2BEBA

X-ray structure of asn to thr mutant of winged bean chymotrypsin inhibitor
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
173
structure length
170
Chain Sequence
b'DLVDAEGNLVETGGTYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSQFLSLFIPRGSLVALGFANPPSCAASPWWTVVDSPQGPAVKLSQQKLPEKDILVFKFEKVSHSNIHVYKLLYCQHDVKCDQYIGIHRDRNGNRRLVVTEENPLELVLLKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin inhibitor 3
publication title Spacer Asn Determines the Fate of Kunitz (STI) Inhibitors, as Revealed by Structural and Biochemical Studies on WCI Mutants.
pubmed doi rcsb
source organism Psophocarpus tetragonolobus
molecule tags Hydrolase inhibitor
total genus 23
structure length 170
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2bebA00
3IM7A 1QQLA 1HWPB 1D0HA 2Z49A 5FNXA 3D7WB 1PWAA 3I29B 2ET2A 1AF9A 2Y9XE 4PC4A 1S0CA 1OQLB 3O4AA 2NYYA 1V6VA 1RG8A 3H6RA 4KC3A 4OWJA 5D62A 4LO7B 3Q7YA 1YTOA 1JT7A 3AZWA 3CA3A 4GP0A 1JT5A 4XFSA 1IILA 1FMZA 3F62B 4A7ZA 1DLLA 5EG6C 1DJSB 4IZXA 3WA1A 4IY8A 3Q7WA 3ZX7A 2D1ZA 3NBNA 4OUJA 3O4BA 1ISZA 3BA5A 4F34A 3FJCA 2ERMA 3WO2A 4DCKC 1AVAC 3CA4A 1BLDA 1PZZA 4QKRA 4CJMA 1ISXA 1DIWA 4IYBA 3BAUA 3AJ6A 2UUSA 4II0A 3PUBA 1QXMA 1W3AA 4ISQA 4P0KA 2F8XC 4LO2A 3BA4A 5HPZA 5BP5A 3HN1A 4D8HA 3BX1C 4G9MA 7I1BA 1TP0A 3H6SE 4X3AA 2D7RA 2HWAA 1RMLA 4JP0A 1VCLA 4USPA 4DENA 1XG6A 2RSTA 1Q04A 3UD7A 2IWTB 3JUTA 4GAIA 4ISRA 4LO3A 3OJMA 5F8YA 1AVXB 1MC9A 1S0EA 4J2XA 1S0DA 1FMMS 3CU1B 1G9BA 3F1RA 4I4UA 5D63A 1JTCA 3ZXDA 5DVHA 3BRGC 2KI6B 4LO1A 2KI4A 5FZUA 5E24E 1TIEA 2KKIA 1V6WA 3A21A 3AKIA 2FGFA 1XYFA 4ZFWB 2MLLB 4I1BA 4I4VA 4I4YA 2Q3NB 2QYIB 3FJAA 1HCEA 2FFVA 2QN4A 4KBBA 2VUAA 4QD2C 5I1BA 21BIA 1EVTA 3UD9A 1ILR1 4R6UB 2FO1A 2K43A 1V6UA 3NBEA 3O5WB 4I37A 4LO7C 2VSEA 2DS0A 3HMYA 4FGFA 3V0BB 1NZKA 4IHZA 1II4A 5FZZA 3POKA 4LO0A 3PMEA 2L5XA 1BFCA 5BXPA 1W3FA 2AAIB 1JT4A 3EF2A 3P53A 1TOOA 2LIEA 3OGGA 4GOVA 4EKXB 1JLYA 3FJDA 4WBCA 3KMVA 3O4DA 5BOWA 4ZKTB 2K4AB 2MIBA 4FVVA 4QALA 3NBCA 3A07A 1BARA 2YUGA 1TFMB 9ILBA 4L4HA 4I4XA 1I1EA 1W3GA 1HCDA 3CRGA 4I4SA 4HJJA 3SNVA 2DRZA 1WBAA 1KNMA 1FQ9A 3R4SA 3WINA 3AKGA 3V0AB 4AN6A 1R8OA 5F90A 3RTJB 1G9AA 1NUNA 3MPPG 4GAFA 4QD2B 5EC5A 1DQOA 1N4KA 1SR4C 3VSFA 1V6XA 1YF8B 4P0LA 1K5VA 3OBTA 1FV2A 3BTAA 1TTUA 1MD6A 4L4IA 3FJ8A 1J0SA 4J23B 2D22A 3UJ0A 1BFBA 3VT2A 4P6AA 3HSMA 3BAGA 2BEAA 2WRYA 4GP3A 4A7KA 4Q91A 1DQGA 2RG9B 3NBDA 1F31A 2M49A 4LO2C 2F2FA 3AH2A 3JRRA 3O4CA 1ONKB 5FNWA 1TWMA 1T9FA 2Q9XA 3H6RB 3UJ4A 1IRPA 5FZYA 2D24A 3O3QA 3WO3A 4G1RA 4JPZA 4Q9GA 3AH1A 4KEJA 3VWCA 5BXRA 3I2AA 3CA0A 2D7IA 3WMUA 4ZFUB 4GOYA 4I4PA 1AVWB 2FDBM 1IT0A 4ZOTA 3FUQA 1DZCA 4QC4A 3A23A 4LO1C 3P6JA 3HBWA 4X37A 1M16A 1SZ6B 2X2TA 2Y9FA 1S0LA 1IHKA 3RTIB 1QQKA 2Y9GA 1JLXA 4OWKA 2E4MC 3FJHA 3ZXGA 3OJ2A 4J2SA 2HZ9A 3BAHA 1ISWA 2BEBA 4ZGRB 3CRIA 4D0ZA 5JLVA 4F83A 4EEEB 2DREA 1PC8B 1HWOB 3PHZA 1HWMB 4XFUA 5BXSA 4OW4A 1ABRB 3Q7XA 1S0GA 4G6JA 1DZDA 4G6MA 3LLPA 1YBIA 2AFGA 3VT1A 4JRAA 2P23A 3T8SA 1AFCA 2NM1A 2NP0A 3UDAA 3V79C 3H6QA 3BA7A 2GO2A 4I2SA 1AXMA 4EFQA 1E0OA 1HKNA 2D43A 1Q1UA 2XOAA 2X2SA 3NJ5A 4LO8B 4QBVA 2NTDA 4JKQA 4DEPA 6I1BA 3RSJA 2D44A 3FJEA 4USOA 3TC2A 3ZC9A 2D23A 1FV3A 5DUYA 1ISVA 4QO3A 3HALA 1PUMB 2Z48A 1JQZA 4EFPA 1R8NA 1Z0HA 4EFRA 2NVHA 4Z9WB 4IONA 4TLPA 3FJFA 1RY7A 2KH2A 3AZVA 1RZOB 3CQAA 4ZA3B 1WD4A 3OGFA 1BLAA 3C9ZA 3IM6A 1FWVA 4A7YA 4JKXB 3VUOA 3A22A 1DFQA 1UPSA 3FFZA 3CA5A 1XHBA 5BQUA 3WMVA 3P6IA 2AQZA 2Y9WC 4H9WA 1CE7B 3BAOA 1JY0A 4J2YA 1M2TB 4EB2B 31BIA 1K5UA 4YOLA 3O4OA 4Z8SB 2R9KB 3FGMA 3S8KA 2F2FC 2J3PA 3BAQA 2D20A 3ILAA 3K1XA 3RMXA 3N7KA 4IY9A 2LIQA 1A8DA 1G9CA 3R4UA 4KEIA 5BP5C 3B9UA 5G00A 2AXMA 1G9DA 2GZBA 1SR4A 1XZZA 3OBRA 4P0JA 4X38A 1IRAX 1P63A 4I1EA 2VXTI 1FWUA 3MALA 4XKIA 1HIBA 1EPWA 3OJVA 1S0FA 4I96A 3IAGC 4LO3C 3PG0A 2BFHA 5D61A 1GGPB 4QKSA 4H04A 1PUUB 4I8MA 4KEKA 