2BF7A

Leishmania major pteridine reductase 1 in complex with nadp and biopterin
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
283
structure length
265
Chain Sequence
VPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLGDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Leishmania Major Pteridine Reductase Complexes Reveal the Active Site Features Important for Ligand Binding and to Guide Inhibitor Design
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 96
structure length 265
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2004-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bf7A00
5CFZA 2Q1WA 4IY1A 1NX6A 1C3VA 2NSDA 1QORA 3L07A 4P38A 1EFKA 1LJ8A 3WSVA 5L4NA 2CVZA 5F21A 1P44A 2Q49A 4TROA 1QR6A 3MOGA 1ZBQA 1NHWA 1WDMA 1DC5A 3JQ9A 3NT4A 2DQ4A 1BXGA 3WG9A 2Z1MA 3PGJA 4PG7A 1YQDA 1I8TA 2HU2A 2X86A 3SEFA 4E13A 3KXDA 4KUHA 4UEKA 2X9GA 3P7MA 3VZRA 1D4FA 4RJTA 3EVTA 4EDFA 4AJPA 1PJLA 1KYQA 3BMNB 1QMGA 3GZNA 3UOGA 1DC6A 4HY3A 4D79A 2HCTA 4L4XA 5CP8A 5GZ1A 3VH1A 3ABIA 2I76A 2WE8A 1E3JA 4XGKA 1XQ6A 4YJGB 4DQVA 2O7SA 2ZTLA 1N92A 3DBLB 4J2HA 4FFMA 4J1SA 2X5OA 1ZSNA 2PZLA 2W2LD 3H9GA 3KEOA 3PHHA 3KVOA 1PGQA 4J3FA 1AGNA 4E5KA 4RF3A 1B0AA 3LQFA 2VT3A 4WLNA 2YUTA 1K5HA 4IPTA 3K73O 4NH4A 1XDWA 4QFCA 1GV0A 2DFVA 1X14A 5DP2A 2GN6A 1VL6A 2D2IA 3LC1O 3DZFA 3SBOA 5K6AC 1JVSA 3WJ7A 1SZJG 3OQ6A 4OKNA 1A9ZA 3LT0A 4XYLA 4RF5A 3HB4X 3VVCA 1YQGA 5A05A 4J1QA 2WD7A 4Y67A 1FDSA 5ES3A 3H4VA 1P1JA 2CF5A 1SAYA 3MWEB 4IIVA 3KUXA 5JY6A 1GZ6A 3WGYA 3I9OA 4PLWA 3CKYA 2PY6A 2EV9A 3BTSA 2Y99A 4UVEA 4KDFA 4PZCA 1I2BA 4TRNA 5ENDA 3DEYX 4WE3A 1KEUA 2Y68A 3DR3A 3PFFA 3ST7A 5AXAA 1H6BA 9LDBA 4ZHSA 4LGVA 4EEXA 4PLYA 3VDQA 3DBVO 4GVLA 3E18A 4FB5A 1D8AA 3L6EA 3KBOA 4IDDA 1EDZA 3ZV5A 4I8XA 1M76A 4LSMA 1AXEA 2YY7A 4IM7A 4K26A 5F3RA 5F1KA 2Y1EA 5JC8A 3NGLA 4ALIA 5B12A 3GQVA 3DL2A 3KB6A 4MKZA 2NQTA 4HADA 4PG6A 1PZEA 4B4UA 2J3HA 1DLIA 2X8LA 1CQIA 3K8ZA 4R1TA 4TVBA 4XD2A 3F4BA 1KVSA 1LSUA 5B1YA 3GDGA 4GL4A 1EFLA 2OORA 5KVCA 1E92A 2C2YA 4BQPA 1HF3A 1BGVA 1H9BA 2QW8A 1UXGA 1Y8RB 4BO8A 5T8KC 5JMWA 5LCXA 1C0LA 1P1IA 1DJNA 2ZB4A 1XA0A 4IZHA 2CSUA 1XWFA 3SC6A 2X58A 4NHEA 3ASVA 3Q2IA 3ZHZA 1I3MA 4S1VA 1QLJA 4XYEA 5JAMA 2G5CA 1H6DA 3RBZA 1EUCA 5KVSA 3F9IA 3NX4A 3MJCA 1UZNA 3OETA 4JX8A 3V5NA 4DWVA 5L3ZA 2GLXA 4R3WA 5GMOA 4CR8A 5IZ4A 2Y67A 4YAIA 1HSZA 3DC2A 1X0VA 1YBMA 1ZH8A 3H2ZA 1QYXA 1IULA 1U28A 2GASA 2ZIZA 4CLHA 3H5RA 4EUHA 3FNHA 3V1UA 1CETA 1AUPA 1P0CA 1HKUA 4DC1A 1VJ0A 3U4IA 5B4UA 1Q2XA 4DL9A 1XGKA 4CR7A 1W8DA 2VRCD 3EHEA 4I5DA 1J49A 3DZBA 3L0DA 1OZAA 1KEWA 5G2OA 1NAIA 3DOJA 5I9LA 4YT4A 2ZKLA 1E3EA 1KOLA 4BNWA 2DPGA 2W4QA 1YB4A 3G79A 1DO8A 3AUSA 5BSEA 3FPCA 2POQX 3CTMA 3PIIA 1ONOA 3EAGA 2W8ZA 1G6KA 4GQAA 2FHSA 4FD3A 3D3WB 1XELA 5TT0A 4OQZA 4BGEA 2J8ZA 1HE5A 5G0SA 2PK3A 3VHRA 3ZV6A 4MINA 3C1TA 1ZXBA 1N9GA 2C20A 4YQYA 3X2EA 2ZJ1A 1EBUA 3UCEA 1ZK1A 4JNKA 2O4UX 4WNIA 3RQSA 2C54A 4N18A 4CODB 3IJPA 1UZLA 2PGLA 1C1DA 3ZNNA 3AY7A 4CLDA 4YAGA 1BRMA 4F6CA 2WYWA 2B69A 5HRUA 1IPFA 1EBFA 4Z9YA 2BKAA 1HXHA 3Q9UA 4PGFA 