2BEBA

X-ray structure of asn to thr mutant of winged bean chymotrypsin inhibitor
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
173
structure length
170
Chain Sequence
DLVDAEGNLVETGGTYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSQFLSLFIPRGSLVALGFANPPSCAASPWWTVVDSPQGPAVKLSQQKLPEKDILVFKFEKVSHSNIHVYKLLYCQHDVKCDQYIGIHRDRNGNRRLVVTEENPLELVLLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spacer Asn Determines the Fate of Kunitz (STI) Inhibitors, as Revealed by Structural and Biochemical Studies on WCI Mutants.
pubmed doi rcsb
molecule keywords Chymotrypsin inhibitor 3
molecule tags Hydrolase inhibitor
source organism Psophocarpus tetragonolobus
total genus 23
structure length 170
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2bebA00
1JT7A 5BXRA 3JUTA 3ZXGA 1V6UA 3C9ZA 3OJMA 3Q7YA 3RMXA 4IYBA 4HA2A 1FN0A 3V0BB 2GZBA 3I29B 3BRGC 3FJFA 3MPPG 3OGFA 3VSZA 3O4DA 5D63A 2BEBA 4H04A 4JKQA 1VCLA 3FFZA 4D0ZA 2IWTB 4DENA 4X38A 1F31A 2NVHA 3HMYA 3ILAA 1ISXA 4LO7B 3FJEA 1RMLA 4IY8A 4J2KA 3RMYA 4G1RA 5F8WA 3FUOA 1JQZA 3FJ8A 3V0AB 4I4XA 4AN6A 4P0LA 4Q9PA 1ISYA 1EV2A 3AJ5A 3AZVA 3QR5A 4IQPA 3VT2A 5BXSA 3RSJA 1IOBA 3VT0A 4QBCA 3V79C 4I6IA 2HWMA 3FJHA 3VEQA 1TIEA 4LO2C 5FZYA 3VWCA 1TFMB 1PUUB 4F83A 2UUSA 3CA4A 4PC4A 4G6MA 1T4QA 4HR6C 3IM7A 3BADA 4D0TA 2VUAA 2VSEA 3CRIA 4LO1A 4I4RA 1SZ6B 2FDBM 3BAGA 4II0A 4I8MA 1EVTA 1BARA 2NM1A 2KH2A 2LIEA 2FFUA 2XOAA 1AVAC 2D1ZA 3A21A 4IZXA 2L5XA 1BFBA 1XG6A 3HN1A 5BOWA 1UPSA 5FZUA 1BA7A 4I0YA 3CA0A 3F62B 4I4VA 1JTCA 2ESUA 2NYYA 4OEFA 3UD7A 1IHKA 2Y9WC 4ZKTB 3V0AA 3N0KA 4JPZA 3VUOA 4IHZA 4USOA 3IAGC 2BFHA 3BA5A 4ENDA 3N7JA 2IHOA 3P6JA 4ZLBB 1BFFA 5DVHA 1FMMS 2Y9FA 2HZ9A 4LO0A 1AFCA 3HBWA 4DEPA 2F2FA 1IJTA 2NZ9A 3CRHA 1PC8B 2D7IA 3CA1A 1HCDA 4P6AA 5BQUA 2YUGA 1Q1UA 4ZA3B 3FJ9A 4USPA 1ITBA 4I3NA 5FZZA 3ZC9A 5BP5A 3B9UA 1HKNA 1MC9A 5F8SA 1DIWA 2WBCA 2GO2A 4JP0A 1DZDA 2MC2A 5FNWA 1JLYA 3OBTA 1IRPA 1S0LA 2D23A 4OEEA 3ZX7A 1ISVA 4X3AA 5G00A 3N7LA 4OEGA 2Y9XE 1JT4A 3BA7A 2D44A 4XFUA 2VXRA 41BIA 4QBVA 4ZFWB 1ABRB 3FJDA 3FUQA 3TC2A 1AVXB 3FJKA 4I4PA 3NBEA 3AZWA 4LO1C 4Q91A 4G9NA 3O49A 5BXTA 3PUBA 4JRAA 4ISQA 2ZQOA 1RZOB 4ZFYB 2VXTI 5F90A 3UJ4A 2KI6B 1HWNB 3AKGA 2HW9A 9ILBA 1AXMA 4QO3A 3K1XA 1JT5A 4JQ0A 3H6RB 4GOVA 1V6WA 3SNVA 4ZBVB 3HSMA 2DRZA 1I1EA 2NP0A 2Q9XA 1DZCA 1XHBA 3BAUA 1S0BA 1FMZA 4Z9WB 4R6UB 4LO0C 1EPWA 3S8KA 4DCKC 5F8YA 3CA5A 3O3QA 5DUYA 1A8DA 2Z48A 7I1BA 2F2FC 1S0FA 3BTAA 2ET2A 2Z49A 3FJAA 5D62A 3PHZA 3BAVA 5BQUC 1IRAX 3NJ5A 2LIQA 2I1BA 4J23B 5BP5C 3S8JA 1DQGA 1Q03A 1G9DA 1I1BA 4I2SA 3N7KA 4GP0A 3UDAA 5BVPI 4I1EA 2HWAA 4X37A 1TWMA 3V0BA 3E8LC 1W3AA 5D61A 4FGFA 2X2SA 4L4HA 1HWPB 3O4CA 1ONKB 3I2AA 1FWUA 1W3GA 4I7IA 3BAHA 2D20A 1E0OA 3NBCA 4OWJA 1SR4A 4L4IA 4Q9GA 4J2SA 4I4YA 1Z2VA 3Q7WA 4XFTA 4GP3A 2P39A 1RY7A 2KI4A 3IM5A 31BIA 5DSSB 1FV2A 6I1BA 4EFRA 4KC3A 1TTUA 3IIRA 4I96A 1BFCA 3ZXDA 1M2TB 1PUMB 3LLPA 3AKHA 4GAFA 4I37A 4A7KA 4OWLA 2AFGA 4X39A 4G6JA 2J3PA 4I4SA 1TOOA 4EFPA 2AXMA 1V6XA 3CQAA 3I2XA 4AN7B 1CVSA 2FGFA 4QD2C 2RQ9A 1NUNA 4QC4A 2DRYA 3WINA 1S0GA 2VU9A 4KEKA 3O4BA 2MIBA 3HALA 1NZKA 1II4A 1RG8A 3AH2A 3T8SA 3O44A 1P63A 3FJCA 4IY9A 3NBNA 4EB2B 2VSAA 1DFQA 1AF9A 2QYIB 5EG6C 3UJ0A 3VT1A 1T9FA 3WO3A 4I4QA 3FJBA 3OGGA 4G9MA 5B2HA 2Y9GA 8I1BA 1GGPB 2FO1A 4ZOTA 2AAIB 1DFCA 5DZUA 2K8RA 3WO4A 4J2YA 3BA4A 2F8XC 1HIBA 2ZQNA 3VSFA 4EEEB 3BAQA 4WBCA 1ILR1 1FQ9A 1HWOB 5HPZA 1S0EA 1WBCA 3CRGA 4ZFUB 21BIA 2VLCA 4LO3A 1D0HA 2Q3NB 2KLLA 1SR4C 1M16A 1WBAA 3OBRA 4LO7C 5I1BA 3WO2A 1QQKA 3FGMA 1AVWB 3FJJA 3MALA 2K4AB 4IZEA 4OUJA 3A22A 4F34A 2FFVA 5E24E 1PWAA 1OQLB 3W9TA 3RTIB 3BRDA 1ISWA 3A07A 4YOLA 5GAQA 3CA3A 4QKRA 2ZR1B 2RG9B 4P0JA 1TP0A 1BASA 1YTOA 4TLPA 1R8OA 4D8HA 3BAOA 4GOYA 2P23A 4OWKA 1Z0HA 1QQLA 3WMVA 4KEJA 1DJSB 4FVVA 4HJJA 1JLXA 3PMEA 3CA6A 1N4KA 3UD8A 4J2XA 1AVUA 4QKSA 1JT3A 2E4MA 