2BEFA

Crystal structure of ndp kinase complexed with mg, adp, and bef3
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title AlF3 mimics the transition state of protein phosphorylation in the crystal structure of nucleoside diphosphate kinase and MgADP.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Phosphotransferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 42
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1998-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2befA00
5CAAA 1WKJA 3Q8UA 1WKKA 3FBFA 1NHKL 4C6AA 1F6TA 1ZS6A 3R9LA 3VGVA 3Q8YA 1NDKA 3WX8A 1BUXA 1BHNA 3NGSA 4KPCA 2AZ1A 3L7UA 3ELHA 3VGTA 4UOGA 1XQIA 3Q8VA 1KDNA 3ENAA 3FC9A 1NCLA 1NSKL 5CABA 4CP5A 3EMTA 3B6BA 1NDPA 2ZUAA 2B8PA 3FBEA 3ZTSA 3BH7B 3EVMA 1XIQA 3EM1A 3FKBA 2BX6A 3NGRA 1S5ZA 1NDLA 1LEOA 1F3FA 1MN9A 4W98A 3BBBA 2DYAA 3BBFA 1WKLA 1NSQA 3EICA 2DXEA 4F4AA 4ANCA 3MPDA 3PRVA 5C7PA 2DXDA 1JXVA 3Q83A 2VU5A 4FKYA 1HLWA 2NCKL 2HVEA 3EVWA 1B99A 4HR2A 2DY9A 1S59A 1NLKL 4UOHA 4WBFA 3Q86A 3ZTRA 2B8QA 1NPKA 3FBCA 3DDIA 4F36A 3DKDA 3FCWA 3BH6B 3Q89A 5BXIA 3JS9A 1HHQA 3ZTPA 3B54A 3FCVA 3EVOA 3NGTA 3PJ9A 4ANDA 4ENOA 4DUTA 2CWKA 3ETMA 1NUEA 1UCNA 3VVTA 1W7WA 4ANEA 3VGSA 3EJMA 1LWXA 4FKXA 1B4SA 3VVUA 1K44A 3EE3A 2HURA 2BEFA 2AZ3A 1NB2A 4DI6A 3NGUA 3ZTQA 2DXFA 4EK2A 1NDCA 3GPAA 4UOFA 1PKUA 1VYAA 4O0NA 3FBBA 4S0MA 1MN7A 2HVDA 1U8WA 3ZTOA 3GP9A 3G2XA 1NSPA 1HIYA 3BBCA 5IOLA 4DZ6A 3VGUA 1EHWA 1S57A 1PAEX 1BE4A
chains in the Genus database with same CATH superfamily
4NLTA 3SBMA 2MKJA 2X3DA 3RBDA 3IG1B 4LR8A 5DZ6A 3JTOA 5B08A 3J81Y 4DR2J 1HBMA 3BSOA 4USWA 4MMOA 5KT4A 5CD4A 4PG8A 4I67A 2DGOA 5GMKa 2HHTA 3V6DB 1YITS 2OPRA 4CWBA 2CNOB 2UZAA 2R8IA 2QFJA 4NXMJ 2AYMA 2BM0A 1JLBA 3TOQA 2RU3A 3MURP 3TVYA 1WHYA 4CNZA 1MU2A 1MMNA 2GJFA 2O1PA 2YNGB 1VK8A 3WX8A 1T03A 4MYUA 1SC3B 1GX6A 3QT7A 3FVYA 4I6YA 4USJC 2M5YA 1M1KT 1ZM9A 3C66A 1Y5IB 2LXUA 4DG1A 1QSSA 4RU2A 4MK7A 3QT6A 3ENAA 1PJ5A 3MECA 3CCQS 5IM0A 5M2PA 4RUBA 4FXVA 3CVKA 4DX7A 3DN9A 1C0UB 3HSJA 3IMQJ 1RTHA 1JQGA 2J8SA 4L76A 2RH3A 3V4IB 1HQUB 1PJ6A 2VKRA 2J9EA 3W63A 3EVMA 3SSQA 4L6V3 2W2QP 5LXRA 2EFOA 4JV5F 1FT8A 2PA8D 1C2PA 3UNYA 1FJGF 1CULB 4OZ5A 2CQDA 2HFNA 3NWGA 4GVBB 1PYOB 4TLRA 4U7UK 3TZXA 2FHJD 2FQQB 4OI2A 4X62J 4OL8A 1X4BA 1T9WA 2EW9A 3AB2B 4TN2A 2CQHA 5KG6A 5DJBA 2R7TA 5GAEU 2XS5A 1GTHA 4DU7A 2AF6A 2EKYA 2G0JA 4L74A 2CJBA 4HTIA 1CBKA 4EBCA 4ED2A 2OJ3A 3NNAA 4J9QA 2YH0A 4J7CA 3T1AA 3W5YA 3GONA 2JSXA 2YVSA 3SFUA 4UY85 4OX9F 4DV3J 1CS4B 5A2QU 2NCKL 2HHUA 5IM0B 3I31A 3KJQB 1FXRA 3GIIA 2HK3A 2XSJB 1S1WB 5B0GA 5A8KA 1RZMA 1BD6A 4P71A 4RW9B 3ZZZA 4LRBA 4NEYA 4Y00A 3BN4A 4FF3A 3HM9A 1NPKA 3HPOA 1C1CB 2FVPA 2EVZA 3HT3A 5E2QA 3KJNB 1FDNA 1TFYA 2GNKA 3MM8A 3AXMA 4ALZA 4RLEA 4NCBA 2FJEB 1HPZB 3PFEA 4UY8T 4OYAA 3VVTA 1F5AA 1GTEA 3PEJA 2P2CB 2Y0SD 3W2WB 3CTRA 1FKPB 3D54A 4BCAA 4K4XA 3Q0AA 1T7PA 2EFNA 4HT7A 5HMWA 2WSEC 1I3OB 3E51A 1PBAA 1T9VA 1R89A 1RAGB 3ET6A 3DLKB 4ED3A 2YX4A 4ATNA 1TKZA 5DDPC 1UWBA 2ATCB 2RS2A 4NE9C 1J5OB 2CPFA 4OJ3A 2H5JB 1V3ZA 2KO1A 4P7VA 2CJ9A 1TAQA 3DGPA 3T1YF 2UXBJ 4K8RA 5E0OA 2E9TA 4WFBQ 1CEZA 3PR5B 3A4TA 3M2UA 3D4JA 5HBMB 2VODA 3FMBA 2WK4A 4LSLA 1DTQB 5HJYA 1ZETA 3DLLQ 5IC4B 1GNKA 3HVTB 4ICLA 2LQBA 3KJFB 4KHPJ 2V6AA 3N5FA 3G2XA 2W2NP 1ZPWX 2E9ZA 2HFUA 3MMBA 2GJ2A 4EU0A 5EX0A 4KE5A 3KMSA 2M52A 1WF2A 3ZNJ1 2MXYA 3M8RA 2NZCA 1ULRA 5KFLA 3KHGA 1SUQA 1FFWB 2LA6A 3FCHA 1S6QA 3ZZ0A 4CDIA 4F2RA 2CA9A 4M1KA 2XTJP 3GCXP 1RT5A 1UA1A 2GJIA 1SJFA 1TU0B 2V8VA 5IV3A 3JYTA 4MTPA 4NCGB 3DLGB 2YNFA 4QJVA 1Q79A 3CJKB 1IBMF 3DLBA 2KG0A 3BV8A 1WDTA 5FJ4A 3S1TA 2BR0A 3NS5A 2FLPA 2LQ5A 3OPKA 4P2MA 1BHNA 3HD1A 4CLLA 1JNRB 1QM9A 2CAJA 3MAAB 4B9NA 1JJCB 1NRKA 1OSCA 2HLUA 4LVOP 3KHRA 3UD4P 2C2RA 3F73A 3KJVB 4IG0A 1ZTTA 4N8OA 1F9FA 1VMBA 1UFLA 3RRKA 1K73T 1IBKJ 2UXDF 1I1GA 1TL1A 4A48A 2NYIA 5JMNA 4BC7A 4IOCQ 1URNA 5KFJA 5F8LA 2QMXA 4ITSA 2DNHA 2VL1A 2HNYB 3P3DA 3AXKA 4QIWD 1JXEA 5DG8A 3H8YA 5AJ3J 4LRDA 3JSMA 1EETB 2PI4A 3DRPB 1X60A 3F0NA 4B9MA 3HZEA 3TAPA 1LEOA 4TY8B 2CJXB 2PD1A 4ZVUB 1VRQC 2Y8YA 4F4YA 3U1NA 2ZJQQ 3CC7S 4GKJJ 4L3KA 1VC5A 1MWZA 2IBKA 1MLAA 3V5RA 4DL3A 2V5HG 4DJBA 3MMAA 1VIOA 3H42A 1JLQB 2DKOB 3W8PA 1RYRA 1EB0A 2UVUA 4ED4A 4O3SA 2DGQA 4QOTA 4OI6A 4C3MA 3JTPA 2K1RB 3CXCR 4MH8A 5B0DA 1S4EA 1K9MT 2B4PA 2VJUA 4DU8A 3NRBA 1NHUA 3NOCA 4F3OA 2EK1A 3DGVA 4DR1F 2YWWA 1NKEA 4FKYA 3PO4A 3CD6S 1N5VA 1NPRA 4RW9A 2V2QA 1KFDA 1EJ7L 2OTJS 4Z37A 1PJ7A 1LW2A 3MMCA 1UPPA 1HYSA 2IRYA 3D66A 4KGMA 1VBXA 1HNZJ 3K7RA 4XDCA 3HZGA 1FNMA 4WFYA 3D28A 4F36A 5DG7A 1M5SA 2HRTA 2OMOA 2XMKA 1S0VA 2BKNA 2VG7B 2YX1A 3BEGB 1SL1A 2KM8C 2GGPB 3PNIA 3E8OA 4EMDA 4I0WA 4CM0A 2ZM6F 1LFPA 2BXJA 1HD0A 1WUUA 3G8SA 4DSKA 1OJ4A 2NXEA 3FQLA 3NBPB 2HHHJ 2ZOMA 4GVBA 2YKMA 2R7RA 1IKXA 1GMWA 2QGFB 5KFSA 2HPUA 1TK5A 1FJGJ 1JLCA 3BKTA 1Y3JA 2LEBA 4NMLA 1VQ6S 1UVIA 3MEEB 1T94A 4X65F 1RABB 4IOAQ 1RTDA 4LRFA 2PFFB 3P96A 5KFKA 1K47A 3SDEA 2CPJA 1KQKA 2ZZTA 2IMOA 3R5AA 4XTTA 3W5ZA 4YR0A 3MPUB 3RR7A 1Y10A 1RHKB 1IBLJ 3W9JA 1MROB 3VALA 1QD1A 1WWHA 4CM2A 2HVDA 1NJIT 3Q8RB 2OEJA 3H4DA 1U8WA 4DR4J 2BE7D 1RACB 1XEZA 2KTQA 2DRAA 5ETLA 4X4PA 4G1QB 1IM4A 1WHVA 3D3BJ 3QIPA 3OXFA 4DV6J 1TP7A 4TVAB 2KVQE 2R2UA 1SXLA 3H59A 1T03B 3TNVA 4FF4A 5CH7B 4RW8B 1KBRA 4ZVQB 1OIAA 2L9WA 1EKSA 2HVZA 2VFTA 4A8YA 5K14A 4Q44A 2H9ZA 1L3KA 4M8LA 3AJ1A 4CCHA 3U1LA 2HZVA 1MMLA 4OYZA 2DVIA 3KK2B 2ZZMA 1ZS6A 3V6DA 3MAHA 2BOPA 3KMQA 3KUEA 2OEMA 1IWAA 4U8VA 1HW8A 4DN0A 4YY3F 3IWNC 2ACMA 2V50A 4F0KA 3THVA 2KJWA 2KXNB 4LQ3A 4K5RA 2D7SA 4HVZA 1HBOA 2M7SA 4JI8J 3KFWX 1NJXA 2COLA 2LQ9A 3J80Y 3CCUS 4LMZA 4GKKF 2OPQB 8RUCA 1EP4B 2CQBA 3ELHA 4F26A 5C24B 3KLEB 1FTCA 4WKRA 2BM1A 4RZRA 2ASJA 4XK8C 2ALZA 4ZVSB 2XZWA 4ER8A 3MFHA 4EBDA 4LR9A 3KDNA 4TYAA 1HI1A 2YQ3A 1OO0B 2FLLA 1CVJA 2H4YB 1MNEA 4CP5A 1FRHA 1RTJB 3WHIA 5K20B 5T7LA 5L9XA 1RB0A 5JVGQ 4X62F 3FBEA 1L5UA 3G8QA 1E6VB 1KN6A 1TAUA 3FKBA 3UFCX 4DPOA 1RAHB 5L8RC 3MM7A 2FPHX 1JKHB 4JYAJ 4ECZA 1LW0A 4RR5A 1MN9A 1JIHA 1DZ5A 4Y2CA 3M9NB 4ED5A 5DQGA 4KHPF 1OPIA 2Y0BB 4NLGA 1NK6A 4WPAA 2G13A 1O5JA 2NYHA 2LDIA 2XI3A 1IJFB 2B0GA 2DXEA 2UUTA 2OPQA 3HULA 1HA1A 3IO1A 2HS3A 3R27A 4ZP9A 5KG0A 5DGBA 1FD2A 3GSIA 1X5PA 2OAUA 4TQRA 2FLNA 1S6PA 1RWKB 4FVCA 4NL5A 3GYGA 2W7PA 5HATA 5HP1B 4BS2A 3MCNA 3DXBA 2GVZB 1IWGA 1HPZA 5D77A 3J7ZT 1X9MA 1YIJS 4IO9Q 2QFIA 1WI8A 2VH7A 1S76D 4CO4A 2A6OA 3J7YI 4F4XA 1S49A 3Q23A 1VQ5S 4DL4A 1ZBTA 4RW6A 2FHOB 4WFAQ 1ZYQA 3Q8PB 1RHRB 2BE2A 4Q0BA 2GQ2A 4ZJOA 1KTVA 3SFGA 3MM9A 4ZPDA 4ED8A 3DDIA 4DV1F 2HFSA 4DR2F 2RVJA 4DDFA 1CC8A 3JB9k 4J9OA 1DTTB 2YTCA 3A12A 4ERDA 3NGTA 4LQ9A 3IXQA 3TAMB 1CJUA 4LF6J 1RT1B 2H5IB 4N56A 4OHVA 3MCMA 4IG3A 2B4OA 1W26A 2FD2A 5HLFB 1P27B 4IUFA 1PYTA 5GAHU 5LL6d 2NQPA 4FKXA 1TMMA 2JWNA 5AT1B 3TRGA 5CCLA 1RTDB 5CYQB 4ID8A 1KVIA 3FDSA 5GAGI 3NMRA 3TEGA 2CADA 2JL9A 3TO8A 3V81A 1NBEB 1T3NA 3LP1B 5B0CA 2D9OA 2ALYB 4N7TA 1P6TA 1S99A 2QT7A 2YNHB 2XY7A 1SKWA 1U45A 2ZH9A 4KKOA 2OD6A 4LSNB 3GPAA 5LSOA 3RRGA 3L3CA 1C4AA 1VYAA 2F9DA 3LWLA 1N6QB 1GXLA 1YTYA 4F8RA 1TL5A 3HHLA 1FJEB 1IM6A 2HBQB 2N4DA 1F2HA 1NH7A 5KFOA 3M6XA 1DARA 1KQGB 1RU2A 1UEKA 5CZVA 2J0QD 1IR2A 2VDIA 5DLFA 3M8PB 4C8YA 2F1FA 2FJBB 3IRXB 2XULA 2WVDA 2A3JA 1R8AA 2BJ9A 2VPXB 4QW8A 1DY3A 1DHMA 5HJXA 4JV5J 1FRMA 3T3FA 1W2BR 1KC8T 5F0WA 3CD0A 3EZUA 3FRZA 3ITHA 3JQJA 1SKRA 1KVJA 1HNZF 4YR2A 3KXDA 4G65A 1NPPA 2DNZA 1RA7A 1R0CB 2UUAF 3DRXA 4JP8A 2VIHA 1HQ2A 3QJPA 2CQ0A 4WFNQ 1BGXT 2XMVA 3QAEA 2FIUA 3JAMY 3RAMA 3Q8QB 1MWQA 1REVA 2WONB 4URSA 4QWDA 1I6JA 4O3QA 3CDEA 4ELUA 2MZJA 3R2CJ 3MPYA 1KTQA 7AT1B 2K1RA 1XMBA 5IQ6A 1R3NA 2R7QA 4H4MA 5GMEA 3W2VB 2ZOFA 3MD1A 3RB3A 1FEEA 3LH2S 3PYGA 3W8GA 2VA3A 4TU8A 2V0NA 4LF2A 4MIWA 3HT0A 3L7UA 4ZIVA 5F3ZA 2E5LJ 4USUA 4J9KA 3HX9A 1MG7A 4DF8A 4TXSA 3CO9A 2BYCA 2KKHA 1S10A 1TK8A 1CQNA 4UUXA 1YJUA 3MOJB 1XC9A 3D1HA 5A0YB 5HP1A 4N8NA 5KG4A 1RT2B 4O3PA 2LXFA 4NLXA 1YSJA 4J9NA 2HQCA 2ZUAA 2E9RX 3HF5A 3FJ2A 2N7CA 1LXNA 2B7BB 4ZIWA 2L48A 1FE0A 3LQVA 4CO1A 4IQXA 3I0SA 4O3OA 4YDDB 1VQ9S 3G4SS 3K58A 2LCWA 3HD2A 4PXDA 1Z1ZA 2WBRA 3GJSB 2FZCB 3IWXA 1RAIB 2RDIA 2GO9A 2HS0A 2VV5A 3NAHA 3R6LB 4RW4B 3CCJS 2R7XA 3NBPA 3IAM9 7FDRA 3T19A 3HHLD 2Z58B 2G9OA 3DLEA 2ZE2A 3L95X 2I9SA 3J80U 3KLVA 3K5PA 2XB2D 3CCES 1N33F 2RKIA 1JMTA 2N3OA 2DXDA 2DNMA 2QLWA 4ZHRB 2ZH5A 3L4BC 2AJQA 5KFHA 1GXTA 3MDFA 4OLOA 4WYWA 4OYBA 2CFXA 5KG3A 2VQFF 1R6VA 4CT8A 3T5LA 1F5BA 3KK3A 3B4DA 2G0CA 1YDLA 2JFKA 2DY9A 3DMJB 1OY6A 1UKUA 3AQOA 5DO2A 1KEKA 3G96A 2KZMA 3CDWA 4WFZA 3W64A 5KFPA 1QTNB 2C42A 4DR3F 3BQ1A 3MMBB 2CJAA 2J7WA 4RNMA 1SPBP 4JI2J 1Q81T 3J7A1 2HZAA 4UF4A 1CSJA 3MFIA 1G6BA 4DCPB 2EG2A 3U02A 2M88A 1RT7A 5B7WA 3M9OB 2E1RA 4EGLA 3KLGB 3UDCA 1FX2A 3GFYA 1ZZFA 3OTBA 5LXYA 1RHJB 3J81j 2EBGA 2BJ8A 3N5BA 3R6GB 2AGQA 3UR0A 4G3IA 5KFCA 1A0OB 3QLHB 2V2KA 4Y2MA 5DETA 5IWAJ 4OI1A 3ISZA 3VVUA 3SCJE 4OZNA 3N01A 4OZJA 3EE3A 4ETXA 1TUGB 2BEFA 3T41A 3DRRB 1H6KX 2GHVC 3I5AA 3QGIA 2JEGA 4IH5A 3GV7B 3DM2B 1I94F 5JVHQ 4LR7A 3BREA 1FKOB 3J7YU 2V4JA 5A8RA 1X7VA 4CLFA 1U0HA 4AXIA 1UEUA 4QIGA 1JLEB 1OPZA 1S6UA 4OZ0A 4P6QA 4ILMA 5AJ3F 4KQZA 2GVDB 4OQJA 3ILOA 3PEHA 3SEOA 5IT9Y 4AL5A 4UTGA 3L7OA 2IYIA 4Y3CA 4PKDB 2NUUG 5ITHA 4D3HA 2MJUA 3GFXA 3PHTA 1AUDA 1A9NB 3RU0A 4DSIA 2W25A 2IDEA 1IXKA 4QPXA 2OELA 5H9FJ 2B5JB 1JNZB 4FNHA 5J2MA 2CZVC 3RB6A 3C2PA 2F3JA 4OJGA 1IVZA 4K7QA 4USKA 1VRUB 3SSSA 4RNOA 1KVKA 4RWWA 1U2CA 4C7QA 1IBMJ 2VONA 4K4ZA 2HFVA 3SIPB 2KZZA 3BGRA 2A2CA 3O8WA 1GK8A 1NHKL 4I1TA 1GAOA 2BV3A 5D4PA 1F6TA 1HBNA 2YKPA 5KTQA 2ZWOA 3GFHA 4WP3A 1Z2LA 4IOBA 3NNHA 2KYXA 1IUJA 3VGVA 4ZHRA 2J6SA 2AWZA 1FWPA 2Q3PA 4XO0A 2JVRA 2JEFA 2EG1A 1R8CA 1RYSA 2CJQA 4P73A 3MOZA 3NGSA 2E7WA 1SL0A 2ZE2B 2EFGA 3BGRB 3CUNA 2DNLA 1RK8A 2H1YA 4KSEB 1R31A 2BUNA 4QYRA 3UN5A 3RBEA 5E5NA 4B3MF 3BN7A 2QIFA 4DSJA 2X51A 5HO4A 2ERRA 2N82B 2O3DA 2AEJA 3NP5A 4WJBA 2R8KA 5F0UA 1FDBA 4IKAA 3QT5A 4HACA 3VAHA 2GMLA 4QQBA 3BSNA 4RNHA 2LVWA 3WZ0A 4CLKA 5KG5A 3NGRA 3V4MA 5J2QB 1PILA 3HXMA 2BW2A 2LP4A 3NOGA 4ZPWR 3ET6B 1UJ6A 1AYEA 2ZD1A 5SUHA 1ZM4A 2KH9A 1XNRJ 1C0TA 1PBUA 1VDHA 4D3GA 1S1XB 1RGVA 4WZMA 3TYTA 3WDOA 2BKOA 1S1XA 3F56A 2V4RA 2FVRA 3UNGC 2F63A 1XNRF 4DL5A 1DJ0A 3UDLA 4CLSA 4K0KJ 1TELA 1U8SA 1J5EJ 4TY8A 3SQOP 2AJ4A 1TL4A 4B3SJ 4WXWA 2IDLA 1S9GA 5I3UA 3PRVA 1RWNB 2HIYA 4CH7A 4OV1A 3BGLA 1FTRA 4ZITA 3AJ2A 8AT1B 2IM2A 1NO8A 2ZEJA 2R7UA 1QJHA 5L9NA 2L41A 3R5DA 1M1HA 1WOPA 2VU5A 1ZA2B 3AHPA 2E5LF 4GRSA 5CYMB 2Z2YB 4KHMA 2UU9F 4R25A 1U47A 1FNOA 3O1LA 1PCAA 3M6UA 1RT7B 