2BF7A

Leishmania major pteridine reductase 1 in complex with nadp and biopterin
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
283
structure length
265
Chain Sequence
VPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLGDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structures of Leishmania Major Pteridine Reductase Complexes Reveal the Active Site Features Important for Ligand Binding and to Guide Inhibitor Design
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 96
structure length 265
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2004-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bf7A00
3WMXA 3G1UA 1QV6A 3DBRB 2OBNA 1UAYA 3G79A 4J7UA 3GPIA 2VUTA 2VYVA 3VPXA 1PJTA 2X9GA 4A73A 5JDIA 3AI2A 2YV3A 5I7SA 3F1KA 1LXCA 1HLDA 1GD1O 1Q0HA 2GF2A 4M89A 5CDUA 1PJ2A 2AQ8A 2IXAA 4MJLA 4QEDA 1YS4A 1JKJA 2I65A 1X14A 4PLHA 4OOFA 3ZWOA 4DQUA 1DOHA 4PRLA 4U8GA 5JY6A 4B3JA 3VVBA 4CM9A 3PJEA 3B20A 4DUPA 2ZIZA 3ONEA 2EEZA 4BGIA 3ZHBA 2DBQA 4OM8A 5AQ1A 1R0LA 3ZU5A 1GPJA 1GUZA 5A04A 1GUFA 1A9YA 3DWFA 1PWZA 1IY8A 4RZIA 3BTVA 4ONEA 4R54A 3GUCA 5KIAA 4GX1A 1UXGA 1M66A 1ZBQA 3LF2A 3UOGA 3WR5A 4E30A 1LX6A 1E7YA 4IXTA 3Q11A 2X1HA 4JNKA 2PGDA 3WWZA 5L4SA 3L07A 4S3MA 4PCVA 1SEPA 5C7IO 4ZQBA 3H3JA 3H9UA 3PHJA 5CFZA 1YBAA 2XAAA 2ZQYA 5CEEA 1Q7CA 3UICA 1Y7TA 2RAFA 1GFSA 4TQGA 4GLOA 1T1SA 4E5YA 1QYVA 2FP4A 1H6DA 1AXGA 3HQ4O 2CY0A 4WLVA 4FQ8A 1Y8QB 4WNIA 2UUOA 5FFFA 4MVJH 5JFOA 1SOVA 5DBGA 1WPQA 4JN6B 3ZWBA 1XR3A 4EI2A 1PGJA 3HE3A 3F6YA 1D1SA 2GSDA 3PYLA 4EZBA 2AQHA 2WJPA 2ZB8A 3GVPA 4CQLB 3F46A 4XQEA 1EBFA 1IPEA 4DC0A 2YFHA 2A9FA 2VHWA 4F6LA 4PG5A 4DVJA 2P4QA 4BNIA 4CLRB 1SBYA 3JTMA 5JAMA 1EK5A 2YHIA 1DHRA 2VZ9A 4QXMA 3Q0EA 4IDDA 2AEFA 4J16A 4BHTA 1JVBA 3H65A 3U9LA 4B4VA 3BTOA 2Q1WA 1I2BA 1ID1A 3E48A 2FMUA 2IZZA 4WNCA 4B7CA 3KBOA 3KYDA 4YT8A 3GN2A 2G1UA 4L8VA 4CMHA 3X2FA 1H94A 4BO8A 3QWAA 3PEFA 4Z3DA 3U4CA 1WZIA 1JLLA 3STHA 5TIIA 4CLDA 4A27A 3RUAA 3JQAB 2Y93A 5BSHA 3H6KA 1CERA 3O8QA 2XXBA 1U8FO 3GRKA 4DC1A 2BLLA 3QLJA 2FWMX 1HEUA 4YAEA 1Q7GA 1VL8A 3WQQA 3TFQA 5C7LO 4MVJG 3GY0A 4NMHA 3UXYA 1EE2A 4ID9A 4Q3BA 5B1YA 1LDYA 1E3EA 1PZGA 1E3SA 4P22A 2Y1DA 5ER9A 2O3JA 3JQEA 4PG8A 1NTOA 5K6AC 3FNFA 1ENOA 3CSDA 3GVHA 2JAPA 2BKAA 4XEHA 1HWYA 2HKIA 4CL8A 3ICPA 2NUAA 3JQDA 4R3WA 4CQMB 4BQRA 1O5IA 4WOKA 5JC1A 4AJHA 2PV7A 4B4OA 3KZVA 1Z45A 1E7RA 1PWXA 5T5QA 1I30A 5C5IA 1ZNQO 4OJNA 3P5SA 3ANNA 1SB9A 3MJ4A 4ALJA 3NUGA 2EV9A 5TRTA 4GL4A 4C4OA 3VH2A 5MGBA 3I9LA 5CDTA 3JYQA 1QMGA 1U7TA 1UZMA 1O94A 2W8ZA 3C7DB 1WP4A 2J3IA 1LTHR 5T67A 1UXIA 5FEUA 5F5LA 4BO7A 1W4ZA 3H5NA 4RF4A 1MP0A 1CQJA 1NFQA 1HTBA 2GN8A 2IDZA 3GVIA 1NXQA 1C3VA 1QYWA 2IYPA 2B37A 2UV8A 1ADFA 3DO5A 4GX0A 4Y6RA 1HSOA 4RF5A 1PL7A 4HY3A 5KJEA 4RVFA 3RAJA 1VL0A 3IOYA 1N9GA 1DEHA 2P9EA 4BNYA 5IJZA 4PLYA 4GSLA 2O2SA 4I8XA 5TT1A 4J9UE 3QSGA 4L73A 1NWCA 3I6QA 4LISA 3TL2A 3WLFA 1PQPA 4QO8A 4N18A 1VI2A 2GN6A 1IHYA 4WECA 3GF4A 3JQ9C 3K5PA 3EUWA 1P31A 1ZEMA 1E7SA 1ONOA 2LDXA 4L74A 3DZKA 4IPTA 4EITA 5KVSA 3IUPA 4AJJA 4L4RA 4XDYA 2YUTA 2OOSA 5GY7A 1KVUA 3GNTA 2SCUA 1ZIDA 3PJDA 5KVQA 3KM0A 2C5AA 1BRMA 2R2GA 3E8XA 1ONPA 3DZBA 1RM0A 1A4UA 3S1LA 3DAGA 5L4LA 3ENKA 2BH9A 1SNYA 4F45A 5G4KA 3ENNA 3SX2A 1ZO8A 3UCFA 1UXJA 4QFCA 4CV1A 3HDHA 3L4BA 1HZJA 1GR0A 3ZN2A 1EQUA 3ZHZA 1F17A 1Q1NA 4JBGA 2DUWA 3OECA 1VJTA 4XZ3A 4RZHA 4HX5A 2UUPA 1U3WA 2DKNA 2FOIA 4FN4A 5BSFA 3EVTA 4K6CA 1KIFA 4A03A 2IE0A 4D0RA 3P2YA 1PZFA 4UREA 5L95A 4RF3A 3VZRA 1MUUA 4YT5A 3OEYA 4CR7A 3PWZA 1NQAO 3ST7A 1LDNA 3OA2A 3RASA 3ZNQA 1AGNA 3CE6A 4OXKA 1NASA 2B5VA 5U4QA 3CXRA 1QSGA 3IKTA 3TOZA 1ZZEA 3RUCA 1F14A 1SB8A 2AHRA 3GDFA 3HSKA 3TJRA 4J2HA 3PDJA 3ZU4A 4TZKA 2OBYA 5DBFA 3DC2A 2RHRA 4A2CA 1IZ0A 4MO2A 4DQXA 1A7AA 1PS8A 4QSMA 4YRBA 1SAYA 3PQEA 5I8ZA 3SVTA 4OGWA 1CETA 1E3LA 1YO6A 4W99A 3RU9A 4CMKA 3WTBA 1RWBA 5KJ1A 3I4CA 2WD7A 3RUHA 1PJQA 3WGIA 1NHWA 4MKZA 4J1TA 4TRJA 2EJWA 4UVEA 4CLHA 3G17A 3WLEA 1YB1A 4UVDA 3RFVA 4XB1A 5CG1A 4P8RA 2VRCA 5COAA 1JAXA 1J0XO 4NK4A 2FR1A 3HFGA 3WYEA 4CR6A 3S8MA 3FSRA 3GGPA 2DBZA 3EHEA 3WX0A 5C37A 3NDRA 4DLAA 1R37A 4PVCA 2IZ1A 4UEJA 1F0YA 4CMBA 4WCFC 5I7FA 5JSFA 4PN3A 4AVYA 1X1EA 1GV0A 5JW6A 3BMQB 3DAFA 3FHLA 1CWUA 3ZWVA 2ZB4A 3ZWCA 3K6JA 1PGQA 5F1OA 1EEHA 2G82A 2D0IA 5TLSA 4H7PA 2BGLA 5U9CA 3ROMA 1XU7A 3ONDA 1LLCA 4N5MA 4RPKA 1F8GA 5LC1A 2YJZA 2J3KA 4H15A 3IIEA 3BTSA 1E1MA 1U3TA 4Q3NA 4RQUA 2NM0A 3GK3A 4QFDA 5EQFA 3QIVA 4R1TA 3NGLA 2AQKA 1DIHA 3F5SA 2Q4EA 1L7EA 4JQCA 3IJPA 4GPD1 3D4PA 3DZHA 5ICSA 3QQPA 3RQSA 3UCXA 4BO3A 3JQ8A 1WLYA 2DFVA 4AJIA 3GC6A 1EMDA 5G4LA 3EZLA 2JJYA 3HWRA 4M49A 4WKGA 3EVNA 4J1QA 3KHUA 1RJWA 2E6UX 2JCYA 5TQVA 4CMAA 3MJEA 1YJQA 3ZNPA 3SJUA 5C3MA 2BD0A 3C1OA 4IDBA 1NPDA 2B0JA 5I7EA 1LBEA 2B4RO 1ZMTA 5L7TA 1BMDA 1EDOA 1X0VA 4JIGA 3OQ6A 4CMJA 4S1VA 3ROKA 3D0OA 1YDWA 1KVTA 2A94A 2UVDA 4AJEA 3L4SO 2EW2A 1U2GA 2PY6A 3EDMA 3DMTA 1E7WA 3U5TA 1N2SA 1X7DA 3GA0A 2C20A 1YB5A 3WBBA 1GV1A 1ZK3A 4H16A 2OP0A 5B37A 4WLFA 1NQ5A 3HG7A 3ULKA 4UULA 3FTNA 5TF4A 4BNNA 2FHSA 1YOVB 5IXSA 3D4NA 4CM9D 4YBZA 3CH6A 1DC5A 2WE8A 