3A23A 1FWVA 1IILA 1Z4SA 3WINC 4Z8SB 4H9WA 2QN4A 4I4UA 1K5UA 3CAHA 3EF2A 1G82A 2ERMA 3QYDA 3D7WB 1G9CA 1XYFA 4GAIA 4KEIA 1K5VA 2D22A 2X2TA 3H6RA 3AKIA 4JKXB 1KNMA 1XZZA 3HOMA 1IT0A 2M49A 1QXMA 4OW4A 3RTJB 5JMCA 1YYNA 1WD4A 3FJIA 3JRRA 2MLLB 5EC5A 3BRFA 1PZZA 1BFGA 2D7RA 4KBBA 2RSTA 4LO3C 3P6IA 1YF8B 2BEAA 3N7MA 3UD9A 1FGAA 4CJMA 2DREA 2DS0A 1S0CA 4A7YA 1WD3A 1CE7B 5EHAA 1S0DA 3Q7XA 4A7ZA 3P53A 2D24A 3KMVA 1V6VA 1TWEA 1EYLA 4P0KA 5FNXA 3OJVA 4JAWA 4I1BA 3BX1C 3ZC8A 3H6SE 1BLDA 4ZGRB 3CU1B 4LO2A 3O5WB 4EKXB 3OJ2A 1DLLA 3R4SA 1W3FA 2K43A 2NTDA 3AH1A 1FV3A 1HWMB 3O4AA 3F1RA 2KKIA 4XKIA 1DQOA 1L2HA 1R8NA 5BXPA 1YXWA 1Q04A 2R9KB 3WMUA 1J0SA 4LO8B 4EFQA 4IONA 1G9BA 1MD6A 2E4MC 3LTQA 2WRYA 4QD2B 1G9AA 5JLVA 2AQZA 3POKA 1HCEA 3O4OA 3AH4A 3PG0A 3H6QA 1ISZA 3AJ6A 4XFSA 3R4UA 4QALA 3WA1A 3BB2A 3AKFA 4ISRA 3IM6A 1JY0A 1BLAA 1YBIA 3NBDA 4I4OA 2D43A
chains in the Genus database with same CATH superfamily
1JT7A 5BXRA 3JUTA 3ZXGA 1V6UA 3C9ZA 3OJMA 3Q7YA 3RMXA 4IYBA 4HA2A 1FN0A 3V0BB 2GZBA 3I29B 3BRGC 3FJFA 3MPPG 3OGFA 3VSZA 3O4DA 5D63A 2BEBA 4H04A 4JKQA 1VCLA 3FFZA 4D0ZA 2IWTB 4DENA 4X38A 4MZGB 1F31A 2NVHA 3HMYA 3ILAA 1ISXA 4LO7B 3FJEA 1RMLA 4IY8A 4J2KA 3RMYA 4G1RA 5F8WA 3FUOA 1JQZA 3FJ8A 3V0AB 4I4XA 4AN6A 4P0LA 4Q9PA 1ISYA 1EV2A 3AJ5A 3AZVA 3QR5A 4IQPA 3VT2A 5BXSA 3RSJA 1IOBA 3VT0A 4QBCA 3V79C 4I6IA 2HWMA 3FJHA 3VEQA 1TIEA 4LO2C 5FZYA 3VWCA 1TFMB 1PUUB 4F83A 2UUSA 3CA4A 4PC4A 4G6MA 1T4QA 4HR6C 3IM7A 3BADA 4D0TA 2VUAA 2VSEA 3CRIA 4LO1A 4I4RA 1SZ6B 2FDBM 3BAGA 4II0A 4I8MA 1EVTA 1BARA 2NM1A 2KH2A 2LIEA 2FFUA 2XOAA 1AVAC 2D1ZA 3A21A 4IZXA 2L5XA 1BFBA 1XG6A 3HN1A 5BOWA 1UPSA 5FZUA 1BA7A 4I0YA 3CA0A 3F62B 4I4VA 1JTCA 2ESUA 2NYYA 4OEFA 3UD7A 1IHKA 2Y9WC 4ZKTB 3V0AA 3N0KA 4JPZA 3VUOA 4IHZA 4USOA 3IAGC 2BFHA 3BA5A 4ENDA 3N7JA 2IHOA 3P6JA 4ZLBB 1BFFA 5DVHA 1FMMS 2Y9FA 2HZ9A 4LO0A 1AFCA 3HBWA 4DEPA 4MZFB 2F2FA 1IJTA 2NZ9A 3CRHA 1PC8B 2D7IA 3CA1A 1HCDA 4P6AA 5BQUA 2YUGA 1Q1UA 4ZA3B 3FJ9A 4USPA 1ITBA 4I3NA 5FZZA 3ZC9A 5BP5A 3B9UA 1HKNA 1MC9A 5F8SA 1DIWA 2WBCA 2GO2A 4JP0A 1DZDA 2MC2A 5FNWA 1JLYA 3OBTA 1IRPA 1S0LA 2D23A 4OEEA 3ZX7A 1ISVA 4X3AA 5G00A 3N7LA 4OEGA 2Y9XE 1JT4A 3BA7A 2D44A 4XFUA 2VXRA 41BIA 4QBVA 4ZFWB 1ABRB 2NS2A 3FJDA 3FUQA 3TC2A 1AVXB 3FJKA 4I4PA 3NBEA 3AZWA 4LO1C 4Q91A 4G9NA 3O49A 5BXTA 3PUBA 4JRAA 4ISQA 2ZQOA 1RZOB 4ZFYB 2VXTI 5F90A 3UJ4A 2KI6B 1HWNB 3AKGA 2HW9A 9ILBA 1AXMA 4QO3A 3K1XA 1JT5A 4JQ0A 3H6RB 4GOVA 1V6WA 3SNVA 4ZBVB 3HSMA 2DRZA 1I1EA 2NP0A 2Q9XA 1DZCA 1XHBA 3BAUA 1S0BA 1FMZA 4Z9WB 4R6UB 4LO0C 1EPWA 3S8KA 4DCKC 5F8YA 3CA5A 3O3QA 5DUYA 1A8DA 2Z48A 7I1BA 2F2FC 1S0FA 3BTAA 2ET2A 2Z49A 3FJAA 5D62A 3PHZA 3BAVA 5BQUC 1IRAX 4MZHA 3NJ5A 2LIQA 2I1BA 4J23B 5BP5C 3S8JA 1DQGA 1Q03A 1G9DA 1I1BA 4I2SA 3N7KA 4GP0A 3UDAA 5BVPI 4I1EA 2HWAA 4X37A 1TWMA 3V0BA 3E8LC 1W3AA 5D61A 4FGFA 2X2SA 4L4HA 1HWPB 3O4CA 1ONKB 3I2AA 1FWUA 1W3GA 4I7IA 3BAHA 2D20A 1E0OA 3NBCA 4OWJA 1SR4A 4L4IA 4Q9GA 4J2SA 4I4YA 1Z2VA 3Q7WA 4XFTA 4GP3A 2P39A 1RY7A 2KI4A 3IM5A 31BIA 5DSSB 1FV2A 6I1BA 4EFRA 4KC3A 1TTUA 3IIRA 4I96A 1BFCA 3ZXDA 1M2TB 1PUMB 3LLPA 3AKHA 4GAFA 4I37A 4A7KA 4OWLA 2AFGA 4X39A 4G6JA 2J3PA 4I4SA 1TOOA 4EFPA 2AXMA 1V6XA 3CQAA 3I2XA 4AN7B 1CVSA 2FGFA 4QD2C 2RQ9A 1NUNA 4QC4A 2DRYA 3WINA 1S0GA 2VU9A 4KEKA 3O4BA 2MIBA 3HALA 1NZKA 1II4A 1RG8A 3AH2A 3T8SA 3O44A 1P63A 3FJCA 4IY9A 3NBNA 4EB2B 2VSAA 1DFQA 1AF9A 2QYIB 5EG6C 3UJ0A 3VT1A 1T9FA 3WO3A 4I4QA 3FJBA 3OGGA 4G9MA 5B2HA 2Y9GA 8I1BA 1GGPB 2FO1A 4ZOTA 2AAIB 1DFCA 5DZUA 2K8RA 3WO4A 4J2YA 3BA4A 2F8XC 1HIBA 2ZQNA 3VSFA 4EEEB 3BAQA 4WBCA 1ILR1 1FQ9A 1HWOB 5HPZA 1S0EA 1WBCA 3CRGA 4ZFUB 21BIA 2VLCA 4LO3A 1D0HA 2Q3NB 2KLLA 1SR4C 1M16A 1WBAA 3OBRA 4LO7C 5I1BA 3WO2A 1QQKA 3FGMA 1AVWB 3FJJA 3MALA 2K4AB 4IZEA 4OUJA 3A22A 4F34A 2FFVA 5E24E 1PWAA 1OQLB 3W9TA 3RTIB 3BRDA 1ISWA 3A07A 4YOLA 5GAQA 3CA3A 4QKRA 2ZR1B 2RG9B 4P0JA 1TP0A 