3HFZB 4YS2A 1T9XA 2DNNA 2ZKTA 4UOHA 5ETRA 1FRKA 4EO8A 2CYYA 2NS1B 4C3LA 1YG0A 4V1Ak 5KAKA 1NK5A 4URGA 2XSFA 1TKTB 2JX2A 4QIVA 4DSFA 4A8SA 4NYZA 5L39A 3R7NB 3JSRA 4L72B 1UW9A 5LJ3Y 1A7GE 1R43A 1RAEB 1UETA 3FCWA 4C3KA 3IA0A 4LBPA 3ZTPA 2QLXA 4DQPA 4NCGA 1KWMA 2QYGA 2ILYA 3OQ2A 2HZCA 4DPYA 3WBZA 1S48A 3HHLB 3W3SA 5B0AA 1W7WA 4KRWA 2FVQA 4KAIA 1RT3B 3D6MB 1EKRA 4WTYA 4OFZA 2GQQA 4F0MA 2MZTA 2ZVIA 3MR7A 3DOMA 1CJTA 1F9HA 2OPPB 3MM5B 2FC9A 2D69A 5KFYA 4DX5A 1N34J 2J7UA 3QO9A 1Y3KA 3G6YA 2W2OP 4C0OC 1IJEB 4PXEA 4FS1A 3G9CA 1B64A 4MKAA 4M5JA 4RL1A 3FSIA 5E3PA 3M7VA 1ZAWA 2AT1B 3FFIA 2VQEJ 2MJNA 1TFWA 1TL3A 2Q6CA 1SQGA 5A6PA 1RT1A 3NXZA 1PIEA 2WBMA 1UEVA 2YKNB 4EI2A 3HP6A 1HBUA 2HNDA 2HFOA 4IFYA 4WTOB 4LF7J 4DG1B 4P2XA 1KSPA 4Q45A 3GV8B 3DLKA 4DZ6A 4QBUA 3D68A 5D0HA 2HMIB 2RNEA 4A8WA 4ECTA 1EHWA 1N88A 1S57A 2YXLA 3D6FB 3DOKB 3FEXB 3KDOA 2DBBA 2GW8A 4DCOB 2P9GA 3CCMS 4BC9A 4HEA9 4N76A 1WKJA 2NPIA 2W01A 1FFSB 3GV5B 3WC2A 2QLJB 3FBFA 1QAJA 3JQKA 3OTOJ 1OQ3A 2FJDB 2XMTA 5KFZA 2G1HA 2YPYA 4DV6F 4M5KA 4DX6A 3DYAA 4MFBA 5IS2A 2IA0A 3OTOF 3PCOB 4GMKA 3IM8A 5GAGU 3VQTA 2DIVA 3OV7A 3QT8A 1IQTA 4OHZA 2E1CA 2EK6A 2FDNA 2RAQA 2HWHA 3CMQA 3DHWC 1WC4A 3TVZA 1IKVB 2JJ4D 2W2MP 2AKWB 3ZZRA 4C97A 3BPDA 4ILLA 5A8KB 2NR0A 4M5MA 1T9TA 3H98A 4J9RA 4OX8A 1YBAA 1ZZNA 1FWLA 3FRYA 1U2RA 2UUBF 2LU2A 2HAFA 4ELTA 1JKHA 5EDWA 4QWCA 3R2DJ 1CJVB 4CLUA 2W7AA 3IRXA 2HAIA 4OV6A 1T9YA 3HVRA 1ZOTA 5E3AA 1G4CA 2SXLA 3BH7B 1QLNA 3MMJA 3EDQB 3N6LA 2E5HA 3KK1A 1RU1A 2ZH6A 5KT5A 3P8BB 4NWBA 2X3GA 2DHHA 1OMSA 3MPWA 5HVFA 4X64J 2FTRA 1T05B 3H5UA 1KQFB 3I0RB 4Y0FA 4YMEA 2KJVA 2BW7A 1BLUA 2LQ8A 2GZOA 3LPYA 4CLTA 4JI5F 4QU7A 4DEZA 2HHSA 5DQHA 3FZ2A 5A2QY 3BDPA 2VDHA 4GKKJ 2B6AB 5J1EB 2IRXA 1RKIA 5I4MA 2V2VA 2MZSA 1VJWA 5ETMA 3AOCA 3MWBA 2MKHA 1HWIA 2XMJA 2Y1IA 4KB7A 4OZ1A 3I9V9 2ZDPA 2R3VA 4PAAA 1Q0NA 4XIUA 2ADCA 1NM2A 1BMQB 1OQ6A 1WC5A 4MKVA 1YHQS 4K4VA 1SKUB 2QO3A 3MEGB 4Z2XA 3J7Z5 2EWHA 2LQJA 3D6TB 3I9ZA 4ZA1A 4LFBJ 4ZJQA 4PCQA 1P1LA 3LW5C 2NXUA 1DQ8A 5AXKA 1F0XA 3D3CJ 3M32B 1FO1A 3GJTB 1YJ7A 2WAQD 1G7CB 1XK8A 3GWCA 4USMA 2E5JA 3TI0A 1KP6A 2CJKA 1S4FA 1HBMB 1RSCA 4LSZB 4NLOA 1N8RT 1U1OA 3IG1A 4ZPTR 4M63A 4ES3A 2RSQA 1RAFB 1CJKB 3BDEA 2CPHA 3F44A 4IR1A 1JLAB 1NHVA 1LV5A 3QBCA 2DXFA 4YQWA 1NK0A 2MQNA 3VHQA 4C48A 2UXDJ 2PGCA 3FNNA 3IAS9 2WVEA 1PG5B 4F3MA 4OMFG 1UWAA 3N6MA 4HACB 2R7WA 2AD9A 4JYAF 4XPEA 2IM1A 3C14B 1E6YA 5LT5A 4ED0A 4KH0B 1N0VC 2JVOA 2EKNA 4NLSA 2OTLS 2CVIA 2ZDOA 4CLYA 1NU4A 2VHGA 2NXNA 4M5IA 3ZTOA 3OXLA 4LF8J 4X4TA 1XBWA 3Q2SC 2DGTA 4N77A 1DQAA 4A4JA 4DFKA 1NKBA 3T5KA 2VFUA 1BE4A 4I68A 4KGXB 1SJQA 1I5OB 2C2KB 5I42B 2W4CA 1Q4RA 1RAAB 4J90A 2ZH4A 4ZCKA 3UN2A 3MGJA 3Q22A 1HYSB 2XWYA 4HDHA 5J1PA 2BABA 3D67A 4H54A 1WEYA 3ZZYA 5HL7Q 1HBNB 2LU1A 2DPIA 2KT2A 2VG6B 2VPYB 3R9LA 5DRKA 1RWOB 3PZPA 4H4OA 3H7HB 1FHTA 2V9KA 5FDLB 1WC0A 3OSNA 4ED1A 2W24A 2RHQB 1VRUA 4YY3J 3BGOP 2IIHA 1U26A 3U7JA 4F4ZA 1BUXA 2UV8A 4CTAB 5BR8J 4F4WA 1TQLA 4DR1J 2J8AA 3OBIA 2ASYA 2W8KA 2DH7A 3D2WA 4OYWA 3QWPA 1Q5VA 3R8YA 2WVFA 3DU6A 1JLFB 3R1LA 3AD7C 2DNYA 4DR6J 3MR6A 2DR8A 4NXMF 3QIPB 2ZITA 5I3PA 3HCXA 2VD3A 2EC0A 4OZLA 5C2GA 3WIVA 4G1PA 3M4XA 3GIKA 3GR0A 5DGAA 2G2ZA 3PIPQ 1NJWA 2CQ4A 1VJQA 4I2QA 1FVSA 5FLXU 2WHOA 4V19X 1FJ7A 2ASDA 2V4JB 3C6TB 4HI2A 5K5MA 2K3KA 3MCSA 3QATA 1YJ9S 3FQKA 5CQGA 5HROA 2G2OA 3A3OB 1N5YA 2FUG9 2KDOA 2D1CA 3FUYA 2XLJA 1FVQA 1FNXH 2BMBA 2EFPA 3KJVA 3GIMA 1ZH5A 2B51A 5KFUA 4X65J 5DM7Q 2W9CB 5D4NA 1TVRB 4JI1J 3QJJA 2YBVA 5JJBA 4NX9A 3DOMB 2YQ0A 3LPEA 3MM6B 1TL7B 4ANCA 5D6GA 1P9YA 3MHYA 3D5MA 4AYBD 4ELVA 1CPZA 2DO4A 3CJKA 2KXHA 4FBTA 1XR7A 3OL8A 1JXVA 1F3VA 2PMHA 2C3UA 2VG6A 2BE9B 2XWXA 4ES1A 2MPUA 1JJHA 1L3UA 2MMYA 1AZSB 4NPOA 1S12A 3EVWA 3HSZA 4KV8A 2DK2A 3CE8A 3JXOA 4HR2A 4PWUA 5GAEI 4A8QA 4CLZA 1LFWA 2JFDA 5HQMA 2H3EB 5IZHA 4K4YA 5HQ8A 2QX0A 1B7YB 4ECRA 2MLZA 1U48A 4AFFA 4DPTA 1N5TA 2PEHA 2JH3A 2J0XA 1W25A 2KN4A 2VFRA 1HI8A 5CA5A 1PGZA 4IYQA 4PYDA 1FDDA 4ZVEA 1VQ4S 4F0HA 3A3PB 3EGWB 3SI8A 2R7VA 3CJ3A 1BWEA 4IFVB 1TV6B 3MF5A 1AUSL 2QL5B 2GCFA 4FN5A 4WK3A 3KKFA 2A1BA 1TMJA 1VS3A 3KK2A 1E6YB 2XLKA 1NUEA 2XMAA 3DGPB 1RWMB 1X5TA 3G6XA 4NOHA 4NA1A 4CLPA 5E7OB 1RA6A 3PW5A 3R1HA 1TUVA 4Q2MA 5LMUJ 3LAKA 3D0IE 2XI2A 2Z2LA 2G1DA 2ZNZA 2GHWA 3QPIA 2V8DA 2OIHA 2DGXA 1YZ6A 2MZQA 4G1QA 2CPIA 2JLFA 4FVMA 1CJKA 2RJZA 2UXBF 2FHKA 4KPYA 1VFJA 1WORA 3QGHA 5RUBA 1RTZA 3M30B 1LXJA 5KFBA 3X1LB 1IKWB 2CPYA 2E1MC 2RQKA 4G6VB 1H7WA 1S1TA 3PG9A 2E5IA 3BJYA 4S0MA 2YWGA 5C5JA 2AX0A 4PPZA 4FP9A 2F5GA 3PVXA 1M5OC 2HNYA 3MR5A 2OH2A 4NLPA 4WP8A 3RW7A 5I3QA 1O51A 5F9LA 2DR5A 4LFBF 4X4NA 2GIFA 4B17A 4CTAA 3RRHA 4B3OA 2B9EA 1PAEX 4NRUA 5F8GA 2NPFA 4H4MB 4CI0B 3G71S 2YKMB 2MKSA 3H0PA 4A8KA 1YRUA 2AJ1A 5FDLA 3ZZOA 4L75A 3OR2B 4ZPCA 1U02A 4H4OB 1Y4ZB 2BDPA 2ATLA 2DHXA 2JNJA 2LKZA 2MQLA 3AA8A 3QAUA 4KH1B 2WONA 4YN3B 2ZM6J 1HNWJ 2K06A 2CQPA 2WOMB 4ZPBA 3R5JB 3UO0A 3NG8A 2HQGA 2VG7A 1X31C 4OYIA 2JC1A 4LIRA 4IFVA 4TKTA 3DLGA 5D0GA 4C11B 2UUAJ 2E1AA 1FERA 3F41A 3D7SB 2H51B 2VF3A 3IBFB 3LA0A 4LRAA 4P9SA 3I55S 3H4BA 3EGNA 3VGTA 2ZFHA 1WG4A 1S79A 2HNZA 1S6QB 3QFWA 4WIQA 4HYKA 4YHHF 2FVSA 1FJCA 3M8SA 1Q8BA 2HYIB 3NLCA 3I0RA 4AUKA 4K2XA 1VQNS 1I51B 1SKSA 1T05A 1FXLA 1RBAA 1C1BB 1HNWF 1NSKL 1WG1A 5F8MA 2KRRA 1R8BA 3MUVP 2MLYA 4ZOSA 4K4TA 3EMTA 2Y9HA 1RWXB 1ACMB 1Y11A 1NDPA 2L9NA 5EN1A 3IFEA 3NKYA 4IH7A 2FGOA 2IAJA 4X4OA 4F04B 2QRRA 4RW7A 1YBTA 3UE2A 2J5AA 1B0VA 2V63A 3TR5A 5GMDA 1NK8A 5D4LA 2DNRA 4NASA 3EYZA 3B4MA 4DL7A 1NK9A 1SI9A 1TVRA 2ACYA 5C2CA 1B7FA 1M5PC 2YKOA 1VC0A 2C2ZB 3IS9B 4KBIA 4QPTA 4W98A 5GADI 2MKKA 2OEKA 2XMUA 2VJVA 1EARA 2UUBJ 3K2YA 4ZPAA 5A8RB 2IY5B 5HROB 1UZDA 5HAOA 5BYSA 1SH3A 1N5YB 2RQ4A 3KLFA 1PSDA 1Q95G 3TW0A 1WNEA 2IVMA 4E0DA 2HWTA 2W9BB 4FYXB 4YFUA 4DXLA 3EGZA 4TU7A 1DTTA 3ONQA 1FESA 1FKPA 5F41A 4FS2A 2DRDA 3J81U 3B82A 2QV6A 2VBXA 3M2RB 4XDDA 4KGKA 1HLWA 4ZP8A 2GO8A 3DNCA 4CQ1A 4DWIA 3HK2A 3OL9A 3KLGA 2PI5A 2EBEA 2E7XA 3CD5A 4WFXA 4IG0B 3VR1A 1SV5A 4KYZA 1Y0HA 1NK4A 2XG8A 4LF1A 4WBFA 1UMJA 5J2PA 4OI0A 1OS5A 2B8QA 2G2YA 2RB7A 4JI2F 2I38A 4KC5A 2M8DB 3UDVA 1RT6B 3OFHA 2N3LA 1DLOB 2VFVA 4LREA 2RF2A 2DISA 3P4UB 5ETSA 3UWTA 3OJUA 2VB6A 6AT1B 5BXIA 2YKAA 2ASLA 4U9RA 1Z4UA 2DITA 1R8PA 4LIWA 2YNFB 5E3QA 2MHNA 3GE9A 1WC3A 4USTA 3C3LA 2GAGC 2ZJRQ 1SB6A 2CQCA 4BBYA 9RUBA 4DCJB 4OZ3A 1LWCA 4DUTA 3ZZUA 2HBZB 1UW4A 4M5NA 3W7BA 3GJQB 1NJZA 2G4BA 3BF4A 4RUCA 3PO5A 1HL6A 3VCDA 1TKDA 1M1GA 3M6VA 3E01B 2IVYA 1ZTWA 5F8JA 4H4KC 2IFXA 2P6TA 1KR4A 3M1VB 3FZBA 4I6AA 4R8UB 5K8NA 4CYUA 2WTFA 4AT1B 1LNQA 1TKXB 2X1BA 3DOLB 4Z7CA 3PKYA 3NWRA 3PR4A 1YWXA 3A8IA 4L73A 2X7IA 2QA1A 3GILA 5ETNA 4DV2J 2ROPA 2O67A 3ZFVA 4K50A 3C14A 2ZUGA 3I0SB 3QZ7A 2B9XA 2HRUA 3OHBA 2RS8A 1TUWA 1KNZA 3O5TB 3NL0A 1HW9A 2HHQA 3R7BB 2PDAA 4OHXA 1RTHB 3JAMU 2R42A 2RF2B 1S0NA 2RUGA 2RHSB 5IFMA 4C8ZA 4JBCA 4DMZA 1SCJB 3R3TA 2FLOA 5J2PB 4YB7A 3W9IA 2RRAA 1GXUA 2C2NA 3CIMA 4GO5X 2C3OA 3THTA 3OLAA 2UU9J 3LO3A 3RGIA 4PZVA 2FHMA 1H72C 5KT3A 4MK9A 1ELOA 2G0IA 2MY7A 2MZRA 1Q7LB 4YP3A 1XR5A 5I3UB 3DU5A 2KL8A 1M0SA 4KPCA 4AXJA 2NXCA 5F8IA 2DR7A 1TR0A 1YGYA 4LT6A 4KHRA 4DQQA 4OJHA 3K5MA 2LECA 2DNQA 2D41A 2HHWA 2CKWA 3Q8VA 3RW6A 1KDNA 2UXCJ 4U95A 2QSWA 1C0TB 3FC9A 1CS4A 3GJRB 3K17A 2JEJA 2U2FA 2BVZA 5KFVA 1F1BB 3P6YC 4JI3F 4ECSA 1YBUA 2B8PA 4IO1A 4OLPA 5EHHA 5LMUF 4DUYJ 3MXHP 1S9EB 2GIQA 2P8IA 3EM1A 3NCQA 2QYCA 3TQEA 2W9AA 5FD1A 3R97A 4ECWA 1NZ8A 2DR6A 2GA7A 2OPPA 3MM5A 2ZHOA 4MT1A 5A76A 3K59A 1WOSA 2QLBB 2YPZA 2OSQA 2CPZA 1B3TA 4DPWA 3P45B 1JWWA 2V67A 1TKXA 4CO2A 4X84A 2AX1A 3EICA 4YHHJ 3BPSP 3C16B 3EZOA 3M1VA 2XLIA 2VC1A 1RHMB 3RB4A 3C15A 2VG5A 4J5OA 2Z2MA 4OHYA 2BRKA 3NGKA 3EPGA 2KXFA 1HMVB 2OI2A 5K9FA 1OSDA 2BANB 3VAJA 2AQ4A 1ZAVA 1CJVA 1NMEB 1CLFA 3K8WA 3DHXA 3M2VA 4DLEA 3TQ1A 3KYLA 2RRBA 3FK4A 4UW2A 1CJUB 2MB0B 4LF6F 3MECB 4PG5A 3OVAA 2BQ3A 4PWDB 3LALA 3OTCA 1X9WA 4F02A 4Z7YA 4YB1P 2JRSA 3VTIA 3N0VA 4DV1J 1NKCA 2GHPA 3MM9B 1RWUA 3HVWA 3TA2A 4ZVHA 3GZ7A 1EIYB 4DFPA 2HBRB 2YNGA 2BJ3A 1L3SA 2CG4A 4HHHA 4ID5B 4LF5F 2HKEA 1XNQF 4G1IA 3UW1A 1IR0A 5FLXY 3K89A 4DPXA 2VUGA 4W92B 2V34A 3OUYA 3RAXA 4CNYA 1X4CA 1W2IA 2PEBA 2OPRB 3L7PA 1FK9A 4I7FA 5KOWA 3M9MB 2N4CA 3N4WA 1X4AA 6FD1A 4FNIA 4DV7F 1FRIA 1J5EF 3HKZD 2LEAA 4OYMA 3PFOA 2WVCA 1VBKA 3RG6A 3EJMA 2MSTA 3CJ4A 1XJWB 3GFZA 1JJ4A 2EFVA 2RU9A 5KFDA 2AZ3A 3CJ0A 5G0RB 2DHGA 2PE8A 3RBZA 5IC6B 2MKIA 2KFYA 3IN5A 2WSFC 3KLHA 4DUZJ 4ZS6A 2XYHB 5KFXA 1SJ3P 2C2EA 5L38A 3RBXA 4M5GA 2IC3B 1Q86T 1QVFR 1ICEB 4ZCIA 5G4DA 1TL3B 2HWIA 3EGVA 3FFIB 5BR8F 1O0PA 2RUSA 2I6WA 4PG6A 3BSCA 4FXDA 2RD5C 4OX7A 2M70A 1RAOA 3FBBA 2GX8A 2YKQA 1HFEL 1IKYA 3CCZA 4ZP7A 1IBKF 1AROP 2HHHF 3HJFA 2HQFA 2PA3A 3BGFA 2XQCA 5EWEA 4ECYA 1UVNA 4X4QA 4F4KA 2F40A 1PC5A 2V8PA 1B0PA 4I2PB 4RU9A 2PT0A 3CCTA 3N9UC 4YUDA 2M2BA 3E01A 1D8YA 2WSCC 2ABYA 4HT5A 3RZAA 1R8HA 2FB0A 3SCKE 3TARA 1FX4A 4O44A 3BGUA 2ROEA 1JJ2R 5F8NA 3TAQA 3H20A 2D3OR 3AOAA 5CCMA 1EAYC 2UUCJ 1RT5B 1S1VB 2VOPA 1FF2A 2KT3A 1SC1B 1WSRA 3KG1A 1U49A 3DLHA 2NSBA 1HQEA 5CHCB 2VICA 2V94A 4BDPA 3QSIA 2W8LA 4BHQA 1KHVA 2YNIB 1XERA 1O6XA 4LJMA 2AW0A 2DNPA 2XY6A 3T9ZA 2PMWA 2ZBIA 2O01C 2XHWA 3ILIA 1H7XA 4TQSA 2DH8A 1XQIA 4HI1A 2OPSB 1H38A 5K8MA 3OJSA 5AXNA 1F60B 2PSZA 5HBMA 2ZVSA 1NCLA 5CABA 2DGSA 2IPOB 1R0AB 2C3YA 1H74A 2QL7B 2YY3A 1NEEA 2D3UA 3ENWA 3WC0A 2IC3A 3BR8A 5A8WB 1VQ8S 2OFGX 5B0FA 1MROA 3CF5Q 2W9BA 3PW0A 4EZ9A 2KG1A 5DDRC 1U1LA 3PHEA 4U96A 1WC1A 5AE2A 1IKWA 5D0EA 4QW9A 3JTNA 3M30A 4DR4F 3HHEA 3BBBA 2NZ4A 4YB5A 1LWEB 4F50A 4I69A 1WKLA 1QAYA 6FDRA 2F7VA 3QLHA 1VIXA 2XNQA 3MEEA 3L09A 2ZD1B 5AE3A 4UOCA 3IP0A 3SYZA 3GG0A 4NRTA 4F4AA 4RX6A 4DSLA 1YLXA 3UR3C 1FK9B 3MPDA 4RWXA 3W2VA 4K4WA 1HR0F 5DLGA 5C7PA 1QTMA 1SL2A 1JX4A 1KQSR 1JB0C 2OP5A 2P9CA 2APOA 2LYVA 1BQNA 2FJAB 4LBHA 1C1CA 3CJTA 4AQYF 1RCXB 1C1BA 2D74B 2GGPA 4P10A 1TTHB 1K1QA 2DHSA 1S0OA 1WDDA 2ZH3A 4TU9A 3RAQA 2BBEA 3ZTRA 3VZIA 5MAOA 2V8HA 3ITHB 2CDRB 1S97A 2IM3A 1OY9A 3GSDA 4A8MP 1KLNA 4QWBA 3G86A 4NMXA 1VHIA 1YVFA 2C3PA 2MSSA 3DKDA 3BH6B 4KT0C 3U27A 3QRQA 1HWKA 2M0GB 2CUYA 3B54A 3H2VE 3R5BA 3CCLS 3BZQA 4I64A 3FCVA 4MAKA 5KG2A 1QE1B 4R0JA 3CCVS 2XZDB 2P5VA 5SZTA 4JI6F 2B43A 4DX8H 3SXLA 1BQNB 1GFWB 2D9PA 2WRMA 2FY1A 1MSWD 3ULHA 3PTWA 5DZ7A 1U1QA 2HHXA 2MYFA 4KKOB 4LSNA 3TX8A 1B4SA 2DJWA 1GX5A 1UFKA 4OYPA 2HURA 4OYXA 2CRLA 5KFTA 3RTVA 5ADZA 1L3TA 1NB2A 1UL3A 1EQMA 2CPDA 2F8MA 3GYXB 3H90A 3LP2B 2QMUB 3PACA 5DQIA 2AYBA 4C8LA 3MMAB 2ROGA 3I96A 2V69A 1S9EA 3HVAA 3IRWP 4JB8B 2FY8A 3PRBA 2R2SA 