2BF0X

Crystal structure of the rpr of pcf11
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
IVKDFNSILEELTFNSRPIITTLTKLAEENISCAQYFVDAIESRIEKCMPKQKLYAFYALDSICKNVGSPYTIYFSRNLFNLYKRTYLLVDNTTRTKLINMFKLWLNPNDTGLPLFEGSALEKIEQFLIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PCF11
publication title Key Features of the Interaction between Pcf11 Cid and RNA Polymerase II Ctd.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 42
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2004-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2bf0X00
3LDZA 3CLJA 1EDUA 1HG2A 4HFGA 3G2SA 3ONKA 3D9NA 3ZYLA 1EYHA 3D9LA 2L0TB 4FLBA 5J08A 1HFAA 4Q94A 3D9OA 1DVPA 4JXTA 1UJJA 2BF0X 3G2WA 4GZCA 3ZYKA 1JUQA 1ELKA 3D9KA 1HF8A 2DIWA 4FU3A 5CMWA 2DCPA 2KM4A 3D9MA 1LF8A 1H0AA 3G2UA 1MHQA 3ONLA 1XGWA 2QY7A 3D9JA 3D9PA 1UJKA 3G2VA 3D9IA 4AVXA 1JPLA 4NACA 1X5BA 1SZ9A 1PY1A 2L0IA 2MOWA 5LOZA 3G2TA 3ZYQA 4Q96A 1VDYA 1INZA 2LO6A 1SZAA 1HG5A 4GZDA 3ZYMA 3RRUA 5CMYA 1JWFA 5LP0A 1JWGA 1HX8A 2V8SE
chains in the Genus database with same CATH superfamily
2JABA 1K8KG 3UX4A 1TYQG 2DZOA 2F0YA 1N4RA 2VGXA 3DRAA 2AVPA 1RW2A 3DEPA 3I5PA 4DX5D 3C72A 2Y4UA 4YNDA 2KATA 4FLHA 1D8DA 2PQNA 4G8KA 1NFIE 4GU5A 2V4LA 4GYWA 1N11A 2HE0A 2I6HA 4LEUA 4FA6A 2J49A 3MKRA 3GZ2A 4ME2A 4J8FA 3B7TA 4KZ0A 5AQ9A 3ABME 2H6FA 2UY1B 1H19A 3E33A 4P29A 3TWUA 4A3VA 2WXRA 3ASNE 2C0LA 2GW1A 4GPMA 3JYSA 1BI7B 1TNYA 4JHRA 2QC9A 3CLJA 3L08A 2GRNB 4WNDA 4G1TA 5CMWA 2WQ6A 3S7JA 2A4ZA 1G3NB 3TWVA 1TR4A 2P9UG 3SNXA 1JCQA 5T8IA 3L54A 3FUMA 1D8EA 4F3VA 5KNGA 3CK8A 5ENOD 2RD0A 5FZQA 2VJ8A 4OVVA 4AJWA 3BUAA 3ML9A 3FTUA 1Q2ZA 2DWZA 1FVHA 4DX7D 2RG8A 4TXRA 3DWLG 5FQ7A 3B7SA 2GRQB 4MLPA 4WWNA 1DCQA 3ASGA 2AJAA 1O1RA 3B7UX 3KSLA 4KXKB 4LERA 4JHJA 3T8MA 3Q15A 1X5BA 3FUEA 4JHKA 4AV7A 5ARFA 2FBNA 1EDUA 2R5SA 2M63A 3ZU7B 5EYLA 4G11A 4F7AA 3TG5A 2XPYA 2P9KG 2FULA 1WM5A 1IQUA 1MQSA 3LPZA 4U07A 4FHKA 4B8AA 5CCMA 3MX3A 2CHWA 1QYMA 4RG9A 1OWMA 3L9TA 4AP2A 3HVEA 3ZEFA 4MBGA 3D9IA 2L9BA 1JPLA 1IXVA 3ZYQA 4WAFA 3IEGA 3MZLB 5G05J 1HH8A 3SO8A 4RLYA 3T5XA 3BQOA 4TXPA 2P9SG 3ENEA 3R7RA 5BV1A 3ZKJA 1YA0A 3PNTB 3E34A 5HRYA 3Q9NC 1OCCE 4ILGA 2WQ7A 4O1PA 3ZYKA 3D9KA 5BNWA 3MA5A 4RSYA 3I4GA 1FT1A 3ULQA 3NQPA 4N2QA 2J08A 3L6AA 4UQYA 2HO1A 5LP0A 1Z5SC 4BERA 4ANUA 4LCTA 1OUVA 4CGVA 1MX6A 1KPSB 2X6FA 3T8KA 2KCLA 3CEQA 3MKQB 2E2EA 4HBDA 4J8SA 5E75A 4UQXA 1YCSB 1JWGA 2EIME 1O5MA 2VSXE 2PZIA 4JL0A 3FTYA 1S64A 5HS0A 2VTBB 1N54A 1LF8A 1EF1C 4BT8A 3FTZA 4N5QA 3UMVA 3CVNA 3E30A 4AOFA 3EHQA 4U0ZA 5AQ7A 3Q73A 3APCA 3DSXA 4BX9A 2Y1LE 3HYMB 1PAQA 5ENPD 2DCPA 4G23A 1NZNA 2XHEA 2WXGA 4B93B 4YDWA 4I1AA 3EHMA 4N39A 4O1OA 2LAIA 3Q75A 3ZW3A 3C3QA 2P9NG 4JXTA 2NYJA 2AXUA 1IHBA 3PZDA 2KM4A 1P5QA 3GZ1A 4TUUA 3TXNA 5B1BE 2ILRA 2R03A 4PDXA 3QARA 2GGFA 3UXGA 4FULA 5BUZA 4G26A 1ELRA 4XZ4A 2ETAA 3B7RL 3ESKA 4B0ZA 4FLBA 5BV0A 4HLEA 4EPZA 3UT7A 4JA9A 2KCVA 1IHGA 2P58C 4CEMA 5EYPF 1OWLA 3FP3A 4UWKA 4HLLA 4KVOA 5BXUA 4LUNU 1BPOA 3ZHEA 4XKBA 4URKA 3FUFA 2Y69E 2DVWA 3FH5A 2X38A 1JCRA 3PE3A 3U4TA 2VYIA 1TJFA 2WMOA 2PM6A 3FEXA 5DIZA 1DNPA 4QQIA 3GW4A 4FJYA 3BG1B 1UW4B 4TXQA 4ATGA 2CHXA 4E6HA 3OAWA 3ASDA 3GZSA 1TEZA 3SFYA 4J0UA 4GPKA 3DSSA 3TWTA 3BEEA 2QY7A 3UUXA 4L2LA 2BUGA 4BEPA 2X3MA 1PY1A 2MOWA 4A63B 4XE0A 1N52A 4WNFA 1E8YA 4HOQA 3MJWA 1H2VC 2XZTG 3JUEA 5H7PA 3OXGA 2OCCE 1HS6A 2ETCA 4O60A 2XPZA 4CZ2D 2AWIA 5B1AE 2WXPA 3AS5A 3QWWA 3RRUA 2YQ8A 4NURA 3SD5A 2QFCA 2FI7A 2F37A 4U04A 3SI5A 3B95A 4PS3A 4OYSA 4MS6A 3HVEB 4AVXA 1B89A 2GROB 1E8ZA 1N4SA 3RK6A 4LNUD 3FDHA 4V3IA 3HHMA 4GTRA 1O1TA 1DC2A 3UIPC 2V4HC 1MX2A 5DBKA 2PQRA 5T4YA 1X81A 3U64A 3NF1A 4I1OB 3CHSA 4BX8A 3T9KA 5BPPA 3U66A 3TWXA 3DPYA 4NIKA 3CSTA 4YDYA 3LKUA 4CYMD 2XENA 1QZ2A 3Q9UC 3CR3A 2R05A 2LSUA 2LNIA 3NOGD 4K03A 1JUQA 4J8YA 4FADA 1BU9A 4Q96A 4UI9C 4DLOA 4HI8A 4BFRA 4YVQC 1JWFA 5KJMA 4ACKA 3SFXA 5EILA 5LCWC 3R9MA 3SHFA 1HF8A 4ILHB 3FY4A 4WNGA 4J6IA 4EQFA 2XS1A 2L0IA 3PEVB 5FZRA 1NA3A 3QKYA 4GTOA 1U3CA 3VTXA 4LG6A 2MRIA 4F1PA 4U8HA 3Q79A 3QWPA 4GA2A 4EHMA 3E37A 3ZUVB 2WB2A 3HDXA 3PZ3A 4GYYA 5BXOA 3TAXA 4AEZC 3V2OA 4RQIA 2L6JA 4Y6WA 5FZSA 4EZKA 3CHRA 4BTAA 3VLFA 2R17C 2IY0C 1K1AA 1N0QA 2AW6A 5EIDA 4LRZA 4OAUC 1UOHA 4C0EA 2IO2C 2LSVA 3EJNA 3CKCA 5C2YA 3S7BA 3ZXPA 2Q7FA 2KZTA 2OVBA 2Y3AA 5KCMA 3CV0A 3DSTA 3URZA 2PL2A 3CQGB 4WUYA 3UQ3A 5G04J 2FEZA 3D9HA 3LJ3A 3SQVA 3E32A 3HXDA 2KCKA 1HE8A 1MYOA 3AS8A 2L6BA 3JQ1A 2WXQA 5ANLA 5ENNA 3S2AA 3ONLA 3UM1A 2BEDA 4L9PA 3FH7A 3ABKE 3LCAA 4YDEA 5AARA 3J5PA 3Q7FA 1TN6A 3I4RB 2ZXWE 3ZHEB 3RO2A 4L2YA 1AWCB 2BKGA 3RU0A 2J07A 3WXXA 2FO1E 3PNLB 4HVBA 5KJNA 4XX5A 4GZ3A 3PUJA 4BWRA 2R2LA 3D3MA 4GB9A 3PEUB 4I2WA 1HZ4A 3CIAA 1N4QA 2J8SD 1NA0A 3CVQA 1L5JA 2EIKE 3ZRHA 3V79K 4BTBA 3FUKA 3SF4A 3NB2A 4JEHA 1YMPA 4BESA 2V5QC 4R7LA 2FF4A 5CEDB 4ANVA 3LJNA 3ASFA 3DPDA 4W9RA 