1BASA 1YTOA 4TLPA 1R8OA 4D8HA 3BAOA 4GOYA 2P23A 4OWKA 1Z0HA 1QQLA 3WMVA 4KEJA 1DJSB 4FVVA 4HJJA 1JLXA 3PMEA 3CA6A 1N4KA 3UD8A 4J2XA 1AVUA 4QKSA 1JT3A 2E4MA 3A23A 1FWVA 1IILA 1Z4SA 3WINC 4Z8SB 4H9WA 2QN4A 4I4UA 1K5UA 3CAHA 3EF2A 1G82A 2ERMA 3QYDA 3D7WB 1G9CA 1XYFA 4GAIA 4KEIA 1K5VA 2D22A 2X2TA 3H6RA 3AKIA 4JKXB 1KNMA 1XZZA 3HOMA 1IT0A 2M49A 1QXMA 4OW4A 3RTJB 5JMCA 1YYNA 4H75A 1WD4A 3FJIA 3JRRA 2MLLB 5EC5A 3BRFA 1PZZA 1BFGA 2D7RA 4KBBA 2RSTA 4LO3C 3P6IA 1YF8B 2BEAA 3N7MA 3UD9A 1FGAA 4CJMA 2DREA 2DS0A 1S0CA 4A7YA 1WD3A 1CE7B 5EHAA 1S0DA 3Q7XA 4A7ZA 3P53A 2D24A 3KMVA 1V6VA 1TWEA 1EYLA 4P0KA 5FNXA 3OJVA 4JAWA 4I1BA 3BX1C 3ZC8A 3H6SE 1BLDA 4ZGRB 3CU1B 4LO2A 3O5WB 4EKXB 3OJ2A 1DLLA 3R4SA 1W3FA 2K43A 2NTDA 3AH1A 1FV3A 1HWMB 3O4AA 3F1RA 2KKIA 4XKIA 1DQOA 1L2HA 1R8NA 5BXPA 1YXWA 1Q04A 2R9KB 3WMUA 1J0SA 4LO8B 4EFQA 4IONA 1G9BA 1MD6A 2E4MC 3LTQA 2WRYA 4QD2B 1G9AA 5JLVA 2AQZA 3POKA 1HCEA 3O4OA 3AH4A 3PG0A 3H6QA 1ISZA 3AJ6A 4XFSA 3R4UA 4QALA 3WA1A 3BB2A 3AKFA 4ISRA 3IM6A 1JY0A 4UY4A 1BLAA 1YBIA 3NBDA 4I4OA 2D43A
chains in the Genus database with same CATH topology
1JT7A 5BXRA 3JUTA 3ZXGA 1V6UA 3C9ZA 3OJMA 3Q7YA 3RMXA 4IYBA 4HA2A 1FN0A 3V0BB 2GZBA 3I29B 3BRGC 3FJFA 3MPPG 3OGFA 3VSZA 3O4DA 5D63A 2BEBA 4H04A 4JKQA 1VCLA 3FFZA 4D0ZA 2IWTB 4DENA 4X38A 4MZGB 1F31A 2NVHA 3HMYA 3ILAA 1ISXA 4LO7B 3FJEA 1RMLA 4IY8A 4J2KA 3RMYA 4G1RA 5F8WA 3FUOA 1JQZA 3FJ8A 3V0AB 4I4XA 4AN6A 4P0LA 4Q9PA 1ISYA 1EV2A 3AJ5A 3AZVA 3QR5A 4IQPA 3VT2A 5BXSA 3RSJA 1IOBA 3VT0A 4QBCA 3V79C 4I6IA 2HWMA 3FJHA 3VEQA 1TIEA 4LO2C 5FZYA 3VWCA 1TFMB 1PUUB 4F83A 2UUSA 3CA4A 4PC4A 4G6MA 1T4QA 4HR6C 3IM7A 3BADA 4D0TA 2VUAA 2VSEA 3CRIA 4LO1A 4I4RA 1SZ6B 2FDBM 3BAGA 4II0A 4I8MA 1EVTA 1BARA 2NM1A 2KH2A 2LIEA 2FFUA 2XOAA 1AVAC 2D1ZA 3A21A 4IZXA 2L5XA 1BFBA 1XG6A 3HN1A 5BOWA 1UPSA 5FZUA 1BA7A 4I0YA 3CA0A 3F62B 4I4VA 1JTCA 2ESUA 2NYYA 4OEFA 3UD7A 1IHKA 2Y9WC 4ZKTB 3V0AA 3N0KA 4JPZA 3VUOA 4IHZA 4USOA 3IAGC 2BFHA 3BA5A 4ENDA 3N7JA 2IHOA 3P6JA 4ZLBB 1BFFA 5DVHA 1FMMS 2Y9FA 2HZ9A 4LO0A 1AFCA 3HBWA 4DEPA 4MZFB 2F2FA 1IJTA 2NZ9A 3CRHA 1PC8B 2D7IA 3CA1A 1HCDA 4P6AA 5BQUA 2YUGA 1Q1UA 4ZA3B 3FJ9A 4USPA 1ITBA 4I3NA 5FZZA 3ZC9A 5BP5A 3B9UA 1HKNA 1MC9A 5F8SA 1DIWA 2WBCA 2GO2A 4JP0A 1DZDA 2MC2A 5FNWA 1JLYA 3OBTA 1IRPA 1S0LA 2D23A 4OEEA 3ZX7A 1ISVA 4X3AA 5G00A 3N7LA 4OEGA 2Y9XE 1JT4A 3BA7A 2D44A 4XFUA 2VXRA 41BIA 4QBVA 4ZFWB 1ABRB 2NS2A 3FJDA 3FUQA 3TC2A 1AVXB 3FJKA 4I4PA 3NBEA 3AZWA 4LO1C 4Q91A 4G9NA 3O49A 5BXTA 3PUBA 4JRAA 4ISQA 2ZQOA 1RZOB 4ZFYB 2VXTI 5F90A 3UJ4A 2KI6B 1HWNB 3AKGA 2HW9A 9ILBA 1AXMA 4QO3A 3K1XA 1JT5A 4JQ0A 3H6RB 4GOVA 1V6WA 3SNVA 4ZBVB 3HSMA 2DRZA 1I1EA 2NP0A 2Q9XA 1DZCA 1XHBA 3BAUA 1S0BA 1FMZA 4Z9WB 4R6UB 4LO0C 1EPWA 3S8KA 4DCKC 5F8YA 3CA5A 3O3QA 5DUYA 1A8DA 2Z48A 7I1BA 2F2FC 1S0FA 3BTAA 2ET2A 2Z49A 3FJAA 5D62A 3PHZA 3BAVA 5BQUC 1IRAX 4MZHA 3NJ5A 2LIQA 2I1BA 4J23B 5BP5C 3S8JA 1DQGA 1Q03A 1G9DA 1I1BA 4I2SA 3N7KA 4GP0A 3UDAA 5BVPI 4I1EA 2HWAA 4X37A 1TWMA 3V0BA 3E8LC 1W3AA 5D61A 4FGFA 2X2SA 4L4HA 1HWPB 3O4CA 1ONKB 3I2AA 1FWUA 1W3GA 4I7IA 3BAHA 2D20A 1E0OA 3NBCA 4OWJA 1SR4A 4L4IA 4Q9GA 4J2SA 4I4YA 1Z2VA 3Q7WA 4XFTA 4GP3A 2P39A 1RY7A 2KI4A 3IM5A 31BIA 5DSSB 1FV2A 6I1BA 4EFRA 4KC3A 1TTUA 3IIRA 4I96A 1BFCA 3ZXDA 1M2TB 1PUMB 3LLPA 3AKHA 4GAFA 4I37A 4A7KA 4OWLA 2AFGA 4X39A 4G6JA 2J3PA 4I4SA 1TOOA 4EFPA 2AXMA 1V6XA 3CQAA 3I2XA 4AN7B 1CVSA 2FGFA 4QD2C 2RQ9A 1NUNA 4QC4A 2DRYA 3WINA 1S0GA 2VU9A 4KEKA 3O4BA 2MIBA 3HALA 1NZKA 1II4A 1RG8A 3AH2A 3T8SA 3O44A 1P63A 3FJCA 4IY9A 3NBNA 4EB2B 2VSAA 1DFQA 1AF9A 2QYIB 5EG6C 3UJ0A 3VT1A 1T9FA 3WO3A 4I4QA 3FJBA 3OGGA 4G9MA 5B2HA 2Y9GA 8I1BA 1GGPB 2FO1A 4ZOTA 2AAIB 1DFCA 5DZUA 2K8RA 3WO4A 4J2YA 3BA4A 2F8XC 1HIBA 2ZQNA 3VSFA 4EEEB 3BAQA 4WBCA 1ILR1 1FQ9A 1HWOB 5HPZA 1S0EA 1WBCA 3CRGA 4ZFUB 21BIA 2VLCA 4LO3A 1D0HA 2Q3NB 2KLLA 1SR4C 1M16A 1WBAA 3OBRA 4LO7C 5I1BA 3WO2A 