2BE9B

Crystal structure of the ctp-liganded (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
148
Chain Sequence
b'MVSKIKNGTVIDHIPAGRAFAVLNVLGIKEGFRIALVINVDSKKMGKKDIVKIEDKEISDTEANLITLIAPTATINIVREYEVVKKTKLEVPKVVKGILKCPNPYCITSNDVEAIPTFKTLTEKPLKMRCEYCETIIDENEIMSQILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate carbamoyltransferase
publication title Crystal structure of Sulfolobus acidocaldarius aspartate carbamoyltransferase in complex with its allosteric activator CTP.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase
total genus 32
structure length 148
sequence length 150
ec nomenclature
pdb deposition date 2005-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
B PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 2be9B02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 2be9B01
1Q95G 2FZCB 8ATCB 3MPUB 1D09B 1PG5B 2BE7D 1TTHB 4KH0B 1SKUB 2YWWA 4AMCA 4F04B 1RAGB 4AT1B 3D7SB 4KH1B 2HSEB 1RAHB 1XJWB 1ACMB 1EZZB 2A0FB 1RABB 1NBEB 4FYYB 2QG9B 6AT1B 2IPOB 2QGFB 1RAFB 2AT1B 2FZKB 1ZA1B 8AT1B 2AIRB 4E2FB 1RADB 3AT1B 9ATCB 2BE9B 1R0CB 4KGVB 1ZA2B 2FZGB 2H3EB 4FYWB 1RAEB 4FYVB 1AT1B 1R0BG 4FYXB 1RAIB 1F1BB 4KGZB 4KGXB 1I5OB 4WTOB 1TUGB 5AT1B 7AT1B 1RACB 2ATCB 1RAAB 1TU0B
chains in the Genus database with same CATH superfamily
3EGXA 1QUVA 2I38A 3V6JA 1WNLA 2FUG9 3CMES 1IHVA 2OAWA 4OHXA 1YJ9S 4OZ2A 1TKTA 4ANCA 1HI8A 4NE9C 4ETZA 1VYTA 2G3RA 3RUXA 4ZP6A 4NLYA 1OV3A 4CLZA 1UG1A 3NFCA 1NSAA 1NHVA 5D8HB 2E7WA 4ER8A 2C22A 3ENWA 2GVZA 4L74A 1EX8A 2IVFB 5EDWA 1CJKA 3F0NA 2BKOA 4M94A 1JJ2P 4KGVB 1K8AC 2GO9A 2LMJA 1DTQB 1RWNB 3QZ8A 1UZDA 2R8IA 2W9CA 1WWHA 3Q8QB 1Q7YR 5KFPA 1VC0A 1WELA 4M77D 2XEXA 4I6AA 3HLUA 2SRCA 4K50A 1HW9A 2RF0A 4IRDA 1K1QA 2AJFE 3W2VA 4DL5A 2YKQA 4DFPA 2OTJS 2K4YA 3QAEA 1WG5A 2XK0A 2HMAA 2XULA 4OV1A 4CLYA 5FRMA 1OJ4A 1QSYA 4ZTFA 4DSIA 1I8FA 1AZGB 4AUKA 1FDNA 1YBUA 4CLKA 1DJ7B 4TKTA 3UWNA 2RHSB 3EJMA 3CCSQ 1RAFB 1R8AA 1ZBTA 2HHTA 3CCQQ 1FRHA 2A18A 2DNMA 3OYLA 3HSGA 1FCAA 3CCJQ 2VC8A 2DK3A 2HVIA 3CQTA 3D0HE 3NLCA 2YPYA 3BYPA 1L5UA 3U7JA 4U7CA 2HNDA 5M2UA 2ROGA 1U1LA 1CQMA 3ULHA 1ZAWA 2N7YA 2PMHA 3I82A 4CYUA 3F56A 1NYFA 3LALA 2AHOB 1JLQB 4NL5A 3PT9A 1LEOA 3JTNA 3U27A 3VS4A 3VAGA 1YZ7A 2ZZNA 3EXCX 1WOPA 5L1IA 3EG3A 2RI3A 4F36A 3PX6A 2R7VA 1R8BA 3NP5A 1ZPVA 4OZ1A 2YRCA 4MZTA 4RNHA 3M0TA 2M0OA 3JXOA 2D74B 2ZPIB 2YXYA 4ED1A 3BSNA 3VAIA 1BE4A 2BRKA 3TWZA 3BEGB 1NDLA 1GCQC 3LPYA 4EMKA 3PIPA 2V8VA 3S6WA 1H72C 4DL7A 3CJ4A 2DEUA 2XNQA 3N9UC 4B3TF 4LFAJ 3G71S 4YQWA 4AMCA 4OI2A 2FD2A 2AEFA 1ABOA 3TRGA 1VHFA 3EGVA 3L42A 2EGAA 3QO9A 1C0MA 2LEAA 3GPAA 5KAKA 2AJ0A 1IJFB 2KVQG 3QDFA 2D3ZA 1XC9A 2DHGA 3THVA 1OMSA 3G6EA 4NCGB 2Y8WA 3GQCA 1YKWA 1TOVA 2XLIA 1VQLQ 4LF9F 1Y10A 2XGQA 2RH3A 1APSA 3CCET 2W4CA 4ZPWR 1NRKA 1PD0A 4J7IA 2AMCB 5DM7Q 4TLQA 2F8HA 2W9AA 4QW2A 4YUDA 3IS9A 4P72A 4WJBA 3J7AN 3H90A 1DLOB 1U5SA 4FP9A 3DYAA 3W5ZA 4QOTA 2YT6A 4LE9A 1TU0B 1M90U 4YB7A 3CC7T 2EFOA 4F4XA 5D4LA 4UY85 4RTWA 2MHEA 2CIMA 3J7YI 2DE0X 4Q7AA 1HWKA 1C1BA 1WC5A 5M2RA 3OYJA 4JPBW 3QFHA 4M7AF 4C8QF 1KC8C 3IG1B 3R6LB 3HP9A 4LF5F 4R5PB 1FA0A 4CC7A 1VQ4A 4DL2A 3UWTA 1YITT 4X1VA 1R43A 4ILMA 5IT9E 4ZPDA 4UF4A 3DLKB 1QVFP 2DR8A 1SUQA 4B3MJ 3KJFB 4QIWD 1DBDA 1S79A 3TVYA 4QYZJ 2RKIB 4PPDA 1UGQB 4J9QA 1P9YA 4W92B 3N0VA 3KJQB 2RA2A 2CH4W 2CH4A 1IUJA 3MEAA 3HD2A 3R7SB 4ITSA 2AHJB 5ETOA 5KT2A 2AGOA 2XG8D 3R5GA 2D7SA 3OR1A 3NBPB 2MXYA 5T14A 1VIEA 4MZPA 3RW7A 1DQAA 3BV8A 4KT0E 3WZ0A 3SV4A 3CCMA 4JS5A 2AK5A 1Q8IA 4M5KA 3VS6A 3TVKA 1GFCA 2JEGA 3DOMB 1RYSA 1SIZA 3Q23A 1ACMB 5J1EA 5HLFA 1SIWB 2D3UA 2XMVA 1M8VA 4ECXA 4J9RA 2ABLA 4RW7B 2HEKA 3UR3C 1N32F 2KXNB 3B78A 4WZQA 3OSSC 3CCVS 2C1EB 1JJHA 1XK8A 3VALA 5GAOp 4DBQA 1T3SA 2V8GA 2JVOA 2Q6CA 5I22A 1Y71A 3CMEQ 3RRKA 5GMKh 4J6XA 1X6BA 4WP8A 2EFNA 4NLOA 2L41A 4IH5A 2DVEA 3QBCA 3DCAA 2BMBA 1VRTB 4B17A 4RG2A 2ZH2A 5GAOm 1P1LA 2PNIA 4NXMF 2QI2A 3KG0A 1PKTA 1K8AU 3AODA 2EW9A 1YI2Q 1TL3B 4CLWA 4WKRA 1BQNA 2L5QA 2L89A 1Q81C 1YWXA 4LRDA 2CQ1A 2PA8D 5LJ5h 1F1BB 5GAMj 2W24A 1FFWB 4HCZA 3CJQA 2LCSA 1N48A 3RBBB 1QVGS 2VGNA 2F8MA 4JLIA 4NLXA 1Z2ZA 3VAJA 2OTJQ 3JRZA 1SKSA 3LGHA 1R77A 2EGEA 2M1HA 3V81A 1IQZA 3DRSB 2KXDA 5F9NA 3I56S 5A6PA 3MUTP 2A2CA 2OTLA 1KLMB 2HKNA 3C6TB 1LFPA 1RTHA 3GWCA 3EG9A 3MHYA 4TYBA 1JJ2A 4KKOA 3DLHA 3KFVA 2IYGA 3TVTA 2C3OA 1G1XA 4XU0A 3M8ZA 4USKA 3VQTA 4F0HA 4Z2XA 5A8WB 3PR4A 2HSPA 2BKPA 4JJNK 4BS2A 1TP7A 4OI1A 3POTB 1AHJB 5E0OA 1MMNA 4ZLNA 2VBZA 1SJQA 2XC9A 1M1HA 2E64A 1SL2A 4U7UK 1VQNS 4BCAA 3U23A 2QV6A 4OHWA 2J0XA 1TR0A 2CPHA 2R9LA 2QQAA 4W90B 2FYXA 3C16B 4D8DA 1N5QA 4GRSA 3FRYA 5C25B 3FSIA 2VXEA 5HCKA 2RHIA 4KH0B 2I1RA 3N6MA 1S9FA 2DILA 3PVXA 4XTTA 3MUMP 2LQ9A 4QW9A 5CQXA 1TKXB 3X28B 3ZZUA 2WVBA 2XI3A 4F0KA 4MYUA 2WSEE 4P10A 2ACMA 1G3TA 2PTKA 1TVRB 4M78C 1DLOA 2VFUA 1W26A 3CJ0A 3CDEA 1QUPA 2OFGX 2XI2A 5D6XA 5FU7C 2DH7A 3MD1A 4OYPA 1K9MC 3MMAB 4IR9A 5A2QU 2OPPA 2A2DA 2RRNA 4DBHA 2HIQA 5GAHU 1U6FA 1T95A 3IG1A 1VQ9T 1ZM3A 1SPBP 2FHJA 2AIRB 3BREA 3G82B 3JSRA 3P4UB 4J90A 3RBEA 1C4CA 4PUOB 1VYAA 1SHFA 2DH8A 5DZ7A 1S4EA 3BM7A 3DLKA 