4IGEA 1HE2A 1WDLA 3OQBA 4N5MA 4QFDA 4A27A 3JTMA 2HMSA 5EQDA 4TZKA 4YRAA 1ZW1A 4TZTA 1U7TA 4YA6A 4BV8A 1AXGA 2W2KB 2NWQA 4BQRA 5DCWA 1P33A 3E6AA 4NBTA 5DOZA 3JQGB 2QHXA 3ENNA 3Q11A 3QP9A 5JAZA 3WGQA 5KCZA 1R4NA 3WYBA 1I2CA 3AUAA 3RI3A 3WWYA 1IHXA 1WZIA 2J3JA 4D46A 4ONEA 4Q9NA 3VDRA 4IBOA 4B79A 1NYTA 5BSGA 4BO6A 1XKQA 4CQMD 4DPKA 1PZFA 3CEAA 3IDSA 3V2GA 1R0LA 2ZATA 3U4CA 3BA1A 5AYVA 1ZUD1 2FR1A 3BMCA 1V3UA 1ENZA 4FJ1A 2IXAA 4R1SA 4R9RA 1QYWA 2RAFA 3WR5A 3ADOA 3EW7A 4IIUA 3WTCA 3AU8A 3GVIA 4D0SA 1EVJA 1L7EA 4PCVA 4NJOA 1M6HA 3H9JA 1JQBA 4D42A 5KKCA 3BMNA 3GZNB 2PD6A 2PTGA 2F1KA 2NVUA 4BNZA 4BKUA 4CR6A 3GVCA 1P3DA 5CDUA 3AFNA 2GPTA 3ENKA 4XDZA 2P91A 1NWHA 3NJ8A 5I7EA 4L8VA 3NJ4A 1KBZA 4PLTA 2PZKA 3ANNA 2FY8A 5ICMA 1JKFA 2GERA 2ILTA 3GMDA 3JYPA 4ZD6A 5IG2A 1XSEA 2O23A 1Y8QA 5EPOA 2H9IA 4A2CA 3JD3A 1WWKA 3DZJA 4H7PA 1DAPA 1YJQA 3I4CA 4PVCA 2Y1OA 1UDAA 4XB1A 4YT8A 2HK7A 3VVBA 3OJFA 4XA8A 2QYTA 3HHPA 3QSGA 4R9SA 4PZEA 5JDCC 2UDPA 2HK8A 3WB9A 2FPPA 1D1SA 4BB6A 1F12A 3E9NA 4MKXA 3X2FA 4MJLA 3AJRA 4XGNA 2NU8A 1X7DA 3PYMA 4LISA 4R41A 1RM3A 3VPXA 3ROQA 2YFHA 4DMMA 2BFAA 3HDJA 3H6KA 2WYVA 5CEFA 3JQEA 3OJLA 3INTA 4ZQGA 3MJSA 4F3YA 1LI4A 1Q0QA 2D3TA 4OO3A 2PZJA 3PI7A 1PL6A 3PRJA 5JDCA 1NASA 4M49A 1H5QA 2YQ4A 3TF5A 4CMJA 2EG9A 1LLDA 5CDGA 1XLTA 3P19A 4NDNE 2F00A 2QIOA 5FFFA 1LSOA 1MG0A 2DUUA 1PQWA 4JROA 3VKUA 4PLHA 1E0DA 1ZNQO 4W9NA 1JVBA 4RLSA 4PLGA 3TL2A 4DIBA 3DZGA 2IEDA 5IXSA 3DXFA 2WE7A 4CM4A 1P1KA 1YXMA 4O0LA 4CMHA 1N1EA 4EGFA 4D3SA 1I0ZA 3OJ0A 1CWUA 1XG5A 4BO2A 3GLQA 2QZ9A 2X0RA 5T6BA 1T4DA 1ZSYA 4Q3AA 3A9WA 3D3EA 2BHLA 4WCFA 3RC2A 3ZV4A 5BSFA 4MVJF 1PX0A 1E7QA 1R12A 5A4DA 1A72A 2PLAA 4TRRA 4OKIA 5JDIA 2HMTA 3TZKA 4IJWA 1A9YA 2PR2A 3PK0A 2OOSA 5JXWA 1P1HA 3FF4A 1DC3A 2DTXA 1Z74A 5EN4A 5CDTA 3R1IA 4J4TA 4MVJH 3GFBA 4Q3CA 1GUYA 4NIMA 1IUKA 1MFZA 2GNAA 1NAHA 2HMUA 3HDHA 3RCBA 3S1LA 3LU1A 1VJTA 1XIVA 2NQ8A 4P22A 3ZWWA 2OO5A 4NK5A 3ZWAA 2BFPA 3GGPA 1PJTA 2PH5A 2NTNA 1VJ1A 2GCGA 3H9QA 3QQPA 4ROSA 3JD4A 4EJ0A 3FR8A 4YEDA 3F1LA 5U4QA 5CPFA 1ZIDA 4IJVA 2W2KA 2X6TA 1HL3A 3N7UA 2I9PA 3KYCB 3QWFA 4C4OA 5JYEA 1U5AA 2VYVA 3ICCA 2A35A 3I9NA 5T67A 3U4HA 2GUGA 4GVXA 2UYYA 4GWGA 4U0KA 4Q3BA 4L0QA 3OBBA 4M1QA 3TFQA 4UUPA 4FW8A 4JBGA 2VTEA 2D5AA 3L4SO 2YZ7A 1HWYA 3O03A 5HWSA 3QW2A 5ICSA 4GX2A 2B37A 5TJ9A 5AXDA 3COSA 1N5DA 5KTKA 3FBGA 1PJBA 4B7XA 1EUZA 1Y81A 3DHYA 4TVOA 4E31A 3WDSA 4FGSA 2LDBA 1TT7A 3HG7A 2JCYA 4L4RA 5IJZA 3CH6A 4CMGA 1GPDG 5A5EA 4RPGA 3CXRA 5LDHA 4BO1A 4HWKA 4RDHA 1H0KA 4EUEA 1VLLA 3UCFA 4FIZA 2PV7A 1HETA 2RHCA 3NTOA 1GQQA 2V7PA 1GPJA 4U6QA 3SLGA 3TRIA 4CV1A 3GPDG 5EINA 5KVQA 2ZB7A 3DDNA 3BXXA 3F5SA 3GG2A 3GRKA 4RQTA 4UVHA 1EVYA 3FRJA 3PLNA 4CMEA 2O3UA 1BG6A 2X1HA 3TOZA 2JHFA 2I99A 3LT2A 4R1NA 3K2BA 3JQGA 4DLAA 4E0BA 4O63O 4KWIA 1GL3A 1DSSG 1KVRA 5EERA 3UF0A 1EQUA 1QYVA 1QYCA 1ISMA 4GSLA 3PQEA 5DBGA 2UV8A 3LZ6A 1H9AA 3UH1A 1KVTA 3P2YA 3FSRA 1NP3A 1V3TA 1OOEA 4II2A 3W8DA 3JQDA 1DEHA 1PU2A 4PFJA 1HYGA 1F06A 1Z73A 5DOVA 3WGIA 1PQPA 3DBHB 3NRCA 3H9EO 3DMYA 3JQAA 4HFNA 5IZCA 1UP7A 2R00A 3NT2A 3E03A 