1QQKA 3FGMA 1AVWB 3FJJA 3MALA 2K4AB 4IZEA 4OUJA 3A22A 4F34A 2FFVA 5E24E 1PWAA 1OQLB 3W9TA 3RTIB 3BRDA 1ISWA 3A07A 4YOLA 5GAQA 3CA3A 4QKRA 2ZR1B 2RG9B 4P0JA 1TP0A 1BASA 1YTOA 4TLPA 1R8OA 4D8HA 3BAOA 4GOYA 2P23A 4OWKA 1Z0HA 1QQLA 3WMVA 4KEJA 1DJSB 4FVVA 4HJJA 1JLXA 3PMEA 3CA6A 1N4KA 3UD8A 4J2XA 1AVUA 4QKSA 1JT3A 2E4MA 3A23A 1FWVA 1IILA 1Z4SA 3WINC 4Z8SB 4H9WA 2QN4A 4I4UA 1K5UA 3CAHA 3EF2A 1G82A 2ERMA 3QYDA 3D7WB 1G9CA 1XYFA 4GAIA 4KEIA 1K5VA 2D22A 2X2TA 3H6RA 3AKIA 4JKXB 1KNMA 1XZZA 3HOMA 1IT0A 2M49A 1QXMA 4OW4A 3RTJB 5JMCA 1YYNA 4H75A 1WD4A 3FJIA 3JRRA 2MLLB 5EC5A 3BRFA 1PZZA 1BFGA 2D7RA 4KBBA 2RSTA 4LO3C 3P6IA 1YF8B 2BEAA 3N7MA 3UD9A 1FGAA 4CJMA 2DREA 2DS0A 1S0CA 4A7YA 1WD3A 1CE7B 5EHAA 1S0DA 3Q7XA 4A7ZA 3P53A 2D24A 3KMVA 1V6VA 1TWEA 1EYLA 4P0KA 5FNXA 3OJVA 4JAWA 4I1BA 3BX1C 3ZC8A 3H6SE 1BLDA 4ZGRB 3CU1B 4LO2A 3O5WB 4EKXB 3OJ2A 1DLLA 3R4SA 1W3FA 2K43A 2NTDA 3AH1A 1FV3A 1HWMB 3O4AA 3F1RA 2KKIA 4XKIA 1DQOA 1L2HA 1R8NA 5BXPA 1YXWA 1Q04A 2R9KB 3WMUA 1J0SA 4LO8B 4EFQA 4IONA 1G9BA 1MD6A 2E4MC 3LTQA 2WRYA 4QD2B 1G9AA 5JLVA 2AQZA 3POKA 1HCEA 3O4OA 3AH4A 3PG0A 3H6QA 1ISZA 3AJ6A 4XFSA 3R4UA 4QALA 3WA1A 3BB2A 3AKFA 4ISRA 3IM6A 1JY0A 4UY4A 1BLAA 1YBIA 3NBDA 4I4OA 2D43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JT7 A;  5BXR A;  3JUT A;  3ZXG A;  1V6U A;  3C9Z A;  3OJM A;  3Q7Y A;  3RMX A;  4IYB A;  4HA2 A;  1FN0 A;  3V0B B;  2GZB A;  3I29 B;  3BRG C;  3FJF A;  3MPP G;  3OGF A;  3VSZ A;  3O4D A;  5D63 A;  2BEB A;  4H04 A;  4JKQ A;  1VCL A;  3FFZ A;  4D0Z A;  2IWT B;  4DEN A;  4X38 A;  1F31 A;  2NVH A;  3HMY A;  3ILA A;  1ISX A;  4LO7 B;  3FJE A;  1RML A;  4IY8 A;  4J2K A;  3RMY A;  4G1R A;  5F8W A;  3FUO A;  1JQZ A;  3FJ8 A;  3V0A B;  4I4X A;  4AN6 A;  4P0L A;  4Q9P A;  1ISY A;  1EV2 A;  3AJ5 A;  3AZV A;  3QR5 A;  4IQP A;  3VT2 A;  5BXS A;  3RSJ A;  1IOB A;  3VT0 A;  4QBC A;  3V79 C;  4I6I A;  2HWM A;  3FJH A;  3VEQ A;  1TIE A;  4LO2 C;  5FZY A;  3VWC A;  1TFM B;  1PUU B;  4F83 A;  2UUS A;  3CA4 A;  4PC4 A;  4G6M A;  1T4Q A;  4HR6 C;  3IM7 A;  3BAD A;  4D0T A;  2VUA A;  2VSE A;  3CRI A;  4LO1 A;  4I4R A;  1SZ6 B;  2FDB M;  3BAG A;  4II0 A;  4I8M A;  1EVT A;  1BAR A;  2NM1 A;  2KH2 A;  2LIE A;  2FFU A;  2XOA A;  1AVA C;  2D1Z A;  3A21 A;  4IZX A;  2L5X A;  1BFB A;  1XG6 A;  3HN1 A;  5BOW A;  1UPS A;  5FZU A;  1BA7 A;  4I0Y A;  3CA0 A;  3F62 B;  4I4V A;  1JTC A;  2ESU A;  2NYY A;  4OEF A;  3UD7 A;  1IHK A;  2Y9W C;  4ZKT B;  3V0A A;  3N0K A;  4JPZ A;  3VUO A;  4IHZ A;  4USO A;  3IAG C;  2BFH A;  3BA5 A;  4END A;  3N7J A;  2IHO A;  3P6J A;  4ZLB B;  1BFF A;  5DVH A;  1FMM S;  2Y9F A;  2HZ9 A;  4LO0 A;  1AFC A;  3HBW A;  4DEP A;  2F2F A;  1IJT A;  2NZ9 A;  3CRH A;  1PC8 B;  2D7I A;  3CA1 A;  1HCD A;  4P6A A;  5BQU A;  2YUG A;  1Q1U A;  4ZA3 B;  3FJ9 A;  4USP A;  1ITB A;  4I3N A;  5FZZ A;  3ZC9 A;  5BP5 A;  3B9U A;  1HKN A;  1MC9 A;  5F8S A;  1DIW A;  2WBC A;  2GO2 A;  4JP0 A;  1DZD A;  2MC2 A;  5FNW A;  1JLY A;  3OBT A;  1IRP A;  1S0L A;  2D23 A;  4OEE A;  3ZX7 A;  1ISV A;  4X3A A;  5G00 A;  3N7L A;  4OEG A;  2Y9X E;  1JT4 A;  3BA7 A;  2D44 A;  4XFU A;  2VXR A;  41BI A;  4QBV A;  4ZFW B;  1ABR B;  3FJD A;  3FUQ A;  3TC2 A;  1AVX B;  3FJK A;  4I4P A;  3NBE A;  3AZW A;  4LO1 C;  4Q91 A;  4G9N A;  3O49 A;  5BXT A;  3PUB A;  4JRA A;  4ISQ A;  2ZQO A;  1RZO B;  4ZFY B;  2VXT I;  5F90 A;  3UJ4 A;  2KI6 B;  1HWN B;  3AKG A;  2HW9 A;  9ILB A;  1AXM A;  4QO3 A;  3K1X A;  1JT5 A;  4JQ0 A;  3H6R B;  4GOV A;  1V6W A;  3SNV A;  4ZBV B;  3HSM A;  2DRZ A;  1I1E A;  2NP0 A;  2Q9X A;  1DZC A;  1XHB A;  3BAU A;  1S0B A;  1FMZ A;  4Z9W B;  4R6U B;  4LO0 C;  1EPW A;  3S8K A;  4DCK C;  5F8Y A;  3CA5 A;  3O3Q A;  5DUY A;  1A8D A;  2Z48 A;  7I1B A;  2F2F C;  1S0F A;  3BTA A;  2ET2 A;  2Z49 A;  3FJA A;  5D62 A;  3PHZ A;  3BAV A;  5BQU C;  1IRA X;  3NJ5 