1U8SA 2ZH3A 4QQ6A 9RUBA 3AD7C 4DN0A 3HVWA 1Y4ZB 2DGSA 3LP0B 1YGYA 4J9CA 1WQWA 4LIWA 3RBDA 1W4SA 1FMWA 3LWLA 1Q95G 1KEKA 2MPUA 3NBPA 1O6XA 4DV1F 3PFEA 3TUZC 4AQYF 3CWJA 5KFOA 2LA4A 1VC5A 3BR9A 4UQTA 5HK4A 1KOHA 1H0HB 2LQKA 2G9OA 2NLUA 1CVJA 3HI9A 3E01A 3DOMA 4WKYA 1WC3A 4YP3A 3CMAS 3EVMA 4WCIA 5IH2A 4QQDA 1Z2LA 2EVRA 1CJUB 5GAN7 3V6DB 1HI1A 1KC8U 1VQ5S 3IWLA 1IBKF 2W8KA 2Z56B 1XOVA 5HI7A 1G7CB 5I3UB 4M75C 1VQKQ 4ZP7A 2OIHA 4DBRA 1N88A 4ZGEB 3PNWC 2EGCA 5KYYA 2B3TB 2DY1A 1YCYA 2GNCA 2QEXQ 2L3PA 1FDBA 4PJMA 1KP6A 3A1YG 2NUTA 3HHDA 2K2MA 1VYUA 5EUHA 2M3DA 1S57A 4F0MA 1T94A 4RW8A 1ZYQA 1HL6A 4CTAB 5A0GA 5D0EA 2DR6A 4QVCA 4I2QB 2JS0A 1N8RT 4ZIVA 2HLUA 1FESA 4DEYA 2RJFA 1M5VC 3SWNC 1JWWA 2M0GB 3A8LB 2CNLB 4RNFA 1M1KC 2QX0A 2VPXB 5KFRA 1NZ8A 3EDQB 1QVFA 2RK1A 1YTYA 2DO0A 1TL3A 3NGUA 3PYFA 2MF2A 4N4GA 5IQQA 2XHCA 3GSDA 1LNQA 1TAQA 1HPZA 5K9FA 3M9MB 3VYHB 4Y2MA 2QFJA 2RUGA 2VODA 4DCJB 4HCBA 4LDXA 2IVWA 4URQU 4O3PA 3TUIC 3W61A 2K5LA 1LCKA 3B8HA 2D41A 1UVNA 3W63A 3WX4A 4B9MA 4OFZA 3DRSA 1XERA 4J9VA 1KLMA 4XQ3A 2XY7A 4WE1B 1N0UA 2AEJA 2DNUA 2QE5A 1Y5IB 2JDJA 3W8PA 1M5PC 4OZ3A 5KFMA 2LQ8A 4DV2F 3JS9A 2CP0A 3HRTA 2XLJA 3JCMg 1NK4A 3FB9A 3H6ZA 5A8WA 2MZJA 5E3RA 1LWFA 2WK4A 3CW2C 3S3NA 4A8YA 3AQOA 2KNBB 3V4MA 2N3LA 1VQOQ 2ILYA 3OUYB 1NXIA 4E8UA 1Q81U 2NYSA 4OGEA 2DEIA 1WSVA 2EQJA 4DUYJ 3A1PA 3QSYB 4PJNA 2BJ3A 4LSLB 1KFSA 4IR1A 1BHNA 4LRCA 4P74A 4A4JA 2H8HA 4YTLA 2RF2A 4ZITA 1G3OA 4RNMA 1YSJA 4QVDA 1RWXB 4IFYB 3G4SQ 3C14B 3VGVA 3W9JA 2V69A 1P92A 5LL6d 1HQUB 3TQ1A 1URNA 1JXOA 2DBKA 3PTWA 2NZ4A 3AOCA 1VQ6A 2O9VA 1RUWA 2P0QA 2CZVC 1T0JA 3LWMA 3CPWP 1XNRJ 3MEVA 4FS1A 1TVRA 1WGSA 1C0UB 4TY9A 4ZVTB 2CPDA 2YX4A 3O3LA 3MM5A 1RHJB 5EWFA 2YKOA 5KG5A 2HWHA 1K44A 3OSVA 2O1PA 2VFVA 1IRXA 1YBTA 2L3MA 1S72A 1HBNB 2FO0A 1BXNA 2HHQA 1RHMB 2CRLA 1C1CA 3BJYA 1URRA 2KRSA 5K5MA 4KO0B 2GJFA 1U26A 3HK2A 3H0HA 1DY3A 3L95X 2MK5A 3FNNA 2L0AA 3MTKA 3CD6A 5LMUF 3T1AA 3HHLB 3MFIA 4JV5J 4H4KA 3K5OA 4X65F 3G82A 3WVDB 1VQNQ 2MLYA 4ETXA 4DSKA 4PUOA 4LF8F 4ICLA 4F26A 5DG7A 3EH2A 1WJSA 2L48A 1CS4A 2ZH8A 2C0OA 5LJ5d 4PJOF 1F3VA 2MKIA 2OPRA 3RDVA 2FTRA 1CSKA 1JXLA 2KY9A 1M3CA 4O5VA 2VL1A 1NKEA 2K2PA 4OYAA 3LAKA 4G1QB 2UV8G 2GHWA 2UUBJ 4J9LA 2JT4A 4J9FA 4A8XA 2ZGWA 5LJ3Y 1X75C 2ROPA 1TUCA 4FCYA 4MKYA 2AQ4A 5AXNA 3CCRQ 1WJ9A 4QCLA 3HJFA 2R2RA 4JV0A 4VUBA 1X31C 5ETTA 5ETKA 1OSDA 4DR5F 5IOLA 5ADZA 4C0OC 3ZZZA 1VQ8Q 1YJNQ 3GFYA 4A8MP 3BN4A 4KGXB 4YHHJ 4I67A 2WW4A 3V6DA 4MFBB 2HAXA 1QVFR 4PCQA 1JLCA 5A2QY 4EMKC 3UA6A 3FQLA 8RUCA 5E41A 1MGQA 3C66A 3J80U 4OB0B 1N5ZA 2ZZTA 2H3JA 3I5SA 3EGUA 5KYUB 4F7UF 4OYOA 1SSHA 1UA1A 2C2NA 3NGRA 4GLKA 2C2ZB 3UDEA 2DNGA 1G5VA 1QKWA 4O3OA 3I31A 4LFCF 1OS5A 1HMVA 5IZHA 1V5VA 2YTCA 3FUYA 1TUGB 2WVCA 3UO0A 1NJIR 4LDUA 2A1BA 3K7RA 1TSFA 3FBCA 3MXHP 2FVCA 3BF4A 3E3XA 1CKAA 4YN3B 3EGWB 3KLFB 4E47A 3TJ8A 3PXGa 2B6AB 5HAOA 1L3VA 3ZXWA 4ZCIA 3M05A 1UPMB 4CM0A 5AT1B 1NH7A 2CP5A 3GBQA 4B3TJ 2QA2A 4NWBA 2GGRA 2VG6A 3DKMA 3LWIA 1Z4UA 2MWPA 2Y0BB 1QWEA 4PNOA 2Y1JA 4GVBB 2CS7A 2OMLA 5HVHA 1H74A 2Z2LA 3CC4A 4WBFA 1S1XB 5GAN2 1VQYA 4OZ5A 4F50A 3MM8A 1FK9A 4QR1A 5E5NA 1WEZA 5IXUA 3FCWA 2HBPA 3PR5B 1YHQT 5HMXA 1RI7A 2MSTA 2A36A 1WFWA 5F3ZA 5DLFA 4IO1A 2MKKA 1VQMA 1KVJA 1T9UA 1FTRA 3D6HB 1SJFA 1IREB 1LW0B 3G6ES 4MK8A 1H8KA 2BA9A 1V76A 1M1KU 4CWBA 2EW3A 1K0SA 4B3RJ 4DV6F 4OB1B 3OTCA 2Z2ZA 3DRRB 4ECVA 5CKHA 3OUYA 2YUPA 4QR2A 2HURA 1OPIA 2DJWA 1W6XA 1RA6A 3OXLA 3I4PA 2WW8A 1AB8A 3HL8A 2XZWA 1WOOA 2AF6A 1FJEB 3QMQA 4UY8T 1TL7A 3H8YA 4M5NA 1ARKA 3C14A 2PC6A 3JCMe 3W5YA 4FSSA 2UVUA 1X2QA 1JXMA 1VDHA 1JLFB 1REVA 3SIPB 2JMCA 2CPXA 2DD5A 2X4JA 3HKSA 5GAN3 3M4XA 1M5KC 1C0UA 4HHJA 5CKFA 3K17A 4DV7J 2FVRA 4QU6A 4F4YA 1DRZA 1KD1C 1Y96A 1GFWB 1VQ4S 1RTDB 1QVPA 3CDBA 1WX6A 4Y0FA 4F17A 4KO0A 1D1CA 3P8HA 2GJIA 4E7LA 5E3AA 3N5BA 4XK8E 3M6VA 4J9GA 1SXLA 1FJCA 3M6XA 5D4PA 3HHLA 1R7IA 2GW8A 2OH2A 1N5SA 1VS3A 3D67A 2WONA 1NM7A 5HANA 4O3SA 5A0YA 4OI3A 2ASLA 4ZS6A 4ED0A 4MK9A 2QQRA 3M1VB 3CCMS 1HBMA 2J76E 2YQ3A 5KYXB 1R6VA 1S6PA 3MAQA 4Q5WA 1T9VA 2DGUA 1FXRA 5GANg 4LSNB 4M77F 2I5JB 2Q79A 4ZCLA 2MIOA 3E19A 4D6WA 1HXDA 3BQ1A 3H8ZA 4DR6J 4G65A 1W1FA 5HO4A 2XMFA 2DXBA 2M51A 1RT7B 4HTJA 4IURA 2VH7A 4IG3B 4J6YA 4DLEA 1VQPQ 4LD6A 1PYOB 4D3GA 1GTEA 3PEJA 1SC1B 1XMOJ 3IN5A 3ZC4A 1JKHA 4HT7A 2YWGA 2ENMA 3LQVA 3PW4A 3SFMA 2YQ1A 4A4KA 3D0GE 4RTZA 5FWBA 1VLYA 2ZITA 5L9NA 2RS8A 2DR5A 3M30A 4KHRA 5FIIA 4HVZA 4NXMJ 3LUYA 1LPLA 4ZLJA 2RH2A 3M58A 3IRWP 1UECA 3CPWA 1N5TA 3R1LA 1HNWF 1XN9A 2O67A 1VYVA 3CC2T 1BGXT 4A8WA 3T1YJ 4MZMA 5KYUA 1F3FA 2ZBQA 2R7UA 3D1HA 4AFZC 3C3LA 1R8OB 4XAXB 2QK0A 1GK8A 2WSFE 1HW8A 1QAYA 2JVVA 3IM8A 3NPFA 3FLGA 3VUBA 4J6WA 1Q86R 3O1LA 4O3QA 3RYLA 1LVKA 4B3OA 4LSZB 4RCBA 1H641 1SQFA 2W01A 3VVUA 5F8MA 4C92B 3OYCA 3SCLE 2GTJA 5DRKA 1Q8KA 4M5LA 4NI2A 3SQGB 3TZYA 4OI4A 3MR6A 2B9EA 2IC3A 1NK9A 3BKFA 3VGTA 2B6AA 2WZ1A 4DV4F 1UVIA 4CC3A 2OTLS 4MAKA 3GOXA 3MAAB 1JJ2S 1F2HA 4DQ2A 2HFUA 4PKCC 4PJOA 4GVBA 3M8QB 3VU3C 2RHYA 4NCAA 1S1UA 4L6V3 1UFFA 1FI4A 2GQQA 3A98A 2YKNA 2PMWA 1SPKA 1Q4RA 4LBHA 2XS5A 2IA0A 3QUIA 1JB0E 1UJ4A 3HF5A 2FDNA 