3BYZA 3I23A 3U0BA 4FFPA 1BWSA 1QXSA 3OSUA 3ZDFA 4MOWA 4A03A 5HM8A 2YQ5A 4E5NA 3VAZA 1E3WA 1B3BA 3E8XA 4AVYA 2GYYA 4F6LA 4Y8VA 4UUNA 2E82A 4G5HA 4Q3DA 4N5NA 3QV1A 1NPTO 3WICA 1CIVA 1U3TA 2EHDA 2P4HX 4DLBA 1LU9A 4N54A 1JKJA 1ZEJA 1VKNA 4MIYA 4MKRA 4KTVE 1I3NA 3D1LA 1UXIA 4FQ8A 3HDYA 4J7CA 1R4NB 4U0JA 3LYLA 5ER9A 4WLVA 2JFFA 1RJWA 2NNLD 3WIEA 4Z6KA 3ETEA 5JYDA 2FPIA 5ITWA 2Q4BA 3AW9A 5MGBA 1LTHR 5I8ZA 1RWBA 4BUCA 4XEHA 1TI7A 3ICPA 3TZQA 3PLRA 1LDMA 1ZJZA 3GGGA 3NDRA 4GWKA 1MFPA 4BNYA 2Q50A 4IXWA 1JN0A 3IL2A 4UEOA 2P2SA 3ZWXA 3OIFA 3ASUA 3WMWA 1KC1A 4DXHA 1YKFA 1DXYA 2R2GA 5T8KA 4XIYA 3JQ6A 2AE2A 3GRPA 4BGVA 2YHIA 2R6JA 4PRLA 2JKVA 3GK3A 3NYWA 3A1NA 4BS9A 4OSPA 3C1OA 3ZNOA 3RU7A 3KETA 4QSMA 4KDEA 2J5QA 2BELA 3ZCXA 2ZK7A 4Q3EA 5L4LA 3L77A 1E6EA 2ZJ0A 4FN4A 3DOOA 2O4CA 2JHGA 3VPHA 3RKRA 5ITVA 5K0ZA 2J3KA 5JBIA 5L95A 3QWBA 5G4KA 1Q0LA 2B35A 1X1EA 3FN4A 4FSHA 2VHYA 1QRRA 5EL0A 1T2EA 3U4DA 4BV9A 2LDXA 2I3AA 2C5AA 4CMIB 4ITUA 1Z45A 3PEFA 4J0EA 5IDXA 1PWXA 4OGWA 3I52A 4UAGA 4YB8A 1ZCJA 3DZKA 4H3VA 1PR3A 5J23A 4Z9FA 1B8UA 3N58A 4MIEA 1T24A 1NVMB 3K30A 4L76A 1I24A 4RQUA 2CDBA 2G0TA 3TQHA 2QYSA 3GVHA 4LN1A 3LF1A 1Y9AA 4XGIA 1P1RA 2RCYA 2XPCA 3GA0A 3ZN2A 5EJ2A 3N74A 4OH1A 3WIDA 4C7KA 3U09A 5KJ6A 3VPGA 2AW5A 1GEGA 4WKGA 4UVIA 1VKOA 5CAEA 3BAZA 1Z6ZA 1ADGA 1PJQA 4HXYA 2DTEA 2DAPA 6LDHA 5JY1A 2IZ1A 2J5RA 1YH3A 3OJOA 1I3KA 3ZNQA 1C0KA 4YBZA 3GHYA 4WLOA 5A9SB 4KWHA 2PH3A 2FRDA 3NUGA 1HYEA 1WP4A 3PDUA 5CEEA 2VRCA 3BHMA 3KZVA 1MX3A 3U49A 1GYQA 1UXKA 4CLRA 5BNTA 4XB2A 2VTDA 3HN2A 4Z0PA 3H65A 2OBYA 5A3JA 1K3TA 1GD1O 2WTBA 4TSKA 3PIDA 4BO5A 1U8FO 4LCJA 1FDTA 3VZQA 2E49A 3TN7A 3PHGA 4BNUA 1SNYA 1T1RA 4S3MA 4RGBA 2NU6A 2XXBA 1Y7TA 3JQFA 4BKPA 1E1MA 1R0KA 4WNCA 4RF2A 3PJGA 1RYDA 4CL3A 3JQ9C 5KOIA 4HV4A 3D5QA 5DNAA 3ZNPA 2J5KA 5DT9A 4QUKA 1NTOA 1MGOA 1ADBA 4IGFA 2GRAA 2OZPA 1ZVMA 3T7CA 3STHA 2HQ1A 1U4OA 3RC9A 2VN8A 3IKTA 5KJFA 2VOEA 3P5SA 3LSYA 5TGDA 4JBIA 1BW9B 4CUJA 1N7GA 2D8AA 1E3SA 2JCVA 3OMLA 1CDOA 1HLPA 1KVUA 1QP8A 5L4SA 3GNTA 1DOHA 2QX7A 2VZ9A 4CM3A 3AK4A 4KOAA 3UVEA 5L53A 2O3SA 3DFUA 3GAFA 4BMVA 1UP4A 2Q4EA 4BKQA 3TL3A 5ILOA 5H82A 4WEOA 2I6TA 2DLDA 4GBJA 3MJVA 3E5MA 3D3WA 4CM9D 3TFOA 4PG8A 5KVVA 3LT4A 4EJ6A 1E7YA 3AUUA 4EYEA 3G1UA 4DTIA 2X23A 3SC4A 2X7HA 4BO7A 2Y1GA 1Z7BA 3ROMA 2P5UA 5IXYA 1NVGA 1VSUA 2FZEA 3D5TA 3GZ4A 4IUYA 4M86A 1WMAA 4RVUA 2O2SA 1GV1A 3U5TA 1CYDA 1OMOA 3BTVA 4WCDA 3T7EA 5KWEA 4EBFA 2X0IA 4DBVO 3OHSX 2V6MA 3PZBA 2BH9A 3QVXA 3MWDB 3VPSA 2CVOA 4GX1A 5BNFA 3BZUA 5G0VA 3LLVA 4K28A 4BGIA 3SLKA 4LVCA 4KP7A 1P77A 3D4NA 3NDJA 3RKUA 3HWRA 3LLSA 1WMBA 3AI3A 3V2UA 1E7WA 1JA9A 3ONDA 3G17A 3WYCA 3GVPA 3HDQA 4XQCA 1XCBA 5HS4A 4PLVA 2AG5A 3EZLA 2JCXA 2GDZA 4CMEC 3QRWA 1XQ1A 3CMMA 2ZCVA 3M6IA 4ZU3A 4JP3A 1U9JA 1T2CA 2P68A 1ZO8A 5FWNA 4A10A 4J6FA 3LC7O 3B1FA 3CSDA 4WPGA 5F1PA 4CQMB 1B7GO 4YAEA 1Y9EA 1WW8A 2O48X 1JAYA 4NQZA 4AJ4A 2GSDA 4EJMA 3CZMA 3NGXA 5I7FA 3EK2A 3GVXA 1U2GA 4D3FA 1PS8A 3VZSA 5AQ1A 1R16A 3M1LA 2V65A 1MLDA 3RSHA 1DFIA 4OOFA 5JAIA 4R69A 4U7WA 1KC3A 5EQFA 3RAJA 1GZ3A 2IE0A 4XYBA 