCB 3M1VA 2OEMA 3KNGA 2C2KB 3P96A 2DBKA 1Q86R 1WKJA 4NLSA 3UD5A 4DEZA 3FRZA 5EHHA 3PRBA 1QLNA 4C8QE 1K1QA 1G6BA 1RYRA 2EJ9A 3MOZA 1MMLA 1SKSA 1AZSB 1T94A 2RHIA 1KK7A 2B3TB 1H7WA 2ED0A 3THPA 3C16B 2VFUA 4LUDA 1RABB 3QPHA 1X60A 4O3SA 4JRKA 4HACA 1Y9OA 1WXUA 3DDIA 3QRQA 1LWCA 4B9NA 2ZH4A 1KBRA 3FRNA 1YVFA 1HI8A 1PD0A 1VIXA 1MMAA 1OMSA 4WCEQ 1LFPA 3ZXWA 4JV0A 3G6VA 1ELOA 1WGSA 4A63B 4BE0A 1YJTA 1YI2T 4J9IA 1UCNA 1UPMB 3D4JA 1HBUA 2O9VA 2EBPA 2EBGA 1FYNA 1PYTA 5KFLA 4JRPA 3M9NB 5DZ6A 4NASA 1IKXA 4X4NA 2GJFA 4LFBJ 3QGGA 4LF8F 2AK5A 3FC3A 2RD5C 1VFJA 3MM7B 4N77A 1QVGA 3IRWP 4I6WA 3TEHB 3I32A 2ATCB 1D09B 1YJVA 1K1SA 5I3QA 4R5PB 3GF5A 1JJHA 2W9BA 4OJ3A 1UE9A 4QQGA 4DPXA 4AE5A 2ZPFB 4ZPCA 4B9UA 1C4AA 3IWXA 1NDLA 3ONQA 1CULA 5GAN3 1Q78A 3A3NB 2ZBCA 2LCLA 1IKWB 3I55A 2MPXC 4C8NA 3K0JA 4LFBF 4DX6A 1Y00A 1Y5NB 1FKOB 1B3TA 3A3PB 3D2WA 1HKAA 2WVEA 1BCMA 1NK7A 5D15A 5KFZA 2DIUA 1SIWB 1URNA 4JRIA 1JQGA 3BDEA 2XSJA 2HD0A 2PT0A 4Q43A 1SJFA 2BV3A 4RW4B 1K73C 1U2FA 2QE5A 3CTRA 3G4SA 5GAMh 1G3TA 2YLBA 3RJMB 1M5Q1 1REVB 4LXCA 2KEAA 2BJ1A 2R8IA 3RG6A 1Z1ZA 2V8HA 3JV3A 2JTMA 1VQ5T 3DDKA 4LMZA 1ZSZA 4M7AC 2KJVA 4K7QA 1HNWF 1JK9B 1O5JA 1U2RA 3EYZA 1X4EA 1S72A 1QCFA 1WLPB 2ZZDA 1S76D 1L5UA 4X2BA 4Z02A 1VDHA 1A9NB 1IM6A 1SHFA 1TL4A 2QQSA 1YITA 1NG2A 3MJXA 3D1HA 5K8NA 1SF9A 3O5TB 1YZ6A 2RK2A 2HKQB 4MIWA 3CCRT 8AT1B 1PC4A 3FC9A 4IRCA 3PY8A 3GSDA 3CCJS 4A4FA 3VZIA 4PJJA 5L9NA 3CCQQ 3DRSB 2PEBA 2UUAF 2LQ9A 2BACA 2Z30B 3VS3A 2CAJA 4HVZA 4B3SJ 1RHQB 4OZ3A 4G1QB 3U7JA 2HCKA 1KFZA 4RUAA 3R1LA 4AQYJ 1X75C 4A8SA 1ZUUA 4KGVB 4DQIA 2MYFA 2H4WB 3EVOA 2EGEA 3PVLA 4DXLA 3CMAQ 3PX0A 2DHHA 1DQAA 4B17A 4M5JA 2Y3YA 1PAEX 4M75A 4M5HA 3FBEA 2GGPB 4XTTA 2ED1A 4C92G 2OPRA 1FXLA 5FD1A 1RT6A 5I42B 2FL7A 1FJEB 4C8LA 2GCFA 5A8RA 1W7WA 4ITSA 2DETA 5EWFA 2HAFA 5BYQA 4PPDA 3A3OB 2KT8A 3UATA 3D0GE 5CH7B 3QWPA 1SL0A 1FD8A 