1AZSB 4Q0BB 3J80Y 2EJFA 5J1PA 1U2RA 3AFGA 2Y4YA 3GR0A 2QA4Q 3CDUA 3I0RA 2ZDOA 2MHNA 1EKRA 1PBAA 4N76A 1M5SA 5JMNA 2PN6A 2B9WA 4UUWA 3EFSA 2FHDA 2B4PA 2YHTA 1X60A 3QT8A 2K8GA 3SCKE 2C2MB 2VKRA 3FBFA 1WJRA 1SJ3P 1IR1A 1OQ3A 2DCLA 2IIMA 4S0MA 1FEHA 4LR7A 3I32A 2GTOA 2RHUA 2B5JA 2AWZA 4DQPA 2VQFJ 3QAUA 2B8QA 1VOMA 2KYMA 2E5HA 2PGCA 4GO5X 3QGPA 1VK3A 1L3KA 2HGLA 2XY5A 1XBWA 2GGPB 1RWOB 3CCEA 4F16A 2BR0A 1WLPB 2Q6BA 2F4VJ 3DHXA 4ZVPB 2HG4A 2FJEB 2W4PA 5GAN6 3DN9A 3JB9k 5ETMA 1EETB 3IR5B 5ETNA 1QLYA 2M4MA 3TW0A 2UVRA 1NAQA 2VZ9A 3AJ2A 2KE9A 1IXKA 5GAOl 1O75A 1SC3B 2ED1A 1S6QB 3CC7A 1CULA 2AT1B 2X3DA 1ZS6A 4M7DA 2PA3A 3UNYA 1XTDA 3BH7B 1D0YA 7AT1B 2C2KB 1ZLMA 2APOA 4NLVA 1OZ3A 1MG7A 1LV5A 1I5LA 3QJPA 4P71A 1TFWA 1UB4A 4K4YA 3CCST 2CNKB 4M4ZA 1HWUA 3CCQT 1G8XA 1YITA 2RDDA 1IR0A 3CCJT 1LFWA 3GLJA 4Q8EA 3DLGB 3WIUA 1O9SA 3T5LA 2ZH5A 2RJDA 5BR8F 4YB1P 4M7AB 3NNHA 4PG7A 1KTVA 3R5JB 5BYSA 5FU6B 5HJXA 4C5GA 2HL3A 2JRSA 3FMWA 4KFBB 2QLXA 2QA4G 5KYXA 2H48B 3ZL7C 4ZGDB 2I5JA 3GB0A 1IGQA 2E1HA 4LRAA 1ZH5A 2W2OP 2C0TA 1SI9A 3PX4A 4I69A 4OZJA 5I3PA 4ALZA 2M8DB 5E3QA 2MQMA 2HBYB 4C48A 1U0HB 4ZJQA 2UUCJ 1N5YA 2DVJA 2EYZA 5ETVA 6FDRA 1T05B 2ACYA 4U96A 4DOVA 4TNOA 5GAEI 1S0VA 3CIMA 4WPAA 1QSLA 1HHQA 4K2JA 2PI5A 4PLIA 1LWEA 3AQPA 4WF9Q 2N3OA 5GANe 1C0TB 3LP2A 5A8RA 3W9IA 3V8KA 3RRHA 3ETMA 5GANd 5KTQA 3CULA 4LF4F 2CPIA 3M0PA 5JVGQ 3DI6B 2AYMA 3CBOA 3H9NA 4RR5A 4DWIA 2DNKA 4Y34A 4CCHA 3GZ7A 5IHNA 4B9UA 2ZWOA 1D0ZA 4P7TA 1QVFS 1SF9A 4RNOA 1M0SA 2K1RB 1ZTTA 4FF1A 3T5JA 1N9SA 2JX2A 1KK7A 3E9GA 5I11A 3JSCA 4C92A 3W2WB 4RG8A 4JI6J 3EYZA 3NMAA 5IQ6A 4RTXA 4X62J 3EX7B 2YY3A 1KHWA 4C5IA 2KZZA 1JLGA 3PRDA 2XSJB 2QIFA 4EO8A 4J9UE 3KOAA 4MK7A 1GXUA 2B9XA 3B4MA 4LF7J 2Y90A 1FRMA 5DDPC 2JVRA 4LUBA 1IZ6A 5GAGI 1D1UA 3W1YC 2KHDA 2RJZA 2NXEA 1AUSL 5KFEA 4AL7A 1RT5A 2AX0A 3M8YA 1AYEA 3VKIA 1UWBB 4Q0BA 1IKYB 3AY0A 5K14B 4DX8H 3J7A1 3MR7A 4H4KC 3AD9C 1P27B 3OYYA 4NLDA 4RW4B 5CAAA 4NLGA 1E6GA 2H4WB 1AA1B 4P9SA 1AZEA 1WEXA 4A54A 4TY8A 1ZQ1A 3PO4A 4B3SF 3CXCP 2RHXA 4CO0A 3SD4A 3MP1A 1LXNA 2CKWA 3NNCA 3CCUQ 4BDZA 1FXDA 4V19X 3P49B 3Q2SC 2E1MC 3M0UA 2JC1A 5IV4A 2M5YA 1GXLA 1VQ6S 4BI8B 2Z0GA 1SRLA 1JNZB 2E6NA 4M1KA 2CSQA 1CJTB 2EI5A 3MOZA 3GIKA 2E41A 1E6VB 4PQUA 5AE1A 4EUVA 5JVHQ 5KOXA 2FPDA 1PWTA 2Q1LA 4KPCA 3BQ0A 2JEFA 1WHWA 3GG1A 4X65J 5F8NA 1NEGA 3FBBA 4J9MA 1UEKA 2D3OR 1NLPC 2W2MP 2OKQA 4Y28E 3JB9H 1UJ5A 1U1TA 2DYIA 3S6EA 2FHJD 3CE8A 2NUPB 3CD6S 4OJGA 5HP1B 1S9GB 2RILA 2AU0A 2HVEA 2LCCA 2CJXB 1QD1A 2V4QA 2DMOA 3MPYA 5LXYA 5F8GA 4M7AE 2DTOA 3WDOA 5CKEA 4BDYA 2ZHAA 4NA1A 3DNCA 4X84A 2H5EA 2R7QA 4RKUC 5KFTA 2ZZDA 1VQ9A 1F5AA 3AH6A 1IKWB 1HLWA 2FPEA 3HRUA 3BO2A 1LW2B 1JMTA 2DEJA 3KKFA 3DM2B 2JOQA 3RKYA 2DR7A 2UXBF 3LOUA 4JDSA 4CLFA 3QHSA 3LWHA 3OBIA 1EIFA 3K8VA 4JI7J 1T8EA 2R57A 3OJSA 1N36J 1WHHA 3D6TB 5K20B 1YI2T 4ZK7M 4QWBA 2HZYA 3I9QA 3SSQA 2MYSA 3CCLQ 1KTQA 4CO1A 3DLMA 4PRFA 2DGQA 5A0DA 2OEMA 4HDHA 3KDOA 1FKPB 3JCMW 1KFZA 5EX3A 1J27A 1T02A 4J9DA 3I9ZA 2IM0A 1WXBA 2POKA 4MMOA 4IQXA 3KWMA 2MQQA 1BBZA 4I2PA 1Y7XA 3CBMA 4ED2A 2W25A 4FSXA 3ZZRA 1BC6A 4JI3F 1VQ7Q 3LGFA 1TK5A 1T05A 2DNYA 4LFCJ 2FG0A 1B3TA 3PYDA 5C0MA 3TSZA 3HT0A 2MY7A 2UXDF 1YN8A 4WFNQ 5D6WA 3G1JA 2O4XB 2LXIA 4CM2A 2Y1LB 1C0TA 2BANB 3IAM9 3A8HB 3VV0A 4X4QA 1NKBA 2A3JA 5F8HA 3D5MA 3RGIA 3TQEA 3HZEA 1FRLA 1RT2B 2QO3A 1LNXA 4M5DA 3PW7A 3DI6A 1Q82T 2HW3A 3GTYX 1TAUA 3PO5A 1AFJA 4BWMA 4N8OA 3VYGA 4ANEA 2MI6A 3EGNA 3RAXA 3QLHB 4IUPA 2RI2A 2NXUA 1JLEB 2XGPA 1XJWB 1SSFA 4Y3CA 2A6OA 2X9HA 5GMKi 2EQIA 3MMJA 2XMJA 4F2SA 3Q8PB 1PC5A 3W2WA 3R3TA 2HHVA 2XG8A 3EM1A 2KT3A 3QKJA 1I6JA 1FRJA 3OYFA 3CC4S 1GTHA 1RCOB 4XTXA 1XTZA 1KHCA 2WTFA 3UPUA 2V2QA 3RR8A 1D8YA 1V29B 3DOLB 1KD1T 3JCMX 1JO8A 4XO0A 1YP5A 1FMVA 3U1NA 2QMXA 1TV6A 2GC8A 4XIUA 3ER0A 4C8YA 4FT4A 1VQMS 1OPLA 5D7UA 4ZN3A 2ZC3A 3M9OB 5H9EJ 3I6PA 4CRIA 4FN5A 2RO0A 1KN6A 3GIBA 1UWBA 2LXFA 3R7BB 2W9BA 1U2CA 3HHLC 1DZ5A 2K5FA 3WXMB 1NJZA 4USUA 2AYGA 1UHFA 1F9FA 5T7LB 3IO1A 2QMUB 3NWGA 4K5SA 2X35A 3J7AF 4OMLA 1UEVA 2GQVA 3H2VE 3QWUA 1M5HA 3OLBA 2ADBA 3OS5A 5HATA 1BK2A 3Q8VA 2Y4XA 3OA6A 3SDZA 3EWGA 4DEZA 3L2ZA 1HQEB 2PUKB 2DRBA 3M7VA 4QJVA 3JCMQ 5D0GA 1GNKA 2CT3A 2EQUA 5M2PA 1B0TA 2ZAEA 5IM0B 4C0ZA 2GO8A 5F41A 2EBGA 2AZ3A 3KXDA 1Y9OA 2VDIA 4UW2A 4FBTA 5BYRA 1IBMF 3FSXA 3MPVA 1U4BA 4FXWA 1U06A 1TTHB 3BGLA 4TN2A 2RQTA 1AWOA 1X5TA 3DLEA 1E6VA 2BM0A 3JYTB 1B7TA 1V3SA 1PIEA 2E9RX 2ZNYA 2X4YA 3DOKB 4BLGA 3PMIA 4CI0B 2F3JA 1WDTA 4O3RA 1PYSB 1JLAB 2QQSA 2YNIB 2Z4PA 4OGCA 5HROB 1NUEA 3HSZA 3KYLA 4IOBA 4OJ3A 2WVDA 4FVCA 4BY6C 2W8LA 1S6UA 1BI0A 2PE8A 3LH5A 4KULA 5EX0A 3KLGB 1VQKT 5HP1A 2O3DA 2KL8A 2DNNA 2H51B 4KUDK 3VWSA 4X4OA 2W4DA 2QEXT 4AE5A 3NS6A 2MGZB 3US5A 5LJ5Y 4P7VA 1RCXB 1UFWA 3HVTB 5L38A 2LJ0A 2YBVA 3T19A 2QYZA 1LW2A 3BN7A 2VJUA 4M78F 3OYGA 1VUBA 3DGVA 3BSAA 2G0CA 4DSEA 2K6DA 1N6QB 4XU1A 2WVEA 8ATCB 1MMAA 4LRBA 1WF0A 2MKHA 1M90R 3MI7X 4QIEA 1LWCA 4NYPA 2M88A 4NLQA 4ZMMA 5T41A 3QRPA 4Y00A 3NXZA 2E66A 4CC4B 1IBLJ 2J5AA 2MKYA 4EBCA 4M7AG 4C8QG 5A76A 1LXJA 1YJUA 2DCUB 3CXCA 4ECYA 2QASA 4KGKA 3WX8A 5DLOA 1A0OB 2KT8A 3M2RB 