3KYDB 1ISHA 1ONNA 1RYEA 4URFA 1B3RA 4XJTA 4IS2A 3OM9A 2D5CA 2D1YA 2GN4A 1ENOA 2OHXA 3JQ8B 2Z1NA 1HDZA 1NFRA 2QRJA 1FMCA 4YVFA 1I3LA 1F17A 2AMFA 3FCOA 1HLDA 3ROKA 3IP1A 5AXCA 2AHRA 3C3XA 3AI1A 5HS6A 2V6BA 4J43A 4XR4A 4IQ8A 4BO4A 1Y5RA 1WAMA 3AOGA 1A7AA 4QX6A 3DOCA 1N2SA 4NBRA 4OAQA 4UREA 3JQCA 4L9RA 4E30A 1E6WA 3UW3A 4UVGA 1GAEO 4Q39A 5THQA 2V6FA 4NU5A 1C0IA 3C7DB 2FR8A 1B15A 4TWRA 4NFHA 5TS3A 3H5NA 1TEHA 4PLCA 4J16A 1SC6A 3PQDA 3TSCA 4FDAA 1AN9A 3O26A 2DVMA 2IEBA 3DZHA 4KZPA 3LC2O 1JAXA 4FR5A 4K9DA 5AVOA 4UUOA 4IDBA 5C3MA 3ZWCA 3PPIA 3WMXA 4WJZA 3BMOB 3E82A 1GY8A 3AM3A 1V35A 4A5OA 3QVTA 2YV3A 4NFSA 3W8EA 1V6AA 1NPYA 9LDTA 2VT2A 2BI8A 3ITDA 5JE8A 1HEUA 2QQ5A 3KYDA 4JCOA 2AQ8A 1NVTA 4GX0A 4RVDA 5JMPA 2JFHA 2YV2A 4YJHB 4BL5A 1V8BA 3I3OA 4UULA 5LC1A 2VYND 2WJPA 4RZIA 4TKLA 3QWIA 1LDGA 1CERA 3ZHXA 1T2AA 3IMFA 5COAA 4LRSB 4KQWA 3DB2A 3IIEA 4PLZA 2ZQYA 1LQUA 2QRLA 2W2LA 3TPCA 3RC1A 4NNJA 2G76A 1ZSVA 4F45A 3ZU5A 4ZQHA 5ENVA 3WQSB 3HNPA 3ETDA 4GGPA 2CF6A 5IN4A 1TT5A 4I9UA 1HRDA 8LDHA 3I9JA 3RBXA 4CQMA 6ADHA 4YRDA 1YOVB 4BNHA 2O3QA 2O3JA 1EQ2A 1JWAB 4NBVA 2ZTVA 5JFOA 1GQ2A 1KEPA 3IP3A 3PYLA 3WOHA 4AJHA 1IPEA 3KSUA 3H8VA 1X15A 4E2WA 2X5KO 3JQAB 1W73A 2JD1A 3K6JA 4DBZA 4B3JA 4R4JA 2EF1A 5I7VA 2NM0A 1UJMA 1N1GA 5JLAA 5CG2A 5A5FA 4JP2A 4MVJG 5DZSA 1LLUA 3AOEA 3ONEA 2Y0CA 1PR9A 3ZW9A 3ZWOA 1DRVA 1ID1A 4WGGA 2EW2A 2BI7A 4OQYA 3NAQA 1CEQA 2EJVA 4BNLA 1LQTA 4Z9XA 3CINA 2IDZA 5C5IA 4TMFA 3E5RA 5I9NA 3DHNA 2AQKA 1RKXA 5C37A 3NTRA 2VNAA 2O50A 4H16A 2A92A 3T4XA 3F46A 2G17A 3OA0A 4E3ZA 2CZCA 1V3VA 3SX2A 2Y05A 4CMBA 2NLOA 3PWZA 2ZB8A 2DBVO 1EZ4A 2DKNA 3GHHA 2PGDA 4YT5A 1NNUA 2B4TO 2XOXA 4RZHA 2OP0A 3DBRB 4BNNA 5C7IO 3BIOA 1BMDA 4FC7A 2X0JA 3PDJA 1ARZA 2ZQZA 3ZWNA 2C7GA 1I2ZA 1DC4A 1A71A 1MA0A 1YONA 4XYGA 1Y5MA 3BMCB 4Y98A 5TNXA 3L4BA 1N8KA 2C2XA 3IJRA 2BRUA 4QQRA 1HDGO 4EITA 1E3IA 3RROA 2EGHA 2Q2VA 4XQ9A 4NZ9A 4XKJA 3S8MA 3KEQA 3ONFA 3WGZA 1G0NA 3R3SA 2RH4A 1PEDA 3OP4A 4YACA 3V1TC 1PIWA 3PQFA 3WTBA 5MDHA 1QYDA 1XR3A 1LRJA 3PTZA 4XCVA 4ZVVA 2VUTA 4B4OA 2YDYA 4OJNA 4FFNA 2WEKA 3AI2A 3GY0A 3PHLA 1MV8A 3PP8A 3S2IA 2CY0A 2OUIA 2YJZA 4YJGA 3DBLA 2SCUA 4MVJI 1LRLA 4Z3DA 2GR9A 3GT0A 3OH8A 3P2OA 4K6CA 3V8BA 2C59A 1KY5A 1TVEA 4JLWA 4JQCA 5EIOA 4UUMA 2HO5A 3LK7A 3AWDA 1J5PA 5BQFA 4XR9A 2GZ1A 4DQXA 3JQ7A 4FOSA 4PVDA 2O2YA 4GKVA 3ZWPA 4WLEA 4MVJD 1M2WA 4I5GA 5TT1A 4BMSA 1X7HA 4YJFB 4CM9A 3KO8A 4EUFA 3RVDA 1DRWA 5IFLA 1SB8A 1Z7EA 2EGGA 1UP6A 1PZGA 3DTTA 2HUNA 2VZ8A 3IKVA 3PXXA 2X4GA 4IDGA 5DP1A 1K6XA 4RF4A 3NT5A 3L9WA 3DQPA 3JYNA 3KRTA 3GH3A 2UAGA 1ADCA 2B36A 4CLOA 1CQJA 2P4QA 1VRWA 5KKAA 1E5LA 1ZKMA 1H94A 1UH5A 1JKIA 2NVBA 5AOVA 5L7YA 3RUFA 4AFNA 4EI2A 1YWGO 3R3JA 4WLUA 4D7AA 1FJHA 4RDIA 1GTMA 3MJ4A 3GN1A 5TSDA 1E7SA 2NVWA 2NU9A 1B8VA 2O7QA 2CNBA 4DLLA 2BMAA 1P9LA 3AOEC 1VL0A 2DBRA 4GKBA 1HE3A 4QO7A 3UGKA 2V6GA 1I36A 4CUKA 1IOLA 4ZICA 1NQTA 1YS4A 4RVGA 3RFXA 3RU9A 4FFRA 4DMLA 3H5AA 4HNGA 3GUYA 3PWKA 3T4EA 5IAAA 3KYBA 4M87A 1HT0A 5I8WA 4OSOA 1P31A 3WWZA 3ZWYA 1T26A 4J4BA 1H6CA 4NG5A 4DQUA 1GDHA 5KJCA 3VPFA 2CMDA 2Z5LA 