4RPLA 1PQWA 3P19A 2FR0A 4GKVA 4I5DA 5B4UA 2GO1A 4FC6A 3PHHA 1PS9A 1LRKA 1TVEA 2BI7A 3DXFA 4D3FA 4IBOA 4CV2A 1MG0A 4I08A 4XWYA 4DIBA 1XLTA 1H5QA 1UP7A 4GVLA 1DO8A 1HF3A 4IIUA 4YQYA 4J90A 3OM9A 4D7AA 3GFBA 1U2DA 1P0CA 1C0PA 2NTJA 2Y67A 5FI3A 4KDFA 1NVGA 6ADHA 2GERA 3DHYA 1IE3A 2EW8A 1XEAA 5GZ6A 3W6UA 4R1NA 4R1UA 3WFIA 2RH8A 3F3SA 4AL4A 3DR3A 1GQQA 4Z9FA 4L0QA 3GRPA 1CF2O 1P1HA 3VHRA 2OP1A 4L9RA 3TPCA 1GEEA 4BMVA 4BUCA 2JL1A 4E2WA 5JMWA 4K6FA 1PJCA 2CNBA 2V6BA 4DMMA 1YJ8A 4DA9A 3GGGA 4D3DA 4R01A 1G6KA 1V8BA 1OOEA 1GPDG 3PI7A 2W90A 1ISJA 3G3EA 3K92A 1GY8A 3OBBA 3ZGYA 3NT5A 5TJ9A 2W4QA 4UUNA 4QQRA 1KEWA 3OJLA 1D3AA 1TI7A 4D0SA 1DB3A 3CIFA 3AJRA 2GASA 4A5OA 5IFLA 4B7UA 3W8FA 4J1NA 5TSDA 3WXBA 1YQDA 3U4IA 1YRLA 2XF8A 5CG2A 5ENDA 3KOUA 3PHGA 3QW2A 2VCYA 3JQCA 3O26A 3A1NA 5JE8A 3GT0A 5CEFA 4CM8B 4B4UA 3L9WA 2HMVA 2PD3A 2Z1MA 2Y66A 2EKLA 4LVUA 5TJHA 2X0RA 1LU9A 2H63A 2PKQO 2FPIA 4IDGA 4I9UA 1NPYA 1E1KA 2DUUA 3COSA 3JQAD 1IZ9A 1R4MA 2DT5A 4GGPA 4F3YA 4D44A 1BG6A 1DFIA 2X5JO 2PGJA 1UP6A 4E21A 1NYTA 3UCEA 1IB6A 1LC3A 1YE3A 5CPBA 4RV9A 3GGOA 4R4JA 5IZCA 4R16A 4BNWA 1MXHA 3PK0A 1P1FA 3LQFA 3RUFA 4R5HA 5JXWA 4PGFA 1DHTA 3FWZA 3AU8A 4Q3AA 3OP4A 5KWEA 3PIIA 4FJ1A 5A03A 1T4DA 3FNHA 3R3SA 3ROQA 5ICMA 2WYVA 3VTZA 4AFNA 2O4UX 1U8XX 1SC6A 1ZH8A 2RHCA 3DZGA 3GMSA 1NNUA 3GZ4A 1V35A 2HK9A 4NJMA 3ZHYA 1B2LA 1H2BA 2JCVA 1NWHA 2HO5A 4GKBA 3K30A 1ML3A 2B5WA 2EKPA 1YBMA 4M86A 4CMEA 3PRJA 1BXGB 3M2TA 1B8UA 3ETGA 3VPFA 2QRJA 2Q2QA 4IDAA 1PSDA 3DFUA 4MVJP 1FDSA 1TT5B 2HK8A 2VHXA 3DBHA 3GPDG 4DYDA 3K8ZA 4CM4B 3QHAA 3QWBA 1H6AA 4IQGA 1BW9A 2NACA 4WJZA 4EUHA 1VJ1A 3Q9UA 5A9SB 4I5GA 2VUUA 1L7DA 2DTEA 3NJ8A 3SEFA 1VSUA 4IXWA 4NJOA 3DBLA 4YAIA 1YWGO 2AA3A 4JX8A 2EERA 4E4YA 2WDZA 4FD3A 4ZRNA 1XQ6A 4CM3A 1T24A 4UEKA 5A05A 5KJCA 1WVGA 1QORA 3Q2KA 1KVRA 3AY6A 2ZCUA 3OIDA 2Q1SA 2B4TO 3OIFA 4U5QA 1NR1A 2ZTVA 5FWNA 3WIDA 2ZJ1A 3ZDFA 1FK8A 2GRAA 2HMWA 3S2FA 2W98A 1ZK1A 1Z74A 4PG4A 2OMEA 3U09A 2O50A 2RIRA 2C82A 3HZZA 3LK7A 3JQ7B 5MDHA 3ZU2A 1ARZA 1PJSA 1JTVA 2HMSA 1ADGA 1U5AA 2UDPA 3VZQA 5JAIA 2P4HX 2NADA 1C0LA 2W2LA 3VH4A 1FDUA 3JQGA 4E2YA 1N8KA 4AJLA 1U4OA 2E4AA 5DF1A 3E5MA 4TMFA 4UVGA 2P5UA 2Q4BA 3BMNB 3JYPA 1RM5A 4KQXA 3WGQA 1K2WA 2QQ5A 2HQ1A 3QVOA 3RUEA 4PLVA 1ZKMA 5HBRA 4E32A 4DPKA 5A02A 5KCZA 3RJ5A 4MPDA 2VWGA 2Q45A 4PVDA 5L9AA 4Z3KA 5DULA 1EE9A 3IS3A 4ZQGA 4RORA 4BNVA 2XXJA 5DBIA 1E6WA 1NHGA 3MOIA 1LDEA 1YH3A 1LLUA 2Q46A 3N74A 4OMUA 2IZ0A 4N5NA 5U1PA 3QP9A 1I33A 5KJFA 4NBVA 2VUSA 2YQ4A 1S6YA 1B8PA 3TF5A 5ILOA 1EDZA 2PZMA 4IS3A 3C85A 4HNGA 1XKQA 4KWIA 5COQA 2OZPA 2PKQP 1FF9A 4YVFA 2NSDA 4IS2A 3PJFA 4R9SA 2HK7A 4R68A 3KLMX 1XCBA 2AW5A 1ZW1A 1BTOA 4B79A 3FR8A 4BS9A 1B3RA 2X9VA 3I9OA 5IZ4A 2X5KO 1HZZA 4YTEA 3IQDB 2HDHA 1ZSNA 4XGIA 2FZEA 4TRMA 4BO4A 2HMTA 3GAFA 4JP3A 3RC9A 4RVUA 3N7UA 3KYBA 1B7GO 1GYRA 4G81A 4W4TA 5ER6A 4J0FA 3PZRA 1DIBA 3UH1A 5EIOA 5T8KA 3RROA 1A5ZA 1M75A 2D59A 2VRCD 4AJ1A 5DOVA 3HN7A 4NIMA 4ALMA 1G1AA 4W9NA 4BGVA 3U62A 4EEXA 1QRRA 1DAOA 2JD1A 2Y1FA 4QTZA 5CHEA 4GLLA 4XD2A 1R4NA 4BL5A 4YT4A 5L4NA 3E1KA 2Y68A 1ZSVA 4QT0A 5ES3A 3GZNA 4YJFB 4XQCA 3O9ZA 2V6FA 4J7XA 3H9EO 3Q9NA 5JO9A 2G0TA 3JD4A 1CJCA 1Z82A 2Q1TA 3H7AA 2Q99A 1YL7A 5JDCC 3HFSA 1HL3A 3NTOA 3GG9A 4PIVA 5A5EA 4JBHA 2J5QA 3GLQA 4E6PA 4CLOA 4L76A 1KVQA 5K0ZA 2ZTMA 4HKTA 5FF9A 3PHLA 3B1KA 5DZSA 3AI1A 1E77A 4AJ2A 1QLJA 1VLLA 4GVXA 5EJ2A 3TN7A 1O6ZA 4M8SA 5BR7A 4BNUA 1IOLA 1GAEO 1MC5A 2OUIA 1PL8A 4OH1A 4ALNA 3TZCA 2DAPA 2PNFA 4Q3EA 2D8AA 5HS4A 2ZATA 2AMFA 3H8VA 4KZPA 3TSCA 5LDHA 2O3UA 1P1RA 3INRA 1KEUA 1SO8A 2JKVA 2CUKA 4HXYA 1AXEA 1JQBA 4JJGA 4IUYA 1ZXBA 3KYDB 4PZDA 4F6CA 4CL3A 1Y1PA 4L75A 3S2IA 3NEPX 3WGYA 4FSHA 3IC5A 4B4WA 5I8WA 4AJPA 3O8QB 3HB4X 3RD5A 2Y1GA 4IMPA 1UJMA 4HNHA 5L3ZA 1K6JA 3LT4A 2AXQA 1HE5A 1P44A 2NU9A 2VHVA 3ASUA 2YQ5A 3JSAA 2I66A 3OJOA 2QYSA 1H0KA 4MOWA 4CLRA 3E03A 3AOGA 4BMSA 3FF4A 4FGWA 3ZI0A 2HSDA 3BHMA 5TS3A 3GNQA 3JQBC 1GYQA 1BHSA 3WIEA 3JQ6A 1UZLA 2GD1O 1A27A 5I9NA 4YAJA 4J1SA 4C7KA 2X4GA 3GR6A 1H2HA 4BMNA 1WXDA 3LC7O 4EW6A 4LRTB 3QRWA 2I6TA 1SOWA 4CLEA 1K0UA 2OFPA 3IP3A 3VPHA 2ZTUA 1JKFA 1HKUA 3D5TA 2HMUA 4GX5A 4MVJA 1PZEA 2DBVO 4FFLA 4NQZA 1WZEA 3GEMA 1VE9A 3G49A 2E48A 4O63O 4RJTA 5KOIA 1KOLA 5L7WA 5G0WA 2HRBA 3ANMA 3D64A 5LDGA 1C1DA 1G0NA 3WOHA 2CF6A 1G0OA 3MJCA 3PHIA 4HFJA 3RSHA 3KYCA 1HDOA 2GZ1A 1GU7A 1LQUA 1Q2XA 1Q7BA 5FYDA 3GAZA 1RM3A 3OJ0A 3WWYA 4CQMA 2P68A 2A4KA 3MEQA 5IDYA 3ABIA 1ISIA 2CDBA 1Z75A 5BT9A 2IXBA 1PX0A 2E82A 3IP1A 3KV3O 4R3NA 3UGKA 4BQPA 1CIVA 4GMFA 4OAQA 3OIGA 1N9GB 3RWBA 5H83A 1Z7BA 2POQX 2DTDA 4YAGA 3I83A 3JYLA 4FB5A 1C1XA 3WGGA 1LRJA 3GH3A 4R51A 4GGOA 4A0SA 1QXSA 4NG5A 5L53A 3EGOA 3RBZA 3JV7A 5A3JA 4GI2A 4G2NA 4W7HA 2V65A 3PTZA 1GQ2A 4ESOA 3VPSA 5T57A 2G76A 4GQAA 4KOAA 4HADA 4O0LA 1T26A 1PGPA 3GOHA 1UDBA 1LRLA 4R9RA 4HFMA 2OHXA 2VTDA 4FFNA 3V2UA 3WSVA 3AUUA 1PS0A 1BXZA 4CM6A 1T25A 4FIZA 3ZWPA 2DPGA 4YRDA 4BV8A 5ITVA 4MP3A 3DTYA 4TROA 5G4KB 2NNLD 3LVFO 4I5FA 3DHNA 1R16A 1U7HA 4YRAA 3W4KA 4RCVA 2ZQZA 3OQBA 2VHYA 1NQOA 1R66A 3BMCA 4BKQA 2OORA 3KSZO 4IJKA 4MVJI 