4HFGA 4F1SA 5KBAA 3G2SA 2L0TB 2RFMA 3CKBA 1U2VG 3AU4A 2I1KA 1BD8A 1GW6A 1N95A 2BTDA 2MYOA 5ENQD 1KLXA 4U0SA 5AIJA 2R59A 1E96B 3PZ1A 3APFA 4AIFA 3QDNA 4DX6D 2VSOE 3AG4E 4GAAA 2V8SE 4CDMA 1FPPA 4JA7A 2CFUA 4XEIG 2LXMA 4EBAA 3DSVA 2IOSA 2WXNA 2KXPC 3KD7A 2P9PG 3SBSA 3FUIA 3I3NA 2WXOA 3BG0B 4WWOA 3UM0A 3QK0A 1E7UA 2IF4A 3CVWA 4JPSA 3QJZA 3PE4A 3FHEA 3F6QA 3DEOA 4C0MA 4MKTA 3O4ZA 4EZJA 3EU9A 3FUDA 1LD8A 3FTWA 4FU3A 4HS2A 2VGXB 4CT4A 1KZOA 2WXFA 1UG3A 4K0RA 4B8CB 5EIBE 1UN9A 4KZCA 4EBAG 5AQAA 4GMJA 3R7QA 4Z68A 1KT1A 4DK5A 5KJKA 2QYJA 4CDRA 2AXVA 3FU0A 5FQ6A 2HYZA 3D9LA 4UWHA 1SQMA 1H6PA 3FUNA 2J4DA 3HXCA 1K1BA 4HRMB 4OVUA 3LY7A 5LOZA 5JMND 3MV2B 2DYRE 4JVSA 3TWQA 3KSQA 4IRUA 2DYSE 3J5QB 3O48A 3EDTB 1FT2A 4KMOA 1Z3YA 4B89A 3EIQC 5D66A 4APOA 2WXKA 2VGYA 5FIOA 2OEVA 2LUHA 3VLDA 3PVLA 3CVPA 2JLBA 3NZSA 4XI0A 3NBNB 5LCWJ 3UPVA 3ULYA 3AU5A 2VQ2A 4PS7A 5EKQD 3NZUA 3FU3A 3JCKC 2Y4TA 2P9IG 1HU3A 3P2BA 4HNAD 5CECB 1ZB1A 4HORA 2YNQA 2J9QA 4AY6A 4BETA 4L23A 3ZYMA 3L22A 5FJYA 3CVVA 2XEHA 3KS2A 2YHCA 3ZFWA 2F8YA 5B3SE 4ANXA 3RIBA 2C0MA 4I6JA 1ZBPA 1SW6A 2PNNA 3T5VA 3SGHA 2V0PA 4DJAA 3EIJA 2OVFA 3UIOC 2XZDG 1OCZE 3UM2A 2BKKB 4O6FA 3JUIA 2IONA 1LD7A 5KNHD 2IFUA 3TL5A 3TGOA 4JB8P 4KYOB 1TNZA 3ZIMA 2I9CA 3CVLA 4XIFA 5FQ4A 2HM8A 4Q69A 4XI9A 5ARGA 3HIZA 3LY8A 3RAUA 3UT8A 3IHVA 3LVRE 3RKVA 1OWPA 3JQ0A 5J08A 4WNEA 5AJDA 3LY9A 5EX0A 3CVYA 2CG2A 5BT1A 1V55E 2EQXA 3PREA 4M3OA 4FP7A 2GRRB 1PC2A 5LX8A 2FO7A 4H7XA 3UM3A 1IKND 4MRUA 5HKPA 5CBNA 1DVPA 1S70B 1UJKA 4AY5A 3U9WA 4JW1A 1FVFA 3LEWA 4E85A 1FCHA 2ZGDA 1UN8A 3HXBA 3KEAA 4I1MA 2NSZA 3ULEG 3NAWA 4U63A 4ATZD 2C2LA 4NRHB 3MYVA 3G2UA 3DSUA 3D9JA 4OAVB 2MHKA 2WXIA 3BU8A 4HRNA 3RO3A 2B6CA 2GRMA 2P9LG 3CGHA 4HRLA 5A6CA 3PRZA 3RRNB 4U7EB 4I17A 4CT0A 5AN8A 4PH4B 3N71A 2B0OE 3FUHA 2XRYA 4J7WA 2XQ0A 2YHEA 5D2MC 5D0OD 3B7BA 3UT4A 1MX4A 2RFAA 3PH0C 3TJPA 3CQCB 2EILE 5D0QD 1Z3XA 1QBQA 4K5BA 3DXKG 3ONKA 3UINC 4EZLA 1YYHA 2ZU6B 3ISMC 1TNUA 3MKQA 3DBSA 2H6GA 3GYZA 2WPVA 5CRVA 4HOSA 3U3WA 2ONDA 4GTVA 3LS8A 5FQ8A 3ZXSA 3LDZA 4DLQA 3FU5A 5AJLA 4LNGA 2WVIA 2XEVA 2VTBA 5AYWD 1ELKA 5AAOA 4DX2A 3HXFA 4GZ6A 4DI4A 5ENSD 4F6RD 1HX8A 2WM9A 3FTSA 4G8LA 4ZHBA 3LYAA 4IN3B 2E0IA 2IQCA 2H6IA 4GA1A 4IULA 3TWRA 1K3ZD 1LTXA 3CSFA 2KC7A 3PUKA 4GMLA 3PS6A 1IYGA 3HG0D 1HFAA 1E8WA 4GZCA 4DUIA 4L1BA 4GCNA 4IYPA 4LSZE 4TUMA 3IKOB 4G25A 4LNBA 3Q49B 4N2SA 3RRMB 1AP7A 3IV0A 3ZYLA 3FTVA 3ASHA 3G2WA 4G2VA 4PUCA 4ILIA 4GTSA 2X6HA 2P2CP 3V31A 5CMYA 1WY6A 3Q47B 2DZNA 4I6GA 1OWOA 4ANWA 4JZYA 1OT8A 3OTNA 3LVQE 1XGWA 3L17A 3UI2A 1E8XA 4J8DA 2H6HA 3CHQA 5FWQA 3ZVVA 4FHJA 4I6EA 1Z6TA 2VSYA 3DSWA 4Q94A 3PDNA 3L13A 1ZU2A 4N3AA 2WXJA 3KEZA 4J8EA 4APFA 3S7DA 4K5CA 2QYUA 4D10C 2IJGX 3UKUG 1HG2A 2KBXA 1S0PA 3MV3B 4GYOA 3ZGQA 2IOLA 4BSXA 1H2TC 1WAO1 1BLXB 3RSEG 4BSZB 1INZA 1HXIA 3FUJA 1Y8MA 3IXEA 1XNFA 3S7FA 4CGWA 3FWVA 4UUCA 2WMNA 2NXPA 2I2OA 3EHNA 4M7CA 4U0UA 5BW8C 5JHBA 2BF0X 3HRAA 5HI7A 5C1DA 3K9IA 4Y6CA 2WXHA 2IO3C 4BY6A 3QOUA 1HO8A 4TRQA 4F53A 1U3DA 3G2TA 1H6KA 3TG4A 1OXJA 2LO6A 5CRUA 3LXUX 4CCAA 2EIJE 1MJ0A 3RJVA 4ABNA 3MCXA 4GA0A 2WXMA 1UJJA 2ZISA 1V54E 5JJTA 3D9PA 4DPRA 3FU6A 4RVBA 4CDNA 4KVMA 1TN7A 1BI8B 4PS8A 2CHZA 2V5FA 2ETBA 1WG0A 4AXHA 4I2ZA 2JEKA 4JEUA 2XGSA 3R9AB 2DBAA 2OV8A 3UKRG 5CHEE 5A23A 4A3TA 2XGMA 2I1JA 5FT9A 3Q7AA 3VLEA 5JA4D 2EINE 4U96D 3WG7E 1O1SA 3CHOA 1SA4A 4NQ0A 4GTPA 2J4BA 1KZPA 1OCOE 3MEKA 2F8XK 5EDSA 4NACA 2QZAA 2Y0BG 5LFAA 5G04C 2VSNA 2ZGGA 4GMRA 1TN8A 1N4PA 3AJIA 2A5UA 3JXIA 4KBQA 1Y6IA 2ZIRA 3TXMA 1QNFA 4A55A 3SFZA 4DI3A 5AQBA 1S63A 2XCCA 4HOTA 1RZ4A 4FC8A 1NL4A 3C3OA 1QQEA 2XCBA 1MZCA 3HXEA 4H7YA 5FTPA 3E4BA 2NC9A 1KT0A 2UY1A 5E76A 1EYHA 5ANRA 4HB5A 4N3BA 2A5EA 4YDOA 2CFZA 3CK7A 1D9SA 4XKCA 4HI9A 3CK9A 2RKKA 3AS4A 4GCOA 1VDYA 4UI9J 4C9BB 5G2NA 1NP7A 3JXJA 3UTMA 4ACLA 4HQDA 3CVUA 1H2UA 2XRZA 2XEEA 4HOUA 3AG3E 2KZTB 2LXLA 2OEWA 3D9MA 4AM9A 2AXZA 1MHQA 5EX3A 5CEAA 1DCEA 3DXMG 3AG2E 4C48B 3FH8A 3QC1A 4GTQA 3PZ2A 3FFLA 2VGEA 4FJZA 4DX1A 3X2QE 2GRPB 3KAEA 3L82A 4N5CA 4UQZA 5G55A 5T3RA 4YVOA 2WQHA 2XPIA 3Q4AB 4GTTA 4JD2G 1SZAA 1TJCA 3CHMA 1JCSA 1ELWA 3ESLA 3AG1E 3AAAC 4UI9K 3C5RA 4N3CA 5G05C 1A17A 1OY3D 4G24A 1N9AA 3B13A 5JJ6A 1N94A 1H0AA 4KT6B 1N0RA 3QAQA 5AENA 1TNOA 5HQ8A 5EN5D 2J09A 3IBEA 3EU5A 2YINA 3Q5MA 5CCLA 2IU1A 4ZFHA 5M72A 1OWNA 4CRWA 2WXLA 4X8QA 2PM7A 3OXFA 5CERB 2HR2A 4I43A 1IQRA 3TWWA 3ZNGA 2IEJA 3ZPJA 4A1GA 3FULA 2XS8A 5J90A 3FTXA 3W9FA 4UWGA 3SY2A 1TNBA 3D9OA 3C98A 3FEYA 1OCRE 2DIWA 2LAHA 3QNKA 2CG3A 1E90A 5JJ7A 4UWFA 2R02A 5ENTD 4GZDA 2GRLA 3IHYA 2OOEA 1SA5A 4HXIA 1EPUA 5JHAA 4I9CA 3ZN3A 4B94A 4TV3A 4GTMA 5IY5E 3L16A 3VTYA 4UWLA 4GZ5A 4RG6A 4U95D 2X6IA 3TWSA 4A1SA 3OXLA 4BT9A 3V30A 4I9EA 4EECA 1A5EA 1H6OA 3EHRA 1NI1A 5KJLA 3CVXA 2X6KA 5ITZF 3SZ7A 3MGBA 4K5AB 3C3RA 3Q78A 4WWPA 3NOCD 3G2VA 4QFVA 5A7DB 1SZ9A 3EUVA 5ENRD 1SVXA 4U8VD 3ML8A 5KWDA 3APDA 3V2XA 4JC8A 3D9NA 1WDYA 4DRXE 3QB2A 5CBOA 3ABLE 3PZ4A 3ASOE 3SBTB 2UWJG 1W3BA 2XGOA 4U8YD 3CHPA 3P1UA 1HG5A 1E7VA 4L7TA 5FINA 2X6JA 3QWVA 3W9GA