1T4QA 1JT3A 1DFCA 5EHAA 4HA2A 2VLCA 1EYLA 1WBCA 3S8JA 3CRHA 3FUOA 1WD3A 4OEEA 2WBCA 2IHOA 1CVSA 3N0KA 3CA6A 3BRFA 3LTQA 1YYNA 4X39A 3FJJA 2DRYA 41BIA 3O49A 3O44A 1EV2A 2VSAA 4ZLBB 1AVUA 4ZBVB 3V0BA 1S0BA 2HW9A 1Z2VA 1TWEA 4LO0C 1YXWA 3BRDA 5F8SA 3BAVA 4AN7B 4QBCA 3VSZA 2HWMA 4Q9PA 4HR6C 1BA7A 1FN0A 3E8LC 3N7JA 3FJIA 2MC2A 4XFTA 3FJKA 1FGAA 1HWNB 3AH4A 3N7MA 4I4RA 4I4OA 4OEFA 5GAQA 3BADA 3QR5A 4ENDA 2E4MA 3QYDA 1I1BA 2VU9A 4ZFYB 2ESUA 2ZQOA 4G9NA 4I3NA 5BVPI 3IIRA 1BASA 1ITBA 3WO4A 4JQ0A 3UD8A 4I6IA 3WINC 4OEGA 1IJTA 3VEQA 2KLLA 2RQ9A 2ZR1B 3V0AA 2P39A 3IM5A 3N7LA 3FJBA 3HOMA 1Z4SA 2VXRA 3I2XA 3CAHA 5B2HA 4I4QA 1BFGA 4I0YA 1Q03A 1ISYA 2NZ9A 2ZQNA 4IQPA 5DZUA 3AKHA 1IOBA 5BQUC 1G82A 3VT0A 4IZEA 3RMYA 3ZC8A 5JMCA 3CA1A 5DSSB 5BXTA 3AJ5A 1L2HA 3AKFA 4JAWA 2I1BA 4I7IA 4D0TA 4J2KA 5F8WA 3FJ9A 4OWLA 2FFUA 3W9TA 8I1BA 1BFFA 3BB2A 2K8RA
chains in the Genus database with same CATH superfamily
3IM7A 1QQLA 1HWPB 1D0HA 2Z49A 5FNXA 3D7WB 1PWAA 3I29B 2ET2A 1AF9A 2Y9XE 4PC4A 1S0CA 1OQLB 4UY4A 3O4AA 2NYYA 1V6VA 1RG8A 3H6RA 4KC3A 4OWJA 5D62A 4LO7B 3Q7YA 1YTOA 1JT7A 3AZWA 3CA3A 4GP0A 1JT5A 4XFSA 1IILA 1FMZA 3F62B 4A7ZA 4MZHA 1DLLA 5EG6C 1DJSB 4IZXA 3WA1A 4IY8A 3Q7WA 3ZX7A 2D1ZA 3NBNA 4OUJA 3O4BA 1ISZA 3BA5A 4F34A 3FJCA 2ERMA 3WO2A 4DCKC 1AVAC 3CA4A 1BLDA 1PZZA 4QKRA 4CJMA 1ISXA 4H75A 1DIWA 4IYBA 3BAUA 3AJ6A 2UUSA 4II0A 3PUBA 1QXMA 1W3AA 4ISQA 4P0KA 2F8XC 4LO2A 3BA4A 5HPZA 5BP5A 3HN1A 4D8HA 3BX1C 4G9MA 7I1BA 1TP0A 3H6SE 4X3AA 2D7RA 2HWAA 1RMLA 4JP0A 1VCLA 4USPA 4DENA 1XG6A 2RSTA 1Q04A 3UD7A 2IWTB 3JUTA 4GAIA 4ISRA 4LO3A 3OJMA 5F8YA 1AVXB 1MC9A 1S0EA 4J2XA 1S0DA 1FMMS 3CU1B 1G9BA 3F1RA 4I4UA 5D63A 1JTCA 3ZXDA 5DVHA 3BRGC 2KI6B 4LO1A 2KI4A 5FZUA 5E24E 1TIEA 2KKIA 1V6WA 3A21A 3AKIA 2FGFA 1XYFA 4ZFWB 2MLLB 4I1BA 4I4VA 4I4YA 2Q3NB 2QYIB 3FJAA 1HCEA 2FFVA 2QN4A 4KBBA 2VUAA 4QD2C 5I1BA 21BIA 1EVTA 3UD9A 1ILR1 4R6UB 2FO1A 2K43A 1V6UA 3NBEA 3O5WB 4I37A 4LO7C 2VSEA 2DS0A 3HMYA 4FGFA 3V0BB 1NZKA 4IHZA 1II4A 5FZZA 3POKA 4LO0A 3PMEA 2L5XA 1BFCA 5BXPA 1W3FA 2AAIB 1JT4A 3EF2A 3P53A 1TOOA 2LIEA 3OGGA 4GOVA 4EKXB 1JLYA 3FJDA 4WBCA 3KMVA 3O4DA 5BOWA 4ZKTB 2K4AB 2MIBA 4FVVA 4QALA 3NBCA 3A07A 1BARA 2YUGA 1TFMB 9ILBA 4L4HA 4I4XA 1I1EA 1W3GA 1HCDA 3CRGA 4I4SA 4HJJA 3SNVA 2DRZA 1WBAA 1KNMA 1FQ9A 3R4SA 3WINA 3AKGA 3V0AB 4AN6A 1R8OA 5F90A 3RTJB 1G9AA 1NUNA 3MPPG 4GAFA 4QD2B 5EC5A 1DQOA 1N4KA 1SR4C 3VSFA 1V6XA 1YF8B 4P0LA 1K5VA 3OBTA 1FV2A 3BTAA 1TTUA 1MD6A 4L4IA 3FJ8A 1J0SA 4J23B 2D22A 3UJ0A 1BFBA 3VT2A 4P6AA 3HSMA 3BAGA 2BEAA 2WRYA 4GP3A 4A7KA 4Q91A 1DQGA 2RG9B 3NBDA 1F31A 2M49A 4LO2C 2F2FA 3AH2A 3JRRA 3O4CA 1ONKB 5FNWA 1TWMA 1T9FA 2Q9XA 3H6RB 3UJ4A 1IRPA 5FZYA 2D24A 3O3QA 3WO3A 4G1RA 4JPZA 4Q9GA 3AH1A 4KEJA 3VWCA 5BXRA 3I2AA 3CA0A 2D7IA 3WMUA 4ZFUB 4GOYA 4I4PA 1AVWB 2FDBM 1IT0A 4ZOTA 3FUQA 1DZCA 4QC4A 3A23A 4LO1C 3P6JA 3HBWA 4X37A 1M16A 1SZ6B 2X2TA 2Y9FA 1S0LA 1IHKA 3RTIB 1QQKA 2Y9GA 1JLXA 4OWKA 2E4MC 3FJHA 3ZXGA 3OJ2A 4J2SA 2HZ9A 3BAHA 1ISWA 2BEBA 4ZGRB 3CRIA 4D0ZA 5JLVA 4F83A 4EEEB 2DREA 1PC8B 1HWOB 3PHZA 1HWMB 4XFUA 5BXSA 4OW4A 1ABRB 3Q7XA 1S0GA 4G6JA 1DZDA 4MZGB 4G6MA 3LLPA 1YBIA 2AFGA 3VT1A 4JRAA 2P23A 3T8SA 1AFCA 2NM1A 2NP0A 3UDAA 3V79C 3H6QA 3BA7A 2GO2A 4I2SA 1AXMA 4EFQA 1E0OA 1HKNA 2D43A 1Q1UA 2XOAA 2X2SA 3NJ5A 4LO8B 4QBVA 2NTDA 4JKQA 4DEPA 6I1BA 3RSJA 2D44A 3FJEA 4USOA 3TC2A 3ZC9A 2D23A 1FV3A 5DUYA 1ISVA 4QO3A 3HALA 1PUMB 2Z48A 1JQZA 4EFPA 1R8NA 1Z0HA 4EFRA 2NVHA 4Z9WB 4IONA 4TLPA 3FJFA 1RY7A 2KH2A 3AZVA 1RZOB 3CQAA 4ZA3B 1WD4A 3OGFA 1BLAA 3C9ZA 3IM6A 1FWVA 4A7YA 4JKXB 3VUOA 3A22A 1DFQA 1UPSA 3FFZA 3CA5A 1XHBA 5BQUA 3WMVA 3P6IA 2AQZA 2Y9WC 4H9WA 1CE7B 3BAOA 1JY0A 4J2YA 1M2TB 4EB2B 31BIA 1K5UA 4YOLA 3O4OA 4Z8SB 2R9KB 3FGMA 3S8KA 2F2FC 2J3PA 3BAQA 2D20A 3ILAA 3K1XA 3RMXA 3N7KA 4IY9A 2LIQA 1A8DA 1G9CA 3R4UA 4KEIA 5BP5C 3B9UA 5G00A 2AXMA 1G9DA 2GZBA 1SR4A 1XZZA 