5JCJA 2LDBA 2F00A 2P5YA 4PG7A 3JQBA 4LN1A 1YBVA 2B35A 2XPCA 2Y05A 4K28A 4BO1A 4DBZA 1O95A 5TGDA 5K6AA 4ITUA 2QW8A 1KC3A 5CDSA 3W8EA 5G0SA 1EK6A 2VOEA 3C7AA 3QJ5A 1JA9A 1Y81A 5T64A 3MZ0A 1P3DA 3CZRA 1QYDA 1RM4A 2D1YA 5JMPA 1I5RA 1P1IA 4NU6A 4D46A 5HTOA 1GTMA 4J9VA 3UAGA 4BO5A 1EUZA 1DFHA 3ZWMA 4RLHA 2NV6A 1JU9A 5ITWA 1CRWG 5AYVA 2AE1A 3TDKA 1DIRA 4XYMA 1H6BA 3FBTA 3KO8A 4XIYA 1P33A 3VAZA 5JLAA 5HM8A 2GN4A 5DP1A 2YHUA 3CMMA 4ZVVA 3GFGA 3KSUA 4J4BA 4R69A 3ITDA 1P0FA 3HB5X 3QWHA 2X0IA 4ZJUA 2YY7A 2C7VA 4XKJA 3F47A 4E3ZA 3ZWYA 3D3WB 3R3JA 4WCDA 2R6JA 5AXDA 3WJ7A 5HS6A 1Z6ZA 2I3GA 1R0SA 4EDFA 4D41A 4IINA 3H9QA 5FI5A 3RBVA 1I10A 2PZJA 4XYBA 3DOCA 2H1SA 4CMIA 3E18A 2OL4A 3A14A 2PWZA 4YJGA 1YGYA 4KUHA 3KLPX 4AICA 5JNLA 1NPTO 1FJHA 1H93A 4NBTA 4ZHSA 3GUYA 1UAGA 2HUNA 1ONNA 3WBFA 3PYMA 4PLTA 4Z0PA 1I3KA 2BFPA 5HA5A 3I3OA 1C14A 2C54A 2RBEA 1Y5RA 1R0KA 3JQ9A 3ONFA 1XSEA 4PG6A 5IN5A 4WLOA 1WWKA 1YL6A 4IDCA 1MLDA 1ENPA 3GG2A 1PJ4A 2W2LD 3ANLA 2ZK7A 3AU9A 3F4BA 2FR8A 3OHSX 1WNTA 4O5OA 5I9MA 2RH4A 4PLWA 3NX4A 3GQVA 2FSVA 5J23A 2C2XA 3AWDA 1OAAA 4DPMA 3H3FA 3LDHA 2J6IA 3HN2A 5AXAA 1I24A 2VNAA 3TRIA 3WG9A 4J0EA 1MXFA 4M87A 3DQPA 4OSPA 4Y6SA 2NU6A 2YV2A 3H2SA 4DBVO 1WDKA 2J8ZA 3WMWA 4IMRA 2VZ8A 5JYDA 1HSZA 3JYNA 4J4HA 3JQ8B 4PLZA 4XDZA 2J5RA 5JCXA 2EWMA 3D5QA 1ADCA 4BVAA 1ENYA 2YDXA 4CODB 2R00C 3NT2A 1DFGA 4WLEA 4QO7A 9LDTA 2VNSA 4BNLA 2X23A 3RBXA 3A28A 3AOEC 4D45A 2QG4A 3H2ZA 3HHPA 3IUSA 1U28A 3JQFC 3WYBA 2DBRA 3GEDA 5I7VA 1I8TA 4B8WA 2CSUA 1FDVA 1T4BA 1VPDA 1HDYA 2V6GA 1E5QA 3CINA 3F1LA 1LJ8A 1PGOA 2ILTA 4NFHA 2VYVD 4FOOA 1PJBA 4MIOA 4NBRA 3UVEA 4WPGA 4LVCA 3NTRA 4AG3A 5L7YA 4Y6PA 2GDZA 3FBGA 3V2GA 1ENZA 2PK3A 1K89A 1DRVA 3ZV5A 4RF2A 1NAIA 2YW9A 1SPXA 1ZCJA 4FR5A 4URFA 5JAQA 5CEJA 1OC4A 3DL2A 2G5CA 1ZK2A 1EUCA 4PLPA 4YB8A 3D7LA 2D5AA 5EESA 4BNJA 2WSBA 4CPDA 3ZCXA 1OC2A 1DIGA 1PGNA 2C07A 3LYLA 4DWVA 2C0CA 1O89A 3L6EA 3PFWO 2B83A 4KUEA 2X7HA 2TMDA 2UYYA 4CUJA 2NVWA 4YCAA 4RO0A 1LEHA 1IUKA 3FI9A 2HJRA 4XR9A 1ZVMA 2JD2A 3DB2A 3RKRA 1E3WB 2CDCA 3BYZA 1DC3A 4Q39A 4RPJA 4LSMA 5F3RA 1HDCA 2Q3EA 1XIVA 4W6ZA 2NWQA 2PLAA 4XGKA 2J3JA 2O48X 1BVRA 4UUOA 1E6UA 4WEOA 2CVOA 4WCFA 1YOVA 2C2YA 4RGBA 2J3HA 5TC4A 2HU2A 3JCZA 1K6IA 1C0IA 3IJRA 3IMFA 1M67A 4FFPA 1LDBA 3EC7A 3FNEA 3L0DA 1LSUA 5F5NA 4FDAA 1E0DA 4XR4A 2Q2VA 1FXSA 1IULA 4NFYA 1IHXA 3S55A 1WDMA 2PFGA 5IN4A 1D8AA 1V3VA 4LSWA 2HRZA 3X2EA 1EVIA 3WQRA 4E33A 3QY9A 3BMOA 4K26A 1R12A 1PTJA 2CDAA 4M1QA 1M2WA 4ZQHA 3GDGA 4UEOA 1VSVA 1A4IA 1QKIA 3OJFA 3TQHA 4YYZA 5CDGA 3RUDA 3VPGA 4EBFA 5KKCA 2NLOA 2WEKA 4ZQEA 3SC4A 4BNKA 5CAEA 3BIOA 1NFRA 2C5EA 2NVUA 1B16A 3NGXA 1UDAA 2JD0A 4Z9XA 3H5AA 2OO5A 3I9KA 3I5MA 3C1TA 2WE7A 2EHDA 3ZW8A 3UUWA 3SXPA 3HJAA 1T1RA 4LMRA 3HDYA 3TFOA 2W2KA 4J2OA 4YQZA 2QRLA 2DPHA 3BAZA 2X8LA 1LA2A 4N54A 4CM8A 3KXDA 5B12A 2X22A 1ADBA 5HWSA 3AI3A 1U5CA 4OYRA 4NJMB 3MTJA 1UR5A 2YZ7A 3LU1A 4IJVA 4E5NA 1A7KA 4I1IA 3KUXA 4MP8A 3GVCA 1SMKA 3PDUA 5IDXA 1N1EA 3VZPA 2Y1CA 1LSJA 1KVSA 1UH5A 4PLGA 4ND4A 4MVJD 5B4VA 3B6ZA 3BTUA 3CUKA 4BO0A 3WTCA 2V6MA 1I2ZA 4YA6A 1PU2A 2YV1A 3BXXA 3ZWXA 1I3MA 1X7GA 4YAKA 4TSKA 1T2CA 1XDWA 3VTFA 4RVSA 1XQ1A 3GEGA 3QVWA 2DC1A 1LLQA 4P4NA 3I9MA 2QRKA 3VVCA 2VOJA 4KMSA 4OOEA 5BNTA 1NP3A 4PLCA 5IDQA 9LDBA 2QHXA 1BW9B 2VTEA 4YACA 4IGEA 1AHHA 4B3IA 1E7QA 3C7CB 3EZYA 4DPLA 3MOGA 1ZEJA 3Q3CA 3H9JA 3DOOA 3DBLB 2I67A 3EMKA 3PVZA 1R6DA 2QYTA 4HUJA 4OKIA 4EUFA 4XGNA 3UHAA 2EP5A 4UAGA 1ISGA 1KS9A 1MGOA 2I5PO 1CDOA 4ND1A 3JD3A 3W6ZA 3FRJA 3PLRA 4IDFA 4R41A 5JDIC 3M6IA 8LDHA 1Y8RA 3WDSA 4WGGA 1BXGA 4I9NA 2DLDA 4D43A 3FD8A 2PD6A 3OSUA 3RC2A 4EEZA 4QECA 1W73A 1TT5A 3INTA 5AVOA 3RFTA 4U0KA 1NQTA 2RCYA 2WD8A 3QWFA 2NU7A 5IAAA 4FPXA 5C7OO 3D1LA 2JAHA 4HFRA 2YDYA 4BNHA 3VDRA 3AM4A 4FCCA 3L6DA 4C7JA 1V6AA 2DVMA 2X6TA 3FPCA 1GUYA 3JQGB 2AEMA 3PQDA 1PEDA 1DDOA 1TEHA 3ZU3A 4N5LA 3QVXA 5CP8A 2C7GA 1HETA 3U49A 1KETA 2B4QA 4NHEA 2QIOA 5H81A 2FN7A 1VM6A 2GYYA 3CTMA 1M6WA 1KC1A 4LCJA 2BGKA 5DCYA 3Q1LA 1JWAB 4XYEA 4KDEA 3NRCA 4CMCA 3JD2A 4Q9NA 4R1SA 3IDSA 5GZ3A 3IAHA 4OHUA 1EQ2A 3AY7A 1DLJA 4NBWA 4OIMA 4I9HA 3SC6A 3U4DA 1QR6A 1XGKA 3AUSA 1TT7A 4FFMA 4EUEA 3T4EA 2BFAA 4MVJE 4A26A 4Y8VA 4TWRA 3RVDA 3M1LA 1TLTA 1JN0A 4YJHA 3V2HA 2JFHA 1JAYA 4IIVA 4PRKA 1E7MA 1X7HA 4ILKA 5IDWA 1EFKA 2CZCA 3E6AA 4XX0A 1VRWA 2ZB7A 1JDJA 2AE2A 4YT2A 4BB5A 3KB6A 5F1KA 2NTVA 4FJ0A 1E6EA 2PH5A 1C0KA 2A35A 2HCTA 4MINA 3K96A 3LLVA 4J49A 1T2DA 3KEOA 4W7IA 1D7OA 1DSSG 3AM5A 4BKPA 2PR2A 2BRUA 2QZ9A 2CVQA 3WSWA 3UKOA 3E82A 3BHIA 1N92A 1Y9EA 5AXCA 3FPLA 5IG2A 3I1JA 2NU8A 2CD9A 2HLPA 2NQ8A 4MKXA 3DBRA 1W6UA 5TX7A 1R4NB 3AK4A 2QZZA 3CZMA 3TOXA 1SCUA 2IYOA 1A9ZA 5G0TA 3VH1A 3GZNB 2ZYGA 3WS7A 3GNSA 2GZ2A 1LSSA 2A92A 4KUGA 1DC4A 2B36A 3I23A 4CMGA 4CUZA 3E9NA 4LGVA 1MX3A 3NDIA 3O03A 2AG5A 4XJSA 3R6DA 5H82A 1WMBA 1TB4A 4BNXA 3M1AA 3DTTA 3NV9A 1DRWA 3U3XA 3VDQA 1ISMA 4WOJA 1BGVA 4G65A 1GCUA 3DAPA 5JC8A 1NFFA 4GH5A 4Q3DA 4CLOB 3LF1A 2GN9A 4XB2A 4OQZA 4RLSA 3DZFA 4TVBA 4GX2A 4HFNA 3FTPA 4ND2A 2EIHA 4FJ2A 2BF7A 1F06A 3OEWA 1CYDA 1YB4A 2FPGA 1WAMA 1B8VA 4CM7A 3WGZA 