3G82A 3NCPA 4ZN3A 2MGZB 3FMWA 1RT2A 4GC6A 4NLQA 4Y65A 3C6TA 5HMXA 4C8KA 2VZ9A 3BYPA 4FYWB 3TAMA 3EXCX 2C3MA 1LWFB 1X5SA 2EXUA 8ATCB 5F9NA 2I5JA 1XWLA 3HI9A 5A6WA 3UQSA 4EYHB 1I94J 2ILZA 4B9TA 4AL6A 1GMUA 2BE2B 2AJFE 2AMCB 2YX7A 2QEXS 4Q5VA 4ZCLA 3ZXWA 1JLFA 3I56S 1FKAF 1NNDA 1Y5LB 1U1KA 4TLQA 2DPJA 2XGPA 3Q8UA 2ZNYA 4U67Q 1HNXJ 1WKKA 3ZC4A 5LM7E 3TVKA 1Y5NB 4C6AA 4OX6A 1XMQF 2IJRA 5HSPA 1AT1B 2IJNA 3BS9A 2AIRB 4EUVA 3GR1A 2Z4PA 3LUYA 5KFFA 1YX2A 2DEIA 3ENQA 3Q8YA 4FDFA 2R4FA 5CYJA 5KT6A 2H48B 3CPWR 1FA0A 2VQFJ 1VC6A 1S1VA 2VASA 2XMMA 2UUCF 1RAJA 4PXBA 4X66F 3LOUA 4J37A 2W4PA 1UJ4A 3BKFA 5DDQC 3V6HA 2KB2A 3G8TA 1JK9B 5HQLA 4W90B 3DCAA 4KV8B 1BXNA 1NH8A 1XTZA 4N47A 2R2TA 1LQ9A 3MD3A 1YI2S 3BQ0A 4L3NA 2GAHC 2V2ZA 4TNOA 3PXGa 1HHSA 4LFAF 1N6QA 1ZA1B 2FVCA 2XGQA 3KK1B 1N32F 4X4VA 3RYLA 5HMZA 5M2RA 1E6VA 1LK7A 3N79A 1FFGB 2CJYB 4P72A 1PYSB 1XIQA 3DOLA 4ZPVR 5D8HB 3DRSA 1DAXA 1SIZA 4LFAJ 4CYUB 1N32J 2X1GA 3LP1A 4ECXA 4I4BA 2NREA 2F65A 3ZNUA 1J2VA 2V4QA 1EX8A 1F3FA 1Z2ZA 2WW8A 3BM7A 3CGIA 3EZ5A 1S0MA 1D1UA 4DN9A 1V5IB 3KTQA 1M5KC 2VPWB 1UWBB 1UAWA 5L46A 4YDXA 3CJRA 4JI3J 1UA0A 3MR3A 2QTWA 2MQQA 2Q1LA 4IG3B 2BJDA 3TZWA 1X4FA 5G0RA 3ENVA 3IR7B 3IWLA 3NMAA 1HBOB 2MKYA 2LDYA 4MIBA 2BJ7A 3Q8SB 1RTIA 4WE1B 3TJ8A 4BWMA 1VQYA 1RXOB 3CCRS 3TZZA 4K4UA 2OO4A 2DCUB 1R6YA 3OFGA 4HL9A 4MFBB 5CZXA 2ADBA 3KNAA 1DLOA 2QC3A 4X4UA 4DR7F 3BQ2A 3SMZA 2AGPA 1Y7PA 4A8FA 3BO4A 1PC4A 3ZO7A 1NLKL 4PQAA 4IRDA 4ETZA 2E44A 3D0HE 2Z0GA 2A6MA 3CMES 1U7LA 1CC7A 4RBVA 2MQPA 3I5CA 3UD5A 4CT9A 3MEGA 4LUBA 4ED7A 3MEDA 4NLVA 2HMIA 2HGLA 4PUOA 2WZ1A 3K0JA 2L08A 3JS9A 1U1RA 3AT1B 1UP1A 2EFQA 4ZVGA 1XNQJ 2X1FA 1SQEA 3WX4A 4ZK7M 3PJ9A 1V5VA 2ZZNA 2QG9B 3HO1A 2BRLA 1QUPA 3K5NA 1N56A 2CWKA 3OL6A 2VQEF 3BO3A 3PJWA 2QE5A 4J9MA 4ANEA 1S7HA 4U7UD 3MI7X 3PM9A 3G82B 3QQCD 3SSRA 1LWXA 2VG5B 2MGZA 2XC9A 4DS4A 3PX0A 1VLYA 1MW7A 1NSAA 3NGUA 3DI6A 4I6WA 2XYGB 3AA9A 3H5YA 1RLDA 2F8EX 1WI6A 3AD9C 3DRSB 1IKXB 1VQSA 4RBTA 1FI4A 5EUHA 5E3RA 5T41A 1WHWA 3T6BA 3EPIA 1F2GA 2AU0A 2IAJB 4UOFA 1VQPS 1KFSA 3UPFA 3TA0A 2RMLA 1VOMA 1RTJA 1UFWA 2ZHAA 2XEXA 3LGHA 1FRXA 1VLOA 4UQGA 1DFDA 4ZVTB 1QE1A 4WU2A 4DUYF 2PO4A 1MN7A 2CQ1A 4IDKA 4NZ7A 4NI2A 2EEYA 1SC6A 4ZCMA 4FPRA 5C24A 2QA2A 3GP9A 1NSPA 2HNZB 2RE1A 2V8GA 3BBCA 2IVFB 2CZ4A 3VAFA 1RHUB 4O3NA 4DL6A 1N4LA 2XMWA 5T14A 2FGCA 5DM6Q 1VQMS 5E41A 3GB0A 4ECQA 1DRZA 1VQLS 3CJ5A 2DRBA 1RJJA 2DY1A 3HHDA 3CULA 3OVSA 4B3RF 3P5TL 2BOAA 2M9KA 2OMLA 1HWUA 5HN0A 4O0IA 1WTBA 1TK0A 2DR9A 3LAMA 3ADAC 5JUMA 4HKQA 2MHEA 3N28A 3OXGA 4J9SA 4O3RA 4M95A 2IBOA 2R7SA 5K14B 2O5DA 2XYPB 1KRPA 4YB6A 3HKWA 2IYGA 2JHEA 1B0TA 2BQRA 4DR7J 1Q5YA 2DT9A 4HDGA 5KFQA 4JV1A 2XHCA 1K1SA 2HW3A 4PG4A 4R5PB 4DSEA 1FD8A 4UOGA 4E2FB 1X5OA 4CO3A 3I5BA 2WB1D 1LWEA 2KU7A 2Z56B 4Q8EA 4GKJF 2AYEA 1U0SA 3LGNA 4B02A 4CRJA 1EQ0A 1T9UA 5F3TA 4XPCA 3AOBA 4MYTA 3RB0A 2Q79A 2AYGA 2NSCA 1KHWA 1URRA 3HSDA 2CQIA 1T11A 4I56A 3DLJA 3SDEB 5J1EA 1EETA 2DTJA 5IT4A 2ZH8A 4KTQA 2LLZA 1S5ZA 1VQ7S 4LF4F 4LFCJ 4LF9J 4PQUB 3M8QB 2BQUA 4NLWA 4ES2A 4KR0B 5L1IA 1JLCB 1N5SA 5D78A 1ROFA 2XCPA 1YJWS 3MZIA 1Q82T 3KUHA 3MAQA 2OPSA 2J9DE 4X64F 5LMNJ 3QO9B 2R2RA 2Z8QA 3MM7B 2RDJA 1ZPVA 2GFFA 4WK1A 4DR3J 4DR5J 1QSYA 3PJXA 2LXIA 4QIFA 4B3MJ 1WOOA 2M4MA 2YWKA 4HLBA 5HK4A 3H5XA 2XO6A 1AFIA 3OW2R 3PYFA 1YJVA 1IBCB 2CWXA 4RO0A 3WQPA 4ZLPA 1RT4A 1FXDA 1SQFA 4OIXA 2FJVA 5KOXA 1LW2B 1JLGA 3A8JA 3MMCB 2K7KA 2HHPA 2QA4S 1BY9A 1RT6A 3W66A 2C2OB 5LSLA 3GU0A 2CQGA 2Z57B 3PDNA 3W62A 2B5JA 4EZ6A 2MKCA 2A0FB 1HHQA 3VAKA 3M8WA 5KFAA 1DTQA 2E1PA 4LSLB 4YEAA 2BACA 3PX6A 2PMZD 1TL7A 1QAIA 3BKUA 3WIUA 4LBIA 4IH6A 3X3UA 4NEZA 2I1RA 4CIOA 1GQEA 1VRTA 2ZOGA 3BR9A 2EPIA 3FEZA 3RJMB 2ZJPQ 2M8HA 3SV3A 1UVLA 2ZC3A 1VQKS 4RUHA 1VISA 1KOOA 3M8YA 1SH0A 2C1EB 3CCSS 2R9LA 4B3SF 3CO0P 2FZKB 1NXIA 1WELA 2J0SD 2I5JB 3ZTQA 1RISA 3LWMA 1WEZA 3N6NA 1XMOF 3KNGA 3PYEA 1N36F 3OVBA 1WHXA 4IFYB 3VZHA 4I2QB 3CIZA 1WF0A 1NDCA 3PW2A 2YKNA 3GIRA 4KY3A 5IWAF 1N36J 2RQCA 3GMGA 1XMOJ 3C19A 2W2PP 2WB4A 3E2EA 1BWVA 1S77D 1RBLA 2AP6A 3QSYB 5J2QA 4P7TA 4UQTA 4P2FA 4A8OA 1VK3A 3PIOQ 4RW7B 2Q43A 3MTJA 3OUYB 1HWJA 1MMDA 2MEWA 4JV2A 3GCWP 4X4RA 1HIYA 3LGMA 2XZTB 5IOLA 3VGUA 1V9OA 2P6SA 2DH9A 3UN3A 4PG7A 4A46A 1JLGB 2KVIA 1C4CA 1HARA 2HRYA 2YNIA 2YWHA 4J9LA 4DFMA 3BO2A 3DMJA 1BC6A 5BYQA 5LSRA 4Q43A 3JYTB 3IR5B 4DQSA 4Y28C 1S1UA 4B3TJ 3TUJC 3HHKA 3VAGA 4DV3F 1FRLA 4F2SA 4DQIA 3H40A 2KFNA 1SUQB 2K7JA 2OUGA 1H73A 3OFFA 3T5HA 1YZ7A 3C15B 3TEHB 3JSYA 1LK5A 2DNGA 3QFHA 4PWWA 1RQ0A 3U1MA 4A47A 5C25B 5KFWA 1N33J 3HFKA 4USHA 1DBDA 3RUBL 1P8GA 2RT3A 3HVTA 4ICLB 5AXLA 1CULA 2AV5A 1VQOS 2FJWA 2E66A 5GAHI 3O2IA 2PC6A 4B3OB 4AQYJ 1F9EB 1VGYA 4E98A 5J2MB 2ZBCA 3M8QA 2I8EA 1RKJA 3I32A 3CJ8A 3S01A 2MQOA 4X4SA 4DBQA 4C8NA 2JLGA 4DF4A 1JXLA 3O3LA 1SH2A 2PFDA 2UUWA 4MKBA 1S1TB 1RE1B 2BX6A 4KGZB 1ZM2A 4K59A 1Q8IA 2J0WA 5A0YA 1YJTA 2GVDA 2VBZA 1JLAA 3OTEA 1KD1T 2NXJA 4J9VA 3T9NA 2R8HA 2JC0A 2J9CA 4DV0F 2MDAA 1L3VA 2UXCF 5H9FK 3PY8A 3BYRA 1RP5A 3JQMA 4NYOA 5FIIA 2P9EA 1NSQA 1FKOA 2KI2A 3NS7B 5EWFA 2F9JA 3DM2A 4GVLA 2B4VA 2HFZA 4PEOA 5IQQA 2A10A 5KFEA 2AJ0A 3V6JA 3DRPA 3UDEA 3W65A 3VQSA 4URQU 1D09B 1U6FA 4NLDA 2H5EA 2POKA 2W4DA 3IM9A 3VV2B 3JSMB 5ETKA 4LF5J 1GH8A 1REVB 4UZCA 5GVQA 1U1PA 3IBCB 2QA4G 1X9SA 2HGMA 1UTAA 1FDAA 2H54B 3SV4A 2HLTA 1NK7A 1N52B 1G2EA 3K5LA 2ZWPA 3AY0A 4RPFA 5JXSA 1N0UA 4WXOA 3QJLA 1YRXA 3A3NB 4QCLA 2N7YA 3KWMA 2UV8G 4HHUA 4ZLJA 4O4GB 3ZZPA 2L3MA 3FBCA 2D3ZA 3HMJG 4JI5J 2QJ3A 5KT2A 4NI2B 1AFJA 2AHOB 1X4EA 4TY9A 1T02A 2C2MB 4DQRA 5MLCV 4J91A 1S1UB 1ZAXA 1SJ4P 1REGX 3C8YA 1WTFA 4O44B 2M3DA 5H9EJ 3T1HJ 5ETVA 3PYDA 4NXNJ 4CO0A 3POTB 4DI6A 1NB7A 3OL7A 3DI6B 1H2UX 3DLEB 5D4OA 2RDDA 3T1YJ 3CSKA 5KFRA 3HHNB 2BKPA 2F4FA 4C98A 3D1QA 1RADB 2B9YA 4IRKA 4C9DA 4NLRA 3D0GE 3CC4S 2KRBA 2NLWA 3SQGA 1X4DA 1SJRA 4K2JA 1FWKA 2OKQA 3GQCA 2JZ5A 4M5LA 1EZZB 4IRCA 3M6WA 3LF0A 2L9DA 5LOQA 4JI0J 1BQMA 4O0NA 3AB4B 3BSAA 3W60A 1UVJA 3GG1A 1U0HB 2YQ1A 1IR1A 2CQ3A 3QYYA 4EFAC 1FRJA 1TKZB 2NUHA 1U09A 2OSRA 3CJ2A 3MEDB 4DS5A 4KFBA 3DC2A 1DURA 1M90T 3CJSA 1PAUB 2LMIA 1XMQJ 3QGGA 4U7CA 2XNRA 1AB8A 4Y2AA 4DV5J 1D8ZA 3OT9A 2HVHA 1TZ0A 1WACA 3MTKA 3W9HA 1MU2B 1V6HA 1R0BG 3A8KA 3MPVA 3EDRB 1JLBB 1WC6A 9ATCB 4DV5F 1D3WA 4EWTA 1T3OA 4HH1A 3R7SB 1WEXA 5L1JA 1UPMB 4NA2A 4BLGA 1CG2A 4LVNP 3TX0A 2Y3YA 3MM8B 2E29A 3LANA 2LFVA 1VR6A 2R7OA 3IGVA 2IMWP 3QRRA 3THPA 3SZ2A 1IBLF 1NDKA 2JDJA 4NXNF 3DOKA 5KFGA 1YKWA 2FHJA 4K4SA 3CWJA 2ZBPA 1X8DA 2DEJA 3QMQA 4W4MA 4F67A 1S9FA 4KFBB 5U47A 4KO0B 4M5HA 2OD4A 3UVJB 1VBYA 4C8OA 5ETPA 1RT4B 5KFMA 2HNDB 4QWAA 2O66A 3US5A 5DG9A 1BQMB 3KK3B 1U2FA 3ICLA 1LW0B 3VAMA 4CZCA 3EWGA 4GO7X 3IGNA 3B6BA 3AFGA 3EXYA 2K3IA 3M8PA 4C0BA 4DPUA 2V9WA 1GMWD 2VBWA 3CDAA 7FD1A 3KHLA 4MKYA 2VKZG 3TANA 2RKIB 2A2DA 4PYAA 5K8PA 3M05A 1DQ9A 4NLYA 4WWSA 1Q8KA 3V2UC 2KM8B 3C16A 4H4KA 4AL7A 1GMVA 1APSA 1FEHA 3T6JA 4LF8F 1RLCL 1PO6A 1T0TV 5ETTA 4DV4J 1P9QC 2YNHA 4RW4A 3AD8C 3K8VA 4OJ1A 4UZBA 1BQXA 3EX7B 4DLGA 1QSLA 3AODA 4N41A 3P49B 1WF1A 1WSVA 1EP4A 1XR6A 2GV1A 2JEIA 1LWCB 4X66J 4UT4A 2FJXA 2GQCA 3BB5A 4LFCF 3CW2C 1X4GA 1H98A 3GIJA 4AE5A 1FCAA 1H3DA 3QGPA 3IBWA 3QWUA 5HLFA 1U1NA 1HQUA 2J6TA 1M5HA 5KG1A 4O4GA 1OYEA 1Y9OA 2QZ8A 5J2NA 5D3GB 1N48A 3J7AN 1Y00A 4MJKA 1RUSA 2VC0A 1HNXF 3VF0B 4P2SA 1Q1KA 1GT8A 5ETQA 3OLBA 4O4RA 1SV5B 2F4VJ 4R5PA 3KOAA 2OFHX 1RI7A 2Q66A 4J9UE 4B9VA 3K5OA 4RW6B 4UUWA 2VPZB 1IN0A 4PRFA 1SIWB 4JI7F 1VBZA 1M5VC 1H2TZ 4QZVB 3VAIA 1S6OA 4RUAA 1T8EA 4JI7J 2HHVA 3AJDA 3H2LA 2Y1LB 3OR1A 4NZ6A 4P52A 5J2NB 5KFNA 2ZH1A 2JLEA 5D3GA 2HIQA 1QY7A 1AW0A 4AD6A 1X0PA 1RTIB 3GYNA 4LF7F 2F4VF 3ZZTA 1D0EA 2CNLB 2ZH2A 3PX4A 1T95A 1K44A 4ECUA 1RCOB 5J1NA 4QYZJ 1KLMB 1XN9A 5C42A 4DV0J 4IQMA 5HI7A 3LP2A 3DDNA 1AA1B 2XCAA 2K8GA 5E3CA 4JV0A 4ZN1A 4OZ2A 4B08A 2XM3A 1KONA 3UD3P 4DV4F 4IDKB 5IT9U 1UZHA 4ZP6A 1PKUA 3TUPA 2HEKA 3HLUA 3NAIA 2I2YA 2GMJA 3OD2A 4OX9J 2KFZA 2DGWA 3PV8A 1S7IA 2OGUA 5B09A 2HVIA 4K5SA 3MR2A 5HVHA 2YWEA 2HG4A 2DGVA 2OLWA 4F25A 2MTLA 4ZVOB 5T7LB 5B0EA 4JOUA 5KG7A 3VWSA 4R0EA 1HWLA 1KS2A 5EX3A 3UCGA 1MWYA 5C25A 4FZVA 3V81B 5THWA 3AAWB 4MIAA 4NYPA 5CYQA 4Y6IA 3GTYX 4PR6A 3DRYA 3LP0A 4ILRA 4KO0A 5CAAA 1J5OA 2R8JA 2R8GA 3KLEA 2FYXA 5IV4A 5B0BA 2DD8S 3MUTP 2CQ2A 3NCRA 1AZSA 2J7KA 4NLUA 4RKUC 5E33A 2QLFB 5CXTA 1RWVB 2ZH7A 3NS6A 5L1KA 2GS8A 4B9SA 3G87A 1FE4A 4Q7AA 3TJ9A 4ZLLA 2DIUA 4YOEA 4Q8FA 4LRCA 5EGYA 3DYAB 1LOUA 2CXEA 4F7VA 4WYLA 4DZDA 3CJQA 1J27A 2C28A 4Y2IA 4OHWA 3PW7A 4X2BA 4C8MA 3SCLE 3E3XA 1SC4B 4DHVA 1N54B 4RW8A 5HVGA 4V19J 1Q8LA 1HR0J 3O44A 4QR2A 1V3RA 5BYRA 2UVVA 3M2RA 2QL9B 5KT7A 3C6UA 3RR8A 4K0KF 4WE1A 4ZMMA 4RNFA 2A18A 1S6PB 4HTJA 3ZTSA 4ZKAA 1WD6A 4JI0F 1NDLA 1B70B 4FF2A 4CLWA 1R0AA 2IJFA 3KLFB 5KFIA 3G6VA 3P5BP 3TUZC 1O8BA 4B9UA 3SQGB 4DR6F 2CZ9A 3HDSA 4JI4J 2ZBQA 2ZHBA 3QZ8A 3IS9A 2U1AA 4CH0S 1P1TA 3KLIA 4KGVB 1U4BA 1U25A 2IA6A 5ETOA 3QRPA 3PRDA 1UJ5A 4OI3A 4DFJA 1CJTB 2ZBRA 3POTA 1K0VA 2HBYB 2J76E 2DGUA 2GMHA 1YRTA 1D9DA 2B3TB 4ZLNA 2KHCA 1TV6A 2H4WB 2FC8A 3Q24A 1OYDA 3EUNA 5AXMA 3Q83A 4RJVA 5IT0A 3ISNC 5DDOC 2B7CB 4NA3A 1U6ZA 4E8UA 1B99A 2IRUA 3S8SA 1S59A 1CQMA 1UVKA 2GIRA 2J9DA 3L9ZA 3LP0B 3SCIE 3Q86A 4C2MA 2FZGB 5BJRA 2DNKA 4USVA 1F5CA 1G3OA 1HNIB 1R7IA 2VA2A 2CDQA 1TKTA 2K2PA 4CO5A 3CEDA 3UCUP 2MY8A 4C11A 5D0RA 3CC2S 3AQPA 4P74A 5CD4H 2RRNA 2XS2A 5D15A 3EVOA 2WOMA 5CYMA 4WCEQ 2RILA 4ENOA 1RBOB 1RWWB 4LF9F 2HQDA 3HSGA 4M94A 3UCZP 3VGSA 5H1SV 2W9CA 3OR2A 3PW4A 4NCAA 2XY5A 3AH6A 4ZVRB 1LKZA 1S9GB 1SJ1A 4HH0A 1H0HB 2BZ2A 2C2DA 1Q78A 2WVBA 3QIDA 4HHJA 1OY8A 1ITPA 1JLQA 4M5DB 2BJEA 3CDUA 3QNWB 2J6UA 1LWFA 2W1BA 3ILLA 4ECVA 3FEYB 4PXCA 2MQMA 3MEKA 1KOHA 4OYOA 2Y1JA 2D3O1 1K8AT 3W2WA 4DV7J 1D9FA 1NZAA 1D9AA 1HKAA 3I6PA 3UI3A 3W61A 5LJ5Y 3G6ES 3OR1B 3KUGA 2CIMA 1Q16B 3M32A 3NNCA 2DCLA 1K0TA 2MQ8A 2HQ3A 2EI5A 4PPDA 5A8WA 3H25A 1Q53A 4OI4A 4QYZK 4EBEA 4ID5A 2DNOA 4M5DA 2VOOA 1RWPB 4WZQA 1OWXA 2XBPA 4PQUA 3H2UB 4U8YA 4FPIA 4A8XA 1S72S 1WJ9A 3A13A 3GLJA 4ZVFA 4WKYA 1GEHA 4N5SA 3MAAA 5F8HA 4C0HA 4PWDA 3TZYA 2YH1A 4TYBA 4JI6J 4ZJLA 4EEYA 3M2VB 3D1OA 3O6QA 3FSYA 3K57A 4FF1A 4B3RJ 3HFVA 1HMVA 1N5QA 2HSEB 1HQEB 5I42A 3I87A 2Z30B 1U24A 2B6AA 4WIIA 4B3TF 2AEMA 3OHAA 2UP1A 5AE1A 4FXWA 1HNIA 2AZ1A 4KJIA 5K8OA 4XAKA 2QSFA 1HI0P 2RIJA 1U6BA 1VCTA 3OFEA 2Y8WA 5EWGA 3S7RA 4B9LA 4FBUA 3TJAA 2XS7A 3HHLC 3JSBA 5DS7A 4I2PA 2C22A 1R27B 4RNNA 2CNNB 2HS4A 2B56A 2KHDA 2ZKUA 1SBRA 3FSXA 5LMNF 3T5JA 2DB1A 2E5GA 3CB4A 4PABA 2VBYA 5HANA 4WF9Q 2VFSA 3S6EA 3M2UB 2HK2A 1A6LA 3A1YG 2LEPA 3I82A 1RHQB 3CCWA 3MM6A 3TUIC 1NAQA 5HMYA 2GC8A 4JI1F 1QVGR 3KLIB 2LA4A 2AEFA 3MCOA 3W1YC 4EO6A 1QUVA 1KLMA 1JLEA 1ZM3A 2DYAA 3BBFA 3IC1A 5C42B 2IM0A 3OTDA 4MK8A 3UVJA 3MUMP 2CPXA 4GC7A 4RBUA 2OHDA 2BA9A 3KLHB 2MLXA 4DUZF 3NGDA 1IKVA 1Q7YT 1HD1A 3DRRA 2BJ1A 4FYYB 2PN6A 1AXQA 2HQIA 3KG4A 4ZDNA 2PIIA 1HHTP 1H2VZ 2KT5A 1IQZA 3C6UB 3D6HB 3ETOA 2Y1RI 1VRTB 3I4PA 2X1AA 4DL0C 3FGVA 4PUOB 4I7FB 4DOZA 1TL1B 3IR6B 1YJNS 2RQMA 1X0FA 2HVEA 4Q0BB 4CH1A 3C46A 2AGOA 2F8HA 1VI7A 3CDBA 3R5CA 3TWZA 3V6KA 1UVMA 1WG5A 4YR3A 4ED6A 2I0XA 3TP2A 1RDRA 1YJRA 2DHAA 5GADU 4QWEA 2WW4A 3LTOA 3B78A 2GVZA 3D9BA 3HJVA 3B8HA 1NJYA 4U6PA 2UVWA 1S1WA 2Q6BA 2XSJA 2V68A 2YWFA 2B9WA 2QMWA 3M8ZA 3Q89A 4NZ0A 4QR0A 2HGNA 2CG8A 4FYVB 1HBUB 3NY0A 5IXUA 3NEKA 4C4WA 2IHR1 1SVDA 3R5GA 1HNVA 3ISND 4ANDA 2QN6B 5L1LA 3ETMA 1UCNA 2BANA 4DV2F 4EYIB 4JUZA 4ZVPB 2AJ2A 3DXSX 4QIEA 3I4HX 3Q2TC 3CD7A 4DR5F 2JOQA 1YK9A 2Z2ZA 4O23A 2CNKB 2W7OA 4IR9A 2WCXA 3CMAS 2H65B 4WP9A 4R8UA 1KKHA 4BWJA 1V3SA 4Q2LA 1X4HA 2B4UA 2CVEA 3CNQP 3TA1A 3DFEA 2UVRA 1IKYB 1YQHA 4EK2A 5M2UA 2XO7A 4J9PA 3T1HF 1N34F 1RT3A 4KIAA 1U1MA 4Y34A 3ILJA 2DO0A 1G1XA 4USIA 3DDKA 1HNVB 3KHHA 4QU6A 3H5SA 2MZ1A 3A8EA 4P75A 1QDUB 2KYZA 3OSPA 2EC2A 4JI4F 2CPEA 3W5XA 4Y2KA 4F3QA 3V4IA 2E7VA 3KG0A 5H9EK 1QAXA 4QR1A 4WU3A 1C0UA 1VHFA 3CT9A 2ZC4A 4LF4J 3PKMA 4DL2A 4FYDA 4JI8F