3P8BB 4V1Ak 1S72Q 3MCSA 4RUGA 3A4TA 5K8NA 3LGMA 2J6KA 1YRXA 3U02A 1K0XA 3C8YA 3VAHA 2J6TA 1YWOA 3G86A 4K59A 5FD1A 4DS4A 5U47A 3CPWS 2CNNB 4YS2A 2DXFA 2HFNA 2IRXA 2IM2A 2MKSA 4DR3J 2EG1A 3CD6Q 1GX5A 4II1A 1UGRB 4ANDA 4UOCA 4J8OA 1DFDA 1GCQA 3QRRA 3HSBA 1UWAA 2JEJA 2BJ7A 2GHVC 4ZPCA 2AX1A 3TO8A 4I6WA 4RBTA 5DJBA 1D3BB 3UDCA 3VCDA 3OBWA 1R0BG 5LJ3g 3A13A 3A8GB 4BWJA 3UDVA 4AL6A 1K9AA 3ITHA 2WSCE 3QO3A 1RT2A 3IP0A 2VF3A 4R8UB 2CZ6B 2VXFA 4H4MB 2ZPEB 4KTQA 4WXOA 1VQOT 3QJLA 4GKKF 1SL1A 1WOSA 3K58A 3DKDA 3ONQA 3CIZA 2QLBB 4YY3J 1JLEA 1Y7PA 1S97A 2J7IA 2J9EA 1U6BA 2F69A 3ZNJ1 4M75F 3V7RA 2ZNZA 2K3KA 3MDFA 2DERA 4I64A 3OW2P 3G4ST 4Z7YA 2AYBA 4NXNJ 3MECB 2LCLA 5DZ6A 1SH0A 2V9WA 1WSRA 3UN5A 3GONA 3QPIA 1QMCA 1WI6A 2BM1A 3AOAA 4Q5VA 2H54B 1J5EJ 3J81E 5I2SA 2HAIA 5KFGA 3ENVA 2DIGA 3A8MB 2F65A 2VWFA 3HM9A 3VS1A 3PEHA 4CLTA 1DHMA 1ZM2A 1FF2A 1SKUB 1K8AR 2R42A 3CMQA 1R8HA 5CVIA 5GAMh 2YKMA 2QGGA 3QBYA 4U6PA 4EPCA 3EG2A 1IVZA 2ABYA 4CH0S 4PFOA 1YHQA 2HLTA 4OB2B 2MPXC 3JTOA 4PXBA 4JYAJ 1MHNA 1EP4B 5T7LA 3BGRB 3DHWC 3T6JA 2VKNA 2M0YA 3D54A 4DMZA 4JI4F 1FRIA 1VBXA 1WG1A 4P6QA 2GJ2A 1QE1B 1FJGJ 2J8AA 5B0EA 2HYIB 1HQEA 3GJTB 4OX6A 1X4EA 3CCES 1PAEX 4OHZA 5KFAA 1NDCA 2ZVSA 5GADI 4F8RA 4IKFA 5LMNF 2YKAA 1PM3A 1Y3KA 4HACA 2GCFA 3ULRB 3NS7B 3EVOA 3IAS9 1JU5C 3CCRT 4L75A 1I94J 4OMPA 2E5LF 1X6GA 3DXSX 3DOKA 3CC7S 2KG1A 1VQ8T 2GCXA 4JRKA 1YJNT 1K73T 5AJ3F 4PAAA 3CO9A 1JLAA 3HTRA 2BKDN 1OPZA 4OX9F 4M95A 4HTIA 1BMQB 4KHPJ 4Q2LA 3EZUA 3IGVA 1B3QA 1D0XA 1W2BP 4FM4B 2HHHJ 1WHGA 1MV0B 3HHLD 2BIVA 1YITS 5J2NA 1EZZB 1W70A 3NG8A 1PC0A 2LDMA 4PXDA 4UOGA 2V68A 3S3OA 3NGDA 1FEEA 3C95A 1Y0MA 1FT8A 5CZVA 2KVIA 2EYXA 3HVTA 5HMZA 3HXMA 4IH7A 1KDNA 5AXMA 3BB5A 3TA2A 2OLWA 1SH2A 4C92C 2RU9A 1V1CA 4HR2A 3CT9A 3FVYA 2B4OA 3OR2A 5HY6A 4BC9A 4Q44A 1UZHA 3HFZB 2KXFA 5L1JA 2P0PA 1FYNA 1REGX 1S9EB 1WI7A 2OFHX 5KFKA 5GMEA 3M32B 3L09A 1MWZA 2XS2A 4XTWA 4B9NA 4B9SA 2HFOA 2OGUA 4RU2A 4B08A 2EC2A 1VCTA 1S99A 2LA6A 2OSRA 3CD5A 1J5OB 2ZD1B 1JLBB 3LH2S 3EXYA 3I4HX 2JM9A 3X26B 4X4NA 4Y6IA 4UOFA 4PABA 2E9TA 2GFFA 4DUZJ 4DBFA 2R2UA 3HPWA 1TKZA 2MKJA 3ILOA 4C98A 1B34B 4MMKA 1PJ7A 2UUWA 4PFPA 4BE1A 5LJ5j 1V9OA 2KYBA 3MOJB 3JV3A 5E3CA 1I0CA 2X1GA 3V4IB 4USJC 4EMGA 5CIUA 1Q7YT 4F7UE 3CC2A 3KUHA 2XMUA 3E51A 4Q45A 2HFZA 1HNIB 4KV8A 4R8UA 3FZ2A 3H59A 4U9RA 4DI6A 3QYYA 4I4BA 2CJYB 1BCMA 4C11B 2HQXA 1UVKA 4USTA 2G6FX 1KC8R 1VISA 3EGDB 4DV3F 5KFNA 4F3MA 4PPZA 4GY5A 3UCUP 3OL7A 5KFUA 3L1AA 1R8PA 3R97A 3I0SB 3RERA 1RU1A 3MEUA 4EWTA 1YQHA 2LYVA 3KG4A 3T1HF 3MM6B 3IBFB 1KR4A 3SEMA 5LJ3e 1VJWA 4QZVB 1ZPWX 2XKOC 2CPYA 4O4GB 3M0SA 1RAEB 3D68A 2ZPBB 3OMGA 1MN7A 4OZLA 5DQIA 4HVWA 2E7XA 2RB7A 1S1WB 5A0LA 2RQVA 4DR4F 2K3IA 4J9HA 5KG7A 2R2SA 2XY6A 2L9NA 2OSQA 2IPOB 2LCWA 4JI1F 2BTTA 1WUUA 1UJ6A 2CP7A 3O5TB 5KYWB 4IRKA 5A6WA 4ZVOB 1P1TA 4DL4A 1Y5NB 3FFIB 1QVGR 4IKAA 3DB3A 1MWQA 2XNRA 1XQIA 1YDLA 2WHOA 2BKNA 1HIYA 3FDSA 2CZ7B 3DGPB 1NCLA 1N0VC 2XQCA 2K7AA 5ETRA 2LVMA 1QE1A 5J2PB 3NL0A 2DRDA 1RHUB 1KRPA 4ECQA 3T6BA 2DHXA 3KLHB 2IG0A 5D0HA 4MJKA 3RJMB 1RHRB 2KU7A 4E7ZA 3GYNA 3Q89A 3NAIA 1U1PA 3NHNA 1NYGA 5HQMA 4OP0A 4BDPA 2ZE2B 2JTEA 5HSPA 1X27A 1L3UA 1VQPT 2AD9A 3FDRA 4AG2C 1ELOA 3OW2A 2NWMA 5KFVA 1Q81R 2UXBJ 1K76A 1RKJA 3VQSA 3J7YU 2F9JA 1RBOB 1M3AA 4DLGA 4QVZA 4W98A 3ILLA 4B02A 2HMIB 1VQ9S 5IV3A 3PHEA 5DDOC 1KHIA 2KRBA 2FL7A 5CHCB 3Q1JA 2NLWA 3MEDB 4DUTA 2DGVA 3TR5A 1W2IA 2VD3A 2DHAA 3CJ5A 3JTPA 2L3QA 2RN8A 2NXCA 1NLKL 2HFSA 1OU8A 3CCSA 4ZA1A 1RBAA 2MEWA 3A8IA 5KFSA 1N8RC 2IVMA 5J39A 1GMVA 3CCQA 2BBEA 3KTQA 4DX6A 1QP3A 3OYBA 5J2QB 3ILJA 3CCJA 5KFWA 1NK7A 1O5JA 2UU9F 3M9QA 4PFZA 3D1OA 3I5AA 4RUHA 2GBQA 2WOMB 1XR7A 4CLLA 4M77E 2PQWA 1H3HA 3OYNA 1A0NB 4K4UA 3MR5A 4GBQA 2PDAA 1J3TA 2KEAA 2D9OA 1S9EA 4Y65A 2HBWA 1S0OA 4QR0A 1FD2A 3BBBA 2ZBRA 4KRWA 3VS5A 3LW5E 3VS2A 2C3UA 2VONA 2XHWA 2MKCA 1F6TA 5GAMd 2EFPA 1WIEA 4DSJA 3AHUA 2CJBA 1J5OA 5D3GB 1C4AA 4PJOG 1R8CA 2ZD1A 4CP5A 2P5VA 3FMBA 2GQIA 1RK8A 2ZHOA 1T3NA 4HCKA 2J0SD 1YITQ 3R2DJ 2K5IA 3CDAA 2CDQA 3BO3A 1LOUA 2V8PA 3QZ9B 3E2EA 2JJ4D 3DU5A 1ZZFA 2QDLA 1NK0A 4C0BA 5HBMA 4HKEA 3H42A 4EBEA 2IA6A 3EFRA 2OEJA 2F2XA 2P6SA 3UCGA 2ZBIA 2QA4T 3UE2A 3H5SA 3OTBA 1K9MR 4RBUA 1W2BA 3M6UA 3PIOQ 4HVUA 1VRUB 3M8PA 2HFVA 5KFLA 1OY8A 4C92D 3HFOA 3OVAA 1X7VA 2HHSA 1YJWQ 2NUHA 2CG4A 3UVJA 1NDKA 1MWYA 1YFNA 2QL7B 1OSCA 3GNFB 4C4WA 4QWEA 5ECAA 1FTCA 1RXOB 2IJRA 3ISZA 2AGPA 2NSBA 2Z8QA 2I0NA 4F7UG 2HL5C 3M5AA 4HL9A 2ZC4A 2Y1IA 2DXUA 3PVLA 1FE0A 3D2WA 3WC0A 1H73A 2AJ2A 1M5OC 4X9DA 2CAJA 4O4GA 2PI4A 3JSBA 2HQHA 1XIQA 4IDKA 2XYPB 4DG1A 1S1WA 2QQ9A 4DHVA 3W5XA 2VA3A 1KVIA 4DSLA 1WKLA 3C6UA 1FHTA 1UVJA 4DDFA 2HVDA 1AD5A 1H3ZA 5E3PA 4E98A 2V4RA 3ASKA 5F8IA 2DXTA 3AJ1A 4ID8A 3GMGA 1VFJA 2QLFB 3WIVA 2JM8A 1WPYA 3CJKB 1M27C 5KYWA 3W62A 4CLUA 4M7DG 3HJVA 2M70A 2DTHA 4N5SA 4OI0A 3HZGA 3M2VA 1IBMJ 4NLTA 5B09A 4UQGA 5GAOq 4LFBJ 1OZ2A 2QXFA 2OO4A 1AVZC 3M54A 4JUVA 1WEYA 2HNZB 2RD5C 2UUAF 1WHYA 2BOAA 4M8LA 2FLLA 4ZDNA 1I81A 1QCNA 1G6BA 1UVLA 2FY1A 4FYXB 3R5CA 1XNQF 3BKUA 1QY7A 3CJ8A 5J2PA 3PJXA 5CQYA 2DNZA 3KUGA 5FLXU 1RSCA 1EHWA 4FDFA 