2UUPA 1I33A 2VUSA 2IYPA 4XQGA 3ZGYA 1BSVA 2WM3A 3ZH2A 2WMDA 4BKRA 1VL8A 4B8WA 2YDXA 4TQGA 3GFGA 4LRTB 3TJRA 1EK6A 1DFGA 1UZMA 1CF2O 3A14A 4FBGA 3WSWA 4J90A 1LBEA 4JBHA 1YBVA 1HDRA 3BMOA 2NACA 1GZ4A 4U8GA 3RASA 2H63A 3JCZA 4D41A 2W98A 4E5YA 3M1AA 2HKIA 3W4IA 3HJAA 3PFWO 5C7LO 3M2TA 3I1JA 4IS3A 1D3AA 1R4MA 4XYMA 1BDBA 1EEHA 4CQLB 1M75A 1GCUA 3DZIA 3MCVA 3NV9A 3PZRA 3PJFA 5G0UA 4B7CA 3QWAA 4MP6A 4OXYA 3WQQA 1Q7BA 4BIIA 3DTYA 4CM5A 3Q2KA 3TOXA 4HUJA 1NQ5A 2HDHA 4GX5A 3JD2A 5FYDA 1YJ8A 2C07A 3QE3A 4OXKA 3F6YA 1YO6A 4P8RA 4UEJA 1G0OA 3D64A 4NBUA 4U6SA 1OC2A 4CLEA 3DMTA 4MVJM 4LMPA 2BGMA 3FNEA 1CRWG 1AHHA 1FXSA 1IY8A 5IF3A 2B4QA 1PWZA 5FF9A 2W90A 2VCYA 4RPKA 4ZGWA 3GF4A 4J1NA 1JLLA 2I3GA 3VTZA 1JDJA 4P4LA 1ADFA 1F8FA 1UR5A 2Y0DA 3RUIA 1NR7A 1LX6A 2EERA 1MG5A 1YL7A 1B14A 3AM4A 3ON5A 2BFMA 4XRGA 5KJ1A 3H3JA 1YRLA 4RLHA 4G81A 4GMFA 4CM6A 4W99A 2ZTMA 1C1XA 1C14A 1C1XB 4CV0A 4NI5A 3JQ8A 3DMTC 3NTQA 2H5LA 4OIMA 1ISJA 1Q7GA 4B7UA 1NR1A 1WNTA 1JWBB 4I5EA 4AJIA 1IE3A 4CQLA 1DPGA 1F8GA 3VTFA 1O0SA 4MP3A 4XJSA 3VC7A 1DIGA 1HYHA 3AM5A 1IZ0A 4DPMA 1YL6A 3BHIA 4IDEA 4IQ0A 4J91A 5DCUA 4NJMA 3K92A 5G4LA 2FZWA 2UUOA 1HDCA 5L45A 4XZ3A 3A06A 2PKRA 3KV3O 4D44A 5ADHA 2Q99A 1ZJYA 1T4BA 1NFFA 3RUHA 4LVUA 1XU9A 3S55A 2C7VA 3EGOA 4PZDA 1EMDA 4M8SA 1B2LA 5TLSA 4IMPA 5F1OA 3IUPA 2E6UX 5L9AA 4BNIA 2DC1A 4H15A 1UXJA 3DBRA 4GI2A 5EESA 3I5MA 3OECA 1JW9B 4ALKA 3RJ9A 1GUFA 4W7IA 2EKPA 3JYOA 1UUFA 3JD0A 4WUVA 4BNMA 1K6JA 3CUKA 3F5QA 3GC6A 1B26A 3VZPA 3MOIA 1W6UA 2B4RO 3ANMA 4HFRA 3WGOA 1Y1PA 2FSVA 2Q46A 3CE6A 2EKLA 1E3WB 2HRZA 4DC0A 3UKOA 1B16A 4YJHA 1PJ3A 3OJEA 4GAEA 2GO1A 4GSKA 5CHEA 4W9NC 1E7RA 5ILGA 1D1TA 1YB5A 4YT2A 2VWQA 3RFVA 3C7CB 2YHUA 1R15A 3OF2A 4Y9DA 3UN1A 4D43A 2D0IA 4LW8A 2VUUA 3E9MA 3QVOA 4FC6A 4K1LA 2A9FA 2VYVD 2Q45A 3ORFA 4AJ1A 3ADPA 2YW9A 1YL5A 4CM4B 3LVFO 1R66A 2ZYGA 3KOUA 4DYVA 3LT1A 3TZ6A 1ENPA 4GGOA 3ZU4A 4FPXA 3D4PA 4D0RA 1N7HA 1Y8RA 5TC4A 3UHAA 5BSHA 3H3FA 4IJUA 1E1KA 1K6IA 1YQXA 2HJSA 2C0CA 4A26A 4BNKA 4EEZA 4YJDA 4QECA 2Q3EA 4FJ0A 1N9GB 2DT5A 4R5HA 4WOKA 4YQZA 3FD8A 2CUKA 1PGJA 4HFJA 5DBIA 1U5CA 4J7UA 1ML3A 4AJNA 2AG8A 3JSAA 5A9RA 4QEDA 3OEYA 2G82A 1KIFA 2WD8A 2IODA 4J7XA 1QSGA 1MXHA 3KTDA 1PS0A 4RPHA 1OC4A 4OHUA 4KUEA 4LSWA 1FK8A 3B20A 5TJHA 5HTOA 1T2DA 4ND5A 1LEHA 1BTOA 3AY6A 4BO3A 4B4WA 2XF8A 2YFQA 3GAZA 5DCYA 3QY9A 4NJMB 4W82A 2FWMX 1LSSA 3D7LA 3SVTA 1GCOA 4K6FA 4O1MA 1LRKA 1V9LA 1Z75A 1BXZA 1GR0A 1P45A 3A28A 3V1YA 2EW8A 4P4GA 4D3DA 3GDFA 2GZ2A 3GGOA 4A73A 2VHWA 2X5JO 3GMSA 4OM8A 3WFIA 1HDXA 2FSSA 4XWYA 4XQEA 4AJ2A 3RD5A 4CLRB 2I5PO 2EIHA 5IZCC 5BR7A 1M67A 5A1TA 1VSVA 3GR6A 2Y1DA 4J2OA 4IINA 4WCFB 1HTBA 4U5QA 5A04A 3MJEA 1DHTA 4O59O 3GG9A 5B4TA 3NKLA 4BB5A 4LK3A 3VOSA 3C8MA 3DHEA 5CG1A 5ER6A 4ALJA 1Q1NA 4NU6A 3ZHYA 3BMQA 1Y6JA 3MTGA 4Z3KA 1O89A 4MP8A 1ZMTA 2JFGA 2O3TA 3I9MA 3JYLA 1K2WA 4W4TA 3ZU3A 4B8ZA 5B4VA 2JAHA 1U1IA 3Q0EA 2BGLA 3B1JA 3WGTA 1MP0A 3ITKA 3K5PA 3RUDA 1BHSA 1LDBA 1TXGA 3OIGA 1C0PA 2FR0A 3L6OO 4TRJA 1KETA 4E4YA 4RVFA 1BVRA 3KM0A 1BDMA 4I9NA 4E32A 4E2XA 4J49A 4XX0A 2C29D 3IAHA 