chains in the Genus database with same CATH topology
5CAAA 1WKJA 3Q8UA 1WKKA 3FBFA 1NHKL 4C6AA 1F6TA 1ZS6A 3R9LA 3VGVA 3Q8YA 1NDKA 3WX8A 1BUXA 1BHNA 3NGSA 4KPCA 2AZ1A 3L7UA 3ELHA 3VGTA 4UOGA 1XQIA 3Q8VA 1KDNA 3ENAA 3FC9A 1NCLA 1NSKL 5CABA 4CP5A 3EMTA 3B6BA 1NDPA 2ZUAA 2B8PA 3FBEA 3ZTSA 3BH7B 3EVMA 1XIQA 3EM1A 3FKBA 2BX6A 3NGRA 1S5ZA 1NDLA 1LEOA 1F3FA 1MN9A 4W98A 3BBBA 2DYAA 3BBFA 1WKLA 1NSQA 3EICA 2DXEA 4F4AA 4ANCA 3MPDA 3PRVA 5C7PA 2DXDA 1JXVA 3Q83A 2VU5A 4FKYA 1HLWA 2NCKL 2HVEA 3EVWA 1B99A 4HR2A 2DY9A 1S59A 1NLKL 4UOHA 4WBFA 3Q86A 3ZTRA 2B8QA 1NPKA 3FBCA 3DDIA 4F36A 3DKDA 3FCWA 3BH6B 3Q89A 5BXIA 3JS9A 1HHQA 3ZTPA 3B54A 3FCVA 3EVOA 3NGTA 3PJ9A 4ANDA 4ENOA 4DUTA 2CWKA 3ETMA 1NUEA 1UCNA 3VVTA 1W7WA 4ANEA 3VGSA 3EJMA 1LWXA 4FKXA 1B4SA 3VVUA 1K44A 3EE3A 2HURA 2BEFA 2AZ3A 1NB2A 4DI6A 3NGUA 3ZTQA 2DXFA 4EK2A 1NDCA 3GPAA 4UOFA 1PKUA 1VYAA 4O0NA 3FBBA 4S0MA 1MN7A 2HVDA 1U8WA 3ZTOA 3GP9A 3G2XA 1NSPA 1HIYA 3BBCA 5IOLA 4DZ6A 3VGUA 1EHWA 1S57A 1PAEX 1BE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CAA A;  1WKJ A;  3Q8U A;  1WKK A;  3FBF A;  1NHK L;  4C6A A;  1F6T A;  1ZS6 A;  3R9L A;  3VGV A;  3Q8Y A;  1NDK A;  3WX8 A;  1BUX A;  1BHN A;  3NGS A;  4KPC A;  2AZ1 A;  3L7U A;  3ELH A;  3VGT A;  4UOG A;  1XQI A;  3Q8V A;  1KDN A;  3ENA A;  3FC9 A;  1NCL A;  1NSK L;  5CAB A;  4CP5 A;  3EMT A;  3B6B A;  1NDP A;  2ZUA A;  2B8P A;  3FBE A;  3ZTS A;  3BH7 B;  3EVM A;  1XIQ A;  3EM1 A;  3FKB A;  2BX6 A;  3NGR A;  1S5Z A;  1NDL A;  1LEO A;  1F3F A;  1MN9 A;  4W98 A;  3BBB A;  2DYA A;  3BBF A;  1WKL A;  1NSQ A;  3EIC A;  2DXE A;  4F4A A;  4ANC A;  3MPD A;  3PRV A;  5C7P A;  2DXD A;  1JXV A;  3Q83 A;  2VU5 A;  4FKY A;  1HLW A;  2NCK L;  2HVE A;  3EVW A;  1B99 A;  4HR2 A;  2DY9 A;  1S59 A;  1NLK L;  4UOH A;  4WBF A;  3Q86 A;  3ZTR A;  2B8Q A;  1NPK A;  3FBC A;  3DDI A;  4F36 A;  3DKD A;  3FCW A;  3BH6 B;  3Q89 A;  5BXI A;  3JS9 A;  1HHQ A;  3ZTP A;  3B54 A;  3FCV A;  3EVO A;  3NGT A;  3PJ9 A;  4AND A;  4ENO A;  4DUT A;  2CWK A;  3ETM A;  1NUE A;  1UCN A;  3VVT A;  1W7W A;  4ANE A;  3VGS A;  3EJM A;  1LWX A;  4FKX A;  1B4S A;  3VVU A;  1K44 A;  3EE3 A;  2HUR A;  2BEF A;  2AZ3 A;  1NB2 A;  4DI6 A;  3NGU A;  3ZTQ A;  2DXF A;  4EK2 A;  1NDC A;  3GPA A;  4UOF A;  1PKU A;  1VYA A;  4O0N A;  3FBB A;  4S0M A;  1MN7 A;  2HVD A;  1U8W A;  3ZTO A;  3GP9 A;  3G2X A;  1NSP A;  1HIY A;  3BBC A;  5IOL A;  4DZ6 A;  3VGU A;  1EHW A;  1S57 A;  1PAE X;  1BE4 A; 
#chains in the Genus database with same CATH topology
 4NLT A;  3SBM A;  2MKJ A;  2X3D A;  3RBD A;  3IG1 B;  4LR8 A;  5DZ6 A;  3JTO A;  5B08 A;  3J81 Y;  4DR2 J;  1HBM A;  3BSO A;  4USW A;  4MMO A;  5KT4 A;  5CD4 A;  4PG8 A;  4I67 A;  2DGO A;  5GMK a;  2HHT A;  3V6D B;  1YIT S;  2OPR A;  4CWB A;  2CNO B;  2UZA A;  2R8I A;  2QFJ A;  4NXM J;  2AYM A;  2BM0 A;  1JLB A;  3TOQ A;  2RU3 A;  3MUR P;  3TVY A;  1WHY A;  4CNZ A;  1MU2 A;  1MMN A;  2GJF A;  2O1P A;  2YNG B;  1VK8 A;  3WX8 A;  1T03 A;  4MYU A;  1SC3 B;  1GX6 A;  3QT7 A;  3FVY A;  4I6Y A;  4USJ C;  2M5Y A;  1M1K T;  1ZM9 A;  3C66 A;  1Y5I B;  2LXU A;  4DG1 A;  1QSS A;  4RU2 A;  4MK7 A;  3QT6 A;  3ENA A;  1PJ5 A;  3MEC A;  3CCQ S;  5IM0 A;  5M2P A;  4RUB A;  4FXV A;  3CVK A;  4DX7 A;  3DN9 A;  1C0U B;  3HSJ A;  3IMQ J;  1RTH A;  1JQG A;  2J8S A;  4L76 A;  2RH3 A;  3V4I B;  1HQU B;  1PJ6 A;  2VKR A;  2J9E A;  3W63 A;  3EVM A;  3SSQ A;  4L6V 3;  2W2Q P;  5LXR A;  2EFO A;  4JV5 F;  1FT8 A;  2PA8 D;  1C2P A;  3UNY A;  1FJG F;  1CUL B;  4OZ5 A;  2CQD A;  2HFN A;  3NWG A;  4GVB B;  1PYO B;  4TLR A;  4U7U K;  3TZX A;  2FHJ D;  2FQQ B;  4OI2 A;  4X62 J;  4OL8 A;  1X4B A;  1T9W A;  2EW9 A;  3AB2 B;  4TN2 A;  2CQH A;  5KG6 A;  5DJB A;  2R7T A;  5GAE U;  2XS5 A;  1GTH A;  4DU7 A;  2AF6 A;  2EKY A;  2G0J A;  4L74 A;  2CJB A;  4HTI A;  1CBK A;  4EBC A;  4ED2 A;  2OJ3 A;  3NNA A;  4J9Q A;  2YH0 A;  4J7C A;  3T1A A;  3W5Y A;  3GON A;  2JSX A;  2YVS A;  3SFU A;  4UY8 5;  4OX9 F;  4DV3 J;  1CS4 B;  5A2Q U;  2NCK L;  2HHU A;  5IM0 B;  3I31 A;  3KJQ B;  1FXR A;  3GII A;  2HK3 A;  2XSJ B;  1S1W B;  5B0G A;  5A8K A;  1RZM A;  1BD6 A;  4P71 A;  4RW9 B;  3ZZZ A;  4LRB A;  4NEY A;  4Y00 A;  3BN4 A;  4FF3 A;  3HM9 A;  1NPK A;  3HPO A;  1C1C B;  2FVP A;  2EVZ A;  3HT3 A;  5E2Q A;  3KJN B;  1FDN A;  1TFY A;  2GNK A;  3MM8 A;  3AXM A;  4ALZ A;  4RLE A;  4NCB A;  2FJE B;  1HPZ B;  3PFE A;  4UY8 T;  4OYA A;  3VVT A;  1F5A A;  1GTE A;  3PEJ A;  2P2C B;  2Y0S D;  3W2W B;  3CTR A;  1FKP B;  3D54 A;  4BCA A;  4K4X A;  3Q0A A;  1T7P A;  2EFN A;  4HT7 A;  5HMW A;  2WSE C;  1I3O B;  3E51 A;  1PBA A;  1T9V A;  1R89 A;  1RAG B;  3ET6 A;  3DLK B;  4ED3 A;  2YX4 A;  4ATN A;  1TKZ A;  5DDP C;  1UWB A;  2ATC B;  2RS2 A;  4NE9 C;  1J5O B;  2CPF A;  4OJ3 A;  2H5J B;  1V3Z A;  2KO1 A;  4P7V A;  2CJ9 A;  1TAQ A;  3DGP A;  3T1Y F;  2UXB J;  4K8R A;  5E0O A;  2E9T A;  4WFB Q;  1CEZ A;  3PR5 B;  3A4T A;  3M2U A;  3D4J A;  5HBM B;  2VOD A;  3FMB A;  2WK4 A;  4LSL A;  1DTQ B;  5HJY A;  1ZET A;  3DLL Q;  5IC4 B;  1GNK A;  3HVT B;  4ICL A;  2LQB A;  3KJF B;  4KHP J;  2V6A A;  3N5F A;  3G2X A;  2W2N P;  1ZPW X;  2E9Z A;  2HFU A;  3MMB A;  2GJ2 A;  4EU0 A;  5EX0 A;  4KE5 A;  3KMS A;  2M52 A;  1WF2 A;  3ZNJ 1;  2MXY A;  3M8R A;  2NZC A;  1ULR A;  5KFL A;  3KHG A;  1SUQ A;  1FFW B;  2LA6 A;  3FCH A;  1S6Q A;  3ZZ0 A;  4CDI A;  4F2R A;  2CA9 A;  4M1K A;  2XTJ P;  3GCX P;  1RT5 A;  1UA1 A;  2GJI A;  1SJF A;  1TU0 B;  2V8V A;  5IV3 A;  3JYT A;  4MTP A;  4NCG B;  3DLG B;  2YNF A;  4QJV A;  1Q79 A;  3CJK B;  1IBM F;  3DLB A;  2KG0 A;  3BV8 A;  1WDT A;  5FJ4 A;  3S1T A;  2BR0 A;  3NS5 A;  2FLP A;  2LQ5 A;  3OPK A;  4P2M A;  1BHN A;  3HD1 A;  4CLL A;  1JNR B;  1QM9 A;  2CAJ A;  3MAA B;  4B9N A;  1JJC B;  1NRK A;  1OSC A;  2HLU A;  4LVO P;  3KHR A;  3UD4 P;  2C2R A;  3F73 A;  3KJV B;  4IG0 A;  1ZTT A;  4N8O A;  1F9F A;  1VMB A;  1UFL A;  3RRK A;  1K73 T;  1IBK J;  2UXD F;  1I1G A;  1TL1 A;  4A48 A;  2NYI A;  5JMN A;  4BC7 A;  4IOC Q;  1URN A;  5KFJ A;  5F8L A;  2QMX A;  4ITS A;  2DNH A;  2VL1 A;  2HNY B;  3P3D A;  3AXK A;  4QIW D;  1JXE A;  5DG8 A;  3H8Y A;  5AJ3 J;  4LRD A;  3JSM A;  1EET B;  2PI4 A;  3DRP B;  1X60 A;  3F0N A;  4B9M A;  3HZE A;  3TAP A;  1LEO A;  4TY8 B;  2CJX B;  2PD1 A;  4ZVU B;  1VRQ C;  2Y8Y A;  4F4Y A;  3U1N A;  2ZJQ Q;  3CC7 S;  4GKJ J;  4L3K A;  1VC5 A;  1MWZ A;  2IBK A;  1MLA A;  3V5R A;  4DL3 A;  2V5H G;  4DJB A;  3MMA A;  1VIO A;  3H42 A;  1JLQ B;  2DKO B;  3W8P A;  1RYR A;  1EB0 A;  2UVU A;  4ED4 A;  4O3S A;  2DGQ A;  4QOT A;  4OI6 A;  4C3M A;  3JTP A;  2K1R B;  3CXC R;  4MH8 A;  5B0D A;  1S4E A;  1K9M T;  2B4P A;  2VJU A;  4DU8 A;  3NRB A;  1NHU A;  3NOC A;  4F3O A;  2EK1 A;  3DGV A;  4DR1 F;  2YWW A;  1NKE A;  4FKY A;  3PO4 A;  3CD6 S;  1N5V A;  1NPR A;  4RW9 A;  2V2Q A;  1KFD A;  1EJ7 L;  2OTJ S;  4Z37 A;  1PJ7 A;  1LW2 A;  3MMC A;  1UPP A;  1HYS A;  2IRY A;  3D66 A;  4KGM A;  1VBX A;  1HNZ J;  3K7R A;  4XDC A;  3HZG A;  1FNM A;  4WFY A;  3D28 A;  4F36 A;  5DG7 A;  1M5S A;  2HRT A;  2OMO A;  2XMK A;  1S0V A;  2BKN A;  2VG7 B;  2YX1 A;  3BEG B;  1SL1 A;  2KM8 C;  2GGP B;  3PNI A;  3E8O A;  4EMD A;  4I0W A;  4CM0 A;  2ZM6 F;  1LFP A;  2BXJ A;  1HD0 A;  1WUU A;  3G8S A;  4DSK A;  1OJ4 A;  2NXE A;  3FQL A;  3NBP B;  2HHH J;  2ZOM A;  4GVB A;  2YKM A;  2R7R A;  1IKX A;  1GMW A;  2QGF B;  5KFS A;  2HPU A;  1TK5 A;  1FJG J;  1JLC A;  3BKT A;  1Y3J A;  2LEB A;  4NML A;  1VQ6 S;  1UVI A;  3MEE B;  1T94 A;  4X65 F;  1RAB B;  4IOA Q;  1RTD A;  4LRF A;  2PFF B;  3P96 A;  5KFK A;  1K47 A;  3SDE A;  2CPJ A;  1KQK A;  2ZZT A;  2IMO A;  3R5A A;  4XTT A;  3W5Z A;  4YR0 A;  3MPU B;  3RR7 A;  1Y10 A;  1RHK B;  1IBL J;  3W9J A;  1MRO B;  3VAL A;  1QD1 A;  1WWH A;  4CM2 A;  2HVD A;  1NJI T;  3Q8R B;  2OEJ A;  3H4D A;  1U8W A;  4DR4 J;  2BE7 D;  1RAC B;  1XEZ A;  2KTQ A;  2DRA A;  5ETL A;  4X4P A;  4G1Q B;  1IM4 A;  1WHV A;  3D3B J;  3QIP A;  3OXF A;  4DV6 J;  1TP7 A;  4TVA B;  2KVQ E;  2R2U A;  1SXL A;  3H59 A;  1T03 B;  3TNV A;  4FF4 A;  5CH7 B;  4RW8 B;  1KBR A;  4ZVQ B;  1OIA A;  2L9W A;  1EKS A;  2HVZ A;  2VFT A;  4A8Y A;  5K14 A;  4Q44 A;  2H9Z A;  1L3K A;  4M8L A;  3AJ1 A;  4CCH A;  3U1L A;  2HZV A;  1MML A;  4OYZ A;  2DVI A;  3KK2 B;  2ZZM A;  1ZS6 A;  3V6D A;  3MAH A;  2BOP A;  3KMQ A;  3KUE A;  2OEM A;  1IWA A;  4U8V A;  1HW8 A;  4DN0 A;  4YY3 F;  3IWN C;  2ACM A;  2V50 A;  4F0K A;  3THV A;  2KJW A;  2KXN B;  4LQ3 A;  4K5R A;  2D7S A;  4HVZ A;  1HBO A;  2M7S A;  4JI8 J;  3KFW X;  1NJX A;  2COL A;  2LQ9 A;  3J80 Y;  3CCU S;  4LMZ A;  4GKK F;  2OPQ B;  8RUC A;  1EP4 B;  2CQB A;  3ELH A;  4F26 A;  5C24 B;  3KLE B;  1FTC A;  4WKR A;  2BM1 A;  4RZR A;  2ASJ A;  4XK8 C;  2ALZ A;  4ZVS B;  2XZW A;  4ER8 A;  3MFH A;  4EBD A;  4LR9 A;  3KDN A;  4TYA A;  1HI1 A;  2YQ3 A;  1OO0 B;  2FLL A;  1CVJ A;  2H4Y B;  1MNE A;  4CP5 A;  1FRH A;  1RTJ B;  3WHI A;  5K20 B;  5T7L A;  5L9X A;  1RB0 A;  5JVG Q;  4X62 F;  3FBE A;  1L5U A;  3G8Q A;  1E6V B;  1KN6 A;  1TAU