3OBRA 4P0JA 4X38A 1IRAX 1P63A 4I1EA 2VXTI 1FWUA 3MALA 4XKIA 1HIBA 1EPWA 3OJVA 1S0FA 4I96A 3IAGC 4LO3C 3PG0A 2BFHA 5D61A 1GGPB 4QKSA 4H04A 1PUUB 4I8MA 4KEKA 1T4QA 1JT3A 1DFCA 5EHAA 4HA2A 2VLCA 1EYLA 1WBCA 3S8JA 3CRHA 3FUOA 1WD3A 4OEEA 2WBCA 2IHOA 1CVSA 3N0KA 3CA6A 3BRFA 3LTQA 1YYNA 4X39A 3FJJA 2DRYA 41BIA 3O49A 3O44A 1EV2A 2VSAA 4ZLBB 1AVUA 4ZBVB 3V0BA 1S0BA 2HW9A 1Z2VA 1TWEA 4LO0C 1YXWA 3BRDA 5F8SA 3BAVA 4AN7B 4QBCA 3VSZA 2HWMA 4Q9PA 4HR6C 1BA7A 1FN0A 3E8LC 3N7JA 3FJIA 2MC2A 4XFTA 3FJKA 1FGAA 1HWNB 3AH4A 3N7MA 4I4RA 4I4OA 4OEFA 5GAQA 3BADA 3QR5A 4ENDA 2E4MA 3QYDA 1I1BA 2VU9A 4ZFYB 2ESUA 2ZQOA 4G9NA 4I3NA 5BVPI 3IIRA 1BASA 1ITBA 3WO4A 4JQ0A 3UD8A 4I6IA 3WINC 4OEGA 1IJTA 3VEQA 2KLLA 2RQ9A 2ZR1B 3V0AA 2P39A 3IM5A 3N7LA 3FJBA 3HOMA 1Z4SA 2VXRA 2NS2A 3I2XA 3CAHA 5B2HA 4I4QA 1BFGA 4I0YA 1Q03A 1ISYA 2NZ9A 2ZQNA 4IQPA 5DZUA 3AKHA 1IOBA 4MZFB 5BQUC 1G82A 3VT0A 4IZEA 3RMYA 3ZC8A 5JMCA 3CA1A 5DSSB 5BXTA 3AJ5A 1L2HA 3AKFA 4JAWA 2I1BA 4I7IA 4D0TA 4J2KA 5F8WA 3FJ9A 4OWLA 2FFUA 3W9TA 8I1BA 1BFFA 3BB2A 2K8RA
chains in the Genus database with same CATH topology
3IM7A 1QQLA 1HWPB 1D0HA 2Z49A 5FNXA 3D7WB 1PWAA 3I29B 2ET2A 1AF9A 2Y9XE 4PC4A 1S0CA 1OQLB 4UY4A 3O4AA 2NYYA 1V6VA 1RG8A 3H6RA 4KC3A 4OWJA 5D62A 4LO7B 3Q7YA 1YTOA 1JT7A 3AZWA 3CA3A 4GP0A 1JT5A 4XFSA 1IILA 1FMZA 3F62B 4A7ZA 4MZHA 1DLLA 5EG6C 1DJSB 4IZXA 3WA1A 4IY8A 3Q7WA 3ZX7A 2D1ZA 3NBNA 4OUJA 3O4BA 1ISZA 3BA5A 4F34A 3FJCA 2ERMA 3WO2A 4DCKC 1AVAC 3CA4A 1BLDA 1PZZA 4QKRA 4CJMA 1ISXA 4H75A 1DIWA 4IYBA 3BAUA 3AJ6A 2UUSA 4II0A 3PUBA 1QXMA 1W3AA 4ISQA 4P0KA 2F8XC 4LO2A 3BA4A 5HPZA 5BP5A 3HN1A 4D8HA 3BX1C 4G9MA 7I1BA 1TP0A 3H6SE 4X3AA 2D7RA 2HWAA 1RMLA 4JP0A 1VCLA 4USPA 4DENA 1XG6A 2RSTA 1Q04A 3UD7A 2IWTB 3JUTA 4GAIA 4ISRA 4LO3A 3OJMA 5F8YA 1AVXB 1MC9A 1S0EA 4J2XA 1S0DA 1FMMS 3CU1B 1G9BA 3F1RA 4I4UA 5D63A 1JTCA 3ZXDA 5DVHA 3BRGC 2KI6B 4LO1A 2KI4A 5FZUA 5E24E 1TIEA 2KKIA 1V6WA 3A21A 3AKIA 2FGFA 1XYFA 4ZFWB 2MLLB 4I1BA 4I4VA 4I4YA 2Q3NB 2QYIB 3FJAA 1HCEA 2FFVA 2QN4A 4KBBA 2VUAA 4QD2C 5I1BA 21BIA 1EVTA 3UD9A 1ILR1 4R6UB 2FO1A 2K43A 1V6UA 3NBEA 3O5WB 4I37A 4LO7C 2VSEA 2DS0A 3HMYA 4FGFA 3V0BB 1NZKA 4IHZA 1II4A 5FZZA 3POKA 4LO0A 3PMEA 2L5XA 1BFCA 5BXPA 1W3FA 2AAIB 1JT4A 3EF2A 3P53A 1TOOA 2LIEA 3OGGA 4GOVA 4EKXB 1JLYA 3FJDA 4WBCA 3KMVA 3O4DA 5BOWA 4ZKTB 2K4AB 2MIBA 4FVVA 4QALA 3NBCA 3A07A 1BARA 2YUGA 1TFMB 9ILBA 4L4HA 4I4XA 1I1EA 1W3GA 1HCDA 3CRGA 4I4SA 4HJJA 3SNVA 2DRZA 1WBAA 1KNMA 1FQ9A 3R4SA 3WINA 3AKGA 3V0AB 4AN6A 1R8OA 5F90A 3RTJB 1G9AA 1NUNA 3MPPG 4GAFA 4QD2B 5EC5A 1DQOA 1N4KA 1SR4C 3VSFA 1V6XA 1YF8B 4P0LA 1K5VA 3OBTA 1FV2A 3BTAA 1TTUA 1MD6A 4L4IA 3FJ8A 1J0SA 4J23B 2D22A 3UJ0A 1BFBA 3VT2A 4P6AA 3HSMA 3BAGA 2BEAA 2WRYA 4GP3A 4A7KA 4Q91A 1DQGA 2RG9B 3NBDA 1F31A 2M49A 4LO2C 2F2FA 3AH2A 3JRRA 3O4CA 1ONKB 5FNWA 1TWMA 1T9FA 2Q9XA 3H6RB 3UJ4A 1IRPA 5FZYA 2D24A 3O3QA 3WO3A 4G1RA 4JPZA 4Q9GA 3AH1A 4KEJA 3VWCA 5BXRA 3I2AA 3CA0A 2D7IA 3WMUA 4ZFUB 4GOYA 4I4PA 1AVWB 2FDBM 1IT0A 4ZOTA 3FUQA 1DZCA 4QC4A 3A23A 4LO1C 3P6JA 3HBWA 4X37A 1M16A 1SZ6B 2X2TA 2Y9FA 1S0LA 1IHKA 3RTIB 1QQKA 2Y9GA 1JLXA 4OWKA 2E4MC 3FJHA 3ZXGA 3OJ2A 4J2SA 2HZ9A 3BAHA 1ISWA 2BEBA 4ZGRB 3CRIA 4D0ZA 5JLVA 4F83A 4EEEB 2DREA 1PC8B 1HWOB 3PHZA 1HWMB 4XFUA 5BXSA 4OW4A 1ABRB 3Q7XA 1S0GA 4G6JA 1DZDA 4MZGB 4G6MA 3LLPA 1YBIA 2AFGA 3VT1A 4JRAA 2P23A 3T8SA 1AFCA 2NM1A 2NP0A 3UDAA 3V79C 3H6QA 3BA7A 2GO2A 4I2SA 1AXMA 4EFQA 1E0OA 1HKNA 2D43A 1Q1UA 2XOAA 2X2SA 3NJ5A 4LO8B 4QBVA 2NTDA 4JKQA 4DEPA 6I1BA 3RSJA 2D44A 3FJEA 4USOA 3TC2A 3ZC9A 2D23A 1FV3A 5DUYA 1ISVA 4QO3A 3HALA 1PUMB 2Z48A 1JQZA 4EFPA 1R8NA 1Z0HA 4EFRA 2NVHA 4Z9WB 4IONA 4TLPA 3FJFA 1RY7A 2KH2A 3AZVA 1RZOB 3CQAA 4ZA3B 1WD4A 3OGFA 1BLAA 3C9ZA 3IM6A 1FWVA 4A7YA 4JKXB 3VUOA 3A22A 1DFQA 1UPSA 3FFZA 3CA5A 1XHBA 5BQUA 3WMVA 3P6IA 2AQZA 2Y9WC 4H9WA 1CE7B 3BAOA 1JY0A 4J2YA 1M2TB 4EB2B 31BIA 1K5UA 