A;  2LIQ A;  2I1B A;  4J23 B;  5BP5 C;  3S8J A;  1DQG A;  1Q03 A;  1G9D A;  1I1B A;  4I2S A;  3N7K A;  4GP0 A;  3UDA A;  5BVP I;  4I1E A;  2HWA A;  4X37 A;  1TWM A;  3V0B A;  3E8L C;  1W3A A;  5D61 A;  4FGF A;  2X2S A;  4L4H A;  1HWP B;  3O4C A;  1ONK B;  3I2A A;  1FWU A;  1W3G A;  4I7I A;  3BAH A;  2D20 A;  1E0O A;  3NBC A;  4OWJ A;  1SR4 A;  4L4I A;  4Q9G A;  4J2S A;  4I4Y A;  1Z2V A;  3Q7W A;  4XFT A;  4GP3 A;  2P39 A;  1RY7 A;  2KI4 A;  3IM5 A;  31BI A;  5DSS B;  1FV2 A;  6I1B A;  4EFR A;  4KC3 A;  1TTU A;  3IIR A;  4I96 A;  1BFC A;  3ZXD A;  1M2T B;  1PUM B;  3LLP A;  3AKH A;  4GAF A;  4I37 A;  4A7K A;  4OWL A;  2AFG A;  4X39 A;  4G6J A;  2J3P A;  4I4S A;  1TOO A;  4EFP A;  2AXM A;  1V6X A;  3CQA A;  3I2X A;  4AN7 B;  1CVS A;  2FGF A;  4QD2 C;  2RQ9 A;  1NUN A;  4QC4 A;  2DRY A;  3WIN A;  1S0G A;  2VU9 A;  4KEK A;  3O4B A;  2MIB A;  3HAL A;  1NZK A;  1II4 A;  1RG8 A;  3AH2 A;  3T8S A;  3O44 A;  1P63 A;  3FJC A;  4IY9 A;  3NBN A;  4EB2 B;  2VSA A;  1DFQ A;  1AF9 A;  2QYI B;  5EG6 C;  3UJ0 A;  3VT1 A;  1T9F A;  3WO3 A;  4I4Q A;  3FJB A;  3OGG A;  4G9M A;  5B2H A;  2Y9G A;  8I1B A;  1GGP B;  2FO1 A;  4ZOT A;  2AAI B;  1DFC A;  5DZU A;  2K8R A;  3WO4 A;  4J2Y A;  3BA4 A;  2F8X C;  1HIB A;  2ZQN A;  3VSF A;  4EEE B;  3BAQ A;  4WBC A;  1ILR 1;  1FQ9 A;  1HWO B;  5HPZ A;  1S0E A;  1WBC A;  3CRG A;  4ZFU B;  21BI A;  2VLC A;  4LO3 A;  1D0H A;  2Q3N B;  2KLL A;  1SR4 C;  1M16 A;  1WBA A;  3OBR A;  4LO7 C;  5I1B A;  3WO2 A;  1QQK A;  3FGM A;  1AVW B;  3FJJ A;  3MAL A;  2K4A B;  4IZE A;  4OUJ A;  3A22 A;  4F34 A;  2FFV A;  5E24 E;  1PWA A;  1OQL B;  3W9T A;  3RTI B;  3BRD A;  1ISW A;  3A07 A;  4YOL A;  5GAQ A;  3CA3 A;  4QKR A;  2ZR1 B;  2RG9 B;  4P0J A;  1TP0 A;  1BAS A;  1YTO A;  4TLP A;  1R8O A;  4D8H A;  3BAO A;  4GOY A;  2P23 A;  4OWK A;  1Z0H A;  1QQL A;  3WMV A;  4KEJ A;  1DJS B;  4FVV A;  4HJJ A;  1JLX A;  3PME A;  3CA6 A;  1N4K A;  3UD8 A;  4J2X A;  1AVU A;  4QKS A;  1JT3 A;  2E4M A;  3A23 A;  1FWV A;  1IIL A;  1Z4S A;  3WIN C;  4Z8S B;  4H9W A;  2QN4 A;  4I4U A;  1K5U A;  3CAH A;  3EF2 A;  1G82 A;  2ERM A;  3QYD A;  3D7W B;  1G9C A;  1XYF A;  4GAI A;  4KEI A;  1K5V A;  2D22 A;  2X2T A;  3H6R A;  3AKI A;  4JKX B;  1KNM A;  1XZZ A;  3HOM A;  1IT0 A;  2M49 A;  1QXM A;  4OW4 A;  3RTJ B;  5JMC A;  1YYN A;  1WD4 A;  3FJI A;  3JRR A;  2MLL B;  5EC5 A;  3BRF A;  1PZZ A;  1BFG A;  2D7R A;  4KBB A;  2RST A;  4LO3 C;  3P6I A;  1YF8 B;  2BEA A;  3N7M A;  3UD9 A;  1FGA A;  4CJM A;  2DRE A;  2DS0 A;  1S0C A;  4A7Y A;  1WD3 A;  1CE7 B;  5EHA A;  1S0D A;  3Q7X A;  4A7Z A;  3P53 A;  2D24 A;  3KMV A;  1V6V A;  1TWE A;  1EYL A;  4P0K A;  5FNX A;  3OJV A;  4JAW A;  4I1B A;  3BX1 C;  3ZC8 A;  3H6S E;  1BLD A;  4ZGR B;  3CU1 B;  4LO2 A;  3O5W B;  4EKX B;  3OJ2 A;  1DLL A;  3R4S A;  1W3F A;  2K43 A;  2NTD A;  3AH1 A;  1FV3 A;  1HWM B;  3O4A A;  3F1R A;  2KKI A;  4XKI A;  1DQO A;  1L2H A;  1R8N A;  5BXP A;  1YXW A;  1Q04 A;  2R9K B;  3WMU A;  1J0S A;  4LO8 B;  4EFQ A;  4ION A;  1G9B A;  1MD6 A;  2E4M C;  3LTQ A;  2WRY A;  4QD2 B;  1G9A A;  5JLV A;  2AQZ A;  3POK A;  1HCE A;  3O4O A;  3AH4 A;  3PG0 A;  3H6Q A;  1ISZ A;  3AJ6 A;  4XFS A;  3R4U A;  4QAL A;  3WA1 A;  3BB2 A;  3AKF A;  4ISR A;  3IM6 A;  1JY0 A;  1BLA A;  1YBI A;  3NBD A;  4I4O A;  2D43 A; 
#chains in the Genus database with same CATH topology