4KH1B 2MMPA 1Z9ZA 3GYXB 2DX1A 4NLWA 4CT8A 1M5Q1 1WHJA 1OYXA 2OPQA 1M1GA 4LF6J 4AYBD 4EU0A 2QA1A 3OFEA 3SDEA 4ZHRA 2B51A 3PW5A 4KBIA 2CADA 2ZE2A 4E7IA 1CJVB 4C8LA 2LKZA 1M1KR 2EBEA 4ZN1A 1RA7A 1NKCA 2J9DE 5FDLB 2KR3A 2VG5B 1B64A 2J6FA 4FW2A 4J5YA 4UOHA 4UC4A 3GYGA 4A8FA 1UGPB 2LEPA 3VJPA 1M1FA 3MURP 6FD1A 2KBTA 1H92A 3ZFVA 2KHCA 4IG0B 1ABQA 2HMIA 3SMZA 2IY5B 2R7RA 1EB0A 2G13A 3R6GB 4DFJA 3MEGB 2J9CA 3ETOA 2HQ3A 2J0QD 2DGXA 4MH8A 5GAN5 4M7AD 2XZTB 1I3OB 2MY8A 1HBUB 1Q16B 4Q43A 6AT1B 2FZKB 2FGCA 2I0XA 4NLPA 2BW2A 3CXCS 3THKA 2K7KA 2UXCF 5L1LA 5J2QA 1BLUA 4KR0B 5C24B 3W9HA 1TUVA 3R6NA 1YIJQ 1HD0A 2R8GA 4P2MA 5KFQA 2WOMA 3I9V9 3AAWB 1RAGB 3H98A 1RT1B 4AXJA 1OI1A 1VIXA 3MM9A 3A8JA 1YI2A 1EQMA 1X4GA 2XU8A 1RAJA 4N77A 1UW4A 1SL0A 3JAMU 2V8HA 2HGNA 4I7FB 3IWNC 3KJVB 1NLOC 2DL4A 2X4WA 5KT7A 1NB2A 4YR3A 3TUPA 2VUBA 5ETQA 2E1CA 5D3GA 1WYXA 2QSWA 1S7IA 9ATCB 1F5CA 4OVAA 3A8EA 3KLEB 2E1AA 3NGKA 1VQ9Q 4JRPA 2IMWP 4M77G 4PL6A 4EMDA 1X4HA 1LK7A 3KK1A 4C3KA 1CBKA 1N8RU 1NPPA 3OTOJ 1T9XA 4YDDB 1FE4A 2ZPGB 2ZOFA 5CCAA 1ZTWA 1OULA 1Y11A 3PZPA 2QLWA 3AA9A 1MW7A 4N4HA 2P8IA 2XDDA 3R7NB 2RAQA 2V63A 1FX2A 4QWAA 4OB3B 4XU2A 1UAWA 2HKQB 3PHTA 5B0GA 2E9ZA 2VC1A 1OYEA 3CCUT 3NMRA 4DFMA 4UZBA 1TXQA 3NY0A 4J9OA 1SQGA 3FQKA 1RI9A 4BBYA 3IBCB 3KK3B 3OBYA 4FF3A 2NR0A 4PKDB 1S1VB 5DY9A 1DTQA 5KG0A 3IRXB 4CH7A 2AKWB 1Y5LB 2P6TA 2DD4A 1TFYA 3V8LA 5EG2A 4CI0C 4KGZB 3SCJE 5GANj 1QCFA 4NEZA 2BQ3A 4USHA 3J81j 2MQ8A 3BS9A 4LBPA 1V5IB 4DPWA 4JI4J 2VC0A 4ATOA 3TI0A 2LQBA 2KH9A 2Y8YA 3CEDA 5HKCA 1YHQS 5C42B 3DLLQ 1PRMC 1RWUA 5J3BA 4JI8J 4NLSA 3TX8A 1CPZA 3R27A 4C9DA 3FEZA 2DNOA 1RLQC 1ZSZB 1OOTA 2Y1RI 4EYIB 1NK8A 5K8MA 1YJ9Q 3L2VA 2Q66A 1NNDA 2DZ9A 2ZKTA 4WP3A 3F70A 2GIRA 2DIVA 3FSYA 4L6V5 5A8KB 4E7SA 1T3LA 4C0HA 2HNZA 2VPYB 1WXUA 3ADAC 3OYKA 2JFKA 4ZJLA 2XMWA 4ZVHA 2W1BA 2FY8A 2RMLA 1WC4A 2BV3A 4LFAF 1KQKA 4B9XA 2DTIA 1H3DA 1JLQA 2VBYA 2NREA 3P96A 2KTQA 5H1SV 5H9FJ 3RTVA 3JCMV 4AFSC 3CCLT 1PCXA 5I42B 4HXJA 5IC6B 5G0RB 4JI0J 1U3OA 5A2QE 4OF1A 2G2ZA 3ZEHA 4JV2A 3ZZPA 1UEBA 1WORA 2CXEA 2BE2B 1QWFA 1YBYA 1N34J 1VQ7T 2GV1A 2PMZD 2RVJA 1S1TB 1X0FA 1S4FA 2PD1A 2VIHA 3JB9F 2HQFA 1S0NA 1X6OA 1S1NA 2XCAA 2XMAA 3NWRA 1UL3A 4IG0A 1Y3JA 1VQKA 2CJKA 1JXVA 4IOAQ 3MEGA 2MB0B 3KFWX 3Q8SB 1IKVB 3A3OB 2JTMA 3HFNA 1UVMA 2HVZA 2QEXA 1FJ7A 2E29A 3ZTPA 2ZBPA 3K5NA 1UMJA 1MU2B 3KXTA 2RJCA 1CC7A 4NCGA 3SYZA 4X64J 5IWAJ 3AB2B 4OMQA 4EZ6A 3I96A 1YRUA 2JUFA 2XLKA 1RGVA 2HS4A 1HARA 4L59A 1T9WA 4JI5J 4B3MF 1WC0A 3DDIA 4PWUA 1DURA 2XZDB 4HI1A 4M78B 5D78A 4QYZK 5LJ5g 4LNPA 5CH7B 2DB1A 4RW9B 3H41A 2G1HA 4M5GA 4I7FA 1PNJA 2YNFB 4FNIA 4L3KA 1KKHA 4BE0A 3KJVA 3ME9A 1SC4B 2HGMA 1ITPA 5KFYA 5I4MA 1U48A 2FZCB 3MGJA 2G4BA 4JJCA 3AB4B 3G71Q 5D6YA 3KLEA 4ZPAA 2DITA 3CC2S 3ICLA 1RKIA 4K0KJ 4R5PA 4HKQA 1TG0A 1XMBA 5CYQB 1HFEL 2ROLA 1X8DA 3MEEB 2AW0A 4KAIA 2XWXA 1Z9QA 2BUNA 4I6YA 3TAMB 2RKIA 2YLCA 1KD1R 3JQMA 3X24B 4PQAA 4E2FB 2F5TX 2UV8A 3VV2B 2PFDA 4OYIA 4DV5J 1VQOA 4USVA 2CUYA 2B0GA 2VOPA 2KK4A 5C7PA 2COWA 2CJAA 4ELYC 5BJRA 2P9EA 2VA2A 2G0IA 2M52A 2LRQA 2G2OA 2Z57B 4QKUA 4CH1A 3CJSA 2MLZA 2FC8A 3D6MB 3BYRA 3CBPA 1MMLA 4IFVB 1E6HA 2E1PA 5HK3A 2FEIA 3G4SA 1RB0A 2IMOA 3M56A 2EFVA 3JAMY 1NJIT 2GVDB 4RW7A 4EK2A 4M75B 1YG0A 4ZP9A 2VQEJ 2J7UA 2XM3A 4M5MA 3P6YC 3TQ7P 3GR1A 5C42A 4USMA 4DZDA 2RU3A 2CQ4A 1BQMB 5D6GA 5KFXA 3GCXP 1B70B 4FBUA 1RLPC 1PC4A 1AW0A 1JJ2R 3EG0A 1AEYA 3KG1A 3QDRB 1BWVA 3UD5A 2J7WA 4A4FA 3SWNB 1VRTA 2BDPA 4DV0J 2BABA 2CT4A 1SHGA 2X4XA 2W7AA 5A8KA 2BOPA 1OQ6A 5IAYA 3JSMB 2KB2A 4FKYA 1UPPA 4GC7A 4UT4A 2HDAA 3TCJA 3HP6A 2DO4A 2VG7B 5J1NA 1G3YA 4DPYA 5HMYA 2RJEA 4RZRA 5I42A 3OW2S 5CA5A 1HNXJ 1S72T 5LSRA 2BVZA 4OIXA 3B54A 2WVFA 4AL5A 2DL8A 2RNAA 3CCRA 4G1IA 2D3O1 2MQNA 4WF2A 3CCVQ 5HJYA 3C6TA 4TVRA 4A4HA 2IJNA 1BU1A 1BI1A 1I1JA 1VQSA 2Z30B 1VQ8A 1YJNA 3CD6T 2Z2MA 2KI7A 4H4OB 3LW5C 1FRXA 2ZZMA 1VLOA 2O66A 2P9CA 3FC9A 5KOWA 4DR2J 5K8PA 1M2VB 2FRWA 4YFUA 1CEZA 3EGXB 3LLRA 3M55A 3CCSS 2L9DA 1R3NA 4LT6A 3RKWA 5E7OB 3CCQS 3POTA 1S77D 2E5QA 4G6VB 2R58A 2B7BB 2RRAA 5AYFA 3Q2TC 1ZSGA 4I0WA 3CCJS 1IKVA 4JUZA 1U1MA 3VVTA 2YWWA 1MU2A 1NDPA 2DRKA 3LGLA 2CYZB 1WHLA 3C16A 4M78E 4IOCQ 4X66J 2GVZB 1WHMA 5C25A 4P2FA 3V6KA 5JJBA 2LVWA 2F8EX 4NEYA 1YX2A 3TJ9A 1U1QA 1CQNA 3OQ2A 1U25A 4K5RA 1EQ0A 4P73A 4KY3A 2OI2A 1TKXA 3FKBA 3TAQA 2KAFA 4LVNP 2W9CB 1TK0A 3HHTB 2XMMA 1XMQJ 5CYJA 1X4CA 2R3VA 3Q8RB 3W2VB 3I56Q 3QSIA 3FK4A 2HCKA 4RW9A 3MMAA 1WDXA 2VJVA 2EFQA 3J80E 1G3SA 2D8HA 4C0FA 5MAOA 2BZXA 2A7YA 5GMKe 5ETSA 2H9ZA 5EN1A 3TYTA 4IIMA 3W65A 1FXLA 1V3RA 5IXFA 2FJBB 4B9LA 1ZUKA 2UVWA 1LJOA 3C4SA 3NS5A 3DLBA 2EJGA 1D09B 1W2BS 1D9DA 5KFIA 3JQJA 1TL4A 4MIAA 3MEEA 4KHMA 1CC8A 3G96A 4PEOA 3NTIA 3QIIA 2LQNA 5LJ5e 2D6FA 1H38A 3HRSA 1QDUB 4F4WA 1OX9A 1NSPA 2HNDB 4WIIA 4PYDA 3T9NA 2YUQA 1S10A 2RM4A 3JQKA 3H2LA 3LP0A 3CJ3A 1H7WA 4CYUB 3GF5A 4C2MA 3MWBA 2X1BA 4HT8A 4V19J 1XQHA 2N82B 3HSDA 4OJ1A 2CQBA 3M8SA 2NUZA 1WJQA 1NJWA 2CP3A 3M57A 4IQMA 2BJ8A 3URGA 1K9MU 4M75E 3OYMA 4J7FA 3M9NB 5F3TA 2FRYA 4DL3A 3K8WA 4L3NA 4WCEQ 2EEYA 4HT9A 4WFAQ 4FF4A 3E8OA 2V50A 2V8JA 1A6LA 3SBMA 