chains in the Genus database with same CATH topology
2VSYA 4E6HA 3OAWA 3FUDA 3UX4A 3ASDA 3GZSA 4Q94A 1TEZA 3PDNA 2VGXA 4J0UA 4GPKA 3FTWA 4FU3A 4HS2A 2VGXB 3L13A 4CT4A 2WXFA 1ZU2A 3BEEA 2QY7A 3UUXA 1UG3A 4K0RA 4L2LA 2BUGA 1UN9A 2AVPA 2WXJA 4KZCA 3KEZA 4N3AA 2X3MA 4B8CB 1PY1A 2MOWA 3I5PA 4J8EA 4APFA 4XE0A 1N52A 2Y4UA 4GMJA 4WNFA 3R7QA 3S7DA 1E8YA 1KT1A 4HOQA 4DK5A 4YNDA 5KJKA 2KATA 4FLHA 2PQNA 3MJWA 2IJGX 4D10C 4CDRA 2AXVA 1HG2A 3FU0A 5FQ6A 1H2VC 2HYZA 1S0PA 3D9LA 4UWHA 1SQMA 3FUNA 4GU5A 2V4LA 3MV3B 3OXGA 4GYWA 2J4DA 4GYOA 1HS6A 3ZGQA 2IOLA 4BSXA 1H2TC 2I6HA 4OVUA 1WAO1 4LEUA 2XPZA 2AWIA 3LY7A 5LOZA 1INZA 1HXIA 3FUJA 4FA6A 3MV2B 1Y8MA 2J49A 4JVSA 3MKRA 2WXPA 3AS5A 3QWWA 3RRUA 1XNFA 3GZ2A 4IRUA 4ME2A 2YQ8A 3S7FA 3O48A 4CGWA 3FWVA 4J8FA 2WMNA 3B7TA 4KZ0A 4NURA 3SD5A 2NXPA 2I2OA 2QFCA 2FI7A 2UY1B 3EHNA 3EDTB 1H19A 4KMOA 4P29A 4A3VA 4U0UA 4U04A 5BW8C 3SI5A 5JHBA 1Z3YA 2BF0X 5HI7A 4B89A 2WXRA 3EIQC 4APOA 5C1DA 2WXKA 2VGYA 4PS3A 3K9IA 4OYSA 4Y6CA 2WXHA 4MS6A 2C0LA 2GW1A 3HVEB 4AVXA 1B89A 4BY6A 3QOUA 1HO8A 4TRQA 3VLDA 4F53A 3PVLA 1U3DA 1E8ZA 3G2TA 1H6KA 3TG4A 3CVPA 2LO6A 3JYSA 3RK6A 3LXUX 4CCAA 2JLBA 4JHRA 3NZSA 4XI0A 5LCWJ 3RJVA 4ABNA 3CLJA 3UPVA 3FDHA 4V3IA 3HHMA 3AU5A 3L08A 2VQ2A 3MCXA 4GA0A 4PS7A 5EKQD 3NZUA 3FU3A 3JCKC 2WXMA 1UJJA 4WNDA 2Y4TA 4G1TA 1HU3A 5CMWA 2WQ6A 3P2BA 5DBKA 4I6EA 2A4ZA 3S7JA 2PQRA 5T4YA 5JJTA 3D9PA 4DPRA 3U64A 3NF1A 4I1OB 4HORA 3FU6A 3CHSA 4RVBA 4BX8A 3SNXA 2YNQA 4CDNA 4KVMA 2J9QA 4AY6A 5T8IA 5BPPA 3L54A 3U66A 4L23A 3ZYMA 3L22A 5FJYA 3FUMA 4PS8A 3CSTA 3CVVA 2CHZA 3LKUA 4F3VA 1QZ2A 3KS2A 2YHCA 3CR3A 3ZFWA 2V5FA 3CK8A 2LSUA 2RD0A 5FZQA 2LNIA 2VJ8A 4K03A 4OVVA 4AXHA 4I2ZA 2JEKA 4JEUA 1JUQA 4AJWA 2XGSA 4ANXA 3ML9A 3FTUA 3R9AB 3RIBA 2C0MA 2DBAA 4I6JA 1ZBPA 4FADA 1FVHA 2RG8A 3T5VA 3SGHA 2OV8A 2V0PA 4Q96A 5CHEE 5FQ7A 4DJAA 3EIJA 2OVFA 4UI9C 4DLOA 3B7SA 4BFRA 4YVQC 1JWFA 5A23A 4A3TA 2XGMA 5KJMA 4ACKA 4MLPA 4O6FA 4WWNA 2I1JA 3JUIA 2IONA 5LCWC 3ASGA 5FT9A 3SHFA 3VLEA 3B7UX 4KXKB 2IFUA 3TL5A 3CHOA 1HF8A 3TGOA 4NQ0A 4LERA 4JHJA 4KYOB 2J4BA 4ILHB 3MEKA 3FY4A 3T8MA 4WNGA 5EDSA 3Q15A 4NACA 1X5BA 4J6IA 2I9CA 3CVLA 2L0IA 3FUEA 3PEVB 4XIFA 3ZIMA 5FQ4A 4EQFA 2HM8A 4JHKA 5FZRA 4Q69A 1NA3A 3QKYA 4XI9A 5ARGA 4AV7A 3HIZA 5LFAA 3LY8A 5ARFA 3UT8A 2FBNA 5G04C 1EDUA 2R5SA 1U3CA 3VTXA 2VSNA 3IHVA 3LVRE 3RKVA 2M63A 1OWPA 2MRIA 3JQ0A 5J08A 4WNEA 5AJDA 2A5UA 3LY9A 4G11A 5EX0A 3CVYA 4KBQA 4U8HA 3QWPA 4F7AA 4GA2A 1Y6IA 2CG2A 5BT1A 2EQXA 3PREA 4M3OA 3TXMA 1QNFA 3TG5A 2XPYA 4FP7A 4A55A 1PC2A 2WB2A 3SFZA 4DI3A 3HDXA 2FULA 1WM5A 2XCCA 4GYYA 4HOTA 1IQUA 1MQSA 3LPZA 5LX8A 4FC8A 4U07A 3TAXA 1QQEA 2FO7A 2XCBA 4FHKA 4H7YA 4AEZC 4H7XA 5FTPA 3E4BA 2NC9A 2L6JA 4B8AA 1KT0A 2UY1A 4Y6WA 5FZSA 5E76A 1EYHA 4MRUA 5ANRA 4N3BA 4EZKA 1DVPA 5CCMA 3CHRA 3MX3A 2CFZA 2CHWA 4BTAA 3CK7A 4RG9A 1OWMA 3VLFA 2R17C 4AP2A 3HVEA 1UJKA 4XKCA 3CK9A 3ZEFA 4AY5A 3D9IA 2L9BA 1JPLA 3U9WA 2AW6A 3AS4A 4GCOA 3ZYQA 1VDYA 4LRZA 4UI9J 4JW1A 4C9BB 1FVFA 3LEWA 4C0EA 5G2NA 4E85A 1FCHA 1UN8A 2LSVA 4WAFA 3EJNA 1NP7A 3IEGA 3MZLB 5G05J 1HH8A 4ACLA 3CVUA 3CKCA 5C2YA 3S7BA 2Q7FA 4I1MA 1H2UA 2KZTA 2NSZA 2XRZA 4HOUA 2KZTB 2OVBA 2Y3AA 5KCMA 4U63A 3T5XA 3D9MA 3CV0A 2C2LA 4NRHB 3MYVA 2AXZA 3G2UA 1MHQA 3URZA 4AM9A 3D9JA 5EX3A 3ENEA 3R7RA 2PL2A 3CQGB 5BV1A 2MHKA 2WXIA 4WUYA 1YA0A 3RO3A 3UQ3A 3FH8A 3PNTB 2GRMA 3QC1A 5G04J 2FEZA 3CGHA 5A6CA 3PRZA 3RRNB 4I17A 4ILGA 3FFLA 3LJ3A 4FJZA 3KAEA 2WQ7A 4CT0A 2KCKA 1HE8A 3AS8A 4N5CA 4UQZA 5G55A 5T3RA 3ZYKA 3JQ1A 4PH4B 3N71A 4YVOA 3D9KA 3FUHA 3MA5A 5BNWA 2WXQA 5ANLA 5ENNA 4RSYA 2XRYA 2WQHA 3I4GA 3S2AA 2XQ0A 3ONLA 2YHEA 2XPIA 3FH7A 3LCAA 3Q4AB 3ULQA 3NQPA 4N2QA 2J08A 3L6AA 5D0OD 4UQYA 2HO1A 1SZAA 1TJCA 3CHMA 3UT4A 1ELWA 3ESLA 3PH0C 3TJPA 3CQCB 5D0QD 5LP0A 1Z3XA 3I4RB 4UI9K 4ANUA 3ZHEB 3RO2A 4LCTA 4L2YA 1OUVA 4CGVA 4N3CA 3ONKA 5G05C 1A17A 4G24A 2J07A 2X6FA 3RU0A 3WXXA 4EZLA 3B13A 2ZU6B 5JJ6A 3PNLB 2KCLA 3CEQA 4HVBA 5KJNA 3MKQA 4XX5A 1H0AA 3DBSA 4KT6B 3MKQB 3GYZA 4GZ3A 2E2EA 3PUJA 4J8SA 3QAQA 5AENA 2WPVA 4BWRA 4HOSA 5HQ8A 2J09A 3D3MA 4GB9A 5E75A 2ONDA 3U3WA 3LS8A 4UQXA 3IBEA 5FQ8A 3ZXSA 2YINA 1JWGA 3Q5MA 5CCLA 3PEUB 3LDZA 4DLQA 3FU5A 2IU1A 2VSXE 4I2WA 1HZ4A 2PZIA 5AJLA 4JL0A 3CIAA 2WVIA 2XEVA 3FTYA 5M72A 2VTBA 1OWNA 5AYWD 1ELKA 1N54A 4CRWA 2VTBB 2WXLA 1NA0A 1LF8A 1EF1C 2PM7A 3FTZA 4BT8A 3CVQA 1L5JA 3OXFA 4GZ6A 2HR2A 4DI4A 4I43A 3UMVA 1IQRA 3CVNA 3ZRHA 4AOFA 4BTBA 3FUKA 3SF4A 4U0ZA 3ZPJA 4A1GA 3FULA 1HX8A 2WM9A 3FTSA 4JEHA 5J90A 3APCA 4BX9A 3FTXA 4UWGA 3D9OA 3C98A 3LYAA 4IN3B 3FEYA 2E0IA 2IQCA 3HYMB 2DIWA 1PAQA 2LAHA 2DCPA 4G23A 3QNKA 2CG3A 1E90A 5JJ7A 4GA1A 4IULA 4R7LA 1NZNA 4UWFA 2XHEA 