A;  3FKB A;  3UFC X;  4DPO A;  1RAH B;  5L8R C;  3MM7 A;  2FPH X;  1JKH B;  4JYA J;  4ECZ A;  1LW0 A;  4RR5 A;  1MN9 A;  1JIH A;  1DZ5 A;  4Y2C A;  3M9N B;  4ED5 A;  5DQG A;  4KHP F;  1OPI A;  2Y0B B;  4NLG A;  1NK6 A;  4WPA A;  2G13 A;  1O5J A;  2NYH A;  2LDI A;  2XI3 A;  1IJF B;  2B0G A;  2DXE A;  2UUT A;  2OPQ A;  3HUL A;  1HA1 A;  3IO1 A;  2HS3 A;  3R27 A;  4ZP9 A;  5KG0 A;  5DGB A;  1FD2 A;  3GSI A;  1X5P A;  2OAU A;  4TQR A;  2FLN A;  1S6P A;  1RWK B;  4FVC A;  4NL5 A;  3GYG A;  2W7P A;  5HAT A;  5HP1 B;  4BS2 A;  3MCN A;  3DXB A;  2GVZ B;  1IWG A;  1HPZ A;  5D77 A;  3J7Z T;  1X9M A;  1YIJ S;  4IO9 Q;  2QFI A;  1WI8 A;  2VH7 A;  1S76 D;  4CO4 A;  2A6O A;  3J7Y I;  4F4X A;  1S49 A;  3Q23 A;  1VQ5 S;  4DL4 A;  1ZBT A;  4RW6 A;  2FHO B;  4WFA Q;  1ZYQ A;  3Q8P B;  1RHR B;  2BE2 A;  4Q0B A;  2GQ2 A;  4ZJO A;  1KTV A;  3SFG A;  3MM9 A;  4ZPD A;  4ED8 A;  3DDI A;  4DV1 F;  2HFS A;  4DR2 F;  2RVJ A;  4DDF A;  1CC8 A;  3JB9 k;  4J9O A;  1DTT B;  2YTC A;  3A12 A;  4ERD A;  3NGT A;  4LQ9 A;  3IXQ A;  3TAM B;  1CJU A;  4LF6 J;  1RT1 B;  2H5I B;  4N56 A;  4OHV A;  3MCM A;  4IG3 A;  2B4O A;  1W26 A;  2FD2 A;  5HLF B;  1P27 B;  4IUF A;  1PYT A;  5GAH U;  5LL6 d;  2NQP A;  4FKX A;  1TMM A;  2JWN A;  5AT1 B;  3TRG A;  5CCL A;  1RTD B;  5CYQ B;  4ID8 A;  1KVI A;  3FDS A;  5GAG I;  3NMR A;  3TEG A;  2CAD A;  2JL9 A;  3TO8 A;  3V81 A;  1NBE B;  1T3N A;  3LP1 B;  5B0C A;  2D9O A;  2ALY B;  4N7T A;  1P6T A;  1S99 A;  2QT7 A;  2YNH B;  2XY7 A;  1SKW A;  1U45 A;  2ZH9 A;  4KKO A;  2OD6 A;  4LSN B;  3GPA A;  5LSO A;  3RRG A;  3L3C A;  1C4A A;  1VYA A;  2F9D A;  3LWL A;  1N6Q B;  1GXL A;  1YTY A;  4F8R A;  1TL5 A;  3HHL A;  1FJE B;  1IM6 A;  2HBQ B;  2N4D A;  1F2H A;  1NH7 A;  5KFO A;  3M6X A;  1DAR A;  1KQG B;  1RU2 A;  1UEK A;  5CZV A;  2J0Q D;  1IR2 A;  2VDI A;  5DLF A;  3M8P B;  4C8Y A;  2F1F A;  2FJB B;  3IRX B;  2XUL A;  2WVD A;  2A3J A;  1R8A A;  2BJ9 A;  2VPX B;  4QW8 A;  1DY3 A;  1DHM A;  5HJX A;  4JV5 J;  1FRM A;  3T3F A;  1W2B R;  1KC8 T;  5F0W A;  3CD0 A;  3EZU A;  3FRZ A;  3ITH A;  3JQJ A;  1SKR A;  1KVJ A;  1HNZ F;  4YR2 A;  3KXD A;  4G65 A;  1NPP A;  2DNZ A;  1RA7 A;  1R0C B;  2UUA F;  3DRX A;  4JP8 A;  2VIH A;  1HQ2 A;  3QJP A;  2CQ0 A;  4WFN Q;  1BGX T;  2XMV A;  3QAE A;  2FIU A;  3JAM Y;  3RAM A;  3Q8Q B;  1MWQ A;  1REV A;  2WON B;  4URS A;  4QWD A;  1I6J A;  4O3Q A;  3CDE A;  4ELU A;  2MZJ A;  3R2C J;  3MPY A;  1KTQ A;  7AT1 B;  2K1R A;  1XMB A;  5IQ6 A;  1R3N A;  2R7Q A;  4H4M A;  5GME A;  3W2V B;  2ZOF A;  3MD1 A;  3RB3 A;  1FEE A;  3LH2 S;  3PYG A;  3W8G A;  2VA3 A;  4TU8 A;  2V0N A;  4LF2 A;  4MIW A;  3HT0 A;  3L7U A;  4ZIV A;  5F3Z A;  2E5L J;  4USU A;  4J9K A;  3HX9 A;  1MG7 A;  4DF8 A;  4TXS A;  3CO9 A;  2BYC A;  2KKH A;  1S10 A;  1TK8 A;  1CQN A;  4UUX A;  1YJU A;  3MOJ B;  1XC9 A;  3D1H A;  5A0Y B;  5HP1 A;  4N8N A;  5KG4 A;  1RT2 B;  4O3P A;  2LXF A;  4NLX A;  1YSJ A;  4J9N A;  2HQC A;  2ZUA A;  2E9R X;  3HF5 A;  3FJ2 A;  2N7C A;  1LXN A;  2B7B B;  4ZIW A;  2L48 A;  1FE0 A;  3LQV A;  4CO1 A;  4IQX A;  3I0S A;  4O3O A;  4YDD B;  1VQ9 S;  3G4S S;  3K58 A;  2LCW A;  3HD2 A;  4PXD A;  1Z1Z A;  2WBR A;  3GJS B;  2FZC B;  3IWX A;  1RAI B;  2RDI A;  2GO9 A;  2HS0 A;  2VV5 A;  3NAH A;  3R6L B;  4RW4 B;  3CCJ S;  2R7X A;  3NBP A;  3IAM 9;  7FDR A;  3T19 A;  3HHL D;  2Z58 B;  2G9O A;  3DLE A;  2ZE2 A;  3L95 X;  2I9S A;  3J80 U;  3KLV A;  3K5P A;  2XB2 D;  3CCE S;  1N33 F;  2RKI A;  1JMT A;  2N3O A;  2DXD A;  2DNM A;  2QLW A;  4ZHR B;  2ZH5 A;  3L4B C;  2AJQ A;  5KFH A;  1GXT A;  3MDF A;  4OLO A;  4WYW A;  4OYB A;  2CFX A;  5KG3 A;  2VQF F;  1R6V A;  4CT8 A;  3T5L A;  1F5B A;  3KK3 A;  3B4D A;  2G0C A;  1YDL A;  2JFK A;  2DY9 A;  3DMJ B;  1OY6 A;  1UKU A;  3AQO A;  5DO2 A;  1KEK A;  3G96 A;  2KZM A;  3CDW A;  4WFZ A;  3W64 A;  5KFP A;  1QTN B;  2C42 A;  4DR3 F;  3BQ1 A;  3MMB B;  2CJA A;  2J7W A;  4RNM A;  1SPB P;  4JI2 J;  1Q81 T;  3J7A 1;  2HZA A;  4UF4 A;  1CSJ A;  3MFI A;  1G6B A;  4DCP B;  2EG2 A;  3U02 A;  2M88 A;  1RT7 A;  5B7W A;  3M9O B;  2E1R A;  4EGL A;  3KLG B;  3UDC A;  1FX2 A;  3GFY A;  1ZZF A;  3OTB A;  5LXY A;  1RHJ B;  3J81 j;  2EBG A;  2BJ8 A;  3N5B A;  3R6G B;  2AGQ A;  3UR0 A;  4G3I A;  5KFC A;  1A0O B;  3QLH B;  2V2K A;  4Y2M A;  5DET A;  5IWA J;  4OI1 A;  3ISZ A;  3VVU A;  3SCJ E;  4OZN A;  3N01 A;  4OZJ A;  3EE3 A;  4ETX A;  1TUG B;  2BEF A;  3T41 A;  3DRR B;  1H6K X;  2GHV C;  3I5A A;  3QGI A;  2JEG A;  4IH5 A;  3GV7 B;  3DM2 B;  1I94 F;  5JVH Q;  4LR7 A;  3BRE A;  1FKO B;  3J7Y U;  2V4J A;  5A8R A;  1X7V A;  4CLF A;  1U0H A;  4AXI A;  1UEU A;  4QIG A;  1JLE B;  1OPZ A;  1S6U A;  4OZ0 A;  4P6Q A;  4ILM A;  5AJ3 F;  4KQZ A;  2GVD B;  4OQJ A;  3ILO A;  3PEH A;  3SEO A;  5IT9 Y;  4AL5 A;  4UTG A;  3L7O A;  2IYI A;  4Y3C A;  4PKD B;  2NUU G;  5ITH A;  4D3H A;  2MJU A;  3GFX A;  3PHT A;  1AUD A;  1A9N B;  3RU0 A;  4DSI A;  2W25 A;  2IDE A;  1IXK A;  4QPX A;  2OEL A;  5H9F J;  2B5J B;  1JNZ B;  4FNH A;  5J2M A;  2CZV C;  3RB6 A;  3C2P A;  2F3J A;  4OJG A;  1IVZ A;  4K7Q A;  4USK A;  1VRU B;  3SSS A;  4RNO A;  1KVK A;  4RWW A;  1U2C A;  4C7Q A;  1IBM J;  2VON A;  4K4Z A;  2HFV A;  3SIP B;  2KZZ A;  3BGR A;  2A2C A;  3O8W A;  1GK8 A;  1NHK L;  4I1T A;  1GAO A;  2BV3 A;  5D4P A;  1F6T A;  1HBN A;  2YKP A;  5KTQ A;  2ZWO A;  3GFH A;  4WP3 A;  1Z2L A;  4IOB A;  3NNH A;  2KYX A;  1IUJ A;  3VGV A;  4ZHR A;  2J6S A;  2AWZ A;  1FWP A;  2Q3P A;  4XO0 A;  2JVR A;  2JEF A;  2EG1 A;  1R8C A;  1RYS A;  2CJQ A;  4P73 A;  3MOZ A;  3NGS A;  2E7W A;  1SL0 A;  2ZE2 B;  2EFG A;  3BGR B;  3CUN A;  2DNL A;  1RK8 A;  2H1Y A;  4KSE B;  1R31 A;  2BUN A;  4QYR A;  3UN5 A;  3RBE A;  5E5N A;  4B3M F;  3BN7 A;  2QIF A;  4DSJ A;  2X51 A;  5HO4 A;  2ERR A;  2N82 B;  2O3D A;  2AEJ A;  3NP5 A;  4WJB A;  2R8K A;  5F0U A;  1FDB A;  4IKA A;  3QT5 A;  4HAC A;  3VAH A;  2GML A;  4QQB A;  3BSN A;  4RNH A;  2LVW A;  3WZ0 A;  4CLK A;  5KG5 A;  3NGR A;  3V4M A;  5J2Q B;  1PIL A;  3HXM A;  2BW2 A;  2LP4 A;  3NOG A;  4ZPW R;  3ET6 B;  1UJ6 A;  1AYE A;  2ZD1 A;  5SUH A;  1ZM4 A;  2KH9 A;  1XNR J;  1C0T A;  1PBU A;  1VDH A;  4D3G A;  1S1X B;  1RGV A;  4WZM A;  3TYT A;  3WDO A;  2BKO A;  1S1X A;  3F56 A;  2V4R A;  2FVR A;  3UNG C;  2F63 A;  1XNR F;  4DL5 A;  1DJ0 A;  3UDL A;  4CLS A;  4K0K J;  1TEL A;  1U8S A;  1J5E J;  4TY8 A;  3SQO P;  2AJ4 A;  1TL4 A;  4B3S J;  4WXW A;  2IDL A;  1S9G A;  5I3U A;  3PRV A;  1RWN B;  2HIY A;  4CH7 A;  4OV1 A;  3BGL A;  1FTR A;  4ZIT A;  3AJ2 A;  8AT1 B;  2IM2 A;  1NO8 A;  2ZEJ A;  2R7U A;  1QJH A;  5L9N A;  2L41 A;  3R5D A;  1M1H A;  1WOP A;  2VU5 A;  1ZA2 B;  3AHP A;  2E5L F;  4GRS A;  5CYM B;  2Z2Y B;  4KHM A;  2UU9 F;  4R25 A;  1U47 A;  1FNO A;  3O1L A;  1PCA A;  3M6U A;  1RT7 B;  3HFZ B;  4YS2 A;  1T9X A;  2DNN A;  2ZKT A;  4UOH A;  5ETR A;  1FRK A;  4EO8 A;  2CYY A;  2NS1 B;  4C3L A;  1YG0 A;  4V1A k;  5KAK A;  1NK5 A;  4URG A;  2XSF A;  1TKT B;  2JX2 A;  4QIV A;  4DSF A;  4A8S A;  4NYZ A;  5L39 A;  3R7N B;  3JSR A;  4L72 B;  1UW9 A;  5LJ3 Y;  1A7G E;  1R43 A;  1RAE B;  1UET A;  3FCW A;  4C3K A;  3IA0 A;  4LBP A;  3ZTP A;  2QLX A;  4DQP A;  4NCG A;  1KWM A;  2QYG A;  2ILY A;  3OQ2 A;  2HZC A;  4DPY A;  3WBZ A;  1S48 A;  3HHL B;  3W3S A;  5B0A A;  1W7W A;  4KRW A;  2FVQ A;  4KAI A;  1RT3 B;  3D6M B;  1EKR A;  4WTY A;  4OFZ A;  2GQQ A;  4F0M A;  2MZT A;  2ZVI A;  3MR7 A;  3DOM A;  1CJT A;  1F9H A;  2OPP B;  3MM5 B;  2FC9 A;  2D69 A;  5KFY A;  4DX5 A;  1N34 J;  2J7U A;  3QO9 A;  1Y3K A;  3G6Y A;  2W2O P;  4C0O C;  1IJE B;  4PXE A;  4FS1 A;  3G9C A;  1B64 A;  4MKA A;  4M5J A;  4RL1 A;  3FSI A;  5E3P A;  3M7V A;  1ZAW A;  2AT1 B;  3FFI A;  2VQE J;  2MJN A;  1TFW A;  1TL3 A;  2Q6C A;  1SQG A;  5A6P A;  1RT1 A;  3NXZ A;  1PIE A;  2WBM A;  1UEV A;  2YKN B;  4EI2 A;  3HP6 A;  1HBU A;  2HND A;  2HFO A;  4IFY A;  4WTO B;  4LF7 J;  4DG1 B;  4P2X A;  1KSP A;  4Q45 A;  3GV8 B;  3DLK A;  4DZ6 A;  4QBU A;  3D68 A;  5D0H A;  2HMI B;  2RNE A;  4A8W A;  4ECT A;  1EHW A;  1N88 A;  1S57 A;  2YXL A;  3D6F B;  3DOK B;  3FEX B;  3KDO A;  2DBB A;  2GW8 A;  4DCO B;  2P9G A;  3CCM S;  4BC9 A;  4HEA 9;  4N76 A;  1WKJ A;  2NPI A;  2W01 A;  1FFS B;  3GV5 B;  3WC2 A;  2QLJ B;  3FBF A;  1QAJ A;  3JQK A;  3OTO J;  1OQ3 A;  2FJD B;  2XMT A;  5KFZ A;  2G1H A;  2YPY A;  4DV6 F;  4M5K A;  4DX6 A;  3DYA A;  4MFB A;  5IS2 A;  2IA0 A;  3OTO F;  3PCO B;  4GMK A;  3IM8 A;  5GAG U;  3VQT A;  2DIV A;  3OV7 A;  3QT8 A;  1IQT A;  4OHZ A;  2E1C A;  2EK6 A;  2FDN A;  2RAQ A;  2HWH A;  3CMQ A;  3DHW C;  1WC4 A;  3TVZ A;  1IKV B;  2JJ4 D;  2W2M P;  2AKW B;  3ZZR A;  4C97 A;  3BPD A;  4ILL A;  5A8K B;  2NR0 A;  4M5M A;  1T9T A;  3H98 A;  4J9R A;  4OX8 A;  1YBA A;  1ZZN A;  1FWL A;  3FRY A;  1U2R A;  2UUB F;  2LU2 A;  2HAF A;  4ELT A;  1JKH A;  5EDW A;  4QWC A;  3R2D J;  1CJV B;  4CLU A;  2W7A A;  3IRX A;  2HAI A;  4OV6 A;  1T9Y A;  3HVR A;  1ZOT A;  5E3A A;  1G4C A;  2SXL A;  3BH7 B;  1QLN A;  3MMJ A;  3EDQ B;  3N6L A;  2E5H A;  3KK1 A;  1RU1 A;  2ZH6 A;  5KT5 A;  3P8B B;  4NWB A;  2X3G A;  2DHH A;  1OMS A;  3MPW A;  5HVF A;  4X64 J;  2FTR A;  1T05 B;  3H5U A;  1KQF B;  3I0R B;  4Y0F A;  4YME A;  2KJV A;  2BW7 A;  1BLU A;  2LQ8 A;  2GZO A;  3LPY A;  4CLT A;  4JI5 F;  4QU7 A;  4DEZ A;  2HHS A;  5DQH A;  3FZ2 A;  5A2Q Y;  3BDP A;  2VDH A;  4GKK J;  2B6A B;  5J1E B;  2IRX A;  1RKI A;  5I4M A;  2V2V A;  2MZS A;  1VJW A;  5ETM A;  3AOC A;  3MWB A;  2MKH A;  1HWI A;  2XMJ A;  2Y1I A;  4KB7 A;  4OZ1 A;  3I9V 9;  2ZDP A;  2R3V A;  4PAA A;  1Q0N A;  4XIU A;  2ADC A;  1NM2 A;  1BMQ B;  1OQ6 A;  1WC5 A;  4MKV A;  1YHQ S;  4K4V A;  1SKU B;  2QO3 A;  3MEG B;  4Z2X A;  3J7Z 5;  2EWH A;  2LQJ A;  3D6T B;  3I9Z A;  4ZA1 A;  4LFB J;  4ZJQ A;  4PCQ A;  1P1L A;  3LW5 C;  2NXU A;  1DQ8 A;  5AXK A;  1F0X A;  3D3C J;  3M32 B;  1FO1 A;  3GJT B;  1YJ7 A;  2WAQ D;  1G7C B;  1XK8 A;  3GWC A;  4USM A;  2E5J A;  3TI0 A;  1KP6 A;  2CJK A;  1S4F A;  1HBM B;  1RSC A;  4LSZ B;  4NLO A;  1N8R T;  1U1O A;  3IG1 A;  4ZPT R;  4M63 A;  4ES3 A;  2RSQ A;  1RAF B;  1CJK B;  3BDE A;  2CPH A;  3F44 A;  4IR1 A;  1JLA B;  1NHV A;  1LV5 A;  3QBC A;  2DXF A;  4YQW A;  1NK0 A;  2MQN A;  3VHQ A;  4C48 A;  2UXD J;  2PGC A;  3FNN A;  3IAS 9;  2WVE A;  1PG5 B;  4F3M A;  4OMF G;  1UWA A;  3N6M A;  4HAC B;  2R7W A;  2AD9 A;  4JYA F;  4XPE A;  2IM1 A;  