3O9ZA 4I9HA 5A03A 1NM5A 1NHGA 2VWHA 2EJWA 2HJRA 1H2BA 5FI3A 2OL4A 3GEGA 5AXBA 3VH4A 3OICA 4E2YA 3ROPA 4Z0TA 4GPD1 3WNQA 4AJLA 3E1KA 4M54A 3F3SA 1TB4A 3QIVA 2VWGA 4HP8A 3CIFA 4PG5A 1IZ9A 4CJXA 4IXTA 4CMAA 2HSDA 4ND3A 7ADHA 1GADO 2O3RA 2CDAA 4HX5A 4L4SA 1Z82A 4E5MA 2PKQO 3QHAA 4AJOA 1WLYA 3D4OA 1MC5A 5CDYA 2D59A 2JD0A 2IZ0A 5EMHA 3SJ7A 2NUAA 1A4IA 2PD4A 3HSKA 5BNIA 1PS9A 3RUCA 1FDVA 3PHJA 3RBVA 2PD3A 3UFXA 2AQIA 3KLMX 1ZK0A 4BVAA 4R16A 1QKIA 3O8QB 5T57A 3FTNA 4JXKA 4LCEA 4YAJA 5L40A 1WDKA 2VHVA 3I9KA 2OMEA 3WS7A 3B70A 1E5QA 4IMRA 1RM5A 2EKQA 3CZRA 1M66A 2EP7A 1F14A 1ZEMA 1E7MA 5KJEA 3WXBA 1SPXA 4X54A 3EVNA 4YR9A 3SXPA 1T1SA 4FCCA 4NK4A 5TF4A 2AEJA 1W0CA 1OFGA 2PFGA 3GUCA 5JNLA 1NWCA 4QXMA 3W6UA 3DONA 3EY4A 3BTOA 1PJ4A 4Y6SA 5G4KB 5HBRA 4WEQA 1LDEA 3G3EA 2GZ3A 2VQ3A 2AQHA 2QG4A 1NFQA 3QVWA 4OL9A 5CDSA 1WZEA 4E5PA 5L7TA 2YYYA 3UCXA 4WCFC 4ZRNA 2HRBA 1E1NA 4G65A 1IB6A 3L9XA 1EVZA 2Q2WA 2GGSA 1YVEI 4NR0A 4ND4A 1C1DB 4TRMA 5H83A 1TA4A 3F4LA 4I5FA 4PG4A 2VHXA 2CDCA 3I6IA 3HN7A 1Q0HA 3JV7A 2DU8A 4IQGA 1VC2A 1QV6A 2C82A 4DVJA 3DWFA 3DFZA 5IN5A 3KSDO 5DULA 3WGGA 3GNQA 4QO8A 1ZFNA 1F0YA 3PYXA 1M6WA 3WBBA 3O8QA 1P0FA 4JJGA 3W1VA 1YDWA 4W7HA 5JCJA 2ET6A 4DIOA 4RPLA 3AY3A 3Q6IA 4DREA 3NEPX 2QZZA 1PZHA 1R0SA 4WECA 4JJIA 1P1FA 2JJYA 1KERA 4AG3A 2FN7A 3VH3A 1RPNA 4ZN6A 4RVHA 2PKQP 4TKMA 1P74A 3G1TA 2YV1A 2ZTUA 1OAAA 1NQOA 3GPIA 4E33A 4YYZA 1KEVA 2ZYAA 4LMRA 4AL4A 4CLXA 3ZW8A 4MVJA 4I08A 1XEAA 4PIVA 1HE4A 5T64A 3TNLA 3TZCA 5TRTA 4Y6RA 4B4VA 4DPLA 5U9CA 1ORRA 4W6ZA 1BXGB 1QLHA 2OBNA 1YOVA 2VOJA 1I32A 1UAYA 4WK6A 4DRYA 5JO9A 4OOEA 3NDIA 3WJAA 3QLJA 1DB3A 2B5VA 2VHZA 1EVIA 1LC3A 3PWSA 3KSZO 3TWOA 3V2HA 3INGA 5A9TA 3LF2A 1EUDA 1MXFA 3JYQA 3HADA 2ZCUA 3A4VA 4BNJA 3C24A 2JL1A 5T5QA 3B6ZA 2E37A 1IL0A 4OYRA 2RH8A 1U4SA 2TMGA 4E12A 1SOVA 1ONPA 1GQYA 5CPBA 1H6AA 4FS3A 4HBGA 1X0XA 2JAPA 1LUAA 1DLJA 3RIHA 1FDUA 1KS9A 4C7JA 3FNGA 1ZK4A 4WASA 2JD2A 4CUZA 3HZZA 4PRKA 3F47A 4YDRA 1R6DA 5H81A 1SCUA 4L73A 2BFOA 1BXKA 3Q9NA 3WLFA 2PWZA 4DGSA 4II3A 2OGUA 1NQAO 4MDHA 4AICA 1ZXLA 3OA2A 1FF9A 4GLOA 1MB4A 5LDGA 1XU7A 2GN8A 1L7DA 5DF1A 2HLPA 4IZIA 4KQXA 2DFDA 3DAFA 3ETGA 4CM7A 2IRWA 4JGBA 2I67A 4WOJA 1ULUA 2G1UA 2WWRA 2AE1A 2X0NA 3EUWA 3CPSA 4R3NA 4CV3A 4ZQEA 3CMCO 3C7AA 1J6UA 1VM6A 2FPGA 3JQBA 4ND1A 1PGPA 5I9MA 2EWMA 2CFCA 5L51A 4QT0A 2CVQA 4BNFA 2OXIA 1XHLA 2PGJA 3L4BC 1A27A 4N5LA 1EE9A 1XYGA 3O4RA 1B8PA 4BNTA 3KLPX 4HNHA 1H2HA 1PJSA 1LDNA 4CM8B 2EP5A 3INRA 1DIHA 1O94A 1ZZEA 1S7CA 3EZYA 4R68A 1ZK2A 4DUPA 4KMSA 1ISFA 1UXHA 2J3IA 1KVQA 3G0OA 4MPDA 4B3IA 4F46A 3VH2A 1UDBA 1K89A 3OIDA 4NBWA 4D45A 7MDHA 1MC4A 1H93A 4GH5A 4MVJE 1A5ZA 1WVGA 1K0UA 4R5MA 1NBOA 2Y93A 1AHIA 3R6DA 2DM6A 1JU9A 3GOHA 1O8CA 3AU9A 2H1SA 3DO5A 4BO0A 1VPDA 2X9NA 1GU7A 4R51A 1IHYA 1A4UA 4YWJA 4ZJUA 3ZWBA 1HZZA 3EYWA 3RFTA 5JSFA 3S2GA 1DAOA 2UVDA 2BF7A 5JPIA 5TX7A 1UAGA 5BT9A 3RJ5A 2WSBA 1KY4A 2Z95A 3HE3A 2Q1UA 2BD0A 1D7OA 4DIFA 2VZ0A 4ALNA 5JDIC 5K6AA 3IQDB 4MO2A 1SEVA 3W4KA 4JJFA 3U3XA 4GLLA 3JQFC 1DRUA 1ZK3A 3GEDA 2DPHA 2FP4A 2PZMA 8ADHA 1YE3A 3K2EA 