2FF4A 2WXGA 3CSFA 4ANVA 2KC7A 3PUKA 4GMLA 4I1AA 4GZDA 2GRLA 3EHMA 3PS6A 4N39A 3ASFA 3IHYA 2OOEA 3DPDA 4HXIA 1EPUA 4W9RA 4I9CA 3ZN3A 4B94A 5JHAA 1IYGA 4TV3A 4HFGA 4F1SA 3G2SA 2LAIA 3ZW3A 2L0TB 1HFAA 3CKBA 3AU4A 3L16A 4JXTA 4UWLA 3VTYA 1E8WA 2I1KA 4GZCA 1GW6A 4GZ5A 4L1BA 2AXUA 4RG6A 3PZDA 2BTDA 2KM4A 1P5QA 3GZ1A 4GCNA 4IYPA 4TUUA 1KLXA 3TXNA 4U0SA 2ILRA 5AIJA 2R59A 4PDXA 1E96B 2X6IA 3QARA 2GGFA 3APFA 4A1SA 4AIFA 3QDNA 4FULA 3OXLA 4BT9A 2VSOE 3IKOB 5BUZA 4G25A 4I9EA 4G26A 4GAAA 4EECA 3Q49B 4N2SA 1ELRA 4XZ4A 3RRMB 2V8SE 3B7RL 4CDMA 3ESKA 4JA7A 3IV0A 4B0ZA 3ZYLA 5KJLA 4FLBA 5BV0A 2CFUA 3CVXA 3FTVA 2X6KA 4EBAA 4HLEA 3SZ7A 3ASHA 3G2WA 3MGBA 4EPZA 3UT7A 4JA9A 2KCVA 1IHGA 2P58C 4G2VA 4PUCA 4WWPA 4CEMA 3G2VA 4ILIA 2IOSA 4QFVA 5A7DB 1OWLA 3FP3A 4UWKA 1SZ9A 2WXNA 2X6HA 4KVOA 3KD7A 3ML8A 3SBSA 3FUIA 3I3NA 2WXOA 5CMYA 1WY6A 3Q47B 3APDA 4LUNU 1BPOA 3BG0B 3ZHEA 4WWOA 4XKBA 4URKA 4JC8A 3FUFA 3D9NA 4I6GA 1OWOA 4ANWA 4JZYA 3OTNA 3QB2A 3FH5A 2X38A 3QK0A 1E7UA 2IF4A 3PE3A 3CVWA 4JPSA 3QJZA 2UWJG 3LVQE 3SBTB 1XGWA 3U4TA 3PE4A 2VYIA 1TJFA 2WMOA 3L17A 1W3BA 2PM6A 3FHEA 3FEXA 4C0MA 2XGOA 1E8XA 5DIZA 1DNPA 3CHPA 3GW4A 4MKTA 3P1UA 4FJYA 1HG5A 1UW4B 1E7VA 3BG1B 3CHQA 3O4ZA 4J8DA 4L7TA 4ATGA 4EBAG 5FWQA 3ZVVA 4EZJA 2X6JA 2CHXA 4FHJA 3QWVA 1Z6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDZ A;  3CLJ A;  1EDU A;  1HG2 A;  4HFG A;  3G2S A;  3ONK A;  3D9N A;  3ZYL A;  1EYH A;  3D9L A;  2L0T B;  4FLB A;  5J08 A;  1HFA A;  4Q94 A;  3D9O A;  1DVP A;  4JXT A;  1UJJ A;  2BF0 X;  3G2W A;  4GZC A;  3ZYK A;  1JUQ A;  1ELK A;  3D9K A;  1HF8 A;  2DIW A;  4FU3 A;  5CMW A;  2DCP A;  2KM4 A;  3D9M A;  1LF8 A;  1H0A A;  3G2U A;  1MHQ A;  3ONL A;  1XGW A;  2QY7 A;  3D9J A;  3D9P A;  1UJK A;  3G2V A;  3D9I A;  4AVX A;  1JPL A;  4NAC A;  1X5B A;  1SZ9 A;  1PY1 A;  2L0I A;  2MOW A;  5LOZ A;  3G2T A;  3ZYQ A;  4Q96 A;  1VDY A;  1INZ A;  2LO6 A;  1SZA A;  1HG5 A;  4GZD A;  3ZYM A;  3RRU A;  5CMY A;  1JWF A;  5LP0 A;  1JWG A;  1HX8 A;  2V8S E; 
#chains in the Genus database with same CATH topology
 2JAB A;  1K8K G;  3UX4 A;  1TYQ G;  2DZO A;  2F0Y A;  1N4R A;  2VGX A;  3DRA A;  2AVP A;  1RW2 A;  3DEP A;  3I5P A;  4DX5 D;  3C72 A;  2Y4U A;  4YND A;  2KAT A;  4FLH A;  1D8D A;  2PQN A;  4G8K A;  1NFI E;  4GU5 A;  2V4L A;  4GYW A;  1N11 A;  2HE0 A;  2I6H A;  4LEU A;  4FA6 A;  2J49 A;  3MKR A;  3GZ2 A;  4ME2 A;  4J8F A;  3B7T A;  4KZ0 A;  5AQ9 A;  3ABM E;  2H6F A;  2UY1 B;  1H19 A;  3E33 A;  4P29 A;  3TWU A;  4A3V A;  2WXR A;  3ASN E;  2C0L A;  2GW1 A;  4GPM A;  3JYS A;  1BI7 B;  1TNY A;  4JHR A;  2QC9 A;  3CLJ A;  3L08 A;  2GRN B;  4WND A;  4G1T A;  5CMW A;  2WQ6 A;  3S7J A;  2A4Z A;  1G3N B;  3TWV A;  1TR4 A;  2P9U G;  3SNX A;  1JCQ A;  5T8I A;  3L54 A;  3FUM A;  1D8E A;  4F3V A;  5KNG A;  3CK8 A;  5ENO D;  2RD0 A;  5FZQ A;  2VJ8 A;  4OVV A;  4AJW A;  3BUA A;  3ML9 A;  3FTU A;  1Q2Z A;  2DWZ A;  1FVH A;  4DX7 D;  2RG8 A;  4TXR A;  3DWL G;  5FQ7 A;  3B7S A;  2GRQ B;  4MLP A;  4WWN A;  1DCQ A;  3ASG A;  2AJA A;  1O1R A;  3B7U X;  3KSL A;  4KXK B;  4LER A;  4JHJ A;  3T8M A;  3Q15 A;  1X5B A;  3FUE A;  4JHK A;  4AV7 A;  5ARF A;  2FBN A;  1EDU A;  2R5S A;  2M63 A;  3ZU7 B;  5EYL A;  4G11 A;  4F7A A;  3TG5 A;  2XPY A;  2P9K G;  2FUL A;  1WM5 A;  1IQU A;  1MQS A;  3LPZ A;  4U07 A;  4FHK A;  4B8A A;  5CCM A;  3MX3 A;  2CHW A;  1QYM A;  4RG9 A;  1OWM A;  3L9T A;  4AP2 A;  3HVE A;  3ZEF A;  4MBG A;  3D9I A;  2L9B A;  1JPL A;  1IXV A;  3ZYQ A;  4WAF A;  3IEG A;  3MZL B;  5G05 J;  1HH8 A;  3SO8 A;  4RLY A;  3T5X A;  3BQO A;  4TXP A;  2P9S G;  3ENE A;  3R7R A;  5BV1 A;  3ZKJ A;  1YA0 A;  3PNT B;  3E34 A;  5HRY A;  3Q9N C;  1OCC E;  4ILG A;  2WQ7 A;  4O1P A;  3ZYK A;  3D9K A;  5BNW A;  3MA5 A;  4RSY A;  3I4G A;  1FT1 A;  3ULQ A;  3NQP A;  4N2Q A;  2J08 A;  3L6A A;  4UQY A;  2HO1 A;  5LP0 A;  1Z5S C;  4BER A;  4ANU A;  4LCT A;  1OUV A;  4CGV A;  1MX6 A;  1KPS B;  2X6F A;  3T8K A;  2KCL A;  3CEQ A;  3MKQ B;  2E2E A;  4HBD A;  4J8S A;  5E75 A;  4UQX A;  1YCS B;  1JWG A;  2EIM E;  1O5M A;  2VSX E;  2PZI A;  4JL0 A;  3FTY A;  1S64 A;  5HS0 A;  2VTB B;  1N54 A;  1LF8 A;  1EF1 C;  4BT8 A;  3FTZ A;  4N5Q A;  3UMV A;  3CVN A;  3E30 A;  4AOF A;  3EHQ A;  4U0Z A;  5AQ7 A;  3Q73 A;  3APC A;  3DSX A;  4BX9 A;  2Y1L E;  3HYM B;  1PAQ A;  5ENP D;  2DCP A;  4G23 A;  1NZN A;  2XHE A;  2WXG A;  4B93 B;  4YDW A;  4I1A A;  3EHM A;  4N39 A;  4O1O A;  2LAI A;  3Q75 A;  3ZW3 A;  3C3Q A;  2P9N G;  4JXT A;  2NYJ A;  2AXU A;  1IHB A;  3PZD A;  2KM4 A;  1P5Q A;  3GZ1 A;  4TUU A;  3TXN A;  5B1B E;  2ILR A;  2R03 A;  4PDX A;  3QAR A;  2GGF A;  3UXG A;  4FUL A;  5BUZ A;  4G26 A;  1ELR A;  4XZ4 A;  2ETA A;  3B7R L;  3ESK A;  4B0Z A;  4FLB A;  5BV0 A;  4HLE A;  4EPZ A;  3UT7 A;  4JA9 A;  2KCV A;  1IHG A;  2P58 