4YOLA 3O4OA 4Z8SB 2R9KB 3FGMA 3S8KA 2F2FC 2J3PA 3BAQA 2D20A 3ILAA 3K1XA 3RMXA 3N7KA 4IY9A 2LIQA 1A8DA 1G9CA 3R4UA 4KEIA 5BP5C 3B9UA 5G00A 2AXMA 1G9DA 2GZBA 1SR4A 1XZZA 3OBRA 4P0JA 4X38A 1IRAX 1P63A 4I1EA 2VXTI 1FWUA 3MALA 4XKIA 1HIBA 1EPWA 3OJVA 1S0FA 4I96A 3IAGC 4LO3C 3PG0A 2BFHA 5D61A 1GGPB 4QKSA 4H04A 1PUUB 4I8MA 4KEKA 1T4QA 1JT3A 1DFCA 5EHAA 4HA2A 2VLCA 1EYLA 1WBCA 3S8JA 3CRHA 3FUOA 1WD3A 4OEEA 2WBCA 2IHOA 1CVSA 3N0KA 3CA6A 3BRFA 3LTQA 1YYNA 4X39A 3FJJA 2DRYA 41BIA 3O49A 3O44A 1EV2A 2VSAA 4ZLBB 1AVUA 4ZBVB 3V0BA 1S0BA 2HW9A 1Z2VA 1TWEA 4LO0C 1YXWA 3BRDA 5F8SA 3BAVA 4AN7B 4QBCA 3VSZA 2HWMA 4Q9PA 4HR6C 1BA7A 1FN0A 3E8LC 3N7JA 3FJIA 2MC2A 4XFTA 3FJKA 1FGAA 1HWNB 3AH4A 3N7MA 4I4RA 4I4OA 4OEFA 5GAQA 3BADA 3QR5A 4ENDA 2E4MA 3QYDA 1I1BA 2VU9A 4ZFYB 2ESUA 2ZQOA 4G9NA 4I3NA 5BVPI 3IIRA 1BASA 1ITBA 3WO4A 4JQ0A 3UD8A 4I6IA 3WINC 4OEGA 1IJTA 3VEQA 2KLLA 2RQ9A 2ZR1B 3V0AA 2P39A 3IM5A 3N7LA 3FJBA 3HOMA 1Z4SA 2VXRA 2NS2A 3I2XA 3CAHA 5B2HA 4I4QA 1BFGA 4I0YA 1Q03A 1ISYA 2NZ9A 2ZQNA 4IQPA 5DZUA 3AKHA 1IOBA 4MZFB 5BQUC 1G82A 3VT0A 4IZEA 3RMYA 3ZC8A 5JMCA 3CA1A 5DSSB 5BXTA 3AJ5A 1L2HA 3AKFA 4JAWA 2I1BA 4I7IA 4D0TA 4J2KA 5F8WA 3FJ9A 4OWLA 2FFUA 3W9TA 8I1BA 1BFFA 3BB2A 2K8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IM7 A;  1QQL A;  1HWP B;  1D0H A;  2Z49 A;  5FNX A;  3D7W B;  1PWA A;  3I29 B;  2ET2 A;  1AF9 A;  2Y9X E;  4PC4 A;  1S0C A;  1OQL B;  3O4A A;  2NYY A;  1V6V A;  1RG8 A;  3H6R A;  4KC3 A;  4OWJ A;  5D62 A;  4LO7 B;  3Q7Y A;  1YTO A;  1JT7 A;  3AZW A;  3CA3 A;  4GP0 A;  1JT5 A;  4XFS A;  1IIL A;  1FMZ A;  3F62 B;  4A7Z A;  1DLL A;  5EG6 C;  1DJS B;  4IZX A;  3WA1 A;  4IY8 A;  3Q7W A;  3ZX7 A;  2D1Z A;  3NBN A;  4OUJ A;  3O4B A;  1ISZ A;  3BA5 A;  4F34 A;  3FJC A;  2ERM A;  3WO2 A;  4DCK C;  1AVA C;  3CA4 A;  1BLD A;  1PZZ A;  4QKR A;  4CJM A;  1ISX A;  1DIW A;  4IYB A;  3BAU A;  3AJ6 A;  2UUS A;  4II0 A;  3PUB A;  1QXM A;  1W3A A;  4ISQ A;  4P0K A;  2F8X C;  4LO2 A;  3BA4 A;  5HPZ A;  5BP5 A;  3HN1 A;  4D8H A;  3BX1 C;  4G9M A;  7I1B A;  1TP0 A;  3H6S E;  4X3A A;  2D7R A;  2HWA A;  1RML A;  4JP0 A;  1VCL A;  4USP A;  4DEN A;  1XG6 A;  2RST A;  1Q04 A;  3UD7 A;  2IWT B;  3JUT A;  4GAI A;  4ISR A;  4LO3 A;  3OJM A;  5F8Y A;  1AVX B;  1MC9 A;  1S0E A;  4J2X A;  1S0D A;  1FMM S;  3CU1 B;  1G9B A;  3F1R A;  4I4U A;  5D63 A;  1JTC A;  3ZXD A;  5DVH A;  3BRG C;  2KI6 B;  4LO1 A;  2KI4 A;  5FZU A;  5E24 E;  1TIE A;  2KKI A;  1V6W A;  3A21 A;  3AKI A;  2FGF A;  1XYF A;  4ZFW B;  2MLL B;  4I1B A;  4I4V A;  4I4Y A;  2Q3N B;  2QYI B;  3FJA A;  1HCE A;  2FFV A;  2QN4 A;  4KBB A;  2VUA A;  4QD2 C;  5I1B A;  21BI A;  1EVT A;  3UD9 A;  1ILR 1;  4R6U B;  2FO1 A;  2K43 A;  1V6U A;  3NBE A;  3O5W B;  4I37 A;  4LO7 C;  2VSE A;  2DS0 A;  3HMY A;  4FGF A;  3V0B B;  1NZK A;  4IHZ A;  1II4 A;  5FZZ A;  3POK A;  4LO0 A;  3PME A;  2L5X A;  1BFC A;  5BXP A;  1W3F A;  2AAI B;  1JT4 A;  3EF2 A;  3P53 A;  1TOO A;  2LIE A;  3OGG A;  4GOV A;  4EKX B;  1JLY A;  3FJD A;  4WBC A;  3KMV A;  3O4D A;  5BOW A;  4ZKT B;  2K4A B;  2MIB A;  4FVV A;  4QAL A;  3NBC A;  3A07 A;  1BAR A;  2YUG A;  1TFM B;  9ILB A;  4L4H A;  4I4X A;  1I1E A;  1W3G A;  1HCD A;  3CRG A;  4I4S A;  4HJJ A;  3SNV A;  2DRZ A;  1WBA A;  1KNM A;  1FQ9 A;  3R4S A;  3WIN A;  3AKG A;  3V0A B;  4AN6 A;  1R8O A;  5F90 A;  3RTJ B;  1G9A A;  1NUN A;  3MPP G;  4GAF A;  4QD2 B;  5EC5 A;  1DQO A;  1N4K A;  1SR4 C;  3VSF A;  1V6X A;  1YF8 B;  4P0L A;  1K5V A;  3OBT A;  1FV2 A;  3BTA A;  1TTU A;  1MD6 A;  4L4I A;  3FJ8 A;  1J0S A;  4J23 B;  2D22 A;  3UJ0 A;  1BFB A;  3VT2 A;  4P6A A;  3HSM A;  3BAG A;  2BEA A;  2WRY A;  4GP3 A;  4A7K A;  4Q91 A;  1DQG A;  2RG9 B;  3NBD A;  1F31 A;  2M49 A;  4LO2 C;  2F2F A;  3AH2 A;  3JRR A;  3O4C A;  1ONK B;  5FNW A;  1TWM A;  1T9F A;  2Q9X A;  3H6R B;  3UJ4 A;  1IRP A;  