3C14 B;  1E6Y A;  5LT5 A;  4ED0 A;  4KH0 B;  1N0V C;  2JVO A;  2EKN A;  4NLS A;  2OTL S;  2CVI A;  2ZDO A;  4CLY A;  1NU4 A;  2VHG A;  2NXN A;  4M5I A;  3ZTO A;  3OXL A;  4LF8 J;  4X4T A;  1XBW A;  3Q2S C;  2DGT A;  4N77 A;  1DQA A;  4A4J A;  4DFK A;  1NKB A;  3T5K A;  2VFU A;  1BE4 A;  4I68 A;  4KGX B;  1SJQ A;  1I5O B;  2C2K B;  5I42 B;  2W4C A;  1Q4R A;  1RAA B;  4J90 A;  2ZH4 A;  4ZCK A;  3UN2 A;  3MGJ A;  3Q22 A;  1HYS B;  2XWY A;  4HDH A;  5J1P A;  2BAB A;  3D67 A;  4H54 A;  1WEY A;  3ZZY A;  5HL7 Q;  1HBN B;  2LU1 A;  2DPI A;  2KT2 A;  2VG6 B;  2VPY B;  3R9L A;  5DRK A;  1RWO B;  3PZP A;  4H4O A;  3H7H B;  1FHT A;  2V9K A;  5FDL B;  1WC0 A;  3OSN A;  4ED1 A;  2W24 A;  2RHQ B;  1VRU A;  4YY3 J;  3BGO P;  2IIH A;  1U26 A;  3U7J A;  4F4Z A;  1BUX A;  2UV8 A;  4CTA B;  5BR8 J;  4F4W A;  1TQL A;  4DR1 J;  2J8A A;  3OBI A;  2ASY A;  2W8K A;  2DH7 A;  3D2W A;  4OYW A;  3QWP A;  1Q5V A;  3R8Y A;  2WVF A;  3DU6 A;  1JLF B;  3R1L A;  3AD7 C;  2DNY A;  4DR6 J;  3MR6 A;  2DR8 A;  4NXM F;  3QIP B;  2ZIT A;  5I3P A;  3HCX A;  2VD3 A;  2EC0 A;  4OZL A;  5C2G A;  3WIV A;  4G1P A;  3M4X A;  3GIK A;  3GR0 A;  5DGA A;  2G2Z A;  3PIP Q;  1NJW A;  2CQ4 A;  1VJQ A;  4I2Q A;  1FVS A;  5FLX U;  2WHO A;  4V19 X;  1FJ7 A;  2ASD A;  2V4J B;  3C6T B;  4HI2 A;  5K5M A;  2K3K A;  3MCS A;  3QAT A;  1YJ9 S;  3FQK A;  5CQG A;  5HRO A;  2G2O A;  3A3O B;  1N5Y A;  2FUG 9;  2KDO A;  2D1C A;  3FUY A;  2XLJ A;  1FVQ A;  1FNX H;  2BMB A;  2EFP A;  3KJV A;  3GIM A;  1ZH5 A;  2B51 A;  5KFU A;  4X65 J;  5DM7 Q;  2W9C B;  5D4N A;  1TVR B;  4JI1 J;  3QJJ A;  2YBV A;  5JJB A;  4NX9 A;  3DOM B;  2YQ0 A;  3LPE A;  3MM6 B;  1TL7 B;  4ANC A;  5D6G A;  1P9Y A;  3MHY A;  3D5M A;  4AYB D;  4ELV A;  1CPZ A;  2DO4 A;  3CJK A;  2KXH A;  4FBT A;  1XR7 A;  3OL8 A;  1JXV A;  1F3V A;  2PMH A;  2C3U A;  2VG6 A;  2BE9 B;  2XWX A;  4ES1 A;  2MPU A;  1JJH A;  1L3U A;  2MMY A;  1AZS B;  4NPO A;  1S12 A;  3EVW A;  3HSZ A;  4KV8 A;  2DK2 A;  3CE8 A;  3JXO A;  4HR2 A;  4PWU A;  5GAE I;  4A8Q A;  4CLZ A;  1LFW A;  2JFD A;  5HQM A;  2H3E B;  5IZH A;  4K4Y A;  5HQ8 A;  2QX0 A;  1B7Y B;  4ECR A;  2MLZ A;  1U48 A;  4AFF A;  4DPT A;  1N5T A;  2PEH A;  2JH3 A;  2J0X A;  1W25 A;  2KN4 A;  2VFR A;  1HI8 A;  5CA5 A;  1PGZ A;  4IYQ A;  4PYD A;  1FDD A;  4ZVE A;  1VQ4 S;  4F0H A;  3A3P B;  3EGW B;  3SI8 A;  2R7V A;  3CJ3 A;  1BWE A;  4IFV B;  1TV6 B;  3MF5 A;  1AUS L;  2QL5 B;  2GCF A;  4FN5 A;  4WK3 A;  3KKF A;  2A1B A;  1TMJ A;  1VS3 A;  3KK2 A;  1E6Y B;  2XLK A;  1NUE A;  2XMA A;  3DGP B;  1RWM B;  1X5T A;  3G6X A;  4NOH A;  4NA1 A;  4CLP A;  5E7O B;  1RA6 A;  3PW5 A;  3R1H A;  1TUV A;  4Q2M A;  5LMU J;  3LAK A;  3D0I E;  2XI2 A;  2Z2L A;  2G1D A;  2ZNZ A;  2GHW A;  3QPI A;  2V8D A;  2OIH A;  2DGX A;  1YZ6 A;  2MZQ A;  4G1Q A;  2CPI A;  2JLF A;  4FVM A;  1CJK A;  2RJZ A;  2UXB F;  2FHK A;  4KPY A;  1VFJ A;  1WOR A;  3QGH A;  5RUB A;  1RTZ A;  3M30 B;  1LXJ A;  5KFB A;  3X1L B;  1IKW B;  2CPY A;  2E1M C;  2RQK A;  4G6V B;  1H7W A;  1S1T A;  3PG9 A;  2E5I A;  3BJY A;  4S0M A;  2YWG A;  5C5J A;  2AX0 A;  4PPZ A;  4FP9 A;  2F5G A;  3PVX A;  1M5O C;  2HNY A;  3MR5 A;  2OH2 A;  4NLP A;  4WP8 A;  3RW7 A;  5I3Q A;  1O51 A;  5F9L A;  2DR5 A;  4LFB F;  4X4N A;  2GIF A;  4B17 A;  4CTA A;  3RRH A;  4B3O A;  2B9E A;  1PAE X;  4NRU A;  5F8G A;  2NPF A;  4H4M B;  4CI0 B;  3G71 S;  2YKM B;  2MKS A;  3H0P A;  4A8K A;  1YRU A;  2AJ1 A;  5FDL A;  3ZZO A;  4L75 A;  3OR2 B;  4ZPC A;  1U02 A;  4H4O B;  1Y4Z B;  2BDP A;  2ATL A;  2DHX A;  2JNJ A;  2LKZ A;  2MQL A;  3AA8 A;  3QAU A;  4KH1 B;  2WON A;  4YN3 B;  2ZM6 J;  1HNW J;  2K06 A;  2CQP A;  2WOM B;  4ZPB A;  3R5J B;  3UO0 A;  3NG8 A;  2HQG A;  2VG7 A;  1X31 C;  4OYI A;  2JC1 A;  4LIR A;  4IFV A;  4TKT A;  3DLG A;  5D0G A;  4C11 B;  2UUA J;  2E1A A;  1FER A;  3F41 A;  3D7S B;  2H51 B;  2VF3 A;  3IBF B;  3LA0 A;  4LRA A;  4P9S A;  3I55 S;  3H4B A;  3EGN A;  3VGT A;  2ZFH A;  1WG4 A;  1S79 A;  2HNZ A;  1S6Q B;  3QFW A;  4WIQ A;  4HYK A;  4YHH F;  2FVS A;  1FJC A;  3M8S A;  1Q8B A;  2HYI B;  3NLC A;  3I0R A;  4AUK A;  4K2X A;  1VQN S;  1I51 B;  1SKS A;  1T05 A;  1FXL A;  1RBA A;  1C1B B;  1HNW F;  1NSK L;  1WG1 A;  5F8M A;  2KRR A;  1R8B A;  3MUV P;  2MLY A;  4ZOS A;  4K4T A;  3EMT A;  2Y9H A;  1RWX B;  1ACM B;  1Y11 A;  1NDP A;  2L9N A;  5EN1 A;  3IFE A;  3NKY A;  4IH7 A;  2FGO A;  2IAJ A;  4X4O A;  4F04 B;  2QRR A;  4RW7 A;  1YBT A;  3UE2 A;  2J5A A;  1B0V A;  2V63 A;  3TR5 A;  5GMD A;  1NK8 A;  5D4L A;  2DNR A;  4NAS A;  3EYZ A;  3B4M A;  4DL7 A;  1NK9 A;  1SI9 A;  1TVR A;  2ACY A;  5C2C A;  1B7F A;  1M5P C;  2YKO A;  1VC0 A;  2C2Z B;  3IS9 B;  4KBI A;  4QPT A;  4W98 A;  5GAD I;  2MKK A;  2OEK A;  2XMU A;  2VJV A;  1EAR A;  2UUB J;  3K2Y A;  4ZPA A;  5A8R B;  2IY5 B;  5HRO B;  1UZD A;  5HAO A;  5BYS A;  1SH3 A;  1N5Y B;  2RQ4 A;  3KLF A;  1PSD A;  1Q95 G;  3TW0 A;  1WNE A;  2IVM A;  4E0D A;  2HWT A;  2W9B B;  4FYX B;  4YFU A;  4DXL A;  3EGZ A;  4TU7 A;  1DTT A;  3ONQ A;  1FES A;  1FKP A;  5F41 A;  4FS2 A;  2DRD A;  3J81 U;  3B82 A;  2QV6 A;  2VBX A;  3M2R B;  4XDD A;  4KGK A;  1HLW A;  4ZP8 A;  2GO8 A;  3DNC A;  4CQ1 A;  4DWI A;  3HK2 A;  3OL9 A;  3KLG A;  2PI5 A;  2EBE A;  2E7X A;  3CD5 A;  4WFX A;  4IG0 B;  3VR1 A;  1SV5 A;  4KYZ A;  1Y0H A;  1NK4 A;  2XG8 A;  4LF1 A;  4WBF A;  1UMJ A;  5J2P A;  4OI0 A;  1OS5 A;  2B8Q A;  2G2Y A;  2RB7 A;  4JI2 F;  2I38 A;  4KC5 A;  2M8D B;  3UDV A;  1RT6 B;  3OFH A;  2N3L A;  1DLO B;  2VFV A;  4LRE A;  2RF2 A;  2DIS A;  3P4U B;  5ETS A;  3UWT A;  3OJU A;  2VB6 A;  6AT1 B;  5BXI A;  2YKA A;  2ASL A;  4U9R A;  1Z4U A;  2DIT A;  1R8P A;  4LIW A;  2YNF B;  5E3Q A;  2MHN A;  3GE9 A;  1WC3 A;  4UST A;  3C3L A;  2GAG C;  2ZJR Q;  1SB6 A;  2CQC A;  4BBY A;  9RUB A;  4DCJ B;  4OZ3 A;  1LWC A;  4DUT A;  3ZZU A;  2HBZ B;  1UW4 A;  4M5N A;  3W7B A;  3GJQ B;  1NJZ A;  2G4B A;  3BF4 A;  4RUC A;  3PO5 A;  1HL6 A;  3VCD A;  1TKD A;  1M1G A;  3M6V A;  3E01 B;  2IVY A;  1ZTW A;  5F8J A;  4H4K C;  2IFX A;  2P6T A;  1KR4 A;  3M1V B;  3FZB A;  4I6A A;  4R8U B;  5K8N A;  4CYU A;  2WTF A;  4AT1 B;  1LNQ A;  1TKX B;  2X1B A;  3DOL B;  4Z7C A;  3PKY A;  3NWR A;  3PR4 A;  1YWX A;  3A8I A;  4L73 A;  2X7I A;  2QA1 A;  3GIL A;  5ETN A;  4DV2 J;  2ROP A;  2O67 A;  3ZFV A;  4K50 A;  3C14 A;  2ZUG A;  3I0S B;  3QZ7 A;  2B9X A;  2HRU A;  3OHB A;  2RS8 A;  1TUW A;  1KNZ A;  3O5T B;  3NL0 A;  1HW9 A;  2HHQ A;  3R7B B;  2PDA A;  4OHX A;  1RTH B;  3JAM U;  2R42 A;  2RF2 B;  1S0N A;  2RUG A;  2RHS B;  5IFM A;  4C8Z A;  4JBC A;  4DMZ A;  1SCJ B;  3R3T A;  2FLO A;  5J2P B;  4YB7 A;  3W9I A;  2RRA A;  1GXU A;  2C2N A;  3CIM A;  4GO5 X;  2C3O A;  3THT A;  3OLA A;  2UU9 J;  3LO3 A;  3RGI A;  4PZV A;  2FHM A;  1H72 C;  5KT3 A;  4MK9 A;  1ELO A;  2G0I A;  2MY7 A;  2MZR A;  1Q7L B;  4YP3 A;  1XR5 A;  5I3U B;  3DU5 A;  2KL8 A;  1M0S A;  4KPC A;  4AXJ A;  2NXC A;  5F8I A;  2DR7 A;  1TR0 A;  1YGY A;  4LT6 A;  4KHR A;  4DQQ A;  4OJH A;  3K5M A;  2LEC A;  2DNQ A;  2D41 A;  2HHW A;  2CKW A;  3Q8V A;  3RW6 A;  1KDN A;  2UXC J;  4U95 A;  2QSW A;  1C0T B;  3FC9 A;  1CS4 A;  3GJR B;  3K17 A;  2JEJ A;  2U2F A;  2BVZ A;  5KFV A;  1F1B B;  3P6Y C;  4JI3 F;  4ECS A;  1YBU A;  2B8P A;  4IO1 A;  4OLP A;  5EHH A;  5LMU F;  4DUY J;  3MXH P;  1S9E B;  2GIQ A;  2P8I A;  3EM1 A;  3NCQ A;  2QYC A;  3TQE A;  2W9A A;  5FD1 A;  3R97 A;  4ECW A;  1NZ8 A;  2DR6 A;  2GA7 A;  2OPP A;  3MM5 A;  2ZHO A;  4MT1 A;  5A76 A;  3K59 A;  1WOS A;  2QLB B;  2YPZ A;  2OSQ A;  2CPZ A;  1B3T A;  4DPW A;  3P45 B;  1JWW A;  2V67 A;  1TKX A;  4CO2 A;  4X84 A;  2AX1 A;  3EIC A;  4YHH J;  3BPS P;  3C16 B;  3EZO A;  3M1V A;  2XLI A;  2VC1 A;  1RHM B;  3RB4 A;  3C15 A;  2VG5 A;  4J5O A;  2Z2M A;  4OHY A;  2BRK A;  3NGK A;  3EPG A;  2KXF A;  1HMV B;  2OI2 A;  5K9F A;  1OSD A;  2BAN B;  3VAJ A;  2AQ4 A;  1ZAV A;  1CJV A;  1NME B;  1CLF A;  3K8W A;  3DHX A;  3M2V A;  4DLE A;  3TQ1 A;  3KYL A;  2RRB A;  3FK4 A;  4UW2 A;  1CJU B;  2MB0 B;  4LF6 F;  3MEC B;  4PG5 A;  3OVA A;  2BQ3 A;  4PWD B;  3LAL A;  3OTC A;  1X9W A;  4F02 A;  4Z7Y A;  4YB1 P;  2JRS A;  3VTI A;  3N0V A;  4DV1 J;  1NKC A;  2GHP A;  3MM9 B;  1RWU A;  3HVW A;  3TA2 A;  4ZVH A;  3GZ7 A;  1EIY B;  4DFP A;  2HBR B;  2YNG A;  2BJ3 A;  1L3S A;  2CG4 A;  4HHH A;  4ID5 B;  4LF5 F;  2HKE A;  1XNQ F;  4G1I A;  3UW1 A;  1IR0 A;  5FLX Y;  3K89 A;  4DPX A;  2VUG A;  4W92 B;  2V34 A;  3OUY A;  3RAX A;  4CNY A;  1X4C A;  1W2I A;  2PEB A;  2OPR B;  3L7P A;  1FK9 A;  4I7F A;  5KOW A;  3M9M B;  2N4C A;  3N4W A;  1X4A A;  6FD1 A;  4FNI A;  4DV7 F;  1FRI A;  1J5E F;  3HKZ D;  2LEA A;  4OYM A;  3PFO A;  2WVC A;  1VBK A;  3RG6 A;  3EJM A;  2MST A;  3CJ4 A;  1XJW B;  3GFZ A;  1JJ4 A;  2EFV A;  2RU9 A;  5KFD A;  2AZ3 A;  3CJ0 A;  5G0R B;  2DHG A;  2PE8 A;  3RBZ A;  5IC6 B;  2MKI A;  2KFY A;  3IN5 A;  2WSF C;  3KLH A;  4DUZ J;  4ZS6 A;  2XYH B;  5KFX A;  1SJ3 P;  2C2E A;  5L38 A;  3RBX A;  4M5G A;  2IC3 B;  1Q86 T;  1QVF R;  1ICE B;  4ZCI A;  5G4D A;  1TL3 B;  2HWI A;  3EGV A;  3FFI B;  5BR8 F;  1O0P A;  2RUS A;  2I6W A;  4PG6 A;  3BSC A;  4FXD A;  2RD5 C;  4OX7 A;  2M70 A;  1RAO A;  3FBB A;  2GX8 A;  2YKQ A;  1HFE L;  1IKY A;  3CCZ A;  4ZP7 A;  1IBK F;  1ARO P;  2HHH F;  3HJF A;  2HQF A;  2PA3 A;  3BGF A;  2XQC A;  5EWE A;  4ECY A;  1UVN A;  4X4Q A;  4F4K A;  2F40 A;  1PC5 A;  2V8P A;  1B0P A;  4I2P B;  4RU9 A;  2PT0 A;  3CCT A;  3N9U C;  4YUD A;  2M2B A;  3E01 A;  1D8Y A;  2WSC C;  2ABY A;  4HT5 A;  3RZA A;  1R8H A;  2FB0 A;  3SCK E;  3TAR A;  1FX4 A;  4O44 A;  3BGU A;  2ROE A;  1JJ2 R;  5F8N A;  3TAQ A;  3H20 A;  2D3O R;  3AOA A;  5CCM A;  1EAY C;  2UUC J;  1RT5 B;  1S1V B;  2VOP A;  1FF2 A;  2KT3 A;  1SC1 B;  1WSR A;  3KG1 A;  1U49 A;  3DLH A;  2NSB A;  1HQE A;  5CHC B;  2VIC A;  2V94 A;  4BDP A;  3QSI A;  2W8L A;  4BHQ A;  1KHV A;  2YNI B;  1XER A;  1O6X A;  4LJM A;  2AW0 A;  2DNP A;  2XY6 A;  3T9Z A;  2PMW A;  2ZBI A;  2O01 C;  2XHW A;  3ILI A;  1H7X A;  4TQS A;  2DH8 A;  1XQI A;  4HI1 A;  2OPS B;  1H38 A;  5K8M A;  3OJS A;  5AXN A;  1F60 B;  2PSZ A;  5HBM A;  2ZVS A;  1NCL A;  5CAB A;  2DGS A;  2IPO B;  1R0A B;  2C3Y A;  1H74 A;  2QL7 B;  2YY3 A;  1NEE A;  2D3U A;  3ENW A;  3WC0 A;  2IC3 A;  3BR8 A;  5A8W B;  1VQ8 S;  2OFG X;  5B0F A;  1MRO A;  3CF5 Q;  2W9B A;  3PW0 A;  4EZ9 A;  2KG1 A;  5DDR C;  1U1L A;  3PHE