C;  4CEM A;  5EYP F;  1OWL A;  3FP3 A;  4UWK A;  4HLL A;  4KVO A;  5BXU A;  4LUN U;  1BPO A;  3ZHE A;  4XKB A;  4URK A;  3FUF A;  2Y69 E;  2DVW A;  3FH5 A;  2X38 A;  1JCR A;  3PE3 A;  3U4T A;  2VYI A;  1TJF A;  2WMO A;  2PM6 A;  3FEX A;  5DIZ A;  1DNP A;  4QQI A;  3GW4 A;  4FJY A;  3BG1 B;  1UW4 B;  4TXQ A;  4ATG A;  2CHX A;  4E6H A;  3OAW A;  3ASD A;  3GZS A;  1TEZ A;  3SFY A;  4J0U A;  4GPK A;  3DSS A;  3TWT A;  3BEE A;  2QY7 A;  3UUX A;  4L2L A;  2BUG A;  4BEP A;  2X3M A;  1PY1 A;  2MOW A;  4A63 B;  4XE0 A;  1N52 A;  4WNF A;  1E8Y A;  4HOQ A;  3MJW A;  1H2V C;  2XZT G;  3JUE A;  5H7P A;  3OXG A;  2OCC E;  1HS6 A;  2ETC A;  4O60 A;  2XPZ A;  4CZ2 D;  2AWI A;  5B1A E;  2WXP A;  3AS5 A;  3QWW A;  3RRU A;  2YQ8 A;  4NUR A;  3SD5 A;  2QFC A;  2FI7 A;  2F37 A;  4U04 A;  3SI5 A;  3B95 A;  4PS3 A;  4OYS A;  4MS6 A;  3HVE B;  4AVX A;  1B89 A;  2GRO B;  1E8Z A;  1N4S A;  3RK6 A;  4LNU D;  3FDH A;  4V3I A;  3HHM A;  4GTR A;  1O1T A;  1DC2 A;  3UIP C;  2V4H C;  1MX2 A;  5DBK A;  2PQR A;  5T4Y A;  1X81 A;  3U64 A;  3NF1 A;  4I1O B;  3CHS A;  4BX8 A;  3T9K A;  5BPP A;  3U66 A;  3TWX A;  3DPY A;  4NIK A;  3CST A;  4YDY A;  3LKU A;  4CYM D;  2XEN A;  1QZ2 A;  3Q9U C;  3CR3 A;  2R05 A;  2LSU A;  2LNI A;  3NOG D;  4K03 A;  1JUQ A;  4J8Y A;  4FAD A;  1BU9 A;  4Q96 A;  4UI9 C;  4DLO A;  4HI8 A;  4BFR A;  4YVQ C;  1JWF A;  5KJM A;  4ACK A;  3SFX A;  5EIL A;  5LCW C;  3R9M A;  3SHF A;  1HF8 A;  4ILH B;  3FY4 A;  4WNG A;  4J6I A;  4EQF A;  2XS1 A;  2L0I A;  3PEV B;  5FZR A;  1NA3 A;  3QKY A;  4GTO A;  1U3C A;  3VTX A;  4LG6 A;  2MRI A;  4F1P A;  4U8H A;  3Q79 A;  3QWP A;  4GA2 A;  4EHM A;  3E37 A;  3ZUV B;  2WB2 A;  3HDX A;  3PZ3 A;  4GYY A;  5BXO A;  3TAX A;  4AEZ C;  3V2O A;  4RQI A;  2L6J A;  4Y6W A;  5FZS A;  4EZK A;  3CHR A;  4BTA A;  3VLF A;  2R17 C;  2IY0 C;  1K1A A;  1N0Q A;  2AW6 A;  5EID A;  4LRZ A;  4OAU C;  1UOH A;  4C0E A;  2IO2 C;  2LSV A;  3EJN A;  3CKC A;  5C2Y A;  3S7B A;  3ZXP A;  2Q7F A;  2KZT A;  2OVB A;  2Y3A A;  5KCM A;  3CV0 A;  3DST A;  3URZ A;  2PL2 A;  3CQG B;  4WUY A;  3UQ3 A;  5G04 J;  2FEZ A;  3D9H A;  3LJ3 A;  3SQV A;  3E32 A;  3HXD A;  2KCK A;  1HE8 A;  1MYO A;  3AS8 A;  2L6B A;  3JQ1 A;  2WXQ A;  5ANL A;  5ENN A;  3S2A A;  3ONL A;  3UM1 A;  2BED A;  4L9P A;  3FH7 A;  3ABK E;  3LCA A;  4YDE A;  5AAR A;  3J5P A;  3Q7F A;  1TN6 A;  3I4R B;  2ZXW E;  3ZHE B;  3RO2 A;  4L2Y A;  1AWC B;  2BKG A;  3RU0 A;  2J07 A;  3WXX A;  2FO1 E;  3PNL B;  4HVB A;  5KJN A;  4XX5 A;  4GZ3 A;  3PUJ A;  4BWR A;  2R2L A;  3D3M A;  4GB9 A;  3PEU B;  4I2W A;  1HZ4 A;  3CIA A;  1N4Q A;  2J8S D;  1NA0 A;  3CVQ A;  1L5J A;  2EIK E;  3ZRH A;  3V79 K;  4BTB A;  3FUK A;  3SF4 A;  3NB2 A;  4JEH A;  1YMP A;  4BES A;  2V5Q C;  4R7L A;  2FF4 A;  5CED B;  4ANV A;  3LJN A;  3ASF A;  3DPD A;  4W9R A;  4HFG A;  4F1S A;  5KBA A;  3G2S A;  2L0T B;  2RFM A;  3CKB A;  1U2V G;  3AU4 A;  2I1K A;  1BD8 A;  1GW6 A;  1N95 A;  2BTD A;  2MYO A;  5ENQ D;  1KLX A;  4U0S A;  5AIJ A;  2R59 A;  1E96 B;  3PZ1 A;  3APF A;  4AIF A;  3QDN A;  4DX6 D;  2VSO E;  3AG4 E;  4GAA A;  2V8S E;  4CDM A;  1FPP A;  4JA7 A;  2CFU A;  4XEI G;  2LXM A;  4EBA A;  3DSV A;  2IOS A;  2WXN A;  2KXP C;  3KD7 A;  2P9P G;  3SBS A;  3FUI A;  3I3N A;  2WXO A;  3BG0 B;  4WWO A;  3UM0 A;  3QK0 A;  1E7U A;  2IF4 A;  3CVW A;  4JPS A;  3QJZ A;  3PE4 A;  3FHE A;  3F6Q A;  3DEO A;  4C0M A;  4MKT A;  3O4Z A;  4EZJ A;  3EU9 A;  3FUD A;  1LD8 A;  3FTW A;  4FU3 A;  4HS2 A;  2VGX B;  4CT4 A;  1KZO A;  2WXF A;  1UG3 A;  4K0R A;  4B8C B;  5EIB E;  1UN9 A;  4KZC A;  4EBA G;  5AQA A;  4GMJ A;  3R7Q A;  4Z68 A;  1KT1 A;  4DK5 A;  5KJK A;  2QYJ A;  4CDR A;  2AXV A;  3FU0 A;  5FQ6 A;  2HYZ A;  3D9L A;  4UWH A;  1SQM A;  1H6P A;  3FUN A;  2J4D A;  3HXC A;  1K1B A;  4HRM B;  4OVU A;  3LY7 A;  5LOZ A;  5JMN D;  3MV2 B;  2DYR E;  4JVS A;  3TWQ A;  3KSQ A;  4IRU A;  2DYS E;  3J5Q B;  3O48 A;  3EDT B;  1FT2 A;  4KMO A;  1Z3Y A;  4B89 A;  3EIQ C;  5D66 A;  4APO A;  2WXK A;  2VGY A;  5FIO A;  2OEV A;  2LUH A;  3VLD A;  3PVL A;  3CVP A;  2JLB A;  3NZS A;  4XI0 A;  3NBN B;  5LCW J;  3UPV A;  3ULY A;  3AU5 A;  2VQ2 A;  4PS7 A;  5EKQ D;  3NZU A;  3FU3 A;  3JCK C;  2Y4T A;  2P9I G;  1HU3 A;  3P2B A;  4HNA D;  5CEC B;  1ZB1 A;  4HOR A;  2YNQ A;  2J9Q A;  4AY6 A;  4BET A;  4L23 A;  3ZYM A;  3L22 A;  5FJY A;  3CVV A;  2XEH A;  3KS2 A;  2YHC A;  3ZFW A;  2F8Y A;  5B3S E;  4ANX A;  3RIB A;  2C0M A;  4I6J A;  1ZBP A;  1SW6 A;  2PNN A;  3T5V A;  3SGH A;  2V0P A;  4DJA A;  3EIJ A;  2OVF A;  3UIO C;  2XZD G;  1OCZ E;  3UM2 A;  2BKK B;  4O6F A;  3JUI A;  2ION A;  1LD7 A;  5KNH D;  2IFU A;  3TL5 A;  3TGO A;  4JB8 P;  4KYO B;  1TNZ A;  3ZIM A;  2I9C A;  3CVL A;  4XIF A;  5FQ4 A;  2HM8 A;  4Q69 A;  4XI9 A;  5ARG A;  3HIZ A;  3LY8 A;  