2DBQA 4GMGA 3ZWVA 4L75A 1DFHA 5A3VA 2DUWA 2D4AA 2CD9A 1SOWA 4ESOA 3PJDA 4G2NA 2HAEA 4XRRA 3TDKA 2Y66A 1J0XO 4FFOA 1BVUA 1LNQA 2NTVA 4IDFA 1HDYA 4ND2A 1WXDA 3M2PA 2PA3A 1W4ZA 5U1PA 4YCAA 1ENYA 4J0FA 1R37A 4YTEA 1BW9A 3ZU2A 4J9VA 4RL6A 4E21A 4R1UA 2WDZA 3UICA 3QJ5A 4ALLA 2E48A 3H7AA 4ZQFA 1E6UA 4ZRMA 1DIBA 3DAPA 4KTTE 5A02A 3GDOA 4UVDA 4E6PA 2OFPA 1OI7A 4YJFA 3W6ZA 1O9BA 1YB1A 3I9LA 1SO8A 2IZZA 3AFMA 3E48A 5GZ6A 4M55A 3GEMA 4N7RA 4CV2A 2PNFA 2E4AA 3G49A 2AEFA 3FHLA 2B5WA 4YPOA 1ULSA 4IDAA 2P9EA 3FWZA 1SBYA 2XXJA 3BMQB 3DBHA 5COQA 4NFYA 1GFSA 5B37A 5TIIA 1GEEA 1LLQA 3OEWA 3W8FA 4ZQBA 3K31A 2P5YA 5GZ3A 4RVSA 1HSOA 2VYNA 4J9UE 4OXNA 1LC0A 3U9LA 2VNSA 4OMUA 1E77A 4XDYA 1EDOA 2DBZA 3BTUA 4KUGA 1Q7CA 2VRBA 1J4AA 4RV9A 2TMDA 4YRBA 4CPDA 1PL7A 3UAGA 1IYZA 3MZ0A 1V0JA 4RO0A 3FPLA 3ZWMA 4YXFA 5JW6A 5IDWA 3IC5A 3I6QA 4PLFA 1JTVA 3WQRA 4PN3A 1PGNA 4J4HA 3GNSA 1TLTA 5JO0A 3ZZNA 3FBTA 2NV6A 2GN9A 2HK9A 4PLPA 1UDCA 1X7GA 1NPDA 1DDOA 1YDEA 3HFSA 3WBFA 4AJKA 3EMKA 1PQUA 1LLCA 1ISGA 4O5OA 3S2FA 3PJEA 1SEPA 3FWNA 1EK5A 2NTJA 3GN2A 3I4FA 5TQVA 2QRKA 4JK3A 5A06A 3SJUA 3RC7A 4BNXA 4ALMA 4QTZA 3RUAA 3JQAD 3HB5X 4J1TA 1DIRA 2Q1TA 1LA2A 2Q2QA 2WYUA 4MVJP 4CMCA 3Q3CA 1AE1A 3FR7A 3WFJA 3D0OA 4CM1A 3HUDA 1HDOA 4EW6A 4Q3NA 5IDQA 4CL8A 2AEMA 3WX0A 3TZHA 2HMVA 4BHTA 3HQ4O 1PJCA 5JCJD 1DBVO 1E1LA 3PGXA 1X1TA 2AA3A 3IOYA 1X13A 5K9ZA 3JQBC 1DIAA 4FJ2A 1U7HA 2YHIB 1L1FA 3W4JA 2A94A 4FGWA 1VI2A 2HMWA 5JS6A 4BNGA 4DYDA 4INAA 3FI9A 4ZA2A 3K9QO 5L7WA 1LSJA 1T25A 2H6EA 4ILKA 1O95A 5FI5A 4BKOA 5GY7A 2RBEA 3AUTA 2VWPA 4R01A 4R54A 1RM4A 3I83A 1DJQA 3KYCA 3O38A 4NMHA 4BMNA 2GD1O 3KHUA 2B83A 1G1AA 4BOYA 5G0WA 3ZI0A 5I7SA 3UXYA 5C7OO 2NU7A 3S2EA 2I65A 5KNLA 5COBA 3UUWA 4AJJA 2X9VA 2EEZA 4P4NA 4Y6PA 5IDYA 3PHIA 1O5IA 1U3UA 2P9CA 2ZB3A 3B1KA 3OQ1A 2R00C 2GF2A 1FDWA 1ZMOA 2BGKA 4B3HA 1PTJA 3FTPA 3L6DA 2FOIA 1DHRA 4XIJA 4AJEA 4RCVA 2AXQA 1U2DA 2RHRA 4CMKA 3C1AA 1LDYA 3JD1A 1SMKA 4IDCA 2Y0EA 3QVSA 3ZV3A 4HFMA 2NVUB 1NXQA 1ISIA 2P9GA 3BHJA 1PL8A 4L74A 3EC7A 1YBAA 4CM8A 5DDIP 3F1KA 3EDMA 1I01A 1CJCA 2Y1CA 3R0IA 3ULKA 4A7PA 3E9QA 1QG6A 3WLEA 3RUEA 1U3WA 1Y8QB 4FFLA 4MIOA 3JQ7B 4FOOA 2OP1A 4BNVA 3FNFA 3MEQA 2C5EA 2DTDA 2RIRA 1I10A 2B0JA 1GUZA 2Q1SA 3PVZA 2I66A 2EXXA 3IS3A 5DN9A 5THKA 3MJTA 3C85A 1S6YA 1TT5B 4CMIA 3DAGA 1O6ZA 4I1IA 5G0TA 1E3LA 2XAAA 2WD7B 3U62A 5DBFA 1MUUA 3RWBA 1PJ2A 2NADA 4M89A 5F5NA 1GYRA 3H2SA 3WYEA 3Q1LA 4BGUA 2ZYDA 3IUSA 1RM0A 1U8XX 4YAKA 1I5RA 2IYOA 1PSDA 3VKVA 4IJKA 4CLOB 3K96A 3ZHBA 3WGHA 1PGOA 3H9UA 3ANLA 2IXBA 1QV7A 5HA5A 1HZJA 4EZBA 1OBFO 4RPJA 1T2FA 4JN6B 4WLFA 3WNVA 4DA9A 3LDHA 3OFSA 2FMUA 4HKTA 1R4MB 4ID9A 5CEJA 1SB9A 3MTJA 2J6IA 5JCXA 5JC1A 1GYPA 1YGYA 4BO9A 4E2ZA 4A0SA 1I30A 5KIAA 1U3VA 1WPQA 1LXCA 3QWHA 1A7KA 3QA9A 2X22A 5F5LA 1EE2A 4NPCA 2A4KA 4O6VA 5JAQA 2BLLA 2Y1FA 4JIGA 5FEUA 5A9SA 4Z0HO 4RORA 1VE9A 3HFGA
chains in the Genus database with same CATH superfamily