3B54A 3T5LA 2DTIA 4MH8A 3D6FB 4KE5A 2AKLA 2KQWA 3RMQA 4JP8A 1IHVA 2BJ3A 1Q4RA 1EKRA 2COYA 3M9MB 1N9SA 2IPOB 2HPUA 2F1FA 2G1HA 4M5LA 3HL8A 2H3JA 1RT1B 2PIIA 3OR1B 2D7SA 3M54A 4MMKA 5GAOp 5HK0A 4BBYA 4ZP8A 1YGYA 3NKYA 2KYXA 2M9KA 1N4LA 1QY7A 2BVZA 4YB5A 5IAYA 3AA9A 5KG2A 4ZVQB 4URQU 3GNFB 2YKAA 5KFSA 5LJ3f 2NXCA 2F2VA 3EE3A 3ET6A 3TVKA 4LD6A 4UC4A 2NPIA 3K58A 2XS5A 5JMNA 1HYSA 2AJ4A 3GIBA 4F7UE 2QSFA 4DX8H 5CQXA 2OEKA 3KJQB 1T9YA 5D3GA 4K0KJ 1C1BB 1M1KC 2ECZA 3OD2A 4ZVFA 5IC4B 5KTQA 3FEOA 3QATA 2MY8A 3NOGA 3AD7C 3IR5B 1S99A 2YH1A 1Q16B 1RADB 1D0YA 4E7ZA 4X65F 3G6EA 4HLBA 4HCCA 4ZVUB 4MKBA 3OT9A 2KSSA 4HKQA 2DA9A 1HFEL 1OV3A 2B4UA 3AXMA 3PZPA 3NGTA 4C11A 2Z58B 4ELUA 2V2KA 3MEKA 1S6PA 3ZZUA 4KGKA 4CO2A 1VQOT 2XMMA 1KD1T 3DLKB 3JCMW 2MMYA 2ABYA 2RUGA 3KWMA 3SCJE 3CC4Q 3BF4A 3GG0A 3NL0A 5FRMA 2EFVA 5K9FA 5CXTA 4E7IA 1RT2B 1U25A 3GSIA 3OSVA 4Z7YA 3U1NA 1NEBA 5DQGA 1HHQA 1GFCA 1S1XA 1P1TA 3R7BB 4Q8FA 2XM3A 5EGYA 2DK2A 1IUJA 3IAS9 3O6QA 1EP4B 4WCIA 1UMJA 3AJDA 1PHTA 2IM2A 3HCXA 2Q66A 3G9CA 3POTA 1H92A 3GU0A 4HACB 5LOQA 4DR2F 4HL9A 3BZQA 1QVGP 2DT9A 1TUGB 3H5UA 1HSQA 2HHQA 1D8ZA 1RCOB 4I64A 1U45A 1N8RU 3TSWA 4KFBB 3MFIA 2YKMB 4RTVA 2R57A 2RJDA 3CCQA 2G6FX 3F0NA 4FF3A 3OYNA 3BKTA 4M77C 1HBUB 2ZWOA 3TQEA 3Q8SB 1SJQA 3B4DA 1QM9A 1D0EA 1Y57A 1S1TA 4RPFA 2RQTA 1FDAA 2Q6BA 4JI2F 3MCOA 4WJBA 4V2SA 2G1DA 3CPWS 4E98A 5G4DA 3CJSA 1HL6A 3J7ZT 4UW2A 2BW2A 1FJGJ 2CQ1A 5KAKA 1YIJA 2W9BB 2DGQA 3HPWA 1EFNA 5HCKA 2BRLA 1ITPA 3QZ7A 1W25A 4FSXA 2FVUA 3BR8A 3M0SA 4IOAQ 1RK8A 2MZ1A 4OHWA 1YTYA 2KHCA 1SJ3P 1WC6A 4G6VB 1MLAA 2EG1A 3FEYB 4FZVA 1JLAB 2VGNA 3LANA 3CC2Q 3RBBB 3I55S 2DXDA 2FLOA 1NSAA 2HLUA 2ZNZA 2BOAA 4HCKA 1T3OA 4RX6A 3OJSA 4U7UD 2YTCA 2ZH5A 1RAJA 2JTEA 2P0KA 4F4WA 2ADCA 1T8EA 2RRNA 1TFYA 4DEXA 5BJRA 4ELYC 1VBYA 1I3OB 5KFIA 1M1HA 2XSJB 3T19A 2MKJA 2GVDA 1C0TA 3EH1A 2ZPGB 3P8HA 