1P77A 4D3SA 1DJNA 1VJ0A 3ADOA 4YJFA 1OBFO 4WEQA 1P1KA 2YHIB 1GEGA 1VKNA 2P2SA 1BDBA 4NNJA 1EVYA 4PZEA 4IGFA 3GHYA 1K6XA 3RI3A 2ZTLA 4XRGA 2Y1EA 4WK6A 3RKUA 1N7GA 4GWGA 2EXXA 4U6QA 5JY1A 3T7EA 4RVHA 4OXNA 4BO9A 4KQWA 4E12A 4FC7A 3PWSA 1Y8QA 2BHLA 3WFJA 3AY3A 2ET6A 2Q50A 1U3VA 4CM5A 3ZV6A 3WGTA 3UW3A 1JKIA 5B4TA 3O4RA 4F46A 4QUKA 3PGXA 2GCGA 3H5RA 4O1MA 1QYXA 2GR9A 4LK3A 4CQLA 2NTNA 3OMLA 3OA0A 1V3TA 3I9NA 2HAEA 4AJ4A 2O3SA 4TKMA 3P2OA 2DFDA 1B3BA 4FFRA 5A1TA 3GHHA 4GAEA 1XG5A 5KTKA 3K2BA 3U4HA 3ZWNA 1U3UA 3LC1O 4IQ0A 1HDRA 4HV4A 3ZH2A 3TZHA 1BXKA 2C29D 1KYQA 3A9WA 1EVJA 4JJIA 5KNLA 3U0BA 3JQAA 5DP2A 1X1TA 3K31A 3L4BC 1FDTA 3PZBA 3UF0A 1EFLA 2VHZA 1XU9A 4DXHA 5IXYA 3KEQA 5CDYA 1HDXA 2AEJA 3CKYA 4RPGA 3RCBA 3E9QA 2IEDA 3PFFA 3RC7A 3EK2A 1C1DB 1CQIA 1J4AA 1N7HA 3B70A 1W8DA 3H9GA 5ILGA 1MA0A 2PKRA 3KYCB 4JROA 2UAGA 4X54A 5GZ1A 3KRTA 2E49A 1NR7A 5GMOA 3W1VA 4EJ6A 2ZYAA 2YFQA 1ZMOA 4I5EA 1E3JA 1I3NA 1YONA 3V1TC 4M54A 3ZNNA 2C59A 3EY4A 3W4IA 3SLGA 1MV8A 2ZYDA 1HDGO 3M2PA 2Q49A 3L77A 5HRUA 4Z0HO 4ZU3A 3ADPA 3ZZNA 2H5LA 2VYNA 5JDCA 1Z7EA 4ZRMA 1C1XB 3MJVA 4IZHA 4Y67A 4MVJM 3DZIA 4YWJA 3RFXA 1QG6A 1X0XA 4U6SA 4WE3A 5G0UA 1NVTA 2NVBA 3INGA 4MIEA 4Y9DA 2O3QA 2VN8A 3AFNA 1KEPA 4CLXA 2FZWA 1FMCA 3SLKA 4NBUA 3ZWAA 4ZGWA 3F5QA 1XYGA 4TRRA 2EP7A 4PZCA 2Y1OA 1O8CA 4NI5A 2X86A 3OFSA 3TWOA 5G2OA 4BNFA 4Z6KA 2ZJ0A 4UUMA 2WYUA 3C3XA 1OZAA 4ZN6A 4IJWA 1D4FA 2P9GA 3F4LA 1NAHA 4FGSA 5I9LA 3JD1A 4XA8A 1ZSYA 2IEBA 4LMPA 3NYWA 1LUAA 2G17A 3CEAA 4E5KA 3BMCB 3KVOA 1D1TA 2I3AA 3PGJA 3NT4A 3P7MA 3S2GA 1HE3A 4G5HA 1YL5A 1YVEI 3ZWWA 4DREA 4BOYA 4OXYA 4U7WA 4WUVA 1A71A 3ZV3A 4K1LA 2DQ4A 4DLBA 3ZV4A 4J6FA 5EQDA 1DBVO 4IDEA 2P91A 1EUDA 1H6CA 3VZSA 3F9IA 2Y99A 4OSOA 1RKXA 3B1FA 3LZ6A 3MJTA 1T2EA 4GMGA 5EINA 3MJSA 3TZQA 1PR3A 3NDJA 4XQGA 4WLUA 3ETDA 1RYDA 1E5LA 1M76A 2ZB3A 2DM6A 4BGUA 1K3TA 5THKA 1K5HA 4JK3A 1O9BA 7MDHA 4YDRA 1UDCA 3QVTA 4CJXA 2Z1NA 3EYWA 3EW7A 2QX7A 1MG5A 5COBA 1GDHA 3AW9A 4O59O 3NAQA 1DC6A 1GQYA 1ULSA 3SBOA 1JW9B 3N58A 1NBOA 4LRSB 4AJKA 1U1IA 3OJEA 2X0JA 4E2ZA 1BWSA 3QV1A 4XJTA 5A5FA 4H3VA 2WD7B 1IYZA 3L6OO 4JJFA 1OMOA 4Y98A 3DEYX 3ZNOA 5K9ZA 1HYHA 4MKRA 3OICA 3TZKA 4E31A 2EG9A 4N7RA 1BVUA 2YYYA 3L9XA 4J43A 4CMIB 2F1KA 2VWQA 4YJGB 3DMTC 4P4LA 5BSEA 7ADHA 2Q2WA 3WICA 1YKFA 3FWNA 4K9DA 1BSVA 2VRBA 3CMCO 1GADO 3HNPA 4NZ9A 3T4XA 3VKVA 3WNVA 4JCOA 3V8BA 1HXHA 1I3LA 3CPSA 3QE3A 1B26A 3WGHA 4ROSA 1WW8A 4YJDA 4Z9YA 5ADHA 1Y6JA 4ND3A 1HRDA 1ZK4A 1ZXLA 3LC2O 1YQXA 2PD4A 2D2IA 2JCXA 5EMHA 1L1FA 4DIOA 4P38A 3RIHA 1LNQA 2EKQA 4MP6A 5F1PA 3SJ7A 4CR8A 4CM1A 1Z73A 1B0AA 3MWDB 4BO2A 3G0OA 5KJ6A 3D3WA 3PQFA 4GWKA 4HWKA 2BI8A 4NPCA 2XOXA 4DTIA 3ROPA 4ND5A 2AG8A 4ZICA 3JD0A 2CMDA 5CPFA 4EJ0A 1V3UA 5JYEA 2Q1UA 1EZ4A 1I0ZA 1E3IA 2X58A 4BKRA 2BMAA 3E9MA 3QVSA 1LC0A 4II2A 4DIFA 3IL2A 2O23A 3K2EA 4NR0A 2VT2A 2GGSA 3AUAA 4BNMA 4EYEA 3V1YA 1J6UA 2O3TA 4RL6A 4Z0TA 2O3RA 4RQTA 3KTDA 3GN1A 4BO6A 1KEVA 3BMQA 3HDJA 2E37A 5DCWA 1MC4A 3I9JA 2IODA 1T2FA 3DONA 3NTQA 1F12A 4EJMA 1H9AA 4MDHA 3ON5A 1P74A 3LT2A 3I52A 4NH4A 2PZKA 4JXKA 1HLPA 1LI4A 2Z95A 2AQIA 4LW8A 1GZ6A 4WASA 3ICCA 1KY4A 4D42A 4XRRA 3VKUA 3WB9A 1Q0QA 1TXGA 1WMAA 3T7CA 4NFSA 4ZD6A 1HT0A 5JPIA 5IF3A 4WLNA 5DDIP 3K9QO 5T6BA 3RUIA 1JWBB 4XCVA 1EBUA 2OXIA 2BGMA 5KVCA 1NM5A 1PZHA 4RDIA 2VZ0A 4IQ8A 3QA9A 1AUPA 5LCXA 3A4VA 1PQUA 2B69A 1QP8A 3OH8A 3UFXA 4NK5A 3Q2IA 3BHJA 3NJ4A 1TA4A 3VH3A 4PFJA 1U9JA 4TVOA 4XYGA 5G0VA 3AFMA 2GNAA 4CV3A 1P9LA 4L4XA 5IZCC 5AOVA 3R0IA 4HP8A 1KY5A 1DLIA 1LDMA 1HE4A 1GCOA 4RVGA 3MCVA 3C24A 4BKUA 5BNFA 4IJUA 3AUTA 3ZW9A 2Z5LA 3KETA 3NKLA 4BV9A 1PL6A 1XHLA 3S2EA 1IPFA 4FBGA 4DLLA 5BSGA 2ZCVA 4XYLA 3DDNA 4ALKA 3OF2A 1VL6A 3QWIA 4J91A 3WGOA 4WCFB 3GDOA 2TMGA 5ENVA 3LT1A 5EERA 4B8ZA 1HDZA 1N5DA 1HYEA 4CMEC 3V5NA 4O6VA 1LDGA 4QX6A 2BELA 2Y0CA 1E92A 3AM3A 1LSOA 4ZA2A 3O38A 3PLNA 4J3FA 4BGEA 1GL3A 3Q6IA 5TT0A 1MB4A 4DYVA 4TKLA 2JHGA 1XA0A 3HADA 1ORRA 1E3WA 2BFOA 5DN9A 3D3EA 2I76A 2FY8A 1PR9A 4RDHA 4E13A 4FFOA 4BB6A 1S7CA 4FW8A 1P1JA 1NX6A 3EAGA 3FCOA 3TNLA 4OO3A 4BNGA 4DL9A 3BMOB 2GLXA 1YQGA 3BA1A 3HDQA 5A9TA 1B14A 3VOSA 1I2CA 3WNQA 1A72A 2X0NA 5BQFA 1ZUD1 3GMDA 2WM3A 1UZNA 1T2AA 2EGGA 2DU8A 4E0BA 4YPOA 4INAA 4HBGA 2VQ3A 4RVDA 4II3A 1HE2A 1EVZA 5JBIA 1ULUA 2R00A 5DOZA 3UN1A 1DRUA 2EJVA 4YXFA 2GUGA 2NVUB 3ITKA 1QYCA 5AXBA 3AOEA 4LCEA 3I4FA 3D4OA 4JBIA 1R4MB 3DHEA 4M55A 1UXKA 1F8FA 2X5OA 4AJOA 2FRDA 1AHIA 4FOSA 3A06A 2W2KB 3JQFA 1PJ3A 1MFZA 2CF5A 4E2XA 1OFGA 2P9CA 4UVIA 3I6IA 4D79A 1UUFA 2V7PA 5A06A 1SZJG 1DJQA 3IKVA 5L51A 1XELA 5L45A 3V1UA 3BZUA 1V9LA 4Q3CA 1I36A 1YXMA 2HJSA 4E5PA 1Y9AA 1Q0LA 2O7QA 4U0JA 3FN4A 3K73O 2PZLA 4R5MA 2VT3A 3W4JA 3OETA 4L4SA 4BNTA 1GZ3A 4DMLA 2BFMA 2Y0EA 3PP8A 4KP7A 1KBZA 2JFFA 4OQYA 1DXYA 2GPTA 3DBHB 1IL0A 1X13A 1VC2A 3WYCA 2WMDA 3JYOA 1FDWA 1J49A 4B7XA 4TZTA 3MWEB 5EPOA 2PH3A 2VWPA 3ORFA 2JFGA 3PPIA 4JLWA 4DGSA 1O0SA 3W8DA 3OQ1A 3DMYA 2H6EA 1ISFA 4CQMD 5BNIA 2O7SA 5DT9A 3ZHXA 5A9RA 3E5RA 4ZQFA 1Y8RB 2I99A 1R15A 1I01A 3HUDA 4DQVA 2VYND 2CFCA 1GYPA 4YEDA 3ASVA 4A10A 3PWKA 2PTGA 4ALLA 4GSKA 