3RAU A;  3UT8 A;  3IHV A;  3LVR E;  3RKV A;  1OWP A;  3JQ0 A;  5J08 A;  4WNE A;  5AJD A;  3LY9 A;  5EX0 A;  3CVY A;  2CG2 A;  5BT1 A;  1V55 E;  2EQX A;  3PRE A;  4M3O A;  4FP7 A;  2GRR B;  1PC2 A;  5LX8 A;  2FO7 A;  4H7X A;  3UM3 A;  1IKN D;  4MRU A;  5HKP A;  5CBN A;  1DVP A;  1S70 B;  1UJK A;  4AY5 A;  3U9W A;  4JW1 A;  1FVF A;  3LEW A;  4E85 A;  1FCH A;  2ZGD A;  1UN8 A;  3HXB A;  3KEA A;  4I1M A;  2NSZ A;  3ULE G;  3NAW A;  4U63 A;  4ATZ D;  2C2L A;  4NRH B;  3MYV A;  3G2U A;  3DSU A;  3D9J A;  4OAV B;  2MHK A;  2WXI A;  3BU8 A;  4HRN A;  3RO3 A;  2B6C A;  2GRM A;  2P9L G;  3CGH A;  4HRL A;  5A6C A;  3PRZ A;  3RRN B;  4U7E B;  4I17 A;  4CT0 A;  5AN8 A;  4PH4 B;  3N71 A;  2B0O E;  3FUH A;  2XRY A;  4J7W A;  2XQ0 A;  2YHE A;  5D2M C;  5D0O D;  3B7B A;  3UT4 A;  1MX4 A;  2RFA A;  3PH0 C;  3TJP A;  3CQC B;  2EIL E;  5D0Q D;  1Z3X A;  1QBQ A;  4K5B A;  3DXK G;  3ONK A;  3UIN C;  4EZL A;  1YYH A;  2ZU6 B;  3ISM C;  1TNU A;  3MKQ A;  3DBS A;  2H6G A;  3GYZ A;  2WPV A;  5CRV A;  4HOS A;  3U3W A;  2OND A;  4GTV A;  3LS8 A;  5FQ8 A;  3ZXS A;  3LDZ A;  4DLQ A;  3FU5 A;  5AJL A;  4LNG A;  2WVI A;  2XEV A;  2VTB A;  5AYW D;  1ELK A;  5AAO A;  4DX2 A;  3HXF A;  4GZ6 A;  4DI4 A;  5ENS D;  4F6R D;  1HX8 A;  2WM9 A;  3FTS A;  4G8L A;  4ZHB A;  3LYA A;  4IN3 B;  2E0I A;  2IQC A;  2H6I A;  4GA1 A;  4IUL A;  3TWR A;  1K3Z D;  1LTX A;  3CSF A;  2KC7 A;  3PUK A;  4GML A;  3PS6 A;  1IYG A;  3HG0 D;  1HFA A;  1E8W A;  4GZC A;  4DUI A;  4L1B A;  4GCN A;  4IYP A;  4LSZ E;  4TUM A;  3IKO B;  4G25 A;  4LNB A;  3Q49 B;  4N2S A;  3RRM B;  1AP7 A;  3IV0 A;  3ZYL A;  3FTV A;  3ASH A;  3G2W A;  4G2V A;  4PUC A;  4ILI A;  4GTS A;  2X6H A;  2P2C P;  3V31 A;  5CMY A;  1WY6 A;  3Q47 B;  2DZN A;  4I6G A;  1OWO A;  4ANW A;  4JZY A;  1OT8 A;  3OTN A;  3LVQ E;  1XGW A;  3L17 A;  3UI2 A;  1E8X A;  4J8D A;  2H6H A;  3CHQ A;  5FWQ A;  3ZVV A;  4FHJ A;  4I6E A;  1Z6T A;  2VSY A;  3DSW A;  4Q94 A;  3PDN A;  3L13 A;  1ZU2 A;  4N3A A;  2WXJ A;  3KEZ A;  4J8E A;  4APF A;  3S7D A;  4K5C A;  2QYU A;  4D10 C;  2IJG X;  3UKU G;  1HG2 A;  2KBX A;  1S0P A;  3MV3 B;  4GYO A;  3ZGQ A;  2IOL A;  4BSX A;  1H2T C;  1WAO 1;  1BLX B;  3RSE G;  4BSZ B;  1INZ A;  1HXI A;  3FUJ A;  1Y8M A;  3IXE A;  1XNF A;  3S7F A;  4CGW A;  3FWV A;  4UUC A;  2WMN A;  2NXP A;  2I2O A;  3EHN A;  4M7C A;  4U0U A;  5BW8 C;  5JHB A;  2BF0 X;  3HRA A;  5HI7 A;  5C1D A;  3K9I A;  4Y6C A;  2WXH A;  2IO3 C;  4BY6 A;  3QOU A;  1HO8 A;  4TRQ A;  4F53 A;  1U3D A;  3G2T A;  1H6K A;  3TG4 A;  1OXJ A;  2LO6 A;  5CRU A;  3LXU X;  4CCA A;  2EIJ E;  1MJ0 A;  3RJV A;  4ABN A;  3MCX A;  4GA0 A;  2WXM A;  1UJJ A;  2ZIS A;  1V54 E;  5JJT A;  3D9P A;  4DPR A;  3FU6 A;  4RVB A;  4CDN A;  4KVM A;  1TN7 A;  1BI8 B;  4PS8 A;  2CHZ A;  2V5F A;  2ETB A;  1WG0 A;  4AXH A;  4I2Z A;  2JEK A;  4JEU A;  2XGS A;  3R9A B;  2DBA A;  2OV8 A;  3UKR G;  5CHE E;  5A23 A;  4A3T A;  2XGM A;  2I1J A;  5FT9 A;  3Q7A A;  3VLE A;  5JA4 D;  2EIN E;  4U96 D;  3WG7 E;  1O1S A;  3CHO A;  1SA4 A;  4NQ0 A;  4GTP A;  2J4B A;  1KZP A;  1OCO E;  3MEK A;  2F8X K;  5EDS A;  4NAC A;  2QZA A;  2Y0B G;  5LFA A;  5G04 C;  2VSN A;  2ZGG A;  4GMR A;  1TN8 A;  1N4P A;  3AJI A;  2A5U A;  3JXI A;  4KBQ A;  1Y6I A;  2ZIR A;  3TXM A;  1QNF A;  4A55 A;  3SFZ A;  4DI3 A;  5AQB A;  1S63 A;  2XCC A;  4HOT A;  1RZ4 A;  4FC8 A;  1NL4 A;  3C3O A;  1QQE A;  2XCB A;  1MZC A;  3HXE A;  4H7Y A;  5FTP A;  3E4B A;  2NC9 A;  1KT0 A;  2UY1 A;  5E76 A;  1EYH A;  5ANR A;  4HB5 A;  4N3B A;  2A5E A;  4YDO A;  2CFZ A;  3CK7 A;  1D9S A;  4XKC A;  4HI9 A;  3CK9 A;  2RKK A;  3AS4 A;  4GCO A;  1VDY A;  4UI9 J;  4C9B B;  5G2N A;  1NP7 A;  3JXJ A;  3UTM A;  4ACL A;  4HQD A;  3CVU A;  1H2U A;  2XRZ A;  2XEE A;  4HOU A;  3AG3 E;  2KZT B;  2LXL A;  2OEW A;  3D9M A;  4AM9 A;  2AXZ A;  1MHQ A;  5EX3 A;  5CEA A;  1DCE A;  3DXM G;  3AG2 E;  4C48 B;  3FH8 A;  3QC1 A;  4GTQ A;  3PZ2 A;  3FFL A;  2VGE A;  4FJZ A;  4DX1 A;  3X2Q E;  2GRP B;  3KAE A;  3L82 A;  4N5C A;  4UQZ A;  5G55 A;  5T3R A;  4YVO A;  2WQH A;  2XPI A;  3Q4A B;  4GTT A;  4JD2 G;  1SZA A;  1TJC A;  3CHM A;  1JCS A;  1ELW A;  3ESL A;  3AG1 E;  3AAA C;  4UI9 K;  3C5R A;  4N3C A;  5G05 C;  1A17 A;  1OY3 D;  4G24 A;  1N9A A;  3B13 A;  5JJ6 A;  1N94 A;  1H0A A;  4KT6 B;  1N0R A;  3QAQ A;  5AEN A;  1TNO A;  5HQ8 A;  5EN5 D;  2J09 A;  3IBE A;  3EU5 A;  2YIN A;  3Q5M A;  5CCL A;  2IU1 A;  4ZFH A;  5M72 A;  1OWN A;  4CRW A;  2WXL A;  4X8Q A;  2PM7 A;  3OXF A;  5CER B;  2HR2 A;  4I43 A;  1IQR A;  3TWW A;  3ZNG A;  2IEJ A;  3ZPJ A;  4A1G A;  3FUL A;  2XS8 A;  5J90 A;  3FTX A;  3W9F A;  4UWG A;  3SY2 A;  1TNB A;  3D9O A;  3C98 A;  3FEY A;  1OCR E;  2DIW A;  2LAH A;  3QNK A;  2CG3 A;  1E90 A;  5JJ7 A;  4UWF A;  2R02 A;  5ENT D;  4GZD A;  2GRL A;  3IHY A;  2OOE A;  1SA5 A;  4HXI A;  1EPU A;  5JHA A;  4I9C A;  3ZN3 A;  4B94 A;  4TV3 A;  4GTM A;  5IY5 E;  3L16 A;  3VTY A;  4UWL A;  4GZ5 A;  4RG6 A;  4U95 D;  2X6I A;  3TWS A;  4A1S A;  3OXL A;  4BT9 A;  3V30 A;  4I9E A;  4EEC A;  1A5E A;  1H6O A;  3EHR A;  1NI1 A;  5KJL A;  3CVX A;  2X6K A;  5ITZ F;  3SZ7 A;  3MGB A;  4K5A B;  3C3R A;  3Q78 A;  4WWP A;  3NOC D;  3G2V A;  4QFV A;  5A7D B;  1SZ9 A;  3EUV A;  5ENR D;  1SVX A;  4U8V D;  3ML8 A;  5KWD A;  3APD A;  3V2X A;  4JC8 A;  3D9N A;  1WDY A;  4DRX E;  3QB2 A;  5CBO A;  3ABL E;  3PZ4 A;  3ASO E;  3SBT B;  2UWJ G;  1W3B A;  2XGO A;  4U8Y D;  3CHP A;  3P1U A;  1HG5 A;  1E7V A;  4L7T A;  5FIN A;  2X6J A;  3QWV A;  3W9G A; 