5FZY A;  2D24 A;  3O3Q A;  3WO3 A;  4G1R A;  4JPZ A;  4Q9G A;  3AH1 A;  4KEJ A;  3VWC A;  5BXR A;  3I2A A;  3CA0 A;  2D7I A;  3WMU A;  4ZFU B;  4GOY A;  4I4P A;  1AVW B;  2FDB M;  1IT0 A;  4ZOT A;  3FUQ A;  1DZC A;  4QC4 A;  3A23 A;  4LO1 C;  3P6J A;  3HBW A;  4X37 A;  1M16 A;  1SZ6 B;  2X2T A;  2Y9F A;  1S0L A;  1IHK A;  3RTI B;  1QQK A;  2Y9G A;  1JLX A;  4OWK A;  2E4M C;  3FJH A;  3ZXG A;  3OJ2 A;  4J2S A;  2HZ9 A;  3BAH A;  1ISW A;  2BEB A;  4ZGR B;  3CRI A;  4D0Z A;  5JLV A;  4F83 A;  4EEE B;  2DRE A;  1PC8 B;  1HWO B;  3PHZ A;  1HWM B;  4XFU A;  5BXS A;  4OW4 A;  1ABR B;  3Q7X A;  1S0G A;  4G6J A;  1DZD A;  4G6M A;  3LLP A;  1YBI A;  2AFG A;  3VT1 A;  4JRA A;  2P23 A;  3T8S A;  1AFC A;  2NM1 A;  2NP0 A;  3UDA A;  3V79 C;  3H6Q A;  3BA7 A;  2GO2 A;  4I2S A;  1AXM A;  4EFQ A;  1E0O A;  1HKN A;  2D43 A;  1Q1U A;  2XOA A;  2X2S A;  3NJ5 A;  4LO8 B;  4QBV A;  2NTD A;  4JKQ A;  4DEP A;  6I1B A;  3RSJ A;  2D44 A;  3FJE A;  4USO A;  3TC2 A;  3ZC9 A;  2D23 A;  1FV3 A;  5DUY A;  1ISV A;  4QO3 A;  3HAL A;  1PUM B;  2Z48 A;  1JQZ A;  4EFP A;  1R8N A;  1Z0H A;  4EFR A;  2NVH A;  4Z9W B;  4ION A;  4TLP A;  3FJF A;  1RY7 A;  2KH2 A;  3AZV A;  1RZO B;  3CQA A;  4ZA3 B;  1WD4 A;  3OGF A;  1BLA A;  3C9Z A;  3IM6 A;  1FWV A;  4A7Y A;  4JKX B;  3VUO A;  3A22 A;  1DFQ A;  1UPS A;  3FFZ A;  3CA5 A;  1XHB A;  5BQU A;  3WMV A;  3P6I A;  2AQZ A;  2Y9W C;  4H9W A;  1CE7 B;  3BAO A;  1JY0 A;  4J2Y A;  1M2T B;  4EB2 B;  31BI A;  1K5U A;  4YOL A;  3O4O A;  4Z8S B;  2R9K B;  3FGM A;  3S8K A;  2F2F C;  2J3P A;  3BAQ A;  2D20 A;  3ILA A;  3K1X A;  3RMX A;  3N7K A;  4IY9 A;  2LIQ A;  1A8D A;  1G9C A;  3R4U A;  4KEI A;  5BP5 C;  3B9U A;  5G00 A;  2AXM A;  1G9D A;  2GZB A;  1SR4 A;  1XZZ A;  3OBR A;  4P0J A;  4X38 A;  1IRA X;  1P63 A;  4I1E A;  2VXT I;  1FWU A;  3MAL A;  4XKI A;  1HIB A;  1EPW A;  3OJV A;  1S0F A;  4I96 A;  3IAG C;  4LO3 C;  3PG0 A;  2BFH A;  5D61 A;  1GGP B;  4QKS A;  4H04 A;  1PUU B;  4I8M A;  4KEK A;  1T4Q A;  1JT3 A;  1DFC A;  5EHA A;  4HA2 A;  2VLC A;  1EYL A;  1WBC A;  3S8J A;  3CRH A;  3FUO A;  1WD3 A;  4OEE A;  2WBC A;  2IHO A;  1CVS A;  3N0K A;  3CA6 A;  3BRF A;  3LTQ A;  1YYN A;  4X39 A;  3FJJ A;  2DRY A;  41BI A;  3O49 A;  3O44 A;  1EV2 A;  2VSA A;  4ZLB B;  1AVU A;  4ZBV B;  3V0B A;  1S0B A;  2HW9 A;  1Z2V A;  1TWE A;  4LO0 C;  1YXW A;  3BRD A;  5F8S A;  3BAV A;  4AN7 B;  4QBC A;  3VSZ A;  2HWM A;  4Q9P A;  4HR6 C;  1BA7 A;  1FN0 A;  3E8L C;  3N7J A;  3FJI A;  2MC2 A;  4XFT A;  3FJK A;  1FGA A;  1HWN B;  3AH4 A;  3N7M A;  4I4R A;  4I4O A;  4OEF A;  5GAQ A;  3BAD A;  3QR5 A;  4END A;  2E4M A;  3QYD A;  1I1B A;  2VU9 A;  4ZFY B;  2ESU A;  2ZQO A;  4G9N A;  4I3N A;  5BVP I;  3IIR A;  1BAS A;  1ITB A;  3WO4 A;  4JQ0 A;  3UD8 A;  4I6I A;  3WIN C;  4OEG A;  1IJT A;  3VEQ A;  2KLL A;  2RQ9 A;  2ZR1 B;  3V0A A;  2P39 A;  3IM5 A;  3N7L A;  3FJB A;  3HOM A;  1Z4S A;  2VXR A;  3I2X A;  3CAH A;  5B2H A;  4I4Q A;  1BFG A;  4I0Y A;  1Q03 A;  1ISY A;  2NZ9 A;  2ZQN A;  4IQP A;  5DZU A;  3AKH A;  1IOB A;  5BQU C;  1G82 A;  3VT0 A;  4IZE A;  3RMY A;  3ZC8 A;  5JMC A;  3CA1 A;  5DSS B;  5BXT A;  3AJ5 A;  1L2H A;  3AKF A;  4JAW A;  2I1B A;  4I7I A;  4D0T A;  4J2K A;  5F8W A;  3FJ9 A;  4OWL A;  2FFU A;  3W9T A;  8I1B A;  1BFF A;  3BB2 A;  2K8R A; 
#chains in the Genus database with same CATH topology