4ALIA 4FS3A 5KVVA 2H9IA 1BDMA 4E5MA 1ZFNA 4NU5A 4JP2A 5TNXA 2VWHA 1E1LA 4CM4A 5DCUA 2IRWA 4XIJA 1E1NA 1UXHA 4UVHA 6LDHA 4IZIA 5T8KC 3DOJA 3FNGA 1QLHA 2FSSA 5A9SA 2X9NA 3LT0A 4DRYA 1WDLA 1ZJZA 3DZJA 3C1AA 2OGUA 4BNZA 1LQTA 4YR9A 4W9NC 3MTGA 3RU7A 1H9BA 2JHFA 1SEVA 1I32A 1YDEA 3H4VA 3DFZA 8ADHA 2EF1A 3PXXA 5JS6A 4CUKA 3ETEA 1XWFA 2ZKLA 4IY1A 5A3VA 4BKOA 1ZJYA 1NVMB 2I9PA 1P45A 1OI7A 1ZK0A 2WWRA 2D4AA 1CEQA 3TZ6A 4AJNA 4PLFA 3GVXA 4J7CA 4OKNA 1DPGA 4IM7A 2O2YA 4KTTE 4CV0A 1VKOA 1UP4A 1AE1A 2EGHA 2PA3A 2PGLA 3R1IA 3TL3A 3JQ7A 5JCJD 1DAPA 1M6HA 3PJGA 4P4GA 4BIIA 5F21A 1U4SA 3G1TA 4J4TA 1GZ4A 2WYWA 1HYGA 3C8MA 1MFPA 1DIAA 3VC7A 2DTXA 5JO0A 5EL0A 3RC1A 3WQSB 4MIYA 3LLSA 3BMNA 1RPNA 3DBVO 4YJHB 1B15A 5EN4A 4JGBA 3B1JA 1V0JA 3PYXA 1N1GA 4NDNE 1W0CA 1Y5MA 4XQ9A 3WJAA 4MVJF 3RJ9A 3LSYA 5JAZA 1AN9A 2Y0DA 3KSDO 4GBJA 4OL9A 4UUPA 4EGFA 4A7PA 5DNAA 3PIDA 2J5KA 4W82A 4RPHA 1PIWA 5THQA 1LLDA 2NQTA 1PJLA 5KKAA 2D5CA 4KWHA 4B3HA 1J5PA 2D3TA 2FPPA 1RYEA 2CVZA 5L40A 1X15A 2O4CA 1QV7A 1ISHA 1KERA 3FR7A 4KTVE 2WTBA 5A4DA 4TRNA 1JVSA 2GZ3A
chains in the Genus database with same CATH superfamily
2QTVB 1P7CA 3VPBA 4YECA 3FNIA 3P20A 5JD5A 3DBRB 5CR9A 2OBNA 4CG2A 2I6UA 3G79A 4J7UA 4O1HA 3SVZA 2PRIA 2Q8PA 1VIDA 3W2HA 2GFHA 1OV4A 2FEKA 2X9GA 3M9LA 2J5BA 2HWUA 5KAPA 3WISA 5JDIA 2I03A 1U3CA 4DLSA 5I7SA 1WUYA 3F1KA 2GF2A 4NYIR 4P5EA 3BCHA 3I8OA 3UNXA 3VISA 1N57A 2AQ8A 4OHXA 4I81A 5FV7A 4C3OB 1HFEL 1YS4A 4ZT3A 3AF6A 1T4GA 2I65A 4F3CA 3KYIB 2VPPA 4JUIA 4B81A 1GQRA 3FTCA 4ER3A 1ZQ1A 5JY6A 3LBIA 1T36B 2W8BA 2O2GA 3UBMA 3VVBA 3PJEA 2JI8A 3B20A 3I5AA 4DEYA 5EGNA 1P4GA 1FFDA 2VAMA 3UMFA 4BGIA 2W2MA 1MC1A 2XWPA 1W4AA 3Q8MA 5IEBA 1GPJA 5A04A 4HF7A 1CUZA 1OFIA 1P2VA 1PWZA 1UZAA 4B76A 5TS2A 3Q98A 1WMEA 3T7KA 2Y8EA 1UBGA 1W1IA 5DYNA 1ZLYA 1RKVA 3P4XA 3DLTA 3SDZA 1EGVB 4ME6A 5H5JA 1BYIA 2P9ZA 2MYPA 4NQRA 3RVSA 1RJ9A 4DLXA 5C8ZA 2YNMA 3VNRA 1THMA 4KWEA 3WR5A 4E30A 1Z7GA 4IXTA 3Q11A 4UBIA 5ALVA 4Z86A 2O0KA 3PGMA 5GONF 4HGRA 5WRFA 3O84A 3PNPA 1FFAA 1SEPA 1YVDA 4F9EA 4N3NA 5JG7A 4EG6A 2HA3A 4WWHA 3TGWA 3ZPXA 4M8IA 5EIEA 2FWNA 1NP6A 2G67A 3BUSA 2Z83A 2RAVA 3LG2A 4KLCA 4X1KA 1KDOA 2G9RA 4MW1A 1HOTA 1JI0A 2VP6A 2OGSA 1F2DA 1K9SA 1JF8A 2JS7A 2B1RA 1IOZA 3HQ4O 4IIJF 3UOAB 5HOEA 4WNIA 2F8TA 3R9XB 2FQXA 5JFOA 3UQZA 2WK1A 1L5RA 1H4TA 2XJ4A 3H8WA 3MGCA 3MT0A 4YMSA 3DB1A 5AK6A 2M9MA 1QS0B 2W4MA 3A2MA 4UATA 5JZMA 1XR3A 4EI2A 3IP5A 4F6RA 5JMTA 3F6YA 4PX3A 5MHTA 3UMBA 4TYNA 3PYLA 3WRYA 2AQHA 1TK9A 4YRSA 5FNZA 1OXBB 4UHCA 2PL1A 2Q6IA 4L28A 1IPEA 3NHRA 1P2TA 1Z2DA 4D92A 1FYFA 3AKYA 3EH2A 3K0KA 4CLRB 1QKJA 4BQQA 2AD1A 1P81A 1XRPA 1SC4A 1DHRA 3CPJB 4OP1A 3VR3A 1VPTA 3Q0EA 1ZUIA 1QIKA 2Q9UA 1BWRA 1BYUA 2AEFA 2R6R1 2X6RA 3H65A 3F6SA 3OM0A 4IOKA 4B4VA 5IPFA 3TFWA 4C7OA 1T3SA 3T9EA 1I2BA 1MDFA 2G63A 3Q2OA 2FMUA 4HGPA 4FD2A 4RCYA 4NBLA 4W8GA 4B7CA 2LKCA 3KYDA 3FIJA 3MWLA 3N2GB 2G1UA 1BOFA 1FZQA 2IQIA 2QMZA 1H94A 3C6KA 3OC0A 4DMHA 4E51A 1WBDA 4Z3DA 1WZIA 3IIMA 1GJRA 4KO8A 3STHA 3JATB 5IM4F 1V8FA 3JQAB 3HK2A 3QBDA 2Y93A 5ENZA 3HLTA 5C32A 4WY2A 3ISJA 3O8QA 2XXBA 3B1VA 1MC8A 3WP0A 4WAUA 4KBYA 1VMEA 4H4DA 3QLJA 2FYTA 1HEUA 2O8FB 1X1CA 3EQ9A 3WQQA 5JECA 3L8DA 4B43A 4FFWA 2WF8A 3GMTA 4G5SA 4KFCA 4ID9A 4C5CA 3AIKA 4DV5B 4WDQA 4IO1A 5CLFA 4P22A 2Y1DA 3A9CA 3HS3A 1HQYE 2IYWA 3BGVA 3WL8A 3FGPA 1JQLB 1BKYA 1ZP6A 2BFEA 5TEWA 4QQFA 2HKIA 1QWSA 4D9JA 1ND5A 1CJKC 2X8WA 1F0KA 2B3TA 3S1AA 1G7CA 3DDUA 2PMDA 2C4TA 4PQYA 4YMUA 3PR1A 1LFDB 1G55A 1R0YA 1LBTA 2WG0A 3IBSA 4WOKA 5EJMA 4AJHA 4DSUA 5JC1A 1JUDA 2R7KA 2WTXA 1Z45A 1E7RA 1EB8A 1YBHA 2FWPA 2PFSA 3L05A 2ZRCA 4M1EA 3C3BA 4WW0A 2ORWA 1E4OA 4CDNA 1ZNQO 3JS5A 4OJNA 2GZSA 3PNOA 1XDSA 3ANNA 3G0IA 1Y3BE 2O6LA 3L01A 5C8VA 2P40A 4EJSB 2YRXA 4LWPA 3BFVA 2V1XA 5MGBA 3RNLA 3JYQA 3NR2A 2HHHB 2IOQA 2YS6A 2W8ZA 4U8HA 3FPEA 5E6SB 5K0CA 1WP4A 3ICEA 1UEJA 5H7XA 2WUDA 1U2PA 5FA5A 4ZFNA 1UXIA 5BUCA 1KIMA 1JAZA 3H5NA 1VGRA 3DL0A 4I50A 1IRXA 3FZQA 1NFQA 1HTBA 1MV5A 5HF6A 1S1MA 1W5SA 3ENVA 3G6WA 5AHOA 1X7ZB 3ZBQA 1H2FA 1QIEA 1L5ZA 2B37A 2QSZA 3N6RA 1EK1A 1B42A 3RVBA 4JI0B 3A3NA 1FS5A 2WNSA 2QPAA 3A9SA 3LQKA 3O83A 3AR4A 4F93B 3F8TA 1IG3A 2ERXA 2IHZA 1TFUA 2EVWX 2GTHA 3UAWA 4BNYA 1LB1B 3GIDA 1Y48E 2IYSA 2B7CA 1BS1A 5H3LA 3A32A 4LISA 1UJ5A 1PJ8A 2YWCA 3TL2A 3AEKB 2YVLA 4QO8A 1KWKA 3EZ6A 1MJHA 4PO9A 4P36A 1NTRA 4PR0A 1P31A 1N0HA 4JL6A 1ZEMA 1G21E 1CQXA 4XVQA 1PEYA 4R9NA 1XFDA 4HWGA 4MKHA 1CF4A 4CE6A 4LOJA 3DZKA 1I7SB 5D3QA 5GPBA 4AJJA 4LRWA 2C4KA 3E3MA 4XDYA 1VPVA 1EFPB 2OOSA 3C16C 5GOTA 3ZWDA 4RSRA 5I01A 5JU6A 5JLJA 1JTEA 4I3HA 1ZIDA 3I58A 4RVCA 4N76A 4YBRA 1ZAYA 4DIKA 1FLDA 4GFDA 4PYIA 3D8SA 1RAEA 1BRMA 2R2GA 2QL7A 2IOYA 4RFSB 3DAGA 3UJCA 3ZXYA 1NXXA 5L4LA 1Y7IA 1C4WA 4DAOA 5HNKA 8OHMA 3TBFA 5G4KA 4I55A 5JRDS 4TT3A 5EPEA 1DAMA 1AS0A 3S28A 4MQ5A 2G0AA 4BFCA 1UXJA 4M60A 1V71A 4HDQB 1W48A 1NSFA 2G06A 1TE2A 2XDWA 5I7WA 1QTRA 5KQGA 3ZN2A 4PAOA 1GRQA 3L8YA 1H4SA 4UQPA 1GKKA 4KODA 1T6NA 3OECA 1RXVA 1ESDA 4R40A 4HX5A 1MEJA 5TPZA 3V80A 3EVTA 1UDWA 2WVGA 3ABSB 3NPMA 3CZ9A 2QI9C 4K6CA 5IK2A 2AL7A 1XE3A 2IE0A 