4F2RA 5EWGA 6FDRA 1IGUA 2DL7A 3OS5A 3MI7X 3MMCB 2DRKA 1ULRA 4AYBD 5JJBA 3DGVA 4IG0B 1LXJA 3Q89A 4OZ0A 4U7UK 4ANEA 2E9RX 3DKDA 1ZBJA 3UPUA 1O9SA 1IBCB 5HN0A 4TQSA 1QVFR 3QZ5B 3RRGA 3JS9A 5A6PA 1OX9A 3QIPA 1RT4B 2FB0A 4R8UA 1JU5C 1RAHB 2YNGB 1KLNA 2DGUA 4ILMA 3VRYA 3C8YA 3L2VA 1NK5A 3JQJA 2CFXA 3BKUA 3KLHA 2VH7A 3TUJC 4C8QD 3CMAA 3J81E 4JI6F 3KDOA 2R58A 1Y0MA 2FZGB 4IURA 3EGVA 5CAIA 5KFTA 1CSJA 4J9DA 2HFUA 4CH0S 3QGHA 1K44A 3M8ZA 1YJ9Q 3GLXA 4PABA 1U02A 4BLGA 2C2NA 2CZ1B 2U2FA 5LJ5g 5LJ5f 2YWEA 3KLGB 5FLXU 1ZTTA 4IQXA 2CPIA 4FP9A 3EG3A 1NB2A 2LQKA 4C98A 3NNHA 1X2KA 1RA6A 2JH3A 3I0SA 2DVIA 4B9MA 2EW3A 2PNIA 2M7SA 3CD0A 3V6JA 2YXYA 1RT5B 1MW7A 3ZZRA 1WJSA 3OYFA 1KQSP 3LH0A 1KHCA 4RTZA 5GAHI 1RBLA 3IWLA 5LJ5Y 4M7DA 1IWGA 2YX1A 3URGA 5JVGQ 1KC8T 4RBUA 1HR0F 1S72Q 3D66A 2M0GB 3DN9A 2E7XA 3WC2A 3KUGA 2KFNA 1RWMB 2FVSA 4ZGEB 4USKA 1EHWA 4JI2J 1UJ5A 1JXOA 1XR6A 1X69A 4N4HA 3ZNJ1 2YQ1A 2YRCA 2RJFA 2R7XA 3ZC4A 4OMQA 2JFDA 3FSXA 3QT8A 2MGZB 4KC5A 2K3IA 4JBCA 5I2SA 4M5MA 2HMIA 1DARA 1YIJS 2W0ZA 3CNQP 4CO4A 3HHDA 2K6DA 3CMET 4LF9J 1U6FA 2QA4S 2DF6A 3FJ5A 3UR3C 1D1UA 4D3HA 3K17A 2CQIA 1CC8A 4C8OA 4WU2A 5CHCB 1RWVB 2C2ZB 3N5BA 5D0HA 4QWAA 2M70A 2UVVA 1N56A 4LREA 5HK4A 3EDQB 4OI4A 1N36J 2XEXA 4X4OA 1M1KR 1F5BA 3OTBA 3LYIA 1QD1A 3DOLB 3M0RA 2LJ0A 5U47A 1U26A 4DEYA 5KYWA 2SEMA 2XDPA 1ICEB 3CC2T 4P2XA 3UCUP 1Y3JA 1M90R 4M75F 4URGA 2CREA 4FIBA 2LT1A 4EK2A 1NM2A 2LVMA 4NE9C 1FX4A 2GBQA 3LP0B 2D0NA 3E3XA 4ICLA 3MMBA 1GCQA 1VLYA 1XNIA 3E9GA 3OYAA 4OI6A 4TU9A 1QCNA 4PXDA 1R3NA 1NK6A 3CPWR 2GNKA 3HVAA 4O4RA 1I07A 2HBRB 2QAZA 4DV3F 1WI7A 3M2RB 3VAJA 3QBYA 1Y7PA 2J9DE 2RMOA 4PWDA 3NCQA 2QA4A 4OYOA 4K11A 3C15A 1YI2S 5A76A 3MCAB 1K8AU 2AGQA 3ILIA 1JXMA 1GTEA 3THVA 5KFVA 1IQZA 5AT1B 1NJIR 2NXJA 4LBPA 2L9WA 3UN3A 4LR9A 3E2UA 1XWLA 3D6MB 2VGMA 1ZPWX 3G8SA 4ECVA 2DNNA 3K5MA 2W9CA 1Q81C 2FHJD 