 1JT7 A;  5BXR A;  3JUT A;  3ZXG A;  1V6U A;  3C9Z A;  3OJM A;  3Q7Y A;  3RMX A;  4IYB A;  4HA2 A;  1FN0 A;  3V0B B;  2GZB A;  3I29 B;  3BRG C;  3FJF A;  3MPP G;  3OGF A;  3VSZ A;  3O4D A;  5D63 A;  2BEB A;  4H04 A;  4JKQ A;  1VCL A;  3FFZ A;  4D0Z A;  2IWT B;  4DEN A;  4X38 A;  4MZG B;  1F31 A;  2NVH A;  3HMY A;  3ILA A;  1ISX A;  4LO7 B;  3FJE A;  1RML A;  4IY8 A;  4J2K A;  3RMY A;  4G1R A;  5F8W A;  3FUO A;  1JQZ A;  3FJ8 A;  3V0A B;  4I4X A;  4AN6 A;  4P0L A;  4Q9P A;  1ISY A;  1EV2 A;  3AJ5 A;  3AZV A;  3QR5 A;  4IQP A;  3VT2 A;  5BXS A;  3RSJ A;  1IOB A;  3VT0 A;  4QBC A;  3V79 C;  4I6I A;  2HWM A;  3FJH A;  3VEQ A;  1TIE A;  4LO2 C;  5FZY A;  3VWC A;  1TFM B;  1PUU B;  4F83 A;  2UUS A;  3CA4 A;  4PC4 A;  4G6M A;  1T4Q A;  4HR6 C;  3IM7 A;  3BAD A;  4D0T A;  2VUA A;  2VSE A;  3CRI A;  4LO1 A;  4I4R A;  1SZ6 B;  2FDB M;  3BAG A;  4II0 A;  4I8M A;  1EVT A;  1BAR A;  2NM1 A;  2KH2 A;  2LIE A;  2FFU A;  2XOA A;  1AVA C;  2D1Z A;  3A21 A;  4IZX A;  2L5X A;  1BFB A;  1XG6 A;  3HN1 A;  5BOW A;  1UPS A;  5FZU A;  1BA7 A;  4I0Y A;  3CA0 A;  3F62 B;  4I4V A;  1JTC A;  2ESU A;  2NYY A;  4OEF A;  3UD7 A;  1IHK A;  2Y9W C;  4ZKT B;  3V0A A;  3N0K A;  4JPZ A;  3VUO A;  4IHZ A;  4USO A;  3IAG C;  2BFH A;  3BA5 A;  4END A;  3N7J A;  2IHO A;  3P6J A;  4ZLB B;  1BFF A;  5DVH A;  1FMM S;  2Y9F A;  2HZ9 A;  4LO0 A;  1AFC A;  3HBW A;  4DEP A;  4MZF B;  2F2F A;  1IJT A;  2NZ9 A;  3CRH A;  1PC8 B;  2D7I A;  3CA1 A;  1HCD A;  4P6A A;  5BQU A;  2YUG A;  1Q1U A;  4ZA3 B;  3FJ9 A;  4USP A;  1ITB A;  4I3N A;  5FZZ A;  3ZC9 A;  5BP5 A;  3B9U A;  1HKN A;  1MC9 A;  5F8S A;  1DIW A;  2WBC A;  2GO2 A;  4JP0 A;  1DZD A;  2MC2 A;  5FNW A;  1JLY A;  3OBT A;  1IRP A;  1S0L A;  2D23 A;  4OEE A;  3ZX7 A;  1ISV A;  4X3A A;  5G00 A;  3N7L A;  4OEG A;  2Y9X E;  1JT4 A;  3BA7 A;  2D44 A;  4XFU A;  2VXR A;  41BI A;  4QBV A;  4ZFW B;  1ABR B;  2NS2 A;  3FJD A;  3FUQ A;  3TC2 A;  1AVX B;  3FJK A;  4I4P A;  3NBE A;  3AZW A;  4LO1 C;  4Q91 A;  4G9N A;  3O49 A;  5BXT A;  3PUB A;  4JRA A;  4ISQ A;  2ZQO A;  1RZO B;  4ZFY B;  2VXT I;  5F90 A;  3UJ4 A;  2KI6 B;  1HWN B;  3AKG A;  2HW9 A;  9ILB A;  1AXM A;  4QO3 A;  3K1X A;  1JT5 A;  4JQ0 A;  3H6R B;  4GOV A;  1V6W A;  3SNV A;  4ZBV B;  3HSM A;  2DRZ A;  1I1E A;  2NP0 A;  2Q9X A;  1DZC A;  1XHB A;  3BAU A;  1S0B A;  1FMZ A;  4Z9W B;  4R6U B;  4LO0 C;  1EPW A;  3S8K A;  4DCK C;  5F8Y A;  3CA5 A;  3O3Q A;  5DUY A;  1A8D A;  2Z48 A;  7I1B A;  2F2F C;  1S0F A;  3BTA A;  2ET2 A;  2Z49 A;  3FJA A;  5D62 A;  3PHZ A;  3BAV A;  5BQU C;  1IRA X;  4MZH A;  3NJ5 A;  2LIQ A;  2I1B A;  4J23 B;  5BP5 C;  3S8J A;  1DQG A;  1Q03 A;  1G9D A;  1I1B A;  4I2S A;  3N7K A;  4GP0 A;  3UDA A;  5BVP I;  4I1E A;  2HWA A;  4X37 A;  1TWM A;  3V0B A;  3E8L C;  1W3A A;  5D61 A;  4FGF A;  2X2S A;  4L4H A;  1HWP B;  3O4C A;  1ONK B;  3I2A A;  1FWU A;  1W3G A;  4I7I A;  3BAH A;  2D20 A;  1E0O A;  3NBC A;  4OWJ A;  1SR4 A;  4L4I A;  4Q9G A;  4J2S A;  4I4Y A;  1Z2V A;  3Q7W A;  4XFT A;  4GP3 A;  2P39 A;  1RY7 A;  2KI4 A;  3IM5 A;  31BI A;  5DSS B;  1FV2 A;  6I1B A;  4EFR A;  4KC3 A;  1TTU A;  3IIR A;  4I96 A;  1BFC A;  3ZXD A;  1M2T B;  1PUM B;  3LLP A;  3AKH A;  4GAF A;  4I37 A;  4A7K A;  4OWL A;  2AFG A;  4X39 A;  4G6J A;  2J3P A;  4I4S A;  1TOO A;  4EFP A;  2AXM A;  1V6X A;  3CQA A;  3I2X A;  4AN7 B;  1CVS A;  2FGF A;  4QD2 C;  2RQ9 A;  1NUN A;  4QC4 A;  2DRY A;  3WIN A;  1S0G A;  2VU9 A;  4KEK A;  3O4B A;  2MIB A;  3HAL A;  1NZK A;  1II4 A;  1RG8 A;  3AH2 A;  3T8S A;  3O44 A;  1P63 A;  3FJC A;  4IY9 A;  3NBN A;  4EB2 B;  2VSA A;  1DFQ A;  1AF9 A;  2QYI B;  5EG6 C;  3UJ0 A;  3VT1 A;  1T9F A;  3WO3 A;  4I4Q A;  3FJB A;  3OGG A;  4G9M A;  5B2H A;  2Y9G A;  8I1B A;  1GGP B;  2FO1 A;  4ZOT A;  2AAI B;  1DFC A;  5DZU A;  2K8R A;  3WO4 A;  4J2Y A;  3BA4 A;  2F8X C;  1HIB A;  2ZQN A;  3VSF A;  4EEE B;  3BAQ A;  4WBC A;  1ILR 1;  1FQ9 A;  1HWO B;  5HPZ A;  1S0E A;  1WBC A;  3CRG A;  4ZFU B;  21BI A;  2VLC A;  4LO3 A;  1D0H A;  2Q3N B;  2KLL A;  1SR4 C;  1M16 A;  1WBA A;  3OBR A;  4LO7 C;  5I1B A;  3WO2 A;  1QQK A;  3FGM A;  1AVW B;  3FJJ A;  3MAL A;  2K4A B;  4IZE A;  4OUJ A;  3A22 A;  4F34 A;  2FFV A;  5E24 E;  1PWA A;  1OQL B;  3W9T A;  3RTI B;  3BRD A;  1ISW A;  3A07 A;  4YOL A;  5GAQ A;  3CA3 