 3IM7 A;  1QQL A;  1HWP B;  1D0H A;  2Z49 A;  5FNX A;  3D7W B;  1PWA A;  3I29 B;  2ET2 A;  1AF9 A;  2Y9X E;  4PC4 A;  1S0C A;  1OQL B;  4UY4 A;  3O4A A;  2NYY A;  1V6V A;  1RG8 A;  3H6R A;  4KC3 A;  4OWJ A;  5D62 A;  4LO7 B;  3Q7Y A;  1YTO A;  1JT7 A;  3AZW A;  3CA3 A;  4GP0 A;  1JT5 A;  4XFS A;  1IIL A;  1FMZ A;  3F62 B;  4A7Z A;  4MZH A;  1DLL A;  5EG6 C;  1DJS B;  4IZX A;  3WA1 A;  4IY8 A;  3Q7W A;  3ZX7 A;  2D1Z A;  3NBN A;  4OUJ A;  3O4B A;  1ISZ A;  3BA5 A;  4F34 A;  3FJC A;  2ERM A;  3WO2 A;  4DCK C;  1AVA C;  3CA4 A;  1BLD A;  1PZZ A;  4QKR A;  4CJM A;  1ISX A;  4H75 A;  1DIW A;  4IYB A;  3BAU A;  3AJ6 A;  2UUS A;  4II0 A;  3PUB A;  1QXM A;  1W3A A;  4ISQ A;  4P0K A;  2F8X C;  4LO2 A;  3BA4 A;  5HPZ A;  5BP5 A;  3HN1 A;  4D8H A;  3BX1 C;  4G9M A;  7I1B A;  1TP0 A;  3H6S E;  4X3A A;  2D7R A;  2HWA A;  1RML A;  4JP0 A;  1VCL A;  4USP A;  4DEN A;  1XG6 A;  2RST A;  1Q04 A;  3UD7 A;  2IWT B;  3JUT A;  4GAI A;  4ISR A;  4LO3 A;  3OJM A;  5F8Y A;  1AVX B;  1MC9 A;  1S0E A;  4J2X A;  1S0D A;  1FMM S;  3CU1 B;  1G9B A;  3F1R A;  4I4U A;  5D63 A;  1JTC A;  3ZXD A;  5DVH A;  3BRG C;  2KI6 B;  4LO1 A;  2KI4 A;  5FZU A;  5E24 E;  1TIE A;  2KKI A;  1V6W A;  3A21 A;  3AKI A;  2FGF A;  1XYF A;  4ZFW B;  2MLL B;  4I1B A;  4I4V A;  4I4Y A;  2Q3N B;  2QYI B;  3FJA A;  1HCE A;  2FFV A;  2QN4 A;  4KBB A;  2VUA A;  4QD2 C;  5I1B A;  21BI A;  1EVT A;  3UD9 A;  1ILR 1;  4R6U B;  2FO1 A;  2K43 A;  1V6U A;  3NBE A;  3O5W B;  4I37 A;  4LO7 C;  2VSE A;  2DS0 A;  3HMY A;  4FGF A;  3V0B B;  1NZK A;  4IHZ A;  1II4 A;  5FZZ A;  3POK A;  4LO0 A;  3PME A;  2L5X A;  1BFC A;  5BXP A;  1W3F A;  2AAI B;  1JT4 A;  3EF2 A;  3P53 A;  1TOO A;  2LIE A;  3OGG A;  4GOV A;  4EKX B;  1JLY A;  3FJD A;  4WBC A;  3KMV A;  3O4D A;  5BOW A;  4ZKT B;  2K4A B;  2MIB A;  4FVV A;  4QAL A;  3NBC A;  3A07 A;  1BAR A;  2YUG A;  1TFM B;  9ILB A;  4L4H A;  4I4X A;  1I1E A;  1W3G A;  1HCD A;  3CRG A;  4I4S A;  4HJJ A;  3SNV A;  2DRZ A;  1WBA A;  1KNM A;  1FQ9 A;  3R4S A;  3WIN A;  3AKG A;  3V0A B;  4AN6 A;  1R8O A;  5F90 A;  3RTJ B;  1G9A A;  1NUN A;  3MPP G;  4GAF A;  4QD2 B;  5EC5 A;  1DQO A;  1N4K A;  1SR4 C;  3VSF A;  1V6X A;  1YF8 B;  4P0L A;  1K5V A;  3OBT A;  1FV2 A;  3BTA A;  1TTU A;  1MD6 A;  4L4I A;  3FJ8 A;  1J0S A;  4J23 B;  2D22 A;  3UJ0 A;  1BFB A;  3VT2 A;  4P6A A;  3HSM A;  3BAG A;  2BEA A;  2WRY A;  4GP3 A;  4A7K A;  4Q91 A;  1DQG A;  2RG9 B;  3NBD A;  1F31 A;  2M49 A;  4LO2 C;  2F2F A;  3AH2 A;  3JRR A;  3O4C A;  1ONK B;  5FNW A;  1TWM A;  1T9F A;  2Q9X A;  3H6R B;  3UJ4 A;  1IRP A;  5FZY A;  2D24 A;  3O3Q A;  3WO3 A;  4G1R A;  4JPZ A;  4Q9G A;  3AH1 A;  4KEJ A;  3VWC A;  5BXR A;  3I2A A;  3CA0 A;  2D7I A;  3WMU A;  4ZFU B;  4GOY A;  4I4P A;  1AVW B;  2FDB M;  1IT0 A;  4ZOT A;  3FUQ A;  1DZC A;  4QC4 A;  3A23 A;  4LO1 C;  3P6J A;  3HBW A;  4X37 A;  1M16 A;  1SZ6 B;  2X2T A;  2Y9F A;  1S0L A;  1IHK A;  3RTI B;  1QQK A;  2Y9G A;  1JLX A;  4OWK A;  2E4M C;  3FJH A;  3ZXG A;  3OJ2 A;  4J2S A;  2HZ9 A;  3BAH A;  1ISW A;  2BEB A;  4ZGR B;  3CRI A;  4D0Z A;  5JLV A;  4F83 A;  4EEE B;  2DRE A;  1PC8 B;  1HWO B;  3PHZ A;  1HWM B;  4XFU A;  5BXS A;  4OW4 A;  1ABR B;  3Q7X A;  1S0G A;  4G6J A;  1DZD A;  4MZG B;  4G6M A;  3LLP A;  1YBI A;  2AFG A;  3VT1 A;  4JRA A;  2P23 A;  3T8S A;  1AFC A;  2NM1 A;  2NP0 A;  3UDA A;  3V79 C;  3H6Q A;  3BA7 A;  2GO2 A;  4I2S A;  1AXM A;  4EFQ A;  1E0O A;  1HKN A;  2D43 A;  1Q1U A;  2XOA A;  2X2S A;  3NJ5 A;  4LO8 B;  4QBV A;  2NTD A;  4JKQ A;  4DEP A;  6I1B A;  3RSJ A;  2D44 A;  3FJE A;  4USO A;  3TC2 A;  3ZC9 A;  2D23 A;  1FV3 A;  5DUY A;  1ISV A;  4QO3 A;  3HAL A;  1PUM B;  2Z48 A;  1JQZ A;  4EFP A;  1R8N A;  1Z0H A;  4EFR A;  2NVH A;  4Z9W B;  4ION A;  4TLP A;  3FJF A;  1RY7 A;  2KH2 A;  3AZV A;  1RZO B;  3CQA A;  4ZA3 B;  1WD4 A;  3OGF A;  1BLA A;  3C9Z A;  3IM6 A;  1FWV A;  4A7Y A;  4JKX B;  3VUO A;  3A22 A;  1DFQ A;  1UPS A;  3FFZ A;  3CA5 A;  1XHB A;  5BQU A;  3WMV A;  3P6I A;  2AQZ A;  2Y9W C;  4H9W A;  1CE7 B;  3BAO A;  1JY0 A;  4J2Y A;  1M2T B;  4EB2 B;  31BI A;  1K5U A;  4YOL A;  3O4O A;  4Z8S B;  2R9K B;  3FGM A;  3S8K A;  2F2F C;  2J3P A;  3BAQ A;  2D20 A;  3ILA A;  3K1X A;  3RMX A;  3N7K A;  4IY9 A;  2LIQ A;  1A8D A;  1G9C A;  3R4U A;  4KEI A;  5BP5 C;  3B9U