#chains in the Genus database with same CATH homology
 2VSY A;  4E6H A;  3OAW A;  3FUD A;  3UX4 A;  3ASD A;  3GZS A;  4Q94 A;  1TEZ A;  3PDN A;  2VGX A;  4J0U A;  4GPK A;  3FTW A;  4FU3 A;  4HS2 A;  2VGX B;  3L13 A;  4CT4 A;  2WXF A;  1ZU2 A;  3BEE A;  2QY7 A;  3UUX A;  1UG3 A;  4K0R A;  4L2L A;  2BUG A;  1UN9 A;  2AVP A;  2WXJ A;  4KZC A;  3KEZ A;  4N3A A;  2X3M A;  4B8C B;  1PY1 A;  2MOW A;  3I5P A;  4J8E A;  4APF A;  4XE0 A;  1N52 A;  2Y4U A;  4GMJ A;  4WNF A;  3R7Q A;  3S7D A;  1E8Y A;  1KT1 A;  4HOQ A;  4DK5 A;  4YND A;  5KJK A;  2KAT A;  4FLH A;  2PQN A;  3MJW A;  2IJG X;  4D10 C;  4CDR A;  2AXV A;  1HG2 A;  3FU0 A;  5FQ6 A;  1H2V C;  2HYZ A;  1S0P A;  3D9L A;  4UWH A;  1SQM A;  3FUN A;  4GU5 A;  2V4L A;  3MV3 B;  3OXG A;  4GYW A;  2J4D A;  4GYO A;  1HS6 A;  3ZGQ A;  2IOL A;  4BSX A;  1H2T C;  2I6H A;  4OVU A;  1WAO 1;  4LEU A;  2XPZ A;  2AWI A;  3LY7 A;  5LOZ A;  1INZ A;  1HXI A;  3FUJ A;  4FA6 A;  3MV2 B;  1Y8M A;  2J49 A;  4JVS A;  3MKR A;  2WXP A;  3AS5 A;  3QWW A;  3RRU A;  1XNF A;  3GZ2 A;  4IRU A;  4ME2 A;  2YQ8 A;  3S7F A;  3O48 A;  4CGW A;  3FWV A;  4J8F A;  2WMN A;  3B7T A;  4KZ0 A;  4NUR A;  3SD5 A;  2NXP A;  2I2O A;  2QFC A;  2FI7 A;  2UY1 B;  3EHN A;  3EDT B;  1H19 A;  4KMO A;  4P29 A;  4A3V A;  4U0U A;  4U04 A;  5BW8 C;  3SI5 A;  5JHB A;  1Z3Y A;  2BF0 X;  5HI7 A;  4B89 A;  2WXR A;  3EIQ C;  4APO A;  5C1D A;  2WXK A;  2VGY A;  4PS3 A;  3K9I A;  4OYS A;  4Y6C A;  2WXH A;  4MS6 A;  2C0L A;  2GW1 A;  3HVE B;  4AVX A;  1B89 A;  4BY6 A;  3QOU A;  1HO8 A;  4TRQ A;  3VLD A;  4F53 A;  3PVL A;  1U3D A;  1E8Z A;  3G2T A;  1H6K A;  3TG4 A;  3CVP A;  2LO6 A;  3JYS A;  3RK6 A;  3LXU X;  4CCA A;  2JLB A;  4JHR A;  3NZS A;  4XI0 A;  5LCW J;  3RJV A;  4ABN A;  3CLJ A;  3UPV A;  3FDH A;  4V3I A;  3HHM A;  3AU5 A;  3L08 A;  2VQ2 A;  3MCX A;  4GA0 A;  4PS7 A;  5EKQ D;  3NZU A;  3FU3 A;  3JCK C;  2WXM A;  1UJJ A;  4WND A;  2Y4T A;  4G1T A;  1HU3 A;  5CMW A;  2WQ6 A;  3P2B A;  5DBK A;  4I6E A;  2A4Z A;  3S7J A;  2PQR A;  5T4Y A;  5JJT A;  3D9P A;  4DPR A;  3U64 A;  3NF1 A;  4I1O B;  4HOR A;  3FU6 A;  3CHS A;  4RVB A;  4BX8 A;  3SNX A;  2YNQ A;  4CDN A;  4KVM A;  2J9Q A;  4AY6 A;  5T8I A;  5BPP A;  3L54 A;  3U66 A;  4L23 A;  3ZYM A;  3L22 A;  5FJY A;  3FUM A;  4PS8 A;  3CST A;  3CVV A;  2CHZ A;  3LKU A;  4F3V A;  1QZ2 A;  3KS2 A;  2YHC A;  3CR3 A;  3ZFW A;  2V5F A;  3CK8 A;  2LSU A;  2RD0 A;  5FZQ A;  2LNI A;  2VJ8 A;  4K03 A;  4OVV A;  4AXH A;  4I2Z A;  2JEK A;  4JEU A;  1JUQ A;  4AJW A;  2XGS A;  4ANX A;  3ML9 A;  3FTU A;  3R9A B;  3RIB A;  2C0M A;  2DBA A;  4I6J A;  1ZBP A;  4FAD A;  1FVH A;  2RG8 A;  3T5V A;  3SGH A;  2OV8 A;  2V0P A;  4Q96 A;  5CHE E;  5FQ7 A;  4DJA A;  3EIJ A;  2OVF A;  4UI9 C;  4DLO A;  3B7S A;  4BFR A;  4YVQ C;  1JWF A;  5A23 A;  4A3T A;  2XGM A;  5KJM A;  4ACK A;  4MLP A;  4O6F A;  4WWN A;  2I1J A;  3JUI A;  2ION A;  5LCW C;  3ASG A;  5FT9 A;  3SHF A;  3VLE A;  3B7U X;  4KXK B;  2IFU A;  3TL5 A;  3CHO A;  1HF8 A;  3TGO A;  4NQ0 A;  4LER A;  4JHJ A;  4KYO B;  2J4B A;  4ILH B;  3MEK A;  3FY4 A;  3T8M A;  4WNG A;  5EDS A;  3Q15 A;  4NAC A;  1X5B A;  4J6I A;  2I9C A;  3CVL A;  2L0I A;  3FUE A;  3PEV B;  4XIF A;  3ZIM A;  5FQ4 A;  4EQF A;  2HM8 A;  4JHK A;  5FZR A;  4Q69 A;  1NA3 A;  3QKY A;  4XI9 A;  5ARG A;  4AV7 A;  3HIZ A;  5LFA A;  3LY8 A;  5ARF A;  3UT8 A;  2FBN A;  5G04 C;  1EDU A;  2R5S A;  1U3C A;  3VTX A;  2VSN A;  3IHV A;  3LVR E;  3RKV A;  2M63 A;  1OWP A;  2MRI A;  3JQ0 A;  5J08 A;  4WNE A;  5AJD A;  2A5U A;  3LY9 A;  4G11 A;  5EX0 A;  3CVY A;  4KBQ A;  4U8H A;  3QWP A;  4F7A A;  4GA2 A;  1Y6I A;  2CG2 A;  5BT1 A;  2EQX A;  3PRE A;  4M3O A;  3TXM A;  1QNF A;  3TG5 A;  2XPY A;  4FP7 A;  4A55 A;  1PC2 A;  2WB2 A;  3SFZ A;  4DI3 A;  3HDX A;  2FUL A;  1WM5 A;  2XCC A;  4GYY A;  4HOT A;  1IQU A;  1MQS A;  3LPZ A;  5LX8 A;  4FC8 A;  4U07 A;  3TAX A;  1QQE A;  2FO7 A;  2XCB A;  4FHK A;  4H7Y A;  4AEZ C;  4H7X A;  5FTP A;  3E4B A;  2NC9 A;  2L6J A;  4B8A A;  1KT0 A;  2UY1 A;  4Y6W A;  5FZS A;  5E76 A;  1EYH A;  4MRU A;  