3C2PA 3DKMA 4OYWA 4LF6J 1R27B 4Q45A 4EMHA 4UY8T 2EFIA 3LAKA 3TW0A 4C0BA 1UJYA 1M2OA 2U1AA 4XU3A 3BH7B 4B9VA 3Q23A 2CUYA 4B3TJ 2UVUA 1NDPA 4QW2A 4RG8A 2MWOA 1FVQA 4A4EA 3TJ8A 5T14A 2QK0A 2VZ9A 3BDUA 1N32J 2RHXA 2M1HA 3CCEQ 4LSNA 2BQUA 3H59A 4M7DD 2EQIA 3N5FA 2CNLB 3VS6A 3R3TA 2CP6A 4U8YA 3PIOQ 1OEBA 4KRTA 2BZXA 2AYBA 4KAIA 4Q44A 3CCVT 1VQLT 3CPWP 2X9HA 5HVGA 3UFCX 1XBWA 1X27A 1DZ5A 2JS0A 1WDXA 2X7IA 2W2OP 3ISZA 2V67A 2VC8A 1OY9A 2GAGC 1RTHA 3NWRA 1Q7YT 3QO9B 2ILZA 1D0XA 3LWIA 3X24B 2WBMA 2AGPA 3L3CA 2B4PA 5K8OA 1ZH5A 2XGQA 2BJEA 4DR5J 3AOCA 2QL7B 1S9GA 2QTVA 3C3LA 2J0QD 2Y8WA 5CAAA 5GAN5 3CMEQ 1U0SA 5DQIA 3SYZA 3NS5A 1QVGS 2D3ZA 4ZLLA 2HHWA 2HQXA 4Y28E 3DM2A 2JNGA 2LT4A 3KFWX 4PJMA 3OBIA 4FL6A 4YTLA 5GAN6 4NMXA 4RW6A 1YHQS 4F17A 4IOBA 2WBRA 4P71A 1FDBA 1VHIA 4JLGA 3M8QB 1TELA 4CTAA 3MEEA 3RR6A 2I9SA 1TU0B 1TVRB 1X8DA 3FFIA 4R8UB 3JAMU 4WKYA 4FYDA 2YNHB 3DGPA 4X65J 3GB0A 4GVBB 1OYDA 3S3NA 2OTLT 1RWXB 3E51A 3EVWA 1X4BA 3EICA 5LJ3j 2VC0A 4PG8A 3JCMg 3BQ1A 1K47A 3A1YG 4FCYA 3ICLA 1K8AC 3OR2A 1IR1A 1FF2A 3PJXA 1WXTA 1RYSA 3I82A 2RVJA 4E7SA 1NPPA 4BY6C 1O0PA 2DO0A 4B9XA 4NCGA 4RW7B 3E1SA 2ALYB 2LDIA 2NUPB 4FPIA 2BE7D 2Z2ZA 1UW9A 2QL5B 4KHRA 2HQFA 1FRIA 4NEZA 3M6WA 1PSEA 3KLGA 2V94A 4X34A 3OFGA 4IRKA 5HK3A 1HNZJ 1L3TA 1O75A 1VISA 4DOWA 4LSLA 3CCSA 4Z7CA 3G4SS 3TAQA 4ZHRB 5D0GA 5GVQA 3NBPB 4ANDA 1WG1A 3C6TA 3OW2S 3GG1A 2DPIA 1RTJA 1WHYA 1LKZA 4HDGA 1JLQB 1HBNA 1TKZB 3PEJA 1P27B 1B4SA 2IC3A 1S1UA 4ZVRB 3M0PA 4CM0A 3ZZZA 4C5GA 1S57A 2H5JB 2R5AA 3RR8A 1FNXH 2HHUA 1F0XA 1FX2A 3IS9B 1CJKB 1N27A 1G2BA 4ZCMA 4J9QA 2JX2A 1BXNA 2CJAA 1SKRA 3QSYB 2ZKUA 4J7CA 4XTZA 4F26A 2AHOB 5B0FA 3MEDA 1XJWB 3MEGA 1VQ4Q 1OYXA 1UZDA 3M2VB 2E6NA 4ZPTR 4C97A 3D3BJ 1I1GA 1TL1B 4J9VA 5KCOA 3MR2A 1I94J 1MG7A 2A18A 5ETPA 3GYXB 4CYUA 3SWNC 2AZSA 1JKHA 2QEXA 3DRXA 4P10A 1U1QA 1IRXA 4ED3A 2IIMA 4PR6A 