A;  4QKR A;  2ZR1 B;  2RG9 B;  4P0J A;  1TP0 A;  1BAS A;  1YTO A;  4TLP A;  1R8O A;  4D8H A;  3BAO A;  4GOY A;  2P23 A;  4OWK A;  1Z0H A;  1QQL A;  3WMV A;  4KEJ A;  1DJS B;  4FVV A;  4HJJ A;  1JLX A;  3PME A;  3CA6 A;  1N4K A;  3UD8 A;  4J2X A;  1AVU A;  4QKS A;  1JT3 A;  2E4M A;  3A23 A;  1FWV A;  1IIL A;  1Z4S A;  3WIN C;  4Z8S B;  4H9W A;  2QN4 A;  4I4U A;  1K5U A;  3CAH A;  3EF2 A;  1G82 A;  2ERM A;  3QYD A;  3D7W B;  1G9C A;  1XYF A;  4GAI A;  4KEI A;  1K5V A;  2D22 A;  2X2T A;  3H6R A;  3AKI A;  4JKX B;  1KNM A;  1XZZ A;  3HOM A;  1IT0 A;  2M49 A;  1QXM A;  4OW4 A;  3RTJ B;  5JMC A;  1YYN A;  4H75 A;  1WD4 A;  3FJI A;  3JRR A;  2MLL B;  5EC5 A;  3BRF A;  1PZZ A;  1BFG A;  2D7R A;  4KBB A;  2RST A;  4LO3 C;  3P6I A;  1YF8 B;  2BEA A;  3N7M A;  3UD9 A;  1FGA A;  4CJM A;  2DRE A;  2DS0 A;  1S0C A;  4A7Y A;  1WD3 A;  1CE7 B;  5EHA A;  1S0D A;  3Q7X A;  4A7Z A;  3P53 A;  2D24 A;  3KMV A;  1V6V A;  1TWE A;  1EYL A;  4P0K A;  5FNX A;  3OJV A;  4JAW A;  4I1B A;  3BX1 C;  3ZC8 A;  3H6S E;  1BLD A;  4ZGR B;  3CU1 B;  4LO2 A;  3O5W B;  4EKX B;  3OJ2 A;  1DLL A;  3R4S A;  1W3F A;  2K43 A;  2NTD A;  3AH1 A;  1FV3 A;  1HWM B;  3O4A A;  3F1R A;  2KKI A;  4XKI A;  1DQO A;  1L2H A;  1R8N A;  5BXP A;  1YXW A;  1Q04 A;  2R9K B;  3WMU A;  1J0S A;  4LO8 B;  4EFQ A;  4ION A;  1G9B A;  1MD6 A;  2E4M C;  3LTQ A;  2WRY A;  4QD2 B;  1G9A A;  5JLV A;  2AQZ A;  3POK A;  1HCE A;  3O4O A;  3AH4 A;  3PG0 A;  3H6Q A;  1ISZ A;  3AJ6 A;  4XFS A;  3R4U A;  4QAL A;  3WA1 A;  3BB2 A;  3AKF A;  4ISR A;  3IM6 A;  1JY0 A;  4UY4 A;  1BLA A;  1YBI A;  3NBD A;  4I4O A;  2D43 A; 
#chains in the Genus database with same CATH homology
 1JT7 A;  5BXR A;  3JUT A;  3ZXG A;  1V6U A;  3C9Z A;  3OJM A;  3Q7Y A;  3RMX A;  4IYB A;  4HA2 A;  1FN0 A;  3V0B B;  2GZB A;  3I29 B;  3BRG C;  3FJF A;  3MPP G;  3OGF A;  3VSZ A;  3O4D A;  5D63 A;  2BEB A;  4H04 A;  4JKQ A;  1VCL A;  3FFZ A;  4D0Z A;  2IWT B;  4DEN A;  4X38 A;  4MZG B;  1F31 A;  2NVH A;  3HMY A;  3ILA A;  1ISX A;  4LO7 B;  3FJE A;  1RML A;  4IY8 A;  4J2K A;  3RMY A;  4G1R A;  5F8W A;  3FUO A;  1JQZ A;  3FJ8 A;  3V0A B;  4I4X A;  4AN6 A;  4P0L A;  4Q9P A;  1ISY A;  1EV2 A;  3AJ5 A;  3AZV A;  3QR5 A;  4IQP A;  3VT2 A;  5BXS A;  3RSJ A;  1IOB A;  3VT0 A;  4QBC A;  3V79 C;  4I6I A;  2HWM A;  3FJH A;  3VEQ A;  1TIE A;  4LO2 C;  5FZY A;  3VWC A;  1TFM B;  1PUU B;  4F83 A;  2UUS A;  3CA4 A;  4PC4 A;  4G6M A;  1T4Q A;  4HR6 C;  3IM7 A;  3BAD A;  4D0T A;  2VUA A;  2VSE A;  3CRI A;  4LO1 A;  4I4R A;  1SZ6 B;  2FDB M;  3BAG A;  4II0 A;  4I8M A;  1EVT A;  1BAR A;  2NM1 A;  2KH2 A;  2LIE A;  2FFU A;  2XOA A;  1AVA C;  2D1Z A;  3A21 A;  4IZX A;  2L5X A;  1BFB A;  1XG6 A;  3HN1 A;  5BOW A;  1UPS A;  5FZU A;  1BA7 A;  4I0Y A;  3CA0 A;  3F62 B;  4I4V A;  1JTC A;  2ESU A;  2NYY A;  4OEF A;  3UD7 A;  1IHK A;  2Y9W C;  4ZKT B;  3V0A A;  3N0K A;  4JPZ A;  3VUO A;  4IHZ A;  4USO A;  3IAG C;  2BFH A;  3BA5 A;  4END A;  3N7J A;  2IHO A;  3P6J A;  4ZLB B;  1BFF A;  5DVH A;  1FMM S;  2Y9F A;  2HZ9 A;  4LO0 A;  1AFC A;  3HBW A;  4DEP A;  4MZF B;  2F2F A;  1IJT A;  2NZ9 A;  3CRH A;  1PC8 B;  2D7I A;  3CA1 A;  1HCD A;  4P6A A;  5BQU A;  2YUG A;  1Q1U A;  4ZA3 B;  3FJ9 A;  4USP A;  1ITB A;  4I3N A;  5FZZ A;  3ZC9 A;  5BP5 A;  3B9U A;  1HKN A;  1MC9 A;  5F8S A;  1DIW A;  2WBC A;  2GO2 A;  4JP0 A;  1DZD A;  2MC2 A;  5FNW A;  1JLY A;  3OBT A;  1IRP A;  1S0L A;  2D23 A;  4OEE A;  3ZX7 A;  1ISV A;  4X3A A;  5G00 A;  3N7L A;  4OEG A;  2Y9X E;  1JT4 A;  3BA7 A;  2D44 A;  4XFU A;  2VXR A;  41BI A;  4QBV A;  4ZFW B;  1ABR B;  2NS2 A;  3FJD A;  3FUQ A;  3TC2 A;  1AVX B;  3FJK A;  4I4P A;  3NBE A;  3AZW A;  4LO1 C;  4Q91 A;  4G9N A;  3O49 A;  5BXT A;  3PUB A;  4JRA A;  4ISQ A;  2ZQO A;  1RZO B;  4ZFY B;  2VXT I;  5F90 A;  3UJ4 A;  2KI6 B;  1HWN B;  3AKG