1G8SA 3N0VA 1RC8A 4Y2HA 3OPQA 3KD3A 3X1XA 4CIAA 4P58A 1MUUA 5FNVA 5AIBA 1GGKA 1VKJA 3EZ9A 4AQYB 4CR7A 3PWZA 4XPZA 1JFFA 1W30A 2JA1A 1XMQB 3OA2A 4NICA 5T4EA 2B2NA 4P6VF 4AECA 5JMOA 3SOZA 1QTQA 1NASA 2OVFA 1DV1A 1TD1A 3O8DA 1Y5IA 5E9JA 4ZCLA 5LOVB 3IKTA 1OFTA 2Q8QA 3RUCA 1GHTA 4C76A 4MGKR 1MB9A 5BQ5A 4LUCA 3PEVA 3OKPA 4DCJA 1BJKA 1BQ3A 2YV4A 1QH0A 2OHGA 2VCEA 1V1MB 1SB8A 2F1IA 1VI6A 3ND7A 5FL3A 3RKSA 4HWSA 3PDJA 4J2HA 2DFTA 3IVGA 5FWYA 4IHKA 1UBJS 4D3ZA 2Z98A 2TYSB 1A7AA 1PS8A 1F1BA 3BIWA 3H84A 4QSMA 4Z1MD 1A1SA 2DFPA 2PL5A 4MPTA 4YRBA 2VTBB 1SAYA 1UJNA 4MS1A 3M81A 1E2FA 3FUUA 3SVTA 3COJA 4CNQA 1E3LA 1N0VC 3RU9A 5KJ1A 3EDRA 3OZSA 4CMKA 4CEIB 2R85A 1YAHA 2REXB 3I4CA 1XZGA 3K5WA 3M6AA 2XVZA 1PJQA 1XU4A 3CWQA 4QU0A 1KDVA 1M2GA 1NHWA 4YV7A 3S4YA 3WGIA 4MKZA 4UVEA 5KDLA 4EENA 5BSWA 5ALUA 1GILA 1SU6A 1Y1QA 4QKQA 4BLOA 3RFVA 2F8MA 4B6JA 4BE7B 4XB1A 5CG1A 2BAGA 4P8RA 5DI3A 3GQBB 5HCNA 4C14A 1EX7A 2E5FA 3WRXA 1PR5A 4ITVA 3OIWA 3ESBA 1AB6A 5COAA 2XUZA 4E70A 2AG0A 5T41A 1N9ZA 2AXNA 4CR6A 3OO0A 3WMGA 2IITA 4OQNA 4HEA1 5C37A 1TKRA 1YD7A 1ZPDA 5K20A 2X4IA 1EP2B 4WCFC 1HPLA 3D43A 1C2YA 1RQRA 2REOA 1E9FA 1AA6A 1GV0A 1VIAA 1KP3A 1IAQA 1TU3A 1O5TA 1CWUA 3FHLA 1YIOA 2ZB4A 3R5FA 3MWDA 4N7BA 5B58T 1QB8A 3L02A 2ZRQA 2D0IA 2XYVA 3GJ6A 2CFSA 3ROMA 4ZOLA 4IHJF 4J0CA 4UNRA 3PENA 3TAXA 3V7FA 3L6BA 4IIFA 1RWQA 4ZQIA 2BV3A 3KEMA 2M6LA 3DVAA 4MMXB 3BTSA 4EFKA 1V26A 1QM5A 1QRTA 2UXBB 3FTQA 2ZT7A 2IT1A 4M1KA 4Y2JA 3NANA 3NGLA 1NW8A 3MCUA 2ZE8A 1K8RA 2PXAA 3WHKA 3LXUX 4MHSA 3WLSA 1TTHA 1MVOA 2BF4A 3D4PA 3QXGA 3E1SA 3D7KA 3I8SA 1AKWA 1Z15A 4K46A 1ORIA 2FQWA 1PTJC 3E8MA 3UCXA 3T3MB 4JEIA 4KI7A 3JQ8A 3HWX1 1WLYA 4KVFA 3GNLA 4RC9A 4NCNA 3UQYS 4DHEA 4YRMA 4FEYA 1YQWA 2Q1YA 4O4LF 5G4LA 3HWRA 2R84A 1JYFA 3EVNA 1URPA 3A4LA 3TOSA 1RJWA 1XTTA 4PZYA 3FWPA 3MJEA 1QQ5A 2ZUUA 1J8FA 4N0QA 3SJUA 3R74A 3U5TA 4B6SA 4FLFA 3J7AC 2YXBA 1EUCB 3I05A 3K5IA 1LBEA 2B4RO 4TTIA 4WKOA 3IURA 2VA8A 3M70A 4F86A 3F71A 3U1BA 4H7DA 1FW8A 1TIKA 5DASA 3ZTYA 1YDWA 2QZPA 2WYOA 1KVTA 2DWPA 5KYXA 4FE7A 4EW3A 4AJEA 4CCYA 4NOJA 2JLWA 4HDNA 2PYDA 1W76A 3EEYA 2VEOA 1E7WA 1R3DA 1T8YA 2IKSA 3WVNA 5HFJA 1RQNA 2W9XA 1YB5A 3G2KA 4FFBA 4TXHA 4H16A 4B4DA 5JAOA 2PJRA 1PNOA 3CRNA 4JP8A 4BFYA 1ZM3A 2XMDA 3DL4A 3T9DA 5BMVB 4BVJA 4EOGA 5CFZA 1YOVB 2PAFA 5IXSA 2PWBA 2F2TA 4PYKA 1E0KA 4RIGA 4OJTA 2WE8A 3A31A 3HABA 5I9SA 3KXPA 3TLZA 2B8JA 5B4UA 3SM3A 3RV4A 4Z0NA 1LRKA 3DXFA 1G6OA 3HKEB 3PX3A 1PVVA 2QD5A 3ACBA 4I08A 1OBVA 1V43A 4MV6A 4DIBA 9MHTA 1IVNA 1QCCA 3V4ZA 1DO8A 4CWAA 4BLSA 5HVNA 4JMPA 3LUPA 4D7AA 4LEIA 2NTJA 3ED5A 2J4CA 2PL9A 2YNMD 3FYHA 4KDFA 3UJ8A 3WK4A 1G7SA 6ADHA 1FQOA 3T12A 4OAPA 2Q6KA 3FVRA 1IE3A 1HURA 3W6UA 2AFIB 2XXAA 1L4GA 5CCXA 1QP4A 3F3SA 2XUGA 2ZJ3A 3THWB 1IVYA 2X1LA 3DR3A 1GQQA 1ZLXA 3L3BA 4QYIA 3GRPA 4MICA 3VHRA 4ES6A 1GEEA 1QIIA 3BQ9A 1XZFA 1SXIA 4W1PA 1RZRA 1YQUA 1NC1A 1W8IA 2CNBA 2V6BA 1Y5LA 3ZR4B 4DMMA 2F9MA 2Y2VA 2R4TA 1WZUA 3AXSA 4R01A 3BGWA 4ZDJA 2CV1A 3PI7A 1OOEA 2H51A 3G3EA 4OHRA 2BMDA 1RIFA 3UB2A 3C48A 2QX4A 1GY8A 3L8HA 2C99A 3NT5A 4UUNA 1KEWA 1AY0A 4BASA 3COVA 4FFVA 3FLBA 4UBKA 1DB3A 1MR3F 2WI8A 4M8LA 3FDZB 2V1UA 3CIFA 3SQWA 2XZDA 4PX2A 3NH6A 3C70A 2VT7A 3AJRA 3H8SA 3TIGA 3UJHA 3R0ZA 4A5OA 5IFLA 3OFND 4BLWA 3KT3A 5F33A 5TSDA 2F3RA 3WXBA 3ZQJA 2QJRA 3U4IA 3RADC 2WHYA 3TR5A 2XQFA 3C1UA 4MRPA 4P4UA 2NP7A 3ELBA 5ENDA 3G9UA 3KOUA 3EQ2A 3L93A 2A0YA 2WWIA 2VCYA 4OQEA 4UPVA 4O4HA 1HMYA 2IYZA 1G2IA 4C4ZA 4PNEA 2VYQA 3L9WA 2HMVA 3H9BA 4INPA 3T1OA 3OKFA 2PD3A 3IH5A 1PL0A 3O74A 4CKEB 5GINE 2EKLA 4LVUA 3NM4A 3MUNA 1P5RA 4LY0A 1SUWA 3AERA 4GEKA 2IS1A 2DHRA 3AF0A 4G6ZA 2P2CA 3ZDQA 3GIWA 3WKCA 3ZI7A 3HEMA 3ZIDA 4HUTA 4YGXB 4TLCA 2X5JO 4NY1A 1KR2A 1UP6A 4RD0A 3SQLA 4E21A 1XC7A 2HT1A 1IB6A 1UBTS 1YE3A 4MYUA 3QYAA 1QRAA 1FS4A 3FCYA 3L7OA 4G4SO 4GPEA 4KR0A 1O5OA 2VKQA 3STXA 4BNWA 4RD1A 2GNPA 2RGUA 3SNKA 3PK0A 1P1FA 3LQFA 4NATA 1PR4A 1GCGA 1MQ8B 3FWZA 4H3SA 1E9VA 4QOEA 3PIIA 3OT1A 3IPLA 1V8ZA 3KC2A 3EB9A 4HQRA 4DV6B 4LQLA 3VTZA 4AFNA 2O4UX 2QW1A 3WFZA 1U8XX 1WUTA 3GMSA 4QYWA 5HE8A 1CY8A 2FXVA 4Z7JA 1KWGA 5KU1A 4NJMA 4G1UC 3RU2A 3WV5A 3ZHYA 2GN1A 4KQEA 1A9RA 1M3SA 1OZ0A 4YCCA 2AOVA 5KUTA 2BL4A 3FPJA 1W25A 4GKBA 4PEVA 4TUYA 5IAKA 2B5WA 2QNIA 2C04A 4HWOA 1ZRMA 3GP5A 4QNMA 3VPFA 2FN8A 5ADWA 1XAIA 2KPOA 2H1VA 4NCJA 1OBCA 2M1XA 1FDSA 1GNTA 2PN1A 3H83A 3MMNA 3A4TA 2COUA 4P08A 2J0QA 3DBHA 3PQ8A 1O87A 2HFJA 3TB6A 4K9NA 1VP9A 4LRQA 4TYQA 2CCKA 4EHJA 2NU7B 4YC7A 1KAOA 3CZQA 4RLFA 4D98A 3ZJTA 5CVDA 4YHHB 2BRUC 3PR3A 3HTXA 1TEXA 4ZV4A 4R7ZA 1XK6A 4I5GA 2V03A 2DTEA 1CZLA 2I3DA 3GCDA 1R9MA 3O8BA 3QELB 16PKA 4C2TA 3JZAA 4HDKA 2H8KA 3GI1A 1YWGO 4Q7MB 4BQOA 4E4YA 2WDZA 4FD3A 1U8YA 2Q3CA 3UPTA 1VGQA 2XNCA 3SS9X 1OF1A 3DLAA 1VIYA 2GM9A 1T24A 4I1OA 4XTRA 3X1JA 2POCA 2YIJA 3DOUA 3VHQA 1UMBA 3W3AA 4KDRA 1JPJA 3SF8B 1UT6A 2Q1SA 2B4TO 2ZBDA 3CRW1 2DQKA 4M22A 1NR1A 4N5HX 5FORA 3RS8A 3NLLA 4D4GA 2G1JA 4PYJA 5AR1A 4R8LA 4B85A 2BM8A 1SD5A 3PC6A 3E27A 1ZK1A 1XNJA 4H7KA 4PRYA 2HSEA 1FXWF 2H18A 1M8PA 4HDRB 1PVDA 3U1TA 2RIRA 1WB9A 5J58A 1EAYA 2AOWA 2RAPA 