1WG5A 3M8PA 1S6QB 4G65A 4RUCA 4JJBA 2X1AA 5BYSA 5IT9E 4WYWA 2DNPA 4BB7A 1T03A 5E0OA 3H0HA 1QKWA 2KT1A 4GKJJ 5FLXE 3BFMA 2XYPB 3QT7A 1IBMJ 2P4TA 1NDCA 2VD3A 5IQ6A 3DLLA 1Y5LB 1YJWS 4QPTA 4KB7A 4ZVPB 3SDEA 3HJVA 2J7UA 2ZOFA 4WZQA 3Q8YA 1YJUA 4E7KA 2CQGA 3JQMA 3GIJA 2PMHA 2R9LA 2NUTB 3VS5A 1X5TA 4ZIVA 4ER8A 1YIJT 4DQ2A 2V1RA 4XO0A 1IR2A 2H48B 2PZ1A 5G0RA 1T11A 2MWPA 2C0IA 2Z57B 1SI9A 4PQAA 1PRLC 2GNCA 3ZFVA 4DUYJ 2JNJA 2LXIA 2GVZA 3HSDA 2JTFA 3L2ZA 3QQCD 1PSDA 4TVRA 3HULA 3D1OA 2VB6A 4OYBA 1SBRA 2FGOA 1SUQA 2JRSA 3OLAA 3NGDA 2RA2A 1IB8A 1GNKA 1AB8A 2M3DA 5GMEA 2QLWA 1KTQA 2LX7A 4PUOA 3W1YC 3MUMP 1T7PA 2VBZA 2AZ1A 1RE1B 2ACYA 4PYDA 3LGFA 4DUZF 2GW8A 3R6GB 3HHNB 4FN5A 4RL1A 3CJ3A 4QR0A 2CT3A 4P75A 3GJQB 4DX5A 4AG2C 4NXMJ 1U0HA 3GONA 4IG3B 3KXTA 3CCLT 2VASA 3G82B 2VONA 5LL6S 5GAMe 1NLKL 3CDAA 2QFJA 3PX6A 2RJCA 2OMLA 1S97A 1EB0A 4RZRA 1PILA 3IGNA 3M8YA 4L5GA 1U8WA 3VU3C 4OZ1A 5THWA 2B7BB 1FWLA 4F0KA 5A2QE 2EGCA 2J7WA 2KI2A 3I5BA 1ZBXA 1QWEA 4DG1B 1I51B 5L1JA 1S12A 4ANCA 3SWNA 1PO6A 2RU9A 2LJ1A 3M30B 3RBXA 2FD2A 2E1HA 1PIEA 2O01C 2AU0A 5FDLB 3WVDB 5CO7A 1MN7A 1G83A 1GXLA 3M55A 4PL6A 3FIFA 1PJ5A 1L3SA 4XAXB 3MP8A 4RO0A 3U27A 2CZ4A 1Q7YU 4ZLNA 1RBOB 1FWZA 2MQPA 4DSJA 1YI2Q 3AT1B 4OI2A 2LECA 3HZEA 4C9DA 1RA7A 5KT2A 3V6KA 5EC7A 1KQKA 2FJWA 1S9GB 1M5KC 2L0AA 1D3BB 3X26B 1WDDA 3QYHB 1Z9ZA 1BD6A 1FXXA 5CYMB 4EIKA 3TSZA 2R7UA 3AB2B 3PMTA 2M4MA 4L73A 3HP9A 2DITA 2NR0A 4JI0J 4XIUA 5KT7A 3MEUA 3PIOA 4P2FA 4IUVA 2C3UA 4OX7A 1OY8A 5D4PA 1WSRA 2E1PA 1WC4A 4DOZA 1N54B 3M59A 1IBKF 1T02A 3MHXA 2AQ4A 3ENAA 3CCEA 2LEBA 1R43A 1FTCA 1T9XA 1S7IA 2E4HA 3D1QA 1HI1A 5HQ8A 3ENQA 3J7YU 2LNHB 2K1RB 3CCRA 2WB4A 1YSJA 3RERA 2ZHBA 1VC6A 3MD1A 3VS0A 2GQIA 3PKYA 4JS4A 2J8SA 1IR0A 3ZZYA 1S1WA 3DOKB 9ATCB 2JLFA 2DHGA 4RNFA 4KBIA 2UXDJ 4EBEA 1KS2A 2RF0A 2DNYA 5BR8F 4RTYA 4NCGB 2CZ7B 4A8MP 5H9EK 3E2EA