A;  2HW9 A;  9ILB A;  1AXM A;  4QO3 A;  3K1X A;  1JT5 A;  4JQ0 A;  3H6R B;  4GOV A;  1V6W A;  3SNV A;  4ZBV B;  3HSM A;  2DRZ A;  1I1E A;  2NP0 A;  2Q9X A;  1DZC A;  1XHB A;  3BAU A;  1S0B A;  1FMZ A;  4Z9W B;  4R6U B;  4LO0 C;  1EPW A;  3S8K A;  4DCK C;  5F8Y A;  3CA5 A;  3O3Q A;  5DUY A;  1A8D A;  2Z48 A;  7I1B A;  2F2F C;  1S0F A;  3BTA A;  2ET2 A;  2Z49 A;  3FJA A;  5D62 A;  3PHZ A;  3BAV A;  5BQU C;  1IRA X;  4MZH A;  3NJ5 A;  2LIQ A;  2I1B A;  4J23 B;  5BP5 C;  3S8J A;  1DQG A;  1Q03 A;  1G9D A;  1I1B A;  4I2S A;  3N7K A;  4GP0 A;  3UDA A;  5BVP I;  4I1E A;  2HWA A;  4X37 A;  1TWM A;  3V0B A;  3E8L C;  1W3A A;  5D61 A;  4FGF A;  2X2S A;  4L4H A;  1HWP B;  3O4C A;  1ONK B;  3I2A A;  1FWU A;  1W3G A;  4I7I A;  3BAH A;  2D20 A;  1E0O A;  3NBC A;  4OWJ A;  1SR4 A;  4L4I A;  4Q9G A;  4J2S A;  4I4Y A;  1Z2V A;  3Q7W A;  4XFT A;  4GP3 A;  2P39 A;  1RY7 A;  2KI4 A;  3IM5 A;  31BI A;  5DSS B;  1FV2 A;  6I1B A;  4EFR A;  4KC3 A;  1TTU A;  3IIR A;  4I96 A;  1BFC A;  3ZXD A;  1M2T B;  1PUM B;  3LLP A;  3AKH A;  4GAF A;  4I37 A;  4A7K A;  4OWL A;  2AFG A;  4X39 A;  4G6J A;  2J3P A;  4I4S A;  1TOO A;  4EFP A;  2AXM A;  1V6X A;  3CQA A;  3I2X A;  4AN7 B;  1CVS A;  2FGF A;  4QD2 C;  2RQ9 A;  1NUN A;  4QC4 A;  2DRY A;  3WIN A;  1S0G A;  2VU9 A;  4KEK A;  3O4B A;  2MIB A;  3HAL A;  1NZK A;  1II4 A;  1RG8 A;  3AH2 A;  3T8S A;  3O44 A;  1P63 A;  3FJC A;  4IY9 A;  3NBN A;  4EB2 B;  2VSA A;  1DFQ A;  1AF9 A;  2QYI B;  5EG6 C;  3UJ0 A;  3VT1 A;  1T9F A;  3WO3 A;  4I4Q A;  3FJB A;  3OGG A;  4G9M A;  5B2H A;  2Y9G A;  8I1B A;  1GGP B;  2FO1 A;  4ZOT A;  2AAI B;  1DFC A;  5DZU A;  2K8R A;  3WO4 A;  4J2Y A;  3BA4 A;  2F8X C;  1HIB A;  2ZQN A;  3VSF A;  4EEE B;  3BAQ A;  4WBC A;  1ILR 1;  1FQ9 A;  1HWO B;  5HPZ A;  1S0E A;  1WBC A;  3CRG A;  4ZFU B;  21BI A;  2VLC A;  4LO3 A;  1D0H A;  2Q3N B;  2KLL A;  1SR4 C;  1M16 A;  1WBA A;  3OBR A;  4LO7 C;  5I1B A;  3WO2 A;  1QQK A;  3FGM A;  1AVW B;  3FJJ A;  3MAL A;  2K4A B;  4IZE A;  4OUJ A;  3A22 A;  4F34 A;  2FFV A;  5E24 E;  1PWA A;  1OQL B;  3W9T A;  3RTI B;  3BRD A;  1ISW A;  3A07 A;  4YOL A;  5GAQ A;  3CA3 A;  4QKR A;  2ZR1 B;  2RG9 B;  4P0J A;  1TP0 A;  1BAS A;  1YTO A;  4TLP A;  1R8O A;  4D8H A;  3BAO A;  4GOY A;  2P23 A;  4OWK A;  1Z0H A;  1QQL A;  3WMV A;  4KEJ A;  1DJS B;  4FVV A;  4HJJ A;  1JLX A;  3PME A;  3CA6 A;  1N4K A;  3UD8 A;  4J2X A;  1AVU A;  4QKS A;  1JT3 A;  2E4M A;  3A23 A;  1FWV A;  1IIL A;  1Z4S A;  3WIN C;  4Z8S B;  4H9W A;  2QN4 A;  4I4U A;  1K5U A;  3CAH A;  3EF2 A;  1G82 A;  2ERM A;  3QYD A;  3D7W B;  1G9C A;  1XYF A;  4GAI A;  4KEI A;  1K5V A;  2D22 A;  2X2T A;  3H6R A;  3AKI A;  4JKX B;  1KNM A;  1XZZ A;  3HOM A;  1IT0 A;  2M49 A;  1QXM A;  4OW4 A;  3RTJ B;  5JMC A;  1YYN A;  4H75 A;  1WD4 A;  3FJI A;  3JRR A;  2MLL B;  5EC5 A;  3BRF A;  1PZZ A;  1BFG A;  2D7R A;  4KBB A;  2RST A;  4LO3 C;  3P6I A;  1YF8 B;  2BEA A;  3N7M A;  3UD9 A;  1FGA A;  4CJM A;  2DRE A;  2DS0 A;  1S0C A;  4A7Y A;  1WD3 A;  1CE7 B;  5EHA A;  1S0D A;  3Q7X A;  4A7Z A;  3P53 A;  2D24 A;  3KMV A;  1V6V A;  1TWE A;  1EYL A;  4P0K A;  5FNX A;  3OJV A;  4JAW A;  4I1B A;  3BX1 C;  3ZC8 A;  3H6S E;  1BLD A;  4ZGR B;  3CU1 B;  4LO2 A;  3O5W B;  4EKX B;  3OJ2 A;  1DLL A;  3R4S A;  1W3F A;  2K43 A;  2NTD A;  3AH1 A;  1FV3 A;  1HWM B;  3O4A A;  3F1R A;  2KKI A;  4XKI A;  1DQO A;  1L2H A;  1R8N A;  5BXP A;  1YXW A;  1Q04 A;  2R9K B;  3WMU A;  1J0S A;  4LO8 B;  4EFQ A;  4ION A;  1G9B A;  1MD6 A;  2E4M C;  3LTQ A;  2WRY A;  4QD2 B;  1G9A A;  5JLV A;  2AQZ A;  3POK A;  1HCE A;  3O4O A;  3AH4 A;  3PG0 A;  3H6Q A;  1ISZ A;  3AJ6 A;  4XFS A;  3R4U A;  4QAL A;  3WA1 A;  3BB2 A;  3AKF A;  4ISR A;  3IM6 A;  1JY0 A;  4UY4 A;  1BLA A;  1YBI A;  3NBD A;  4I4O A;  2D43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...