1CJUA 1Q86T 1U49A 3RKXA 4F2RA 3KLIB 4QQGA 5I3UA 3PKYA 2YSQA 2HRYA 4EMKB 3PNIA 1GMUA 2DJZA 3QIDA 1XEZA 1KJWA 2H3EB 2FB0A 1HHTP 3CDWA 2XMTA 1H6KX 4XTUA 2RT3A 1BQMA 3VZIA 4L5GA 5DLGA 4Z88A 3QO9B 3IA0A 1HA1A 1FWPA 3PCOB 4CTAA 2XIDA 2CQGA 5IN1A 1RTIB 4I2QA 3EICA 5DO2A 3OYIA 3TANA 3RAMA 2CYYA 4DX7A 4DPOA 4LUEA 2DR9A 2CA9A 2AZSA 1UP1A 4BHQA 3BDPA 2VBWA 2ZBCA 5HL7Q 4TQSA 4XAKA 3BBFA 4ZVSB 5CAIA 1CKBA 5E2QA 1B99A 2MQOA 2WB1D 1TH7A 3HMJG 4DOWA 4M5JA 2RIJA 4A8SA 1RWPB 3O2IA 4M7DF 1C1AA 3TARA 5DGBA 4DU7A 3CMAQ 2VG7A 1KONA 1H2TZ 2OUGA 3H5XA 2PVOB 1WF1A 1IJEB 4RBVA 1VQ5Q 4K4TA 2LNVA 2M2BA 4PLLA 4QT7A 2OD6A 4WXWA 5D4NA 5HVGA 4DUYF 2M7SA 1RI0A 4L72B 2PZ1A 1X4FA 4BC7A 4G3IA 3KLVA 2J6SA 2D9PA 2DL7A 2ZJRQ 3CJRA 1VQPA 4IUQA 1O51A 4WE1A 2BE7D 2C2OB 2P4TA 4LF9J 3FRZA 1X69A 2V8KA 3D9BA 4DR7F 4I1TA 4F02A 5FW9A 1TQLA 4OZ0A 3KUFA 2F2WA 1B0VA 2VDHA 2KRMA 1NU4A 3META 2VPWB 4NA2A 1XNRF 4YOEA 1I51B 5IT4A 1M2VA 3PTAA 1S6OA 4CC2A 4X4SA 1SUQB 1DAXA 3PDNA 3RNJA 3KHRA 3G6XA 2RI5A 2HSEB 2MYFA 1UJYA 3H0IA 3M0RA 3QGHA 2ED0A 3FZBA 2E3HA 1MNDA 1WNEA 4ED4A 1Q82C 2YXLA 2A28A 2B43A 4P52A 3OR1B 4LSLA 3REBB 2RMOA 3DRPB 1YI2S 1AFIA 2L3RA 3KHGA 4CLPA 2XSFA 4XTVA 4IFYA 4JV5F 2V6AA 4LF5J 1HQUA 3HHNB 2IIHA 3PG9A 5HQLA 3BDUA 2D0NA 4WYLA 5J1EB 5LM7E 5HLFB 4AFUC 2JN0A 1ZOTA 3ZTQA 1RHKB 3PW0A 1DQ9A 3C0CA 3HX9A 4KT0C 4K11A 3JCMJ 2FJXA 3LH0A 1Y07A 4M78G 2EYQA 5GAEU 2CQIA 2UUBF 3VAFA 1HBNA 3NOGA 3C15B 4J9PA 4X4UA 2OAUA 2CP2A 4RLEA 5F0UA 4DCOB 1OX8A 2OI3A 4C92F 1VIOA 1QQJA 2E7VA 4N47A 2ZDPA 2DKOB 3FJ5A 2KFZA 1QTMA 1RISA 2EKNA 3B4DA 3T5HA 1M9SA 2XBPA 2MOXA 2C2EA 3AOBA 3OD2A 2FVPA 4LF1A 1N56A 4YHHF 3KHLA 4ZCMA 2HQDA 3HT3A 4YEAA 1JXEA 2QA4A 3DLJA 2DIQA 4ED6A 3L2WA 4OHYA 4ZPBA 4A4EA 5BXIA 1BQNB 1N32J 3FRNA 3NOCA 1SC6A 3D3BJ 2EK1A 4RUBA 4G1QA 2GA7A 4PJJA 2AEMA 4KJIA 5E33A 2GQCA 1FFSB 2VGMA 1TL1B 5LJ5f 4ANJA 3M53A 3N6NA 2LQWA 1VGYA 1NZAA 2OJ3A 4DSFA 3AA8A 2DRAA 3A3NB 2FJDB 3V81B 2FHMA 2SEMA 2Y3YA 3NNAA 1RTHB 3EG9B 4KKOB 1FKAF 1WD6A 2DK2A 2QC3A 4MFBA 5GAGU 3GV7B 3KLIA 2KYXA 4IO9Q 3OVSA 2ZVIA 1EIYB 4ZKAA 4D8KA 2DGTA 4OX8A 4FU6A 2DA9A 4PG5A 2EPDA 3LPEA 3P5BP 4M75G 2RB6A 4U8VA 3H20A 1W25A 2DISA 4EDUA 2DGWA 2X3XD 3FEOA 1L3TA 4XTYA 3I35A 3VRYA 3GP9A 1RTIA 2KKHA 3ISNC 2LLZA 3MCNA 2A10A 1ZM4A 5HVFA 2KI2A 2N4DA 4FW1A 5KYNA 2V0NA 5LJ3j 3VS7A 4TXSA 1N5VA 4ED5A 4HA8A 3KLFA 4TLRA 3BR8A 1K47A 1OY9A 1Q79A 4RCCA 3HD1A 2F4FA 2MQPA 1YBAA 5F8LA 3JB9J 1JEGA 2IBOA 3H5UA 1Z1ZA 3CF5Q 4B3RF 3TAPA 4Y92A 2LXUA 5M9OA 2V5HG 5CQGA 2B86A 3KBGA 2C2RA 4MDXA 1P6TA 4C8OA 4OYBA 1NPRA 3SI8A 3W64A 1PG5B 1S1XA 1GBQA 2ZUAA 5GMDA 1IXDA 4IUUA 3I55T 2OPPB 5IXBA 3U1MA 3ZTOA 3BE3A 1S0MA 2VUGA 1EAYC 1FDDA 1GXIE 3SQOP 2WSEC 2N4CA 3G8TA 2DHSA 2IM1A 3QZ5B 3IQLA 4HCCA 2NPFA 1VQKS 2E65A 1ZUUA 3GP8A 3U1LA 5GAN8 1GXTA 3CGIA 1U1KA 2GX8A 1QP2A 2BJEA 3TX0A 2JMAA 2QEXS 2JS2A 3VS3A 5DS7A 3D7SB 1BB9A 1B0PA 1LW0A 1T03B 1OO0B 4QQBA 2KXHA 3OXGA 2BE9B 4QYRA 4ZOSA 3HHEA 4A8OA 4USIA 2CZ4A 4KSEB 2HVHA 3E9FA 3R5AA 4DV7F 1TL5A 3KDNA 3OFFA 1NZ9A 3DRRA 5L23A 1U24A 3GU0A 4ATNA 1RWKB 1UFKA 4J5OA 3JCMP 1U09A 2XICA 3R9LA 1PJ6A 1UETA 3E2UA 1YJWT 2CDTA 1Q0NA 2RD1A 4FXVA 2MJUA 3DRPA 2R7WA 4HH1A 5KT3A 2EWHA 2FC9A 3E01B 1VR6A 3HCXA 4LUDA 1H2VZ 1UGVA 1JLFA 3GG0A 2EQKA 3WC2A 2ZKUA 3PIPQ 5SZTA 3X25B 1RDRA 4PZVA 4DOZA 4WTOB 1U6ZA 1PSEA 1YJRA 1YLXA 2XYHB 2BXJA 1J2VA 3C2PA 2ZPHB 3JCMf 1RTDA 2ZJPQ 4DR6F 2UP1A 1BY9A 5KYYB 3C15A 3RRGA 2QN6B 3MCAB 2NUTB 2CPZA 1RZMA 3G6EQ 1FX4A 4DV1J 4A53A 1KWMA 3NTKA 5DG9A 3SZ2A 4AQYJ 4P2SA 4RW8B 4LR9A 4E7HA 1ZSZC 1Q82U 2DBMA 1XMOF 2DXCA 3T5KA 3T41A 2V8DA 2ALYB 3M8WA 5IT9U 2V2KA 1GEHA 2E5JA 1VQOS 2OJ2A 4OMMA 2R7SA 3CPWR 2K57A 4X4PA 3N79A 3A5ZB 2CDRB 1WC1A 2J7KA 3MM7B 2KFNA 4C8QB 1NO8A 1IBKJ 3M1VA 2CWKA 4PWDB 3DFEA 4LSNA 2Z0WA 1HPZB 3T1YF 5F9LA 7FDRA 5FROA 3K5PA 1V3ZA 3G4SS 3CCUA 1SG5A 2HK3A 1TL1A 1RT7A 5JXSA 2CJ9A 5DQGA 1KD1U 4Z02A 3L9ZA 4IG3A 1M4ZA 2QYCA 1PHTA 1SCJB 1OU9A 3UCZP 3F73A 2CVEA 3D3CJ 4JI2F 3BW1A 4CT9A 3V8JA 2F40A 2YDLA 1VQ4Q 3MZIA 3UR0A 3L7UA 3VF0B 3K2YA 4LMZA 2OX7A 4LQ9A 4XPCA 1QAIA 2KFYA 2VU5A 2IFXA 2LU2A 2GMHA 1K73C 2YWEA 4BI3A 1WTBA 4NYOA 1FKOB 2CWXA 4LIRA 1FNOA 1RADB 4WFYA 2CUDA 2AYEA 5IC4B 4C3LA 2V94A 2WACA 1LWFB 4QIVA 3QRQA 1RWMB 4ZVQB 2F63A 1Y57A 2DT9A 2HQCA 4OYZA 3KHHA 4RTYA 2GS8A 3X20B 3CCMQ 3EFOB 4F7VA 2JWNA 4NS5A 3C12A 2MLXA 4HLBA 1UGSB 3MUVP 3DXBA 2RF2B 1VQLT 2IVYA 2E70A 4DXLA 1AROP 3DB4A 4J37A 2LU1A 2H65B 4Y2CA 3SQGA 1HJDA 1GT8A 2R5MA 4DV2J 1YIJT 2EC0A 3QJYA 1RLCL 4L73A 3CCRS 2FJVA 4J7CA 3GV5B 3S1TA 2QLJB 4URSA 3MAAA 4PXCA 3PYEA 2A0FB 3MM5B 3CCLA 1MMDA 1VQ8S 2HZCA 3M8QA 1YJNS 4WIQA 4OMFG 2KT2A 3QYGB 3IFEA 2ZH4A 3TZWA 2KSSA 1IM6A 2O9SA 2VQFF 2HIYA 2CZ0B 1NK5A 1C1CB 1XR5A 2QFIA 3EPGA 1LKZA 2ROEA 3ZZYA 4R0KA 3P8DA 2YWFA 3QGIA 4RTUA 1AZSA 1KQ2A 1VQ7A 2F4VF 3DDNA 2IRUA 4RTTA 2YX7A 2PU9B 3UATA 3GIIA 1UE9A 3H2UB 3ISND 1Q8BA 2J06A 1T03A 3V6HA 4ICLB 1VMBA 1GCPA 3A3PB 2P84A 1CS4B 3M0QA 4AT1B 1WXTA 2AJ4A 2ERRA 1Q7YC 1K1ZA 3PE0A 3OL8A 1KQGB 5L8RE 4FYVB 4KUIA 1NPKA 3QWPA 2OPRB 4OI6A 2HKEA 2U2FA 3H0FA 4U67Q 2QAZA 2IBKA 2ZHBA 5GMKm 2VKZG 3AD8C 1X4DA 7FD1A 2OTLQ 