A;  4U96 A;  1WC1 A;  5AE2 A;  1IKW A;  5D0E A;  4QW9 A;  3JTN A;  3M30 A;  4DR4 F;  3HHE A;  3BBB A;  2NZ4 A;  4YB5 A;  1LWE B;  4F50 A;  4I69 A;  1WKL A;  1QAY A;  6FDR A;  2F7V A;  3QLH A;  1VIX A;  2XNQ A;  3MEE A;  3L09 A;  2ZD1 B;  5AE3 A;  4UOC A;  3IP0 A;  3SYZ A;  3GG0 A;  4NRT A;  4F4A A;  4RX6 A;  4DSL A;  1YLX A;  3UR3 C;  1FK9 B;  3MPD A;  4RWX A;  3W2V A;  4K4W A;  1HR0 F;  5DLG A;  5C7P A;  1QTM A;  1SL2 A;  1JX4 A;  1KQS R;  1JB0 C;  2OP5 A;  2P9C A;  2APO A;  2LYV A;  1BQN A;  2FJA B;  4LBH A;  1C1C A;  3CJT A;  4AQY F;  1RCX B;  1C1B A;  2D74 B;  2GGP A;  4P10 A;  1TTH B;  1K1Q A;  2DHS A;  1S0O A;  1WDD A;  2ZH3 A;  4TU9 A;  3RAQ A;  2BBE A;  3ZTR A;  3VZI A;  5MAO A;  2V8H A;  3ITH B;  2CDR B;  1S97 A;  2IM3 A;  1OY9 A;  3GSD A;  4A8M P;  1KLN A;  4QWB A;  3G86 A;  4NMX A;  1VHI A;  1YVF A;  2C3P A;  2MSS A;  3DKD A;  3BH6 B;  4KT0 C;  3U27 A;  3QRQ A;  1HWK A;  2M0G B;  2CUY A;  3B54 A;  3H2V E;  3R5B A;  3CCL S;  3BZQ A;  4I64 A;  3FCV A;  4MAK A;  5KG2 A;  1QE1 B;  4R0J A;  3CCV S;  2XZD B;  2P5V A;  5SZT A;  4JI6 F;  2B43 A;  4DX8 H;  3SXL A;  1BQN B;  1GFW B;  2D9P A;  2WRM A;  2FY1 A;  1MSW D;  3ULH A;  3PTW A;  5DZ7 A;  1U1Q A;  2HHX A;  2MYF A;  4KKO B;  4LSN A;  3TX8 A;  1B4S A;  2DJW A;  1GX5 A;  1UFK A;  4OYP A;  2HUR A;  4OYX A;  2CRL A;  5KFT A;  3RTV A;  5ADZ A;  1L3T A;  1NB2 A;  1UL3 A;  1EQM A;  2CPD A;  2F8M A;  3GYX B;  3H90 A;  3LP2 B;  2QMU B;  3PAC A;  5DQI A;  2AYB A;  4C8L A;  3MMA B;  2ROG A;  3I96 A;  2V69 A;  1S9E A;  3HVA A;  3IRW P;  4JB8 B;  2FY8 A;  3PRB A;  2R2S A;  3G82 A;  3NCP A;  4ZN3 A;  2MGZ B;  3FMW A;  1RT2 A;  4GC6 A;  4NLQ A;  4Y65 A;  3C6T A;  5HMX A;  4C8K A;  2VZ9 A;  3BYP A;  4FYW B;  3TAM A;  3EXC X;  2C3M A;  1LWF B;  1X5S A;  2EXU A;  8ATC B;  5F9N A;  2I5J A;  1XWL A;  3HI9 A;  5A6W A;  3UQS A;  4EYH B;  1I94 J;  2ILZ A;  4B9T A;  4AL6 A;  1GMU A;  2BE2 B;  2AJF E;  2AMC B;  2YX7 A;  2QEX S;  4Q5V A;  4ZCL A;  3ZXW A;  1JLF A;  3I56 S;  1FKA F;  1NND A;  1Y5L B;  1U1K A;  4TLQ A;  2DPJ A;  2XGP A;  3Q8U A;  2ZNY A;  4U67 Q;  1HNX J;  1WKK A;  3ZC4 A;  5LM7 E;  3TVK A;  1Y5N B;  4C6A A;  4OX6 A;  1XMQ F;  2IJR A;  5HSP A;  1AT1 B;  2IJN A;  3BS9 A;  2AIR B;  4EUV A;  3GR1 A;  2Z4P A;  3LUY A;  5KFF A;  1YX2 A;  2DEI A;  3ENQ A;  3Q8Y A;  4FDF A;  2R4F A;  5CYJ A;  5KT6 A;  2H48 B;  3CPW R;  1FA0 A;  2VQF J;  1VC6 A;  1S1V A;  2VAS A;  2XMM A;  2UUC F;  1RAJ A;  4PXB A;  4X66 F;  3LOU A;  4J37 A;  2W4P A;  1UJ4 A;  3BKF A;  5DDQ C;  3V6H A;  2KB2 A;  3G8T A;  1JK9 B;  5HQL A;  4W90 B;  3DCA A;  4KV8 B;  1BXN A;  1NH8 A;  1XTZ A;  4N47 A;  2R2T A;  1LQ9 A;  3MD3 A;  1YI2 S;  3BQ0 A;  4L3N A;  2GAH C;  2V2Z A;  4TNO A;  3PXG a;  1HHS A;  4LFA F;  1N6Q A;  1ZA1 B;  2FVC A;  2XGQ A;  3KK1 B;  1N32 F;  4X4V A;  3RYL A;  5HMZ A;  5M2R A;  1E6V A;  1LK7 A;  3N79 A;  1FFG B;  2CJY B;  4P72 A;  1PYS B;  1XIQ A;  3DOL A;  4ZPV R;  5D8H B;  3DRS A;  1DAX A;  1SIZ A;  4LFA J;  4CYU B;  1N32 J;  2X1G A;  3LP1 A;  4ECX A;  4I4B A;  2NRE A;  2F65 A;  3ZNU A;  1J2V A;  2V4Q A;  1EX8 A;  1F3F A;  1Z2Z A;  2WW8 A;  3BM7 A;  3CGI A;  3EZ5 A;  1S0M A;  1D1U A;  4DN9 A;  1V5I B;  3KTQ A;  1M5K C;  2VPW B;  1UWB B;  1UAW A;  5L46 A;  4YDX A;  3CJR A;  4JI3 J;  1UA0 A;  3MR3 A;  2QTW A;  2MQQ A;  2Q1L A;  4IG3 B;  2BJD A;  3TZW A;  1X4F A;  5G0R A;  3ENV A;  3IR7 B;  3IWL A;  3NMA A;  1HBO B;  2MKY A;  2LDY A;  4MIB A;  2BJ7 A;  3Q8S B;  1RTI A;  4WE1 B;  3TJ8 A;  4BWM A;  1VQY A;  1RXO B;  3CCR S;  3TZZ A;  4K4U A;  2OO4 A;  2DCU B;  1R6Y A;  3OFG A;  4HL9 A;  4MFB B;  5CZX A;  2ADB A;  3KNA A;  1DLO A;  2QC3 A;  4X4U A;  4DR7 F;  3BQ2 A;  3SMZ A;  2AGP A;  1Y7P A;  4A8F A;  3BO4 A;  1PC4 A;  3ZO7 A;  1NLK L;  4PQA A;  4IRD A;  4ETZ A;  2E44 A;  3D0H E;  2Z0G A;  2A6M A;  3CME S;  1U7L A;  1CC7 A;  4RBV A;  2MQP A;  3I5C A;  3UD5 A;  4CT9 A;  3MEG A;  4LUB A;  4ED7 A;  3MED A;  4NLV A;  2HMI A;  2HGL A;  4PUO A;  2WZ1 A;  3K0J A;  2L08 A;  3JS9 A;  1U1R A;  3AT1 B;  1UP1 A;  2EFQ A;  4ZVG A;  1XNQ J;  2X1F A;  1SQE A;  3WX4 A;  4ZK7 M;  3PJ9 A;  1V5V A;  2ZZN A;  2QG9 B;  3HO1 A;  2BRL A;  1QUP A;  3K5N A;  1N56 A;  2CWK A;  3OL6 A;  2VQE F;  3BO3 A;  3PJW A;  2QE5 A;  4J9M A;  4ANE A;  1S7H A;  4U7U D;  3MI7 X;  3PM9 A;  3G82 B;  3QQC D;  3SSR A;  1LWX A;  2VG5 B;  2MGZ A;  2XC9 A;  4DS4 A;  3PX0 A;  1VLY A;  1MW7 A;  1NSA A;  3NGU A;  3DI6 A;  4I6W A;  2XYG B;  3AA9 A;  3H5Y A;  1RLD A;  2F8E X;  1WI6 A;  3AD9 C;  3DRS B;  1IKX B;  1VQS A;  4RBT A;  1FI4 A;  5EUH A;  5E3R A;  5T41 A;  1WHW A;  3T6B A;  3EPI A;  1F2G A;  2AU0 A;  2IAJ B;  4UOF A;  1VQP S;  1KFS A;  3UPF A;  3TA0 A;  2RML A;  1VOM A;  1RTJ A;  1UFW A;  2ZHA A;  2XEX A;  3LGH A;  1FRX A;  1VLO A;  4UQG A;  1DFD A;  4ZVT B;  1QE1 A;  4WU2 A;  4DUY F;  2PO4 A;  1MN7 A;  2CQ1 A;  4IDK A;  4NZ7 A;  4NI2 A;  2EEY A;  1SC6 A;  4ZCM A;  4FPR A;  5C24 A;  2QA2 A;  3GP9 A;  1NSP A;  2HNZ B;  2RE1 A;  2V8G A;  3BBC A;  2IVF B;  2CZ4 A;  3VAF A;  1RHU B;  4O3N A;  4DL6 A;  1N4L A;  2XMW A;  5T14 A;  2FGC A;  5DM6 Q;  1VQM S;  5E41 A;  3GB0 A;  4ECQ A;  1DRZ A;  1VQL S;  3CJ5 A;  2DRB A;  1RJJ A;  2DY1 A;  3HHD A;  3CUL A;  3OVS A;  4B3R F;  3P5T L;  2BOA A;  2M9K A;  2OML A;  1HWU A;  5HN0 A;  4O0I A;  1WTB A;  1TK0 A;  2DR9 A;  3LAM A;  3ADA C;  5JUM A;  4HKQ A;  2MHE A;  3N28 A;  3OXG A;  4J9S A;  4O3R A;  4M95 A;  2IBO A;  2R7S A;  5K14 B;  2O5D A;  2XYP B;  1KRP A;  4YB6 A;  3HKW A;  2IYG A;  2JHE A;  1B0T A;  2BQR A;  4DR7 J;  1Q5Y A;  2DT9 A;  4HDG A;  5KFQ A;  4JV1 A;  2XHC A;  1K1S A;  2HW3 A;  4PG4 A;  4R5P B;  4DSE A;  1FD8 A;  4UOG A;  4E2F B;  1X5O A;  4CO3 A;  3I5B A;  2WB1 D;  1LWE A;  2KU7 A;  2Z56 B;  4Q8E A;  4GKJ F;  2AYE A;  1U0S A;  3LGN A;  4B02 A;  4CRJ A;  1EQ0 A;  1T9U A;  5F3T A;  4XPC A;  3AOB A;  4MYT A;  3RB0 A;  2Q79 A;  2AYG A;  2NSC A;  1KHW A;  1URR A;  3HSD A;  2CQI A;  1T11 A;  4I56 A;  3DLJ A;  3SDE B;  5J1E A;  1EET A;  2DTJ A;  5IT4 A;  2ZH8 A;  4KTQ A;  2LLZ A;  1S5Z A;  1VQ7 S;  4LF4 F;  4LFC J;  4LF9 J;  4PQU B;  3M8Q B;  2BQU A;  4NLW A;  4ES2 A;  4KR0 B;  5L1I A;  1JLC B;  1N5S A;  5D78 A;  1ROF A;  2XCP A;  1YJW S;  3MZI A;  1Q82 T;  3KUH A;  3MAQ A;  2OPS A;  2J9D E;  4X64 F;  5LMN J;  3QO9 B;  2R2R A;  2Z8Q A;  3MM7 B;  2RDJ A;  1ZPV A;  2GFF A;  4WK1 A;  4DR3 J;  4DR5 J;  1QSY A;  3PJX A;  2LXI A;  4QIF A;  4B3M J;  1WOO A;  2M4M A;  2YWK A;  4HLB A;  5HK4 A;  3H5X A;  2XO6 A;  1AFI A;  3OW2 R;  3PYF A;  1YJV A;  1IBC B;  2CWX A;  4RO0 A;  3WQP A;  4ZLP A;  1RT4 A;  1FXD A;  1SQF A;  4OIX A;  2FJV A;  5KOX A;  1LW2 B;  1JLG A;  3A8J A;  3MMC B;  2K7K A;  2HHP A;  2QA4 S;  1BY9 A;  1RT6 A;  3W66 A;  2C2O B;  5LSL A;  3GU0 A;  2CQG A;  2Z57 B;  3PDN A;  3W62 A;  2B5J A;  4EZ6 A;  2MKC A;  2A0F B;  1HHQ A;  3VAK A;  3M8W A;  5KFA A;  1DTQ A;  2E1P A;  4LSL B;  4YEA A;  2BAC A;  3PX6 A;  2PMZ D;  1TL7 A;  1QAI A;  3BKU A;  3WIU A;  4LBI A;  4IH6 A;  3X3U A;  4NEZ A;  2I1R A;  4CIO A;  1GQE A;  1VRT A;  2ZOG A;  3BR9 A;  2EPI A;  3FEZ A;  3RJM B;  2ZJP Q;  2M8H A;  3SV3 A;  1UVL A;  2ZC3 A;  1VQK S;  4RUH A;  1VIS A;  1KOO A;  3M8Y A;  1SH0 A;  2C1E B;  3CCS S;  2R9L A;  4B3S F;  3CO0 P;  2FZK B;  1NXI A;  1WEL A;  2J0S D;  2I5J B;  3ZTQ A;  1RIS A;  3LWM A;  1WEZ A;  3N6N A;  1XMO F;  3KNG A;  3PYE A;  1N36 F;  3OVB A;  1WHX A;  4IFY B;  3VZH A;  4I2Q B;  3CIZ A;  1WF0 A;  1NDC A;  3PW2 A;  2YKN A;  3GIR A;  4KY3 A;  5IWA F;  1N36 J;  2RQC A;  3GMG A;  1XMO J;  3C19 A;  2W2P P;  2WB4 A;  3E2E A;  1BWV A;  1S77 D;  1RBL A;  2AP6 A;  3QSY B;  5J2Q A;  4P7T A;  4UQT A;  4P2F A;  4A8O A;  1VK3 A;  3PIO Q;  4RW7 B;  2Q43 A;  3MTJ A;  3OUY B;  1HWJ A;  1MMD A;  2MEW A;  4JV2 A;  3GCW P;  4X4R A;  1HIY A;  3LGM A;  2XZT B;  5IOL A;  3VGU A;  1V9O A;  2P6S A;  2DH9 A;  3UN3 A;  4PG7 A;  4A46 A;  1JLG B;  2KVI A;  1C4C A;  1HAR A;  2HRY A;  2YNI A;  2YWH A;  4J9L A;  4DFM A;  3BO2 A;  3DMJ A;  1BC6 A;  5BYQ A;  5LSR A;  4Q43 A;  3JYT B;  3IR5 B;  4DQS A;  4Y28 C;  1S1U A;  4B3T J;  3TUJ C;  3HHK A;  3VAG A;  4DV3 F;  1FRL A;  4F2S A;  4DQI A;  3H40 A;  2KFN A;  1SUQ B;  2K7J A;  2OUG A;  1H73 A;  3OFF A;  3T5H A;  1YZ7 A;  3C15 B;  3TEH B;  3JSY A;  1LK5 A;  2DNG A;  3QFH A;  4PWW A;  1RQ0 A;  3U1M A;  4A47 A;  5C25 B;  5KFW A;  1N33 J;  3HFK A;  4USH A;  1DBD A;  3RUB L;  1P8G A;  2RT3 A;  3HVT A;  4ICL B;  5AXL A;  1CUL A;  2AV5 A;  1VQO S;  2FJW A;  2E66 A;  5GAH I;  3O2I A;  2PC6 A;  4B3O B;  4AQY J;  1F9E B;  1VGY A;  4E98 A;  5J2M B;  2ZBC A;  3M8Q A;  2I8E A;  1RKJ A;  3I32 A;  3CJ8 A;  3S01 A;  2MQO A;  4X4S A;  4DBQ A;  4C8N A;  2JLG A;  4DF4 A;  1JXL A;  3O3L A;  1SH2 A;  2PFD A;  2UUW A;  4MKB A;  1S1T B;  1RE1 B;  2BX6 A;  4KGZ B;  1ZM2 A;  4K59 A;  1Q8I A;  2J0W A;  5A0Y A;  1YJT A;  2GVD A;  2VBZ A;  1JLA A;  3OTE A;  1KD1 T;  2NXJ A;  4J9V A;  3T9N A;  2R8H A;  2JC0 A;  2J9C A;  4DV0 F;  2MDA A;  1L3V A;  2UXC F;  5H9F K;  3PY8 A;  3BYR A;  1RP5 A;  3JQM A;  4NYO A;  5FII A;  2P9E A;  1NSQ A;  1FKO A;  2KI2 A;  3NS7 B;  5EWF A;  2F9J A;  3DM2 A;  4GVL A;  2B4V A;  2HFZ A;  4PEO A;  5IQQ A;  2A10 A;  5KFE A;  2AJ0 A;  3V6J A;  3DRP A;  3UDE A;  3W65 A;  3VQS A;  4URQ U;  1D09 B;  1U6F A;  4NLD A;  2H5E A;  2POK A;  2W4D A;  3IM9 A;  3VV2 B;  3JSM B;  5ETK A;  4LF5 J;  1GH8 A;  1REV B;  4UZC A;  5GVQ A;  1U1P A;  3IBC B;  2QA4 G;  1X9S A;  2HGM A;  1UTA A;  1FDA A;  2H54 B;  3SV4 A;  2HLT A;  1NK7 A;  1N52 B;  1G2E A;  3K5L A;  2ZWP A;  3AY0 A;  4RPF A;  5JXS A;  1N0U A;  4WXO A;  3QJL A;  1YRX A;  3A3N B;  4QCL A;  2N7Y A;  3KWM A;  2UV8 G;  4HHU A;  4ZLJ A;  4O4G B;  3ZZP A;  2L3M A;  3FBC A;  2D3Z A;  3HMJ G;  4JI5 J;  2QJ3 A;  5KT2 A;  4NI2 B;  1AFJ A;  2AHO B;  1X4E A;  4TY9 A;  1T02 A;  2C2M B;  4DQR A;  5MLC V;  4J91 A;  1S1U B;  1ZAX A;  1SJ4 P;  1REG X;  3C8Y A;  1WTF A;  4O44 B;  2M3D A;  5H9E J;  3T1H J;  5ETV A;  3PYD A;  4NXN J;  4CO0 A;  3POT B;  4DI6 A;  1NB7 A;  3OL7 A;  3DI6 B;  1H2U X;  3DLE B;  5D4O A;  2RDD A;  3T1Y J;  3CSK A;  5KFR A;  3HHN B;  2BKP A;  2F4F A;  4C98 A;  3D1Q A;  1RAD B;  2B9Y A;  4IRK A;  4C9D A;  4NLR A;  3D0G E;  3CC4 S;  2KRB A;  2NLW A;  3SQG A;  1X4D A;  1SJR A;  4K2J A;  1FWK A;  2OKQ A;  3GQC A;  2JZ5 A;  4M5L A;  1EZZ B;  4IRC A;  3M6W A;  3LF0 A;  2L9D A;  5LOQ A;  