A;  5G00 A;  2AXM A;  1G9D A;  2GZB A;  1SR4 A;  1XZZ A;  3OBR A;  4P0J A;  4X38 A;  1IRA X;  1P63 A;  4I1E A;  2VXT I;  1FWU A;  3MAL A;  4XKI A;  1HIB A;  1EPW A;  3OJV A;  1S0F A;  4I96 A;  3IAG C;  4LO3 C;  3PG0 A;  2BFH A;  5D61 A;  1GGP B;  4QKS A;  4H04 A;  1PUU B;  4I8M A;  4KEK A;  1T4Q A;  1JT3 A;  1DFC A;  5EHA A;  4HA2 A;  2VLC A;  1EYL A;  1WBC A;  3S8J A;  3CRH A;  3FUO A;  1WD3 A;  4OEE A;  2WBC A;  2IHO A;  1CVS A;  3N0K A;  3CA6 A;  3BRF A;  3LTQ A;  1YYN A;  4X39 A;  3FJJ A;  2DRY A;  41BI A;  3O49 A;  3O44 A;  1EV2 A;  2VSA A;  4ZLB B;  1AVU A;  4ZBV B;  3V0B A;  1S0B A;  2HW9 A;  1Z2V A;  1TWE A;  4LO0 C;  1YXW A;  3BRD A;  5F8S A;  3BAV A;  4AN7 B;  4QBC A;  3VSZ A;  2HWM A;  4Q9P A;  4HR6 C;  1BA7 A;  1FN0 A;  3E8L C;  3N7J A;  3FJI A;  2MC2 A;  4XFT A;  3FJK A;  1FGA A;  1HWN B;  3AH4 A;  3N7M A;  4I4R A;  4I4O A;  4OEF A;  5GAQ A;  3BAD A;  3QR5 A;  4END A;  2E4M A;  3QYD A;  1I1B A;  2VU9 A;  4ZFY B;  2ESU A;  2ZQO A;  4G9N A;  4I3N A;  5BVP I;  3IIR A;  1BAS A;  1ITB A;  3WO4 A;  4JQ0 A;  3UD8 A;  4I6I A;  3WIN C;  4OEG A;  1IJT A;  3VEQ A;  2KLL A;  2RQ9 A;  2ZR1 B;  3V0A A;  2P39 A;  3IM5 A;  3N7L A;  3FJB A;  3HOM A;  1Z4S A;  2VXR A;  2NS2 A;  3I2X A;  3CAH A;  5B2H A;  4I4Q A;  1BFG A;  4I0Y A;  1Q03 A;  1ISY A;  2NZ9 A;  2ZQN A;  4IQP A;  5DZU A;  3AKH A;  1IOB A;  4MZF B;  5BQU C;  1G82 A;  3VT0 A;  4IZE A;  3RMY A;  3ZC8 A;  5JMC A;  3CA1 A;  5DSS B;  5BXT A;  3AJ5 A;  1L2H A;  3AKF A;  4JAW A;  2I1B A;  4I7I A;  4D0T A;  4J2K A;  5F8W A;  3FJ9 A;  4OWL A;  2FFU A;  3W9T A;  8I1B A;  1BFF A;  3BB2 A;  2K8R A; 
#chains in the Genus database with same CATH homology
 3IM7 A;  1QQL A;  1HWP B;  1D0H A;  2Z49 A;  5FNX A;  3D7W B;  1PWA A;  3I29 B;  2ET2 A;  1AF9 A;  2Y9X E;  4PC4 A;  1S0C A;  1OQL B;  4UY4 A;  3O4A A;  2NYY A;  1V6V A;  1RG8 A;  3H6R A;  4KC3 A;  4OWJ A;  5D62 A;  4LO7 B;  3Q7Y A;  1YTO A;  1JT7 A;  3AZW A;  3CA3 A;  4GP0 A;  1JT5 A;  4XFS A;  1IIL A;  1FMZ A;  3F62 B;  4A7Z A;  4MZH A;  1DLL A;  5EG6 C;  1DJS B;  4IZX A;  3WA1 A;  4IY8 A;  3Q7W A;  3ZX7 A;  2D1Z A;  3NBN A;  4OUJ A;  3O4B A;  1ISZ A;  3BA5 A;  4F34 A;  3FJC A;  2ERM A;  3WO2 A;  4DCK C;  1AVA C;  3CA4 A;  1BLD A;  1PZZ A;  4QKR A;  4CJM A;  1ISX A;  4H75 A;  1DIW A;  4IYB A;  3BAU A;  3AJ6 A;  2UUS A;  4II0 A;  3PUB A;  1QXM A;  1W3A A;  4ISQ A;  4P0K A;  2F8X C;  4LO2 A;  3BA4 A;  5HPZ A;  5BP5 A;  3HN1 A;  4D8H A;  3BX1 C;  4G9M A;  7I1B A;  1TP0 A;  3H6S E;  4X3A A;  2D7R A;  2HWA A;  1RML A;  4JP0 A;  1VCL A;  4USP A;  4DEN A;  1XG6 A;  2RST A;  1Q04 A;  3UD7 A;  2IWT B;  3JUT A;  4GAI A;  4ISR A;  4LO3 A;  3OJM A;  5F8Y A;  1AVX B;  1MC9 A;  1S0E A;  4J2X A;  1S0D A;  1FMM S;  3CU1 B;  1G9B A;  3F1R A;  4I4U A;  5D63 A;  1JTC A;  3ZXD A;  5DVH A;  3BRG C;  2KI6 B;  4LO1 A;  2KI4 A;  5FZU A;  5E24 E;  1TIE A;  2KKI A;  1V6W A;  3A21 A;  3AKI A;  2FGF A;  1XYF A;  4ZFW B;  2MLL B;  4I1B A;  4I4V A;  4I4Y A;  2Q3N B;  2QYI B;  3FJA A;  1HCE A;  2FFV A;  2QN4 A;  4KBB A;  2VUA A;  4QD2 C;  5I1B A;  21BI A;  1EVT A;  3UD9 A;  1ILR 1;  4R6U B;  2FO1 A;  2K43 A;  1V6U A;  3NBE A;  3O5W B;  4I37 A;  4LO7 C;  2VSE A;  2DS0 A;  3HMY A;  4FGF A;  3V0B B;  1NZK A;  4IHZ A;  1II4 A;  5FZZ A;  3POK A;  4LO0 A;  3PME A;  2L5X A;  1BFC A;  5BXP A;  1W3F A;  2AAI B;  1JT4 A;  3EF2 A;  3P53 A;  1TOO A;  2LIE A;  3OGG A;  4GOV A;  4EKX B;  1JLY A;  3FJD A;  4WBC A;  3KMV A;  3O4D A;  5BOW A;  4ZKT B;  2K4A B;  2MIB A;  4FVV A;  4QAL A;  3NBC A;  3A07 A;  1BAR A;  2YUG A;  1TFM B;  9ILB A;  4L4H A;  4I4X A;  1I1E A;  1W3G A;  1HCD A;  3CRG A;  4I4S A;  4HJJ A;  3SNV A;  2DRZ A;  1WBA A;  1KNM A;  1FQ9 A;  3R4S A;  3WIN A;  3AKG A;  3V0A B;  4AN6 A;  1R8O A;  5F90 A;  3RTJ B;  1G9A A;  1NUN A;  3MPP G;  4GAF A;  4QD2 B;  5EC5 