2GGPA 2OHDA 2JHEA 2RQUA 5I21A 3R1HA 5LMUJ 5SUHA 2O31A 2QL5B 5KT6A 2K79A 3Q83A 1EETA 5FJ4A 1FX7A 4XDDA 4LF8J 2C0IA 2D1CA 4ZVUB 3H5YA 4NOYA 3JCMh 2HRTA 5CO7A 1JLCB 1M90T 3BPSP 2A08A 2LNHB 2WB4A 1VIFA 1RAAB 2LECA 4F3QA 1S6QA 4HI2A 3IBWA 1T11A 2HEQA 4F4ZA 3FCHA 2W7OA 2DYAA 1KSWA 1HBOB 3BGUA 2LP5A 2J05A 3L4BC 2ZUGA 3CJTA 3BQ2A 4ED7A 4C8QE 2GMJA 4C5EA 4KE5A 3HKZD 2UUCF 2EG2A 3OYDA 4JOUA 1BCOA 2QDYB 3Q22A 3CMET 4QIGA 4L76A 1HMVB 1QW1A 4DR5J 3QWXX 1YJ9T 3THTA 3KNAA 1OPKA 2B9YA 4FPIA 2NPIA 2HPUA 3INZA 3GV8B 4CNZA 3DLGA 3RR6A 2Y0SD 3MM7A 4M7AA 4C8QA 3UFCX 2LDIA 2QZ8A 1X9MA 3SB2A 5DG8A 3E1SA 4KFBA 2BZYA 1BWEA 2DL5A 4PWDA 4HVVA 3I5BA 1BD6A 4QPXA 4FVMA 2RRBA 1IKXB 3X1LB 3AXKA 3QSUA 1PJ5A 1GX6A 2JXBA 1NB7A 2VG6B 4HEA9 3THPA 2O88A 3VGUA 5KCHA 3QJ6A 1EJ7L 1U0HA 4PG8A 1HNZF 4FXDA 2FVUA 4OZNA 2JLFA 3MM8B 1S49A 2OTJT 1ZX6A 1FK9B 3RBZA 2DETA 3EUNA 2J0WA 3QT5A 2XD0A 4ZVRB 2KM8B 4JI6F 3OSPA 1RT3B 4X62F 2ECZA 4O44B 1RYRA 4IUTA 3L2QA 1FKOA 2IAJB 3OQ5A 1VI7A 4DR1F 1FXXA 2V1RA 3A12A 2W7PA 1ZAVA 4LF7F 3MFHA 1PKSA 1OQKA 1FDAA 4J9SA 1KQSP 3NCPA 1U02A 2IM3A 4RMOA 1UUEA 5IT9Y 4A4GA 5GANf 3HVRA 1WTFA 3BSCA 1ZM9A 3EFOA 2K1RA 3KJNB 5L46A 1EX4A 4JBCA 4O0IA 1RQ0A 1K8AT 2R8KA 1TL7B 2GIFA 1E7OA 1IWGA 1O8BA 1YVFA 5GADU 1X9WA 4LJMA 1RTJB 4DR7J 3I5CA 2AP6A 4RPFA 3V2UC 4EFAC 1E6YB 3RAQA 1REVB 1BI3A 2XSJA 2NSCA 2JLGA 5HMWA 3GJSB 3P3DA 2I6WA 4QWCA 1K73U 2LT4A 3VGSA 4DQSA 2RQRA 2HQIA 3I5RA 1NJXA 1VQPS 4HT5A 4ELVA 3MPWA 1HYSB 4DV6J 2BUDA 3QGGA 4RTVA 1MUZA 1Y96B 2B4VA 2A6MA 4C0GA 4CO5A 5CABA 2U1AA 3UQSA 4DS5A 3N5BB 3G71T 3SCIE 1IKYA 5K14A 2NCKL 1WQ7A 1IBCB 4FL6A 1KS2A 4CLSA 1YJVA 2WONB 4RW4A 3MHXA 2R8HA 5A0YB 3W66A 5DLQE 2MCNA 3D6FB 2VOOA 2X3WD 3QT6A 5GVQA 2AJQA 4A8QA 4F14A 1HBMB 2YKPA 4XK8C 3RMQA 1S6PB 2I2YA 5AXKA 3TU4K 4BACA 3QYHB 1WHVA 3WBZA 1WZOA 1Q1KA 1ICEB 3Q24A 1BQXA 2D69A 1FWZA 2DH9A 2HWTA 2V67A 2K3XA 2DM1A 1KVKA 2H5IB 1NG2A 2M8HA 2ZH7A 3DRXA 3AHPA 4M78D 4DX5A 1D1AA 5KFFA 1CJTA 3HSJA 3JSYA 3D66A 2DIUA 3CCZA 5THWA 3N5FA 1FWKA 4RW6B 4YB6A 1JKHB 2V9KA 1TWBA 1WA7A 3PRVA 4JI7F 2YWHA 1N36F 3CPFA 4NZ6A 1RWWB 3M30B 2BJ9A 3F41A 4BY6B 4RKUE 2EKOA 2GQ2A 3BKTA 2VICA 1S12A 3RB4A 2NUPA 5KE3A 3N4WA 5GAHI 1S9GA 2DJQA 2LX9A 2LC4A 2MTLA 3ET6B 4KYZA 3UD4P 1Q7YU 1HBOA 5GJWB 4RUAA 2KDOA 3S8SA 2CJQA 4WZMA 4UTGA 1MN9A 2QA4S 3SFUA 4TQRA 4JS4A 3RU0A 2FGOA 4YR0A 3OTDA 1IKWA 2VFSA 2AKLA 2HBZB 1V6HA 2E1RA 1ZA2B 4GLMA 4QU7A 2G1DA 3PJWA 1I5OB 3DM2A 5KFJA 4B3OB 4AFFA 3C46A 1T3OA 1VQ6Q 1QM9A 4TU8A 4NI2B 4B9WA 2R7OA 4MKAA 2FHKA 2HS0A 2QGFB 2CG8A 2H4YB 2DBBA 2IC3B 3X3UA 4XTZA 2WSFC 3L2UA 4QW8A 3HO1A 1HNWJ 2F7VA 1GMWA 1ZAXA 1LK5A 1IKXA 3FCVA 1K0VA 2V34A 2DGOA 4K7QA 3EZ5A 1FKPA 4J9IA 3QFWA 5GAOr 4PJOB 1N8RR 3KMQA 2CQ3A 5CCLA 5HQ8A 2RSQA 3OS2A 1NE8A 4M75D 4KQZA 1S1UB 4K4XA 5KFZA 2G0JA 4E0DA 3G6YA 4ID5B 2EQMA 4DPUA 2FYKA 4N0AA 1KC8T 3GPLA 1FVQA 2YKNB 4DQRA 2L3SA 3V7CA 3CCVT 1D9AA 2D8JA 3NCRA 1RT3A 2O4XA 4O44A 3FIFA 4ZCKA 3CD7A 3PYGA 2NUUG 3FJ2A 5CXTA 2MZRA 2BANA 1VK8A 2IAJA 3A8KA 3I0RB 1NJYA 4EIKA 4WYWA 2R4FA 2QSFA 1YJTA 4W4MA 4ZLLA 4YB5A 1PCAA 4OV6A 4DV4J 3CO0P 4OHVA 1JB0C 5GANh 2QG9B 1MSWD 2KT1A 2F5KA 2F1LA 2V1QA 2QJ3A 2VHGA 1JBMA 2WRMA 1Q7LB 3QLHA 2B5JB 5DDQC 2IHR1 5H9EK 5LSLA 2RNEA 3IR7B 4F7UB 3R5DA 3MP6A 1S59A 3QNWB 2YPZA 4Z7CA 3QATA 5L9XA 1FRKA 3GIJA 3SV3A 1C2PA 3Q8UA 1VJQA 3HPOA 2BJDA 2V8IA 4OYXA 3G9CA 4U95A 1RTJA 3BZQA 2C28A 3JCMd 1E6YA 4JB8B 4WK3A 4ZGJB 4BUGA 3EZOA 4BE2A 1WKKA 4R0EA 2PVDB 3DOLA 3I56T 1HYSA 1IB8A 2JNJA 4OLOA 3ELHA 4ILLA 3FEYB 2XO7A 4I68A 2XB2D 4NX9A 5EWEA 3O8WA 1Q5VA 1CULB 5BYQA 4RL1A 4M7DB 5J2MB 4EZ9A 3J7Z5 2XTJP 1SJ1A 3K0JA 4IUFA 2D0QB 1DARA 3M2UB 4XDCA 4A46A 1B07A 2XWYA 2YRVA 1M2OA 3EVWA 2NXNA 3O44A 1DQ8A 2UUTA 4JLGA 1VA7A 2RQMA 2MZSA 4CNYA 4LQ3A 3ILIA 3MJXA 4JJBA 3D0IE 3BY7A 3TZZA 2MSSA 1VQNT 2EJ9A 2A37A 2BYCA 2YH1A 2HQEA 3W60A 2K9GA 4LREA 3TZXA 2C2DA 1Q81T 2M9UA 1GFDA 3NMZC 1LQ9A 3IWXA 1AWWA 5IM0A 1KQSA 3MKDA 3BFMA 3CC4Q 3JB9G 2HRUA 4IRCA 4UUXA 4NOHA 2EWNA 5MLCV 2B4UA 2DAQA 1UKUA 2XDPA 1F2GA 2DNPA 2IRYA 3JYTA 1N5YB 2J6OA 4RW6A 2W2QP 2CP6A 1PRLC 5B0BA 3G6VA 3OS1A 1QAXA 3PRBA 1X4BA 3NRBA 2CQHA 1VQMQ 2COLA 2YNIA 5HROA 5B0AA 4MMLA 1ZBJA 1LWEB 2N7CA 2J6UA 1IBLF 5BR8J 3IGNA 3CXCR 3OXFA 1IQTA 3LP2B 5A8RB 3TUJC 3C94A 3DDKA 4J9EA 3S7RA 3KLGA 2CQDA 2E5KA 1ROFA 4J9BA 3IM9A 1OIAA 1U8WA 1N6AA 1SEMA 3FC3A 1RABB 3ET6A 1U1NA 2XCPA 3NGPA 2E5GA 2RUSA 2HBQB 3NGSA 2MGZA 1IGUA 5GAMg 2YVSA 5EWGA 1ZETA 5CKDA 4DR3F 3GJRB 5KT5A 3QXEB 4MIBA 2DD8S 2R2TA 1NMEB 2ZM6F 4JI2J 1N6QA 2YNHB 3GNGA 5LL6S 2E6ZA 2RDJA 2ALZA 4PJOE 3CCUS 2DPIA 3MR2A 3K5LA 2HHWA 1RACB 2DLPA 4AG1C 2DXEA 2CSIA 3LGNA 3MPDA 2LDYA 4OLPA 2ZOMA 1RL2A 4TU9A 1TS9A 2HZAA 1JLGB 4E7JA 2ROTA 1RTZA 1NK6A 3OHAA 3MEKA 3JCMb 1PKUA 4LF4J 5AE2A 2XS7A 3BBCA 2DXDA 3M2RA 3OJUA 3CMAT 4IYQA 1K9MT 1HHSA 5GMKj 2V4JB 3L7PA 2XMKA 1F9EB 1VQ5T 4YY3F 4M77B 3NKYA 4ID5A 2NXJA 3IC1A 4URGA 3PGGA 2M02A 3F44A 5DQHA 1RT5B 1AOJA 1WDDA 4M5HA 4DZ6A 4RO0A 1JX4A 5RUBA 2KXCA 1VBYA 2DY9A 1H2UX 2YNGB 2I2LA 4C8NA 3UA7A 3NAHA 4Z37A 4ESRA 4NXNF 3EE3A 4ME7A 1D3BA 2VV5A 1X43A 2KMTA 4ELUA 1R0AB 4ELZC 4N56A 4O6JA 2RE1A 