4JI0 J;  1BQM A;  4O0N A;  3AB4 B;  3BSA A;  3W60 A;  1UVJ A;  3GG1 A;  1U0H B;  2YQ1 A;  1IR1 A;  2CQ3 A;  3QYY A;  4EFA C;  1FRJ A;  1TKZ B;  2NUH A;  1U09 A;  2OSR A;  3CJ2 A;  3MED B;  4DS5 A;  4KFB A;  3DC2 A;  1DUR A;  1M90 T;  3CJS A;  1PAU B;  2LMI A;  1XMQ J;  3QGG A;  4U7C A;  2XNR A;  1AB8 A;  4Y2A A;  4DV5 J;  1D8Z A;  3OT9 A;  2HVH A;  1TZ0 A;  1WAC A;  3MTK A;  3W9H A;  1MU2 B;  1V6H A;  1R0B G;  3A8K A;  3MPV A;  3EDR B;  1JLB B;  1WC6 A;  9ATC B;  4DV5 F;  1D3W A;  4EWT A;  1T3O A;  4HH1 A;  3R7S B;  1WEX A;  5L1J A;  1UPM B;  4NA2 A;  4BLG A;  1CG2 A;  4LVN P;  3TX0 A;  2Y3Y A;  3MM8 B;  2E29 A;  3LAN A;  2LFV A;  1VR6 A;  2R7O A;  3IGV A;  2IMW P;  3QRR A;  3THP A;  3SZ2 A;  1IBL F;  1NDK A;  2JDJ A;  4NXN F;  3DOK A;  5KFG A;  1YKW A;  2FHJ A;  4K4S A;  3CWJ A;  2ZBP A;  1X8D A;  2DEJ A;  3QMQ A;  4W4M A;  4F67 A;  1S9F A;  4KFB B;  5U47 A;  4KO0 B;  4M5H A;  2OD4 A;  3UVJ B;  1VBY A;  4C8O A;  5ETP A;  1RT4 B;  5KFM A;  2HND B;  4QWA A;  2O66 A;  3US5 A;  5DG9 A;  1BQM B;  3KK3 B;  1U2F A;  3ICL A;  1LW0 B;  3VAM A;  4CZC A;  3EWG A;  4GO7 X;  3IGN A;  3B6B A;  3AFG A;  3EXY A;  2K3I A;  3M8P A;  4C0B A;  4DPU A;  2V9W A;  1GMW D;  2VBW A;  3CDA A;  7FD1 A;  3KHL A;  4MKY A;  2VKZ G;  3TAN A;  2RKI B;  2A2D A;  4PYA A;  5K8P A;  3M05 A;  1DQ9 A;  4NLY A;  4WWS A;  1Q8K A;  3V2U C;  2KM8 B;  3C16 A;  4H4K A;  4AL7 A;  1GMV A;  1APS A;  1FEH A;  3T6J A;  4LF8 F;  1RLC L;  1PO6 A;  1T0T V;  5ETT A;  4DV4 J;  1P9Q C;  2YNH A;  4RW4 A;  3AD8 C;  3K8V A;  4OJ1 A;  4UZB A;  1BQX A;  3EX7 B;  4DLG A;  1QSL A;  3AOD A;  4N41 A;  3P49 B;  1WF1 A;  1WSV A;  1EP4 A;  1XR6 A;  2GV1 A;  2JEI A;  1LWC B;  4X66 J;  4UT4 A;  2FJX A;  2GQC A;  3BB5 A;  4LFC F;  3CW2 C;  1X4G A;  1H98 A;  3GIJ A;  4AE5 A;  1FCA A;  1H3D A;  3QGP A;  3IBW A;  3QWU A;  5HLF A;  1U1N A;  1HQU A;  2J6T A;  1M5H A;  5KG1 A;  4O4G A;  1OYE A;  1Y9O A;  2QZ8 A;  5J2N A;  5D3G B;  1N48 A;  3J7A N;  1Y00 A;  4MJK A;  1RUS A;  2VC0 A;  1HNX F;  3VF0 B;  4P2S A;  1Q1K A;  1GT8 A;  5ETQ A;  3OLB A;  4O4R A;  1SV5 B;  2F4V J;  4R5P A;  3KOA A;  2OFH X;  1RI7 A;  2Q66 A;  4J9U E;  4B9V A;  3K5O A;  4RW6 B;  4UUW A;  2VPZ B;  1IN0 A;  4PRF A;  1SIW B;  4JI7 F;  1VBZ A;  1M5V C;  1H2T Z;  4QZV B;  3VAI A;  1S6O A;  4RUA A;  1T8E A;  4JI7 J;  2HHV A;  3AJD A;  3H2L A;  2Y1L B;  3OR1 A;  4NZ6 A;  4P52 A;  5J2N B;  5KFN A;  2ZH1 A;  2JLE A;  5D3G A;  2HIQ A;  1QY7 A;  1AW0 A;  4AD6 A;  1X0P A;  1RTI B;  3GYN A;  4LF7 F;  2F4V F;  3ZZT A;  1D0E A;  2CNL B;  2ZH2 A;  3PX4 A;  1T95 A;  1K44 A;  4ECU A;  1RCO B;  5J1N A;  4QYZ J;  1KLM B;  1XN9 A;  5C42 A;  4DV0 J;  4IQM A;  5HI7 A;  3LP2 A;  3DDN A;  1AA1 B;  2XCA A;  2K8G A;  5E3C A;  4JV0 A;  4ZN1 A;  4OZ2 A;  4B08 A;  2XM3 A;  1KON A;  3UD3 P;  4DV4 F;  4IDK B;  5IT9 U;  1UZH A;  4ZP6 A;  1PKU A;  3TUP A;  2HEK A;  3HLU A;  3NAI A;  2I2Y A;  2GMJ A;  3OD2 A;  4OX9 J;  2KFZ A;  2DGW A;  3PV8 A;  1S7I A;  2OGU A;  5B09 A;  2HVI A;  4K5S A;  3MR2 A;  5HVH A;  2YWE A;  2HG4 A;  2DGV A;  2OLW A;  4F25 A;  2MTL A;  4ZVO B;  5T7L B;  5B0E A;  4JOU A;  5KG7 A;  3VWS A;  4R0E A;  1HWL A;  1KS2 A;  5EX3 A;  3UCG A;  1MWY A;  5C25 A;  4FZV A;  3V81 B;  5THW A;  3AAW B;  4MIA A;  4NYP A;  5CYQ A;  4Y6I A;  3GTY X;  4PR6 A;  3DRY A;  3LP0 A;  4ILR A;  4KO0 A;  5CAA A;  1J5O A;  2R8J A;  2R8G A;  3KLE A;  2FYX A;  5IV4 A;  5B0B A;  2DD8 S;  3MUT P;  2CQ2 A;  3NCR A;  1AZS A;  2J7K A;  4NLU A;  4RKU C;  5E33 A;  2QLF B;  5CXT A;  1RWV B;  2ZH7 A;  3NS6 A;  5L1K A;  2GS8 A;  4B9S A;  3G87 A;  1FE4 A;  4Q7A A;  3TJ9 A;  4ZLL A;  2DIU A;  4YOE A;  4Q8F A;  4LRC A;  5EGY A;  3DYA B;  1LOU A;  2CXE A;  4F7V A;  4WYL A;  4DZD A;  3CJQ A;  1J27 A;  2C28 A;  4Y2I A;  4OHW A;  3PW7 A;  4X2B A;  4C8M A;  3SCL E;  3E3X A;  1SC4 B;  4DHV A;  1N54 B;  4RW8 A;  5HVG A;  4V19 J;  1Q8L A;  1HR0 J;  3O44 A;  4QR2 A;  1V3R A;  5BYR A;  2UVV A;  3M2R A;  2QL9 B;  5KT7 A;  3C6U A;  3RR8 A;  4K0K F;  4WE1 A;  4ZMM A;  4RNF A;  2A18 A;  1S6P B;  4HTJ A;  3ZTS A;  4ZKA A;  1WD6 A;  4JI0 F;  1NDL A;  1B70 B;  4FF2 A;  4CLW A;  1R0A A;  2IJF A;  3KLF B;  5KFI A;  3G6V A;  3P5B P;  3TUZ C;  1O8B A;  4B9U A;  3SQG B;  4DR6 F;  2CZ9 A;  3HDS A;  4JI4 J;  2ZBQ A;  2ZHB A;  3QZ8 A;  3IS9 A;  2U1A A;  4CH0 S;  1P1T A;  3KLI A;  4KGV B;  1U4B A;  1U25 A;  2IA6 A;  5ETO A;  3QRP A;  3PRD A;  1UJ5 A;  4OI3 A;  4DFJ A;  1CJT B;  2ZBR A;  3POT A;  1K0V A;  2HBY B;  2J76 E;  2DGU A;  2GMH A;  1YRT A;  1D9D A;  2B3T B;  4ZLN A;  2KHC A;  1TV6 A;  2H4W B;  2FC8 A;  3Q24 A;  1OYD A;  3EUN A;  5AXM A;  3Q83 A;  4RJV A;  5IT0 A;  3ISN C;  5DDO C;  2B7C B;  4NA3 A;  1U6Z A;  4E8U A;  1B99 A;  2IRU A;  3S8S A;  1S59 A;  1CQM A;  1UVK A;  2GIR A;  2J9D A;  3L9Z A;  3LP0 B;  3SCI E;  3Q86 A;  4C2M A;  2FZG B;  5BJR A;  2DNK A;  4USV A;  1F5C A;  1G3O A;  1HNI B;  1R7I A;  2VA2 A;  2CDQ A;  1TKT A;  2K2P A;  4CO5 A;  3CED A;  3UCU P;  2MY8 A;  4C11 A;  5D0R A;  3CC2 S;  3AQP A;  4P74 A;  5CD4 H;  2RRN A;  2XS2 A;  5D15 A;  3EVO A;  2WOM A;  5CYM A;  4WCE Q;  2RIL A;  4ENO A;  1RBO B;  1RWW B;  4LF9 F;  2HQD A;  3HSG A;  4M94 A;  3UCZ P;  3VGS A;  5H1S V;  2W9C A;  3OR2 A;  3PW4 A;  4NCA A;  2XY5 A;  3AH6 A;  4ZVR B;  1LKZ A;  1S9G B;  1SJ1 A;  4HH0 A;  1H0H B;  2BZ2 A;  2C2D A;  1Q78 A;  2WVB A;  3QID A;  4HHJ A;  1OY8 A;  1ITP A;  1JLQ A;  4M5D B;  2BJE A;  3CDU A;  3QNW B;  2J6U A;  1LWF A;  2W1B A;  3ILL A;  4ECV A;  3FEY B;  4PXC A;  2MQM A;  3MEK A;  1KOH A;  4OYO A;  2Y1J A;  2D3O 1;  1K8A T;  3W2W A;  4DV7 J;  1D9F A;  1NZA A;  1D9A A;  1HKA A;  3I6P A;  3UI3 A;  3W61 A;  5LJ5 Y;  3G6E S;  3OR1 B;  3KUG A;  2CIM A;  1Q16 B;  3M32 A;  3NNC A;  2DCL A;  1K0T A;  2MQ8 A;  2HQ3 A;  2EI5 A;  4PPD A;  5A8W A;  3H25 A;  1Q53 A;  4OI4 A;  4QYZ K;  4EBE A;  4ID5 A;  2DNO A;  4M5D A;  2VOO A;  1RWP B;  4WZQ A;  1OWX A;  2XBP A;  4PQU A;  3H2U B;  4U8Y A;  4FPI A;  4A8X A;  1S72 S;  1WJ9 A;  3A13 A;  3GLJ A;  4ZVF A;  4WKY A;  1GEH A;  4N5S A;  3MAA A;  5F8H A;  4C0H A;  4PWD A;  3TZY A;  2YH1 A;  4TYB A;  4JI6 J;  4ZJL A;  4EEY A;  3M2V B;  3D1O A;  3O6Q A;  3FSY A;  3K57 A;  4FF1 A;  4B3R J;  3HFV A;  1HMV A;  1N5Q A;  2HSE B;  1HQE B;  5I42 A;  3I87 A;  2Z30 B;  1U24 A;  2B6A A;  4WII A;  4B3T F;  2AEM A;  3OHA A;  2UP1 A;  5AE1 A;  4FXW A;  1HNI A;  2AZ1 A;  4KJI A;  5K8O A;  4XAK A;  2QSF A;  1HI0 P;  2RIJ A;  1U6B A;  1VCT A;  3OFE A;  2Y8W A;  5EWG A;  3S7R A;  4B9L A;  4FBU A;  3TJA A;  2XS7 A;  3HHL C;  3JSB A;  5DS7 A;  4I2P A;  2C22 A;  1R27 B;  4RNN A;  2CNN B;  2HS4 A;  2B56 A;  2KHD A;  2ZKU A;  1SBR A;  3FSX A;  5LMN F;  3T5J A;  2DB1 A;  2E5G A;  3CB4 A;  4PAB A;  2VBY A;  5HAN A;  4WF9 Q;  2VFS A;  3S6E A;  3M2U B;  2HK2 A;  1A6L A;  3A1Y G;  2LEP A;  3I82 A;  1RHQ B;  3CCW A;  3MM6 A;  3TUI C;  1NAQ A;  5HMY A;  2GC8 A;  4JI1 F;  1QVG R;  3KLI B;  2LA4 A;  2AEF A;  3MCO A;  3W1Y C;  4EO6 A;  1QUV A;  1KLM A;  1JLE A;  1ZM3 A;  2DYA A;  3BBF A;  3IC1 A;  5C42 B;  2IM0 A;  3OTD A;  4MK8 A;  3UVJ A;  3MUM P;  2CPX A;  4GC7 A;  4RBU A;  2OHD A;  2BA9 A;  3KLH B;  2MLX A;  4DUZ F;  3NGD A;  1IKV A;  1Q7Y T;  1HD1 A;  3DRR A;  2BJ1 A;  4FYY B;  2PN6 A;  1AXQ A;  2HQI A;  3KG4 A;  4ZDN A;  2PII A;  1HHT P;  1H2V Z;  2KT5 A;  1IQZ A;  3C6U B;  3D6H B;  3ETO A;  2Y1R I;  1VRT B;  3I4P A;  2X1A A;  4DL0 C;  3FGV A;  4PUO B;  4I7F B;  4DOZ A;  1TL1 B;  3IR6 B;  1YJN S;  2RQM A;  1X0F A;  2HVE A;  4Q0B B;  4CH1 A;  3C46 A;  2AGO A;  2F8H A;  1VI7 A;  3CDB A;  3R5C A;  3TWZ A;  3V6K A;  1UVM A;  1WG5 A;  4YR3 A;  4ED6 A;  2I0X A;  3TP2 A;  1RDR A;  1YJR A;  2DHA A;  5GAD U;  4QWE A;  2WW4 A;  3LTO A;  3B78 A;  2GVZ A;  3D9B A;  3HJV A;  3B8H A;  1NJY A;  4U6P A;  2UVW A;  1S1W A;  2Q6B A;  2XSJ A;  2V68 A;  2YWF A;  2B9W A;  2QMW A;  3M8Z A;  3Q89 A;  4NZ0 A;  4QR0 A;  2HGN A;  2CG8 A;  4FYV B;  1HBU B;  3NY0 A;  5IXU A;  3NEK A;  4C4W A;  2IHR 1;  1SVD A;  3R5G A;  1HNV A;  3ISN D;  4AND A;  2QN6 B;  5L1L A;  3ETM A;  1UCN A;  2BAN A;  4DV2 F;  4EYI B;  4JUZ A;  4ZVP B;  2AJ2 A;  3DXS X;  4QIE A;  3I4H X;  3Q2T C;  3CD7 A;  4DR5 F;  2JOQ A;  1YK9 A;  2Z2Z A;  4O23 A;  2CNK B;  2W7O A;  4IR9 A;  2WCX A;  3CMA S;  2H65 B;  4WP9 A;  4R8U A;  1KKH A;  4BWJ A;  1V3S A;  4Q2L A;  1X4H A;  2B4U A;  2CVE A;  3CNQ P;  3TA1 A;  3DFE A;  2UVR A;  1IKY B;  1YQH A;  4EK2 A;  5M2U A;  2XO7 A;  4J9P A;  3T1H F;  1N34 F;  1RT3 A;  4KIA A;  1U1M A;  4Y34 A;  3ILJ A;  2DO0 A;  1G1X A;  4USI A;  3DDK A;  1HNV B;  3KHH A;  4QU6 A;  3H5S A;  2MZ1 A;  3A8E A;  4P75 A;  1QDU B;  2KYZ A;  3OSP A;  2EC2 A;  4JI4 F;  2CPE A;  3W5X A;  4Y2K A;  4F3Q A;  3V4I A;  2E7V A;  3KG0 A;  5H9E K;  1QAX A;  4QR1 A;  4WU3 A;  1C0U A;  1VHF A;  3CT9 A;  2ZC4 A;  4LF4 J;  3PKM A;  4DL2 A;  4FYD A;  4JI8 F; 
#chains in the Genus database with same CATH homology
 5CAA A;  1WKJ A;  3Q8U A;  1WKK A;  3FBF A;  1NHK L;  4C6A A;  1F6T A;  1ZS6 A;  3R9L A;  3VGV A;  3Q8Y A;  1NDK A;  3WX8 A;  1BUX A;  1BHN A;  3NGS A;  4KPC A;  2AZ1 A;  3L7U A;  3ELH A;  3VGT A;  4UOG A;  1XQI A;  3Q8V A;  1KDN A;  3ENA A;  3FC9 A;  1NCL A;  1NSK L;  5CAB A;  4CP5 A;  3EMT A;  3B6B A;  1NDP A;  2ZUA A;  2B8P A;  3FBE A;  3ZTS A;  3BH7 B;  3EVM A;  1XIQ A;  3EM1 A;  3FKB A;  2BX6 A;  3NGR A;  1S5Z A;  1NDL A;  1LEO A;  1F3F A;  1MN9 A;  4W98 A;  3BBB A;  2DYA A;  3BBF A;  1WKL A;  1NSQ A;  3EIC A;  2DXE A;  4F4A A;  4ANC A;  3MPD A;  3PRV A;  5C7P A;  2DXD A;  1JXV A;  3Q83 A;  2VU5 A;  4FKY A;  1HLW A;  2NCK L;  2HVE A;  3EVW A;  1B99 A;  4HR2 A;  2DY9 A;  1S59 A;  1NLK L;  4UOH A;  4WBF A;  3Q86 A;  3ZTR A;  2B8Q A;  1NPK A;  3FBC A;  3DDI A;  4F36 A;  3DKD A;  3FCW A;  3BH6 B;  3Q89 A;  5BXI A;  3JS9 A;  1HHQ A;  3ZTP A;  3B54 A;  3FCV A;  3EVO A;  3NGT A;  3PJ9 A;  4AND A;  4ENO A;  4DUT A;  2CWK A;  3ETM A;  1NUE A;  1UCN A;  3VVT A;  1W7W A;  4ANE A;  3VGS A;  3EJM A;  1LWX A;  4FKX A;  1B4S A;  3VVU A;  1K44 A;  3EE3 A;  2HUR A;  2BEF A;  2AZ3 A;  1NB2 A;  4DI6 A;  3NGU A;  3ZTQ A;  2DXF A;  4EK2 A;  1NDC A;  3GPA A;  4UOF A;  1PKU A;  1VYA A;  4O0N A;  3FBB A;  4S0M A;  1MN7 A;  2HVD A;  1U8W A;  3ZTO A;  3GP9 A;  3G2X A;  1NSP A;  1HIY A;  3BBC A;  5IOL A;  4DZ6 A;  3VGU A;  1EHW A;  1S57 A;  1PAE X;  1BE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...