2X4LA 3Q7EA 1DAKA 3V7YA 1E9EA 1EAMA 3SFVA 5BN3B 1M6VA 2PYIA 3PFHA 3QVLA 1M1NB 2UDPA 5ALWA 5JAIA 1C0LA 5I5EA 1EX1A 1FDUA 2AMLA 3SX4A 3GD5A 2H3EA 5EWJB 3SE0A 5KTRA 5LWQA 4AKHA 2E4AA 1FLNA 3CJTA 3D7NA 1IU9A 1MJGA 3E5MA 5DF1A 5FI1B 1U65A 2KYRA 2P5UA 4KXFB 4BB0A 2YN4A 4IZ6A 2IJGX 1RM5A 3FZEA 5BWOA 4QM7A 4WINA 2C8KA 4GOLD 4IJQA 4KR6A 1RXUA 3D9QX 2CXPA 2JLBA 2CWDA 4Y9RA 4JVLA 1JDVA 3X0DA 2A1UB 4HPWA 2ZVQX 1E5VA 4P98A 4PZ0A 5ESWA 3S6JA 1DBSA 4DPKA 1QHIA 4WA7A 4JWKA 3IDOA 4K3UA 2IH4A 3WZMA 2PCLA 3DAOA 4O5AA 3NH9A 5KU7A 3OOHA 1JFVA 3CH5A 1RP7A 4I3GA 4JYMA 4Z3KA 3RS3A 1IQRA 1EE9A 1KH1A 3OURA 4ZQGA 4LYHA 1GUDA 2GETA 2XXJA 4LQ4A 5CGZA 5E6UB 2XTZA 3GJ0A 1E6WA 3KOOA 1YH3A 3HO6A 1LLUA 4TS4A 5KX5B 4E2FA 3FLEA 4OMUA 2IZ0A 5CK4A 4NJEA 4Y18A 2WQ7A 4MW5A 3KAPA 1Q19A 1I33A 2ZVDA 5IW8A 4B6GA 1E1DA 2YQ4A 5DNEA 3TF5A 2RKOA 2QRMA 3C85A 1XKQA 5AJYA 4Z5XA 3MTDA 1O96B 4KWIA 5COQA 3HJFA 3THXB 4HJXA 2OZPA 1FF9A 2OM2A 3ZKWB 4NARA 4XB6B 2CL5A 4D74A 1L4MA 3UY4A 2JGIA 1HYQA 4R68A 1I4TD 4HWPA 4Q9LA 4ZVTA 3IQXA 4DANA 1V48A 1N36B 1OPRA 3MRTA 2X7JA 2PDAA 3FVWA 1JEYB 1V7CA 2YN0A 1QHSA 1B3RA 2X9VA 3LQYA 4LDAA 4EABA 1SBQA 2X5KO 2OY0A 4JC5A 2I7CA 4E94A 1KTIA 2EZ4A 2XKJE 3TEMA 4L0DA 4UDXX 1V47A 3GUHA 1FB5A 2QUJA 3WLIA 3VKHA 3GAFA 3OEHD 1C9YA 3EGXA 3RC9A 3WK8A 3N7UA 1CR4A 2ZPTX 4C0KA 1B7GO 1H8HA 2WAYA 2I8CA 2XQKA 2IBTA 3PUZA 3OPYI 1DIBA 1PFQA 4RWZA 1R5BA 3UH1A 2FVXA 4MGHA 4YRQA 1M75A 4MQLA 2YASA 1QGZA 3SN6A 2WJ3A 4L22A 1X94A 1EIZA 1GGVA 4PRZA 3HN7A 5DV9A 5PNTA 4RZUA 2FEMA 1UOPA 3SHWA 4EEXA 5CA0B 1M83A 1COZA 1TU0A 4BL5A 1I2AA 2O1WA 1IUNA 4XD2A 1YK1A 4RADA 1DBQA 1ZSVA 1WXGA 2Y68A 4QT0A 5ES3A 3CH7A 3HM9A 4JYZA 3RVRA 3V4FA 1DQSA 1YI1A 2NO0A 3E9YA 2B4KA 4L5CA 2FZKA 3K6SA 3F2VA 5EZSA 1Z4MA 3LI2A 3BIXA 1R27A 3OKCA 1G6HA 3I2KA 3PSHA 4MUKA 1N6LA 3QITA 2PR7A 3UM9A 2ZSUA 4P83A 5FB3A 3L06A 4NOLA 3H7AA 1JXMA 1OGIA 3HFSA 1RYYA 3NTOA 4PIVA 3WB0A 4AN4A 4JBHA 4G4GA 3ZY4A 3FFXA 3GLQA 2A3NA 4E5DA 4H4EA 3K35A 1KZ7B 1N2CA 4N9WA 2Y1LA 2BFWA 4ZC8A 4EHDA 4YLYA 5DZSA 4P4TA 4KSBA 3AETA 4HXFB 1R88A 4GVXA 3K71B 1O6ZA 1X39A 4KVZA 4KQIA 3R7FA 4EI9A 1T3LA 1U3GA 1GAEO 1RI3A 2OUIA 5BXQC 4OH1A 2ONCA 4FEAA 3LQ4A 4KFTA 2H07A 4ALNA 2PNFA 4CU2A 5KNDD 1CUAA 1Y6QA 4KZPA 2CHGA 4OQMA 3TSCA 3IBTA 1P1RA 2C9MA 3JVUA 5CJPA 3INRA 2COEA 3QFSA 4K9QA 4X3CA 1S9DA 4XWTA 4YPFA 2ZBRA 4RIIA 1TQ6A 4KE6A 1U94A 4IUYA 1CKEA 4H0NA 4LMAA 3JVIA 3P32A 1A8UA 3T7AA 3GFVA 3O1JC 1G64A 3A9RA 4NBNA 3UZUA 3NEPX 1L5NA 1PG0A 1VJRA 2I4LA 3AJ9A 2IQ5A 5CYPA 4B2YA 4BX3A 4IV8A 1UJ4A 3IC5A 3TPZA 4D9HA 4GZ6A 3ROFA 4ZI7A 3VOSA 4GUAA 4EQ6A 5F51A 2Y1GA 2AKYA 4IMPA 2CNDA 4TV8B 1KOGA 4ZCQA 1QYIA 4IH4A 1P6UA 3GWGA 1JG2A 1JYEA 1E1RD 1JJIA 2D00A 3PKJA 3CWZA 4TN5A 2I66A 3OJOA 3A3KA 5CB8A 4JKYA 3TMKA 5LOVF 4R2IA 3KLBA 4BMSA 3AOGA 1ESMA 1NUUA 3AGPA 4E22A 3ZI0A 3QFRA 3VJRA 3BHMA 4MPRA 2GTPA 5TS3A 1E1YA 1MT3A 3GNQA 3L5KA 3PRYA 1YIAA 3LNCA 3WIEA 1D5WA 1R0WA 3FYUA 1V8DA 2HF7A 3FKQA 1F2UA 2CKMA 3DUWA 4O2AF 5DTIA 4G8BA 2FDXA 2OCKA 1H2HA 3ME5A 4MITA 2QAGA 3NKFA 4QBGB 1LVGA 1WXDA 2BWJA 2I6SA 3LC7O 3MWYW 4JSTA 3NHBA 4U5XA 3REQB 4AY5A 3SEAA 3VPHA 2R65A 1JIUA 2WU4A 3TMYA 3VI3B 2CHFA 3KV1A 5C51B 2I4NA 3D5TA 4HDSA 2E9SA 3JZDA 4GZMA 2HK6A 4IKEA 4GX5A 2AOUB 4MVJA 1PZEA 3UJAA 3N2KA 5J2UA 2HA4A 8GPBA 1E1CA 1COWA 1DWOA 3FXAA 3V2IA 1TM5E 1PHRA 4O63O 4H59A 5K3CA 4WX2B 4D9CA 4RJTA 5ITZA 1RAFA 4XE5A 5G0WA 1XZJA 3ANMA 4KNWA 3W2FA 3KR0A 3UTCA 3BX1A 4PSVA 1G0NA 2OXRA 3FPGA 2CF6A 2RK3A 1AMOA 3SJZA 3HUTA 3LPLA 2I29A 1Q92A 4HAZA 4HFJA 3RSHA 1BQEA 5AKHA 3AG5A 1EH5A 4KIWA 5A62A 5P21A 2MYTA 2OO7A 1X1BA 3DAHA 1RM3A 2HYDA 3OJ0A 3PT9A 1YHNA 3DKRA 3T3IA 1TM4E 3WWYA 4AKTA 2ZUVA 3DV0A 4HAUA 4N03A 3H1BA 1ISIA 2CDBA 1F9AA 1Z75A 2XSZA 2FG6C 1MEEA 4MUYA 4YALA 1RLIA 1PX0A 3C14C 2FN3A 3ICVA 5BN4A 4NVRA 2J1LA 3LRTA 3PSAA 3DV2A 4FU0A 2VBIA 1NVWQ 5I4BA 3RWBA 5H83A 2JFNA 5CXSA 4NWIA 4DQDA 1RZRD 1IFXA 4DZTA 1QO0A 4X95A 1XPUA 4FB5A 4V3CA 1C1XA 4DMFA 4W63A 5JWRA 1ZXXA 3R7SA 4HPXB 1K92A 4MI9A 1KI3A 1QXSA 3CH4B 4IX1A 2PHZA 3NHLA 4B3TB 3HA5A 2FEPA 1ZVKA 4GI2A 4TX1A 1XBTA 4TMWA 2A5DA 4U2FA 2VAXA 5K4GA 3PTZA 3QXXA 4U4AA 1E2IA 4TWZA 4GQAA 3WLKX 4KOAA 4HADA 1Y8CA 2AFHE 1X8KA 1XA3A 2R11A 1SCAA 5E95A 1T26A 4MLPA 3VR4A 1U1FA 1AO0A 1UBSB 3DDWA 5HKKD 1JVNA 4MULA 5ALLA 1U7WA 4OMFG 1Q83A 5CVEA 3ERCA 1QHEA 4L6CA 4HFMA 2FR8C 1DC8A 2VTDA 4Q9DA 4W1SA 4ZYVA 3V2UA 1NNEA 3AUUA 4FIDA 1E66A 1PS0A 3PEUA 4BP1A 3BD8A 3H5IA 1BXZA 3WAGA 1RCTE 4CEJB 4TL6A 4CM6A 5JYBA 4PWYA 1OASA 4FIZA 3KZ1E 4KGDA 5CVUA 2E4UA 2DPGA 1WSDA 4BNJA 3FRHA 4MP3A 3DTYA 4TROA 4I5FA 5JNVA 1N6KA 2NXJA 5AKLA 3Q72A 3AVYA 1T8RA 5GONA 3HCWA 1X77A 2EAUA 1ETUA 1WXIA 5CT8A 2VHYA 1NQOA 1R66A 1RWOA 2RJOA 1ORVA 2M6SA 2O2EA 4OXXA 4IRUB 2OORA 3KSZO 4UNPA 2Q9BA 2JEZA 5TARA 2GTIA 5JCJA 3C3MA 2ECQA 2DCMA 1QZXA 3IP7A 2OZLB 5J2TB 1F6WA 1KJQA 3IQHX 2F00A 4NCKA 5C53B 1RSZA 3W2TA 1GTJ1 3I76A 5DXAA 1UFRA 4IIJA 4MDEA 5EHNA 2WQZA 3IDFA 4LN1A 3VU9B 4BO1A 1SG6A 2XPCA 2Y05A 3BSFA 4K28A 4XCQA 5B5SA 5AVQA 5K6AA 3R4VA 1W0JA 4LBVA 2O8DA 1MDBA 2XB8A 1KARA 3AKCA 3E05A 5G0SA 2GFIA 2HH9A 4KFUA 3BXPA 3C7AA 