5ANR A;  4N3B A;  4EZK A;  1DVP A;  5CCM A;  3CHR A;  3MX3 A;  2CFZ A;  2CHW A;  4BTA A;  3CK7 A;  4RG9 A;  1OWM A;  3VLF A;  2R17 C;  4AP2 A;  3HVE A;  1UJK A;  4XKC A;  3CK9 A;  3ZEF A;  4AY5 A;  3D9I A;  2L9B A;  1JPL A;  3U9W A;  2AW6 A;  3AS4 A;  4GCO A;  3ZYQ A;  1VDY A;  4LRZ A;  4UI9 J;  4JW1 A;  4C9B B;  1FVF A;  3LEW A;  4C0E A;  5G2N A;  4E85 A;  1FCH A;  1UN8 A;  2LSV A;  4WAF A;  3EJN A;  1NP7 A;  3IEG A;  3MZL B;  5G05 J;  1HH8 A;  4ACL A;  3CVU A;  3CKC A;  5C2Y A;  3S7B A;  2Q7F A;  4I1M A;  1H2U A;  2KZT A;  2NSZ A;  2XRZ A;  4HOU A;  2KZT B;  2OVB A;  2Y3A A;  5KCM A;  4U63 A;  3T5X A;  3D9M A;  3CV0 A;  2C2L A;  4NRH B;  3MYV A;  2AXZ A;  3G2U A;  1MHQ A;  3URZ A;  4AM9 A;  3D9J A;  5EX3 A;  3ENE A;  3R7R A;  2PL2 A;  3CQG B;  5BV1 A;  2MHK A;  2WXI A;  4WUY A;  1YA0 A;  3RO3 A;  3UQ3 A;  3FH8 A;  3PNT B;  2GRM A;  3QC1 A;  5G04 J;  2FEZ A;  3CGH A;  5A6C A;  3PRZ A;  3RRN B;  4I17 A;  4ILG A;  3FFL A;  3LJ3 A;  4FJZ A;  3KAE A;  2WQ7 A;  4CT0 A;  2KCK A;  1HE8 A;  3AS8 A;  4N5C A;  4UQZ A;  5G55 A;  5T3R A;  3ZYK A;  3JQ1 A;  4PH4 B;  3N71 A;  4YVO A;  3D9K A;  3FUH A;  3MA5 A;  5BNW A;  2WXQ A;  5ANL A;  5ENN A;  4RSY A;  2XRY A;  2WQH A;  3I4G A;  3S2A A;  2XQ0 A;  3ONL A;  2YHE A;  2XPI A;  3FH7 A;  3LCA A;  3Q4A B;  3ULQ A;  3NQP A;  4N2Q A;  2J08 A;  3L6A A;  5D0O D;  4UQY A;  2HO1 A;  1SZA A;  1TJC A;  3CHM A;  3UT4 A;  1ELW A;  3ESL A;  3PH0 C;  3TJP A;  3CQC B;  5D0Q D;  5LP0 A;  1Z3X A;  3I4R B;  4UI9 K;  4ANU A;  3ZHE B;  3RO2 A;  4LCT A;  4L2Y A;  1OUV A;  4CGV A;  4N3C A;  3ONK A;  5G05 C;  1A17 A;  4G24 A;  2J07 A;  2X6F A;  3RU0 A;  3WXX A;  4EZL A;  3B13 A;  2ZU6 B;  5JJ6 A;  3PNL B;  2KCL A;  3CEQ A;  4HVB A;  5KJN A;  3MKQ A;  4XX5 A;  1H0A A;  3DBS A;  4KT6 B;  3MKQ B;  3GYZ A;  4GZ3 A;  2E2E A;  3PUJ A;  4J8S A;  3QAQ A;  5AEN A;  2WPV A;  4BWR A;  4HOS A;  5HQ8 A;  2J09 A;  3D3M A;  4GB9 A;  5E75 A;  2OND A;  3U3W A;  3LS8 A;  4UQX A;  3IBE A;  5FQ8 A;  3ZXS A;  2YIN A;  1JWG A;  3Q5M A;  5CCL A;  3PEU B;  3LDZ A;  4DLQ A;  3FU5 A;  2IU1 A;  2VSX E;  4I2W A;  1HZ4 A;  2PZI A;  5AJL A;  4JL0 A;  3CIA A;  2WVI A;  2XEV A;  3FTY A;  5M72 A;  2VTB A;  1OWN A;  5AYW D;  1ELK A;  1N54 A;  4CRW A;  2VTB B;  2WXL A;  1NA0 A;  1LF8 A;  1EF1 C;  2PM7 A;  3FTZ A;  4BT8 A;  3CVQ A;  1L5J A;  3OXF A;  4GZ6 A;  2HR2 A;  4DI4 A;  4I43 A;  3UMV A;  1IQR A;  3CVN A;  3ZRH A;  4AOF A;  4BTB A;  3FUK A;  3SF4 A;  4U0Z A;  3ZPJ A;  4A1G A;  3FUL A;  1HX8 A;  2WM9 A;  3FTS A;  4JEH A;  5J90 A;  3APC A;  4BX9 A;  3FTX A;  4UWG A;  3D9O A;  3C98 A;  3LYA A;  4IN3 B;  3FEY A;  2E0I A;  2IQC A;  3HYM B;  2DIW A;  1PAQ A;  2LAH A;  2DCP A;  4G23 A;  3QNK A;  2CG3 A;  1E90 A;  5JJ7 A;  4GA1 A;  4IUL A;  4R7L A;  1NZN A;  4UWF A;  2XHE A;  2FF4 A;  2WXG A;  3CSF A;  4ANV A;  2KC7 A;  3PUK A;  4GML A;  4I1A A;  4GZD A;  2GRL A;  3EHM A;  3PS6 A;  4N39 A;  3ASF A;  3IHY A;  2OOE A;  3DPD A;  4HXI A;  1EPU A;  4W9R A;  4I9C A;  3ZN3 A;  4B94 A;  5JHA A;  1IYG A;  4TV3 A;  4HFG A;  4F1S A;  3G2S A;  2LAI A;  3ZW3 A;  2L0T B;  1HFA A;  3CKB A;  3AU4 A;  3L16 A;  4JXT A;  4UWL A;  3VTY A;  1E8W A;  2I1K A;  4GZC A;  1GW6 A;  4GZ5 A;  4L1B A;  2AXU A;  4RG6 A;  3PZD A;  2BTD A;  2KM4 A;  1P5Q A;  3GZ1 A;  4GCN A;  4IYP A;  4TUU A;  1KLX A;  3TXN A;  4U0S A;  2ILR A;  5AIJ A;  2R59 A;  4PDX A;  1E96 B;  2X6I A;  3QAR A;  2GGF A;  3APF A;  4A1S A;  4AIF A;  3QDN A;  4FUL A;  3OXL A;  4BT9 A;  2VSO E;  3IKO B;  5BUZ A;  4G25 A;  4I9E A;  4G26 A;  4GAA A;  4EEC A;  3Q49 B;  4N2S A;  1ELR A;  4XZ4 A;  3RRM B;  2V8S E;  3B7R L;  4CDM A;  3ESK A;  4JA7 A;  3IV0 A;  4B0Z A;  3ZYL A;  5KJL A;  4FLB A;  5BV0 A;  2CFU A;  3CVX A;  3FTV A;  2X6K A;  4EBA A;  4HLE A;  3SZ7 A;  3ASH A;  3G2W A;  3MGB A;  4EPZ A;  3UT7 A;  4JA9 A;  2KCV A;  1IHG A;  2P58 C;  4G2V A;  4PUC A;  4WWP A;  4CEM A;  3G2V A;  4ILI A;  2IOS A;  4QFV A;  5A7D B;  1OWL A;  3FP3 A;  4UWK A;  1SZ9 A;  2WXN A;  2X6H A;  4KVO A;  3KD7 A;  3ML8 A;  3SBS A;  3FUI A;  3I3N A;  2WXO A;  5CMY A;  1WY6 A;  3Q47 B;  3APD A;  4LUN U;  1BPO A;  3BG0 B;  3ZHE A;  4WWO A;  4XKB A;  4URK A;  4JC8 A;  3FUF A;  3D9N A;  4I6G A;  1OWO A;  4ANW A;  4JZY A;  3OTN A;  3QB2 A;  3FH5 A;  2X38 A;  3QK0 A;  1E7U A;  2IF4 A;  3PE3 A;  3CVW A;  4JPS A;  3QJZ A;  2UWJ G;  3LVQ E;  3SBT B;  1XGW A;  3U4T A;  3PE4 A;  2VYI A;  1TJF A;  2WMO A;  3L17 A;  1W3B A;  2PM6 A;  3FHE A;  3FEX A;  4C0M A;  2XGO A;  1E8X A;  5DIZ A;  1DNP A;  3CHP A;  3GW4 A;  4MKT A;  3P1U A;  4FJY A;  1HG5 A;  1UW4 B;  1E7V A;  3BG1 B;  3CHQ A;  3O4Z A;  4J8D A;  4L7T A;  4ATG A;  4EBA G;  5FWQ A;  3ZVV A;  4EZJ A;  2X6J A;  2CHX A;  4FHJ A;  3QWV A;  1Z6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...