4TY8B 3N28A 1J5EF 1FNMA 2CPJA 4H4MA 3UD3P 3CB4A 4D3HA 2JW4A 2KQWA 4X2BA 4ES3A 4C0DB 1UHCA 3ZZOA 3O8VA 1QLNA 4F04B 4LN2A 2JZ5A 2VVKA 4OMNA 2YLBA 4LDVA 5DETA 2HQGA 4ZJOA 1S76D 3AT1B 4F7UA 3WVEB 1HK9A 2NQPA 5IT0A 2V26A 4OQJA 2OMOA 3LO3A 1U1OA 2R5AA 4PQUB 4JYAF 4KPYA 3CCLS 2DZCA 4ZTJA 5GAN4 1SBRA 5L8RC 4CIOA 3MCMA 3ENQA 4M63A 3RUBL 4ED8A 4M7DE 1X5SA 3MECA 4WK1A 2HAFA 2GFUA 1U0SA 4ZVGA 3H0PA 2LMIA 1N27A 2ASJA 3GIMA 3UN3A 3P45B 1FJGF 3RBXA 2DVIA 1MNEA 1U8RA 2CZ1B 2DL3A 3BO4A 4B3SJ 1KQSR 1VQ7S 2GAGC 4Q2MA 5AE3A 4USWA 1X2KA 1D0EA 4RNNA 2QT7A 5D0RA 1K0TA 3I55A 1M8MA 5J2MA 4CQ1A 3R2CJ 2VFRA 1PYTA 2L2PA 3UNGC 1N33F 1I94F 2MQLA 4J91A 4Y28C 1F9HA 3UN2A 4J83A 3M2UA 3QT7A 5KG4A 3CEYA 5HK0A 2JTFA 1EP4A 2A3LA 3HVAA 2ZJQQ 3BGRA 3C19A 5LSOA 3Q0AA 1M1KT 1M3BA 4KHPF 2MZTA 3Q8YA 3UPFA 4N4IA 2PUOB 2O2OA 2H1YA 4M7AC 5I2MA 4C8QC 4ERDA 3L3CA 1HR0F 1CLFA 3TJAA 2Z2YB 2KZMA 2EYWA 2HHHF 5FU6C 1JIHA 3CD0A 1IO6A 3PIOA 4CZCA 5C5JA 4WU3A 4HH0A 3HHKA 1T0HA 3ENAA 2ATLA 2RHQB 3TEGA 3NCQA 2PIIA 4A47A 4FKXA 3D1QA 4AFQC 2E5IA 1YJWA 3LX7A 2JZ2A 2I9SA 4EYHB 4PWWA 2ZPFB 4I2PB 1GAOA 4DL6A 2DKGA 2BJ1A 3P5TL 2ZEJA 3HULA 1G3WA 3D28A 2KO1A 4FIBA 3EAEA 2LQJA 1NJIC 4NZ0A 1X9SA 2RPNA 2GIQA 4P2XA 1ZA1B 5AXLA 1JK9B 2PEHA 4YMEA 4M5DB 1X0PA 3L7OA 3M59A 1CG2A 4FZVA 2L8DA 4C92E 3SHWA 2X1FA 4ORZA 4C6AA 4C8ZA 2FVQA 2VYTA 5CD4A 1BIBA 1HI0P 1Q53A 1X5OA 1HNZJ 1PAUB 3T9ZA 2QTXA 3LTOA 3CCEQ 4JI3J 4DUZF 1SB6A 2QL9B 4N41A 2YNHA 1D3WA 4KGMA 4KBMB 3SFGA 1TKDA 1G2BA 2QYGA 3H7HB 3RMSA 2UXDJ 2OELA 2D1XA 3K59A 1U2FA 3L2RA 4QIFA 1B7FA 3O6QA 1N52B 1UW9A 1RT6B 4DR1J 2V2VA 3M32A 4LXCA 1RU2A 2ADCA 4RWWA 3CC7Q 2XO6A 4WWSA 3OYHA 3BSOA 1A7GE 5GAMe 3I87A 2V4JA 1F60B 3PVQA 4FNHA 1QCOA 4B9TA 1TV6B 1TZ0A 1Q8LA 3IXQA 1BKBA 4NLRA 3H4DA 4KRTA 4WFXA 4M77A 1JLBA 2EYYA 2P9GA 1SJRA 1P9QC 2JOYA 4NA3A 1RAOA 4DPXA 2EKYA 2YUOA 4K4SA 3OL6A 5KH6A 2NYIA 3SSSA 2BZ8A 4FPRA 2YNGA 1B34A 2W9BB 3OY9A 5GMKl 2CFXA 3HFVA 2QTWA 4MIWA 4MYTA 1SVDA 3V4IA 2HD0A 3RIRA 3G8SA 2FIUA 1R0AA 3ZTSA 5CYMB 2HHXA 1JRIA 3MEWA 4PK4A 1N54B 1HNIA 3T3FA 2RQKA 1YK9A 2BX6A 2HZVA 4GO7X 1UJ0A 1PILA 3M6WA 4C11A 1T9YA 3RR7A 3EGDA 1D1BA 5FLXE 3OYEA 5JUMA 2FQQB 4N7TA 3I0SA 1RAHB 4WFBQ 3PV8A 1VQLA 3MM6A 4PR6A 2GHPA 3BH6B 3DLEB 4LBIA 1FD8A 1KG1A 4AD6A 4K4VA 4V2SA 1HSQA 1YIJA 1S72S 1RLDA 2JH3A 1NHKL 1QTNB 1VBKA 2CPFA 5D4OA 1MROB 4I56A 4IH6A 1U47A 4TVAB 4QWDA 5LJ3f 2KN4A 2K2VA 2DNHA 1HNVB 3AJDA 4Y2KA 3FGVA 4XU3A 3KNGA 2YX1A 2PFFB 1AWXA 1AUDA 4DEXA 2C3MA 5ETLA 3G6ET 1GH8A 1RAIB 3FFIA 2AKKA 2X7IA 2FLOA 3ZZ0A 1RWVB 2MZQA 3OW2R 3BGFA 2LJ3A 5B0DA 4MTPA 3LP1B 1XR6A 2BW7A 2LX7A 3BDLA 2DNLA 4OL8A 3DGPA 3S01A 1LWCB 2CZ9A 1PBUA 1KOOA 4LVOP 2Q43A 1GL5A 3M4YA 5CR2A 4GMKA 3KLHA 1I1GA 3RB3A 1G2EA 1AWJA 2HHPA 4EBDA 2EFIA 4Y91A 2CKKA 5LT5A 3JAME 5CZXA 4U8YA 1YWPA 4DQQA 2EIFA 1FWLA 5D77A 4BI4A 2O01E 4NCBA 5IHIA 1HD1A 1KLNA 2Z58B 4N0AC 1T0TV 4DF8A 1FVSA 1VQ4T 1Q86C 2KM8C 1PGZA 3HDSA 4Z8AA 4ZP8A 4X4TA 4GVLA 2C3PA 1G4CA 2OPSB 1FNXH 2RHZA 4OX7A 3ITHB 2VASA 1WC6A 2LP4A 2J9DA 3OYAA 3MEDA 3MMBB 1YZ6A 2JL9A 3PM9A 1QJHA 3DLLA 5IHKA 4C8QD 3OV7A 1OEBA 3TEHB 2Q3PA 2NZCA 5C2CA 4BB7A 3CMEA 2GZOA 1SQEA 4GKJF 3CCMT 3OTEA 1YJ9A 2WSCC 2IDEA 1Y0HA 1WHXA 2YQ0A 5KFBA 3FBEA 5B7WA 1LWXA 1S5ZA 2ASYA 3K5MA 1QVGP 1R31A 3KK2B 4QPTA 1YNZA 4C92G 3KMSA 3VS0A 2RS2A 5KFHA 1W2BR 4RU9A 4K4ZA 4H54A 1U45A 1NSKL 3A8OB 3QZ7A 2QQBA 2B56A 1RT6A 4EO6A 1TMMA 2XDBA 1NJIU 1RE1B 1X4AA 1T7PA 1GRIA 2VFTA 2ZH6A 3MCOA 4A63B 3WHIA 1HQ2A 1TUWA 4JV1A 4GKKJ 2MMYA 1L3SA 2DF6A 2LQ5A 2EFGA 2OTJA 3GLXA 3PW2A 2EAYA 4ZPTR 1NM2A 2YKMB 1Y00A 4OMOA 1KIKA 1EARA 4Z89A 1U7LA 5EC7A 4LDWA 4NMLA 4PG6A 5GAMf 3CJ2A 2DEQA 2AZVA 5DM7R 3W3SA 3HKWA 2R7TA 2CQ0A 1UCNA 1NBEB 3AXMA 4FYDA 3VHQA 4X34A 4CO3A 4F67A 4ES1A 3B82A 3DC2A 5CYMA 3ZTRA 2FHOB 3EGZA 1VRUA 3GSIA 2CPEA 2O5DA 4O3NA 2WCXA 4C97A 2ZOGA 1SRMA 2XYGB 3QQCD 2EVZA 2DNRA 1K4US 2JFDA 1G83A 4ENOA 4CO4A 1X01A 4HYKA 4HACB 3EPIA 2PEBA 2QMWA 2X51A 2CQ2A 4KC5A 3J7ZT 2OTLT 3EHQA 2D9TA 2G2YA 3QIPB 1ZUYA 2KJWA 4LFBF 3R6OA 1B7YB 2B7CB 1RP5A 3OS0A 1OWXA 2KJVA 1BYMA 1CSJA 4MT1A 4DU8A 2KGTA 1H98A 4DCPB 4NRTA 1MROA 5LJ3h 3CTRA 1TELA 4KIAA 3QWYA 3LYIA 3PFOA 3TNVA 3ZZTA 4ZLPA 3VTIA 2M9KA 4M5IA 1NH8A 1UTAA 1HNVA 2B8PA 2LJ1A 5J2NB 1VC6A 3IR6B 1KQ1A 4E6RA 5LMNJ 4LF6F 4F4KA 3IMQJ 3CJKA 2FPFA 2K7JA 1UFLA 1ULRA 1JNRB 4A8KA 2KRRA 3G8QA 2HNYB 2FLNA 3N6LA 3G71A 1RBLA 1U1RA 2YWKA 3RB6A 3JB9D 2E5LJ 2R7XA 3SXLA 1RUSA 2J8SA 4ED3A 2WBRA 1KQSS 3LP1A 2Y9HA 2ZH1A 3LANA 5AJ3J 1IM4A 4OX9J 4ECSA 1SJ4P 2QRRA 4U7UD 2C06A 3OR2B 2EK6A 2W2NP 1EFNA 2PO4A 4DN9A 4DFKA 2KROA 1WI8A 3DRYA 3RZAA 1MLAA 2WAQD 4ELTA 1QAJA 3DMJB 5L1KA 1ZBXA 4YR2A 4JRQA 4ZIWA 2X1AA 3N01A 4LDYA 4PJOC 4LD9K 1YJ7A 4NL2A 1CJVA 3GFHA 2FB7A 3PJ9A 3QJJA 4JJDA 4B9VA 2RQWA 1I07A 1GBRA 1YCSB 3FJPA 4F25A 5FRNA 5FDLA 2VG5A 1QSSA 2ZM6J 1TKZB 1EKSA 1JJ4A 2H5JB 3V5RA 3MD3A 4ZPVR 1NEBA 2ZH9A 2BQUA 5KG2A 1DTTB 2JEIA 1OY6A 3DU6A 1IHWA 2OPSA 4C5HA 3OFHA 3CUNA 4KV8B 3SSRA 2LT1A 3MMBA 2OEKA 5LOQA 2PT0A 4G1PA 3V7SA 3BDEA 1ZZNA 4DF4A 2L9WA 3EHRA 4OJHA 2COZA 1HBUA 4OYMA 3ZBDA 4Y2AA 4LF2A 3G7ZA 1GMWD 4ECZA 4HHUA 1QKXA 1PSFA