3BSWA 1JA9A 3CO5A 5T64A 4E5VA 1YA6A 1P3DA 5LQUA 1MNQA 3TRHA 4B31A 5BMVF 3T1TA 2J3LA 2NUTA 1RM4A 4MMYB 5JNSA 5JMPA 2RGRA 1Z3CA 3HYNA 5E1OA 1P7PA 1QLWA 1GTMA 2CZGA 4J9VA 5KINB 2V7QD 1J7JA 4A92A 4G09A 5HP4A 1QFXA 4FYHA 2IX3A 1CRWG 1MRSA 1BKSB 1WL8A 2AE1A 1DIRA 5JSKA 3TDKA 2AFVA 4DA7A 4LE2A 2GEFA 1SOUA 5HM8A 3DEHA 4YUZA 4UTVA 4KXMA 3CMMA 3SXJA 1Z5NA 5DGHA 4NKRA 1H65A 3GFGA 1ZIPA 4I2NA 5IM4A 4OUDB 1P0FA 2CD7A 2X0IA 2YJ4A 3F47A 2LCFA 4LZWA 1SBCA 3QSYA 3QLVC 1D2HA 2NX2A 2DQYA 3R5TA 1Z6ZA 2I3GA 1EQAA 3KVRA 1NG1A 1RXSA 2XUKA 1DX9A 2JJ8A 3IV6A 2VQDA 1G20E 3OMWA 5FI5A 1I10A 1ZICA 1GU1A 2PZJA 1S2OA 3DOCA 3ACCA 4NZOA 2H1SA 3E18A 5IU6A 2W58A 1YGYA 4AWBA 4BXOB 1R0XA 4H1VA 4K2HA 3KLPX 4AICA 4MH0R 4P80A 1H93A 4NBTA 4ZHSA 3GUYA 2HUNA 3MJDA 1VCOA 2DPLA 1H5NA 3OQHA 5HUJA 4QVIA 4PLTA 1Z3IX 3DVQX 1PD1A 3E0QA 5FOWA 5FWAA 4ZYWA 1FDIA 2PMCA 1RACA 5HA5A 1C14A 2XW6A 2CJWB 4HRYA 3FZYA 4I1YA 1XSEA 2YWBA 1DZIA 4PG6A 4E07A 4D6YA 5JD6A 3P9CA 4K9KA 1OJ7A 1NVUQ 1TEVA 1XQWA 2JKYA 4A6XA 3PQCA 2GN0A 3OHSX 4ZVSA 2PUWA 4O5OA 4RTPA 4OU5A 5ABPA 5D7BA 1G9TA 1P8JA 4PLWA 3NX4A 3GQVA 2X15A 4MVXA 5GIPE 3AWDA 3H3FA 2XBUA 1EK0A 5AXAA 4YRZA 4M9UA 2XRZA 2C98A 3AT1A 2GK3A 1SVNA 1NNI1 1YACA 3GRCA 3DQPA 4BC0A 3ZLBA 1V16A 3AMVA 5CM2Z 3GEIA 5CNKA 2ERCA 3WNBA 4EGSA 4Q9HA 4R7GA 3GFFA 3WMWA 5FUQA 4ER0A 2XAUA 1IN8A 3JYNA 4G5XA 5G3YA 1KI8A 2PBZA 3SBXA 2FQ1A 5JCXA 2IELA 4X0EA 2WSSA 2ODEA 3G0HA 1IRIA 3RW9A 4RK0A 3TUZC 2YDXA 1ZOIA 4NABA 2IYQA 4EF5A 3V42A 2WIJA 4P3XA 2QE6A 3A26A 3MTQA 4RY8A 1SU4A 5B6IA 3RE1A 3W0LB 2BKLA 4AX8A 2A30A 7MHTA 3WWEA 4RACA 4ZIRB 2YWJA 4ZVNA 3FOFC 1FP2A 3BREA 1B2RA 4WESB 1PV4A 4D0GA 1U28A 4R8RA 1PW7A 4A91A 1W44A 3B48A 2DBRA 3GEDA 4B8WA 3A1EA 2CSUA 2JW5A 2OBFA 1GT91 1Q91A 3A6GA 1PGOA 3F1LA 5AHWA 5IJ0B 3SPXA 3QBTA 2ILTA 1SKUA 4DSNA 4QC2A 4XWKA 2DRIA 2I4OA 3GUZA 3KJQA 1PJBA 2G7ZA 1S3SA 2QR5A 3HDTA 4AG3A 2QF7A 1KJJA 1SPBS 5AKEA 5LP6B 2QQ0A 3NGMA 3MINB 5EOVA 5IHXA 3VO9A 5GTDA 2NAFA 2QXYA 1GZSA 4BU0A 1SPXA 2QVBA 3U48A 5CEJA 4WNAB 3UMJA 2D5AA 3LUGA 5EESA 3QNMA 2WSBA 3P2KA 1XNGA 1H8HD 1MABB 2CNLA 2JCGA 2XGMA 1NOKA 4ZK6A 1DXOA 1DIGA 1V1RA 2Y2UA 4G3XA 2VH5R 3WYFA 1EG7A 2RC5A 3IHWA 4R83A 1O89A 3L6EA 3KSBC 3PFWO 1E0SA 2X0EA 3DCNA 5REQA 2NVWA 2XLCA 3JAKA 4O2RA 3TW4A 5BURA 3FI9A 4KVAA 2C95A 1ZVMA 4I2VA 4OI0A 5TGZA 4L6AA 4LJYA 4MUHA 2BH2A 3A58B 1U90A 2MT9A 2YWDA 4RPJA 4LSMA 4G5YA 4BV3A 1NGSA 1NDHA 2GESA 1LCIA 4W6ZA 1T9DA 3IPCA 1HX7A 1Z06A 2DX7A 2ZJFA 2JBAA 2XMRA 4K8OA 2J3JA 1UOQA 2VBGA 2G9ZA 1BVRA 2GS9A 4WEOA 1XWWA 2CVOA 4O4JB 2YWRA 3W1EA 2BZ1A 4I1RA 4OMDA 4RABA 5DO9A 1J2YA 3WAKA 1FW6A 2NZ2A 1D2CA 5G1PA 3VAAA 4NMWA 4D8TA 2G9QA 3K20A 1KORA 1JKXA 2DUNA 2ODPA 1P5JA 2VHJA 2HU2A 4Y9TA 3CLHA 5KTSA 2HF2A 1C0IA 3CZ4A 3KFVA 3VBEA 4ED9A 1O9HA 4OLHA 1GDDA 4PNZA 1GUAA 1DT3A 2IUSA 4JT8A 4R2HA 4V24A 5ED0A 5FI0B 4F9TA 1XDZA 3HJRA 1G20A 4X24A 5BW5A 1E0DA 3P0IA 3Q3VA 1P2GA 2QN9A 4HQ0A 4C4AA 2QRVB 2HL6A 2NUPB 1I0LA 1IHXA 3S55A 1H9CA 1NDQA 2PFGA 3DMDA 4BWGA 4L85A 1SCDA 5H3HA 1NIJA 4LSWA 3HZRA 2QBYB 5EMNA 1XWIA 3X2EA 1EVIA 2Z56A 3Q7RA 2DZDA 3WQRA 5A5VA 3BMOA 3MS7A 2ZZKA 1XRLA 4GYKA 4M83A 2CDAA 2FQYA 1Z22A 2F48A 2CT8A 1M2WA 4HRXA 5SV2A 2GH1A 1VQ1A 2Q4OA 2BEVB 4ZQHA 3ORHA 4UEOA 3CZCA 4DUGD 1XMVA 2JASA 2WUWE 1J2TA 1H1TA 1QKIA 2BCGY 4WOCA 1T5LA 5CDGA 4FHCA 4Y2QA 1JQKA 1I1NA 1G9XA 2X77A 2OTCA 3L7YA 5KX5F 3KKEA 3CRZA 1G4AE 4S24A 1UM9B 4ZQEA 1U7DA 2AB0A 3M3DA 5CAEA 2C5EA 5HHTA 2NVUA 1WULS 4MVCA 1P2FA 1UDAA 1XKLA 2I22A 5JASA 2OO5A 3LBHA 3CVWA 2CHUA 3PA6A 4PY2A 3OG9A 4DLVA 2JLAA 2KHZA 3HJAA 4NNPA 1EZZA 4DWOA 2VPIA 3T3HA 3GCZA 4MHOA 3KAKA 1KO7A 1XHFA 3HKCA 2DPHA 3CY6A 2LWIA 1ODFA 2X8LA 3WLRA 3I28A 1NRWA 4JR2A 1QWOA 3KXDA 2CNWD 4N54A 1ADBA 4D4HA 6YASA 4F3RA 2Q4RA 1H0HA 2YFYA 2VA9A 3G2IA 3FSEA 4OYRA 2X2OA 2QRNA 2VKTA 3IUMA 1FVHA 2IYFA 4YRGA 3GVCA 4OP3A 1SMKA 4O2AA 4YIHA 2AI3A 1LSJA 3FHCB 5CYGA 1W36B 1XDGA 1Y3FE 3G2OA 4Q47A 4MVJD 4UTPA 4FINA 2ORED 3BTUA 1YR8A 3N39C 3TVTA 4M4SA 4R81A 2VHTA 2JLVA 2CMFA 2AVNA 2TRSB 4BFZA 4IDDA 1J9ZA 3IIJA 2YV1A 4AZ3B 3ABRB 5I4CA 1X7GA 3R7NA 1OLSA 2PKXA 3DD5A 3VTFA 3DE7X 3K8OE 4O4LA 4RVSA 1FYEA 2GYWA 1LLQA 1ND6A 1U2SA 2BTOA 2OSVA 2R8XA 3D2CA 3I9MA 3IXMA 1IOWA 1P2DA 1U6IA 1ZI6A 2R79A 4KMSA 4X1IB 3DEFA 5BNTA 5ALDA 2HV8A 3D8HA 3MWEA 4D9GA 4WN9B 2HIHA 3C7CB 3HMKA 4P5PA 2VF7A 1ZEJA 3BKXA 3H9JA 4UC0A 4C3VA 3DBLB 2GLTA 4JOSA 4OKIA 4XOUA 2VDQB 4Q7LA 2XSZD 1YB6A 4Z99A 1NN1A 2ZUBA 3TH5A 2R5NA 5F1YA 5K0LA 4D8WA 3KZOA 1TJ5A 3KWMA 2C8JA 3JD3A 3W6ZA 4KQ2A 3IV7A 4IDFA 2EKZA 4R41A 4LZZA 5JDIC 1CULC 3WDSA 1VG0B 3NO4A 1QO0D 1BXGA 4TVSA 4KQ1A 1QHHA 2DLDA 3UXMA 4OBBA 1UIRA 1EXVA 1RQ2A 2OD7A 3OSUA 3RO7A 1R0ZA 4QECA 4TLDA 5J5CA 5FLYA 1TT5A 4DM7A 2EYUA 2LRHA 1Q12A 4B2IA 2RCYA 3QWFA 4RX1A 1JIKA 1ZYUA 4RKYA 2PUBA 2WU0A 4PAMA 4Z7OB 3BICA 2UYOA 1GSOA 2G0NA 4FXPA 1CT9A 3GJ8A 3SVLA 4BNHA 3AP3A 1JB1A 2WOJA 4UM9B 2QM8A 3L6DA 3UC9A 4TZ6A 3RHSA 4HNQA 3AM1A 2IP4A 5F52A 3UEOA 1GUYA 2BT4A 3KJHA 4NP6A 4CEHB 3NETA 3PC7A 3QQ5A 3WIOA 4RIFA 4BMCA 2BC9A 1DDOA 3PFKA 1SG0A 1AOXA 4KLNA 2YY6A 5K0EA 4LNHA 5AI4A 3KL2A 2YNMC 4DDUA 3BE5A 4AW9A