A;  1DQO A;  1N4K A;  1SR4 C;  3VSF A;  1V6X A;  1YF8 B;  4P0L A;  1K5V A;  3OBT A;  1FV2 A;  3BTA A;  1TTU A;  1MD6 A;  4L4I A;  3FJ8 A;  1J0S A;  4J23 B;  2D22 A;  3UJ0 A;  1BFB A;  3VT2 A;  4P6A A;  3HSM A;  3BAG A;  2BEA A;  2WRY A;  4GP3 A;  4A7K A;  4Q91 A;  1DQG A;  2RG9 B;  3NBD A;  1F31 A;  2M49 A;  4LO2 C;  2F2F A;  3AH2 A;  3JRR A;  3O4C A;  1ONK B;  5FNW A;  1TWM A;  1T9F A;  2Q9X A;  3H6R B;  3UJ4 A;  1IRP A;  5FZY A;  2D24 A;  3O3Q A;  3WO3 A;  4G1R A;  4JPZ A;  4Q9G A;  3AH1 A;  4KEJ A;  3VWC A;  5BXR A;  3I2A A;  3CA0 A;  2D7I A;  3WMU A;  4ZFU B;  4GOY A;  4I4P A;  1AVW B;  2FDB M;  1IT0 A;  4ZOT A;  3FUQ A;  1DZC A;  4QC4 A;  3A23 A;  4LO1 C;  3P6J A;  3HBW A;  4X37 A;  1M16 A;  1SZ6 B;  2X2T A;  2Y9F A;  1S0L A;  1IHK A;  3RTI B;  1QQK A;  2Y9G A;  1JLX A;  4OWK A;  2E4M C;  3FJH A;  3ZXG A;  3OJ2 A;  4J2S A;  2HZ9 A;  3BAH A;  1ISW A;  2BEB A;  4ZGR B;  3CRI A;  4D0Z A;  5JLV A;  4F83 A;  4EEE B;  2DRE A;  1PC8 B;  1HWO B;  3PHZ A;  1HWM B;  4XFU A;  5BXS A;  4OW4 A;  1ABR B;  3Q7X A;  1S0G A;  4G6J A;  1DZD A;  4MZG B;  4G6M A;  3LLP A;  1YBI A;  2AFG A;  3VT1 A;  4JRA A;  2P23 A;  3T8S A;  1AFC A;  2NM1 A;  2NP0 A;  3UDA A;  3V79 C;  3H6Q A;  3BA7 A;  2GO2 A;  4I2S A;  1AXM A;  4EFQ A;  1E0O A;  1HKN A;  2D43 A;  1Q1U A;  2XOA A;  2X2S A;  3NJ5 A;  4LO8 B;  4QBV A;  2NTD A;  4JKQ A;  4DEP A;  6I1B A;  3RSJ A;  2D44 A;  3FJE A;  4USO A;  3TC2 A;  3ZC9 A;  2D23 A;  1FV3 A;  5DUY A;  1ISV A;  4QO3 A;  3HAL A;  1PUM B;  2Z48 A;  1JQZ A;  4EFP A;  1R8N A;  1Z0H A;  4EFR A;  2NVH A;  4Z9W B;  4ION A;  4TLP A;  3FJF A;  1RY7 A;  2KH2 A;  3AZV A;  1RZO B;  3CQA A;  4ZA3 B;  1WD4 A;  3OGF A;  1BLA A;  3C9Z A;  3IM6 A;  1FWV A;  4A7Y A;  4JKX B;  3VUO A;  3A22 A;  1DFQ A;  1UPS A;  3FFZ A;  3CA5 A;  1XHB A;  5BQU A;  3WMV A;  3P6I A;  2AQZ A;  2Y9W C;  4H9W A;  1CE7 B;  3BAO A;  1JY0 A;  4J2Y A;  1M2T B;  4EB2 B;  31BI A;  1K5U A;  4YOL A;  3O4O A;  4Z8S B;  2R9K B;  3FGM A;  3S8K A;  2F2F C;  2J3P A;  3BAQ A;  2D20 A;  3ILA A;  3K1X A;  3RMX A;  3N7K A;  4IY9 A;  2LIQ A;  1A8D A;  1G9C A;  3R4U A;  4KEI A;  5BP5 C;  3B9U A;  5G00 A;  2AXM A;  1G9D A;  2GZB A;  1SR4 A;  1XZZ A;  3OBR A;  4P0J A;  4X38 A;  1IRA X;  1P63 A;  4I1E A;  2VXT I;  1FWU A;  3MAL A;  4XKI A;  1HIB A;  1EPW A;  3OJV A;  1S0F A;  4I96 A;  3IAG C;  4LO3 C;  3PG0 A;  2BFH A;  5D61 A;  1GGP B;  4QKS A;  4H04 A;  1PUU B;  4I8M A;  4KEK A;  1T4Q A;  1JT3 A;  1DFC A;  5EHA A;  4HA2 A;  2VLC A;  1EYL A;  1WBC A;  3S8J A;  3CRH A;  3FUO A;  1WD3 A;  4OEE A;  2WBC A;  2IHO A;  1CVS A;  3N0K A;  3CA6 A;  3BRF A;  3LTQ A;  1YYN A;  4X39 A;  3FJJ A;  2DRY A;  41BI A;  3O49 A;  3O44 A;  1EV2 A;  2VSA A;  4ZLB B;  1AVU A;  4ZBV B;  3V0B A;  1S0B A;  2HW9 A;  1Z2V A;  1TWE A;  4LO0 C;  1YXW A;  3BRD A;  5F8S A;  3BAV A;  4AN7 B;  4QBC A;  3VSZ A;  2HWM A;  4Q9P A;  4HR6 C;  1BA7 A;  1FN0 A;  3E8L C;  3N7J A;  3FJI A;  2MC2 A;  4XFT A;  3FJK A;  1FGA A;  1HWN B;  3AH4 A;  3N7M A;  4I4R A;  4I4O A;  4OEF A;  5GAQ A;  3BAD A;  3QR5 A;  4END A;  2E4M A;  3QYD A;  1I1B A;  2VU9 A;  4ZFY B;  2ESU A;  2ZQO A;  4G9N A;  4I3N A;  5BVP I;  3IIR A;  1BAS A;  1ITB A;  3WO4 A;  4JQ0 A;  3UD8 A;  4I6I A;  3WIN C;  4OEG A;  1IJT A;  3VEQ A;  2KLL A;  2RQ9 A;  2ZR1 B;  3V0A A;  2P39 A;  3IM5 A;  3N7L A;  3FJB A;  3HOM A;  1Z4S A;  2VXR A;  2NS2 A;  3I2X A;  3CAH A;  5B2H A;  4I4Q A;  1BFG A;  4I0Y A;  1Q03 A;  1ISY A;  2NZ9 A;  2ZQN A;  4IQP A;  5DZU A;  3AKH A;  1IOB A;  4MZF B;  5BQU C;  1G82 A;  3VT0 A;  4IZE A;  3RMY A;  3ZC8 A;  5JMC A;  3CA1 A;  5DSS B;  5BXT A;  3AJ5 A;  1L2H A;  3AKF A;  4JAW A;  2I1B A;  4I7I A;  4D0T A;  4J2K A;  5F8W A;  3FJ9 A;  4OWL A;  2FFU A;  3W9T A;  8I1B A;  1BFF A;  3BB2 A;  2K8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...