2Q1WA 1NX6A 5KNDH 1ZN9A 5FBWB 2P2GA 4DA8A 4B3RB 1LS6A 3RC8A 5EIEA 1GRNA 3KAPA 2I78A 3QH4A 3TXXA 2CVZA 5F21A 1JR3E 3QEMA 4W5TA 2RHLA 3LT5A 4X7BA 1TJNA 2AJTA 5ALQA 4JHXA 3DS8A 1R00A 5HRCA 2Q6IA 5DM70 5LXTB 1DC5A 3JQ9A 2ZAIA 3LGAA 3FCAA 3HRIA 3WG9A 4F8YA 3MAJA 4N48A 4ZZ3A 1N2JA 4FW9A 3GP3A 2ACWA 4TV9F 1WQ3A 4GKKB 5JJBA 4FBMA 2C5FA 1Z4IA 4UEKA 1V1RB 3VZRA 2XHZA 1W0KD 1ISPA 1Z5UA 2ZIEA 4N3CA 3UMCA 2CXRA 1H1DA 1L1RA 2IK8A 1C8KA 3DLTA 3GZNA 3IELA 2REXB 3N70A 3UOGA 1KFBB 3RS0A 1NG9A 5CP8A 4UZSA 1N0VC 4E70A 1SUCA 1DDGA 2V8OA 3ABIA 3AILA 1G5QA 5IPFA 4BDSA 1E3JA 2HPAA 1XQ6A 3TRHA 1DWQA 3KX2A 1R0ZA 1RXIA 2RCNA 3MPUA 4L4ZA 4YJGB 5IK2D 1QG2A 3SC2A 1IBMB 1N92A 1FE8A 2J3EA 3DPSA 1VBMA 2EFDB 2X5OA 3Q3HA 4JQYA 5FR1A 3PHHA 1QHEA 4J3FA 4RF3A 2YV4A 1V95A 1RRVA 2YNMD 4NEQA 4F3RA 5I3ZA 4BFXA 2IYYA 1NU8A 3K73O 2WG2A 1NW3A 1M34B 4Y0AA 2CLMB 4W1PA 2FDCA 4ZK2A 3PICA 1ODFA 5DP2A 2XOKD 4RMIA 2EBFX 3LQ2A 2X8BA 1VL6A 3NAMA 5K0TA 2FMTA 3AKYA 3DZFA 1OGYA 4M0CA 1V4BA 5ESXA 1JVSA 2W7TA 3SBOA 3SYTA 4BX2A 4YIHA 2RD2A 1R0CA 3LT0A 1Q1ZA 5BVHA 3VVCA 1I5EA 1T6BY 4J1QA 5LP6C 1DIOB 1FDSA 2XMDA 4LV6A 5ES3A 2CF5A 1U2SA 1SAYA 3MWEB 2YWCA 1Y3AA 2OWEA 3IX7A 2KJQA 1GZ6A 3HKBA 1Q3KA 2OYRA 3TW8A 1EWVA 1SG0A 2KB0A 3QE9Y 1KI6A 4I50F 5LLSA 2GPBA 4RJKA 2OD2A 4V1CB 1XRPA 2BI4A 5CDHA 4G5RA 2EV9A 2GYVA 1EFUA 3JXEA 1JXAA 1LF5A 5JASA 1JPJA 5AQEA 4TRNA 1G66A 1A5TA 4Q5IA 3IP7A 1KMNA 1E3DA 5ENDA 3B9QA 3PFFA 3WMGA 1Z2PX 5AXAA 9LDBA 4ZHSA 4LWQA 1U65A 2EFHB 3K16A 4HRXA 2CLLB 2ZI4A 3DBVO 4ARIA 2Q4OA 5K4GA 4MS1B 5ERXA 4CLEA 1T6XA 3N28A 1SXJA 3WA7A 1A97A 4GOKA 5MFPA 2YY7A 4R7ZA 3GBSA 4O4HA 1TLLA 2Y1EA 2QLNA 2EZUA 2F8LA 3NGLA 1GPNA 3DL2A 3GQVA 4MKZA 3G0HA 3P2EA 2E4VA 4N3GA 4B4UA 4MVWA 2X8LA 5EIAA 3RM3A 3AFGA 4TVBA 3FIJA 1F8XA 3OX4A 2HLNA 1LSUA 4FR2A 4IHQA 1E2GA 3JVDA 2DLCX 4DT1B 5K0EA 1P6UA 2OORA 4YROA 1E92A 3BEOA 2D2EA 1FVOA 1M73E 4FUQA 2OR3A 1G8SA 1M34E 5LCXA 1C0LA 3R6WA 1DTWA 1H1TA 1O4WA 1VBNA 3FGNA 4ED9A 1T1JA 1UT8A 1CS4C 2B6NA 2CSUA 2C8JA 4B46A 4OU5A 4JI7B 2B7CA 3AYZB 2VT6A 3GJZA 1A82A 3NHRA 1I3MA 3ASZA 4S1VA 3WE7A 2F1OA 4CTOA 4F71A 4CTJA 2C9MA 5FI0B 1FBNA 2ZJAA 5EJFA 2WNSA 3F9IA 4CIXA 1RQ7A 3NX4A 4QQKA 4WNAB 4JX8A 1J8MF 1EUDB 3AL3A 5L3ZA 1IHDA 5BW6B 5B3LA 4R3WA 1J1IA 3VSDA 4CR8A 3SR3A 5JS1A 1WPRA 2R5WA 3DC2A 3O95A 1JDVA 2FWNA 3PPYA 3RWOA 5C53B 4U63A 1QNFA 4QTTB 3EPKA 1QG0A 2BZ0A 4GQIA 2WJIA 2FG5A 1IULA 2Z5GA 2VJAA 2ZIZA 1NBAA 1BQ3A 1OROA 2LV8A 3TR0A 2WG0A 4TTAA 4XJVA 2OV1A 3WWEA 1CETA 3NH9A 5HUHA 2RC5A 1HNNA 4CXMA 1RTKA 1GTRA 1IOZA 3A6ZA 3TTXA 1PV2A 2ORIA 3UGJA 1N75A 1RRCA 4PZUA 1H3EA 2GRUA 2J9GA 3D3NA 3L0DA 1OZAA 1KEWA 3C0KA 3LX5A 1NP7A 5G2OA 4WK2B 2IU6A 2QIPA 2WTUA 1MJGA 4H1UA 4OMDA 1UKEA 1THGA 2AN9A 1HDEA 2W4QA 1P0IA 4J0JA 5E38A 1DO8A 3AUSA 1OAKA 4F3NA 3RGGA 2Y2VA 1C3OA 1VRCA 1KH3A 2POQX 3FPCA 3L8HA 4D3ZA 2VJMB 3PCXA 1JBEA 3B6MA 2W8ZA 2R1ZA 2FHSA 3AZPA 3H99A 3L5KA 2PS0A 3MINB 3O8DA 4FD3A 4ZZ0A 2ZVPX 2X2OA 3H1GA 2P3QA 3PGMA 3ZE8A 2J8ZA 4C0SA 1H2XA 1HE5A 5G0SA 3RAEC 2WU1A 4MINA 2C20A 1XDGA 3M8KA 2O9JA 3ZY6A 4IOLA 4JNKA 2CE7A 3MB8A 4Y18A 5CB8A 3VNVA 4DIDA 3RQSA 2C54A 4BYMA 2ZIGA 1KPHA 3ZXXA 3S70A 4M0EA 4C20A 2PGLA 3I5AA 3DLHA 4BWYA 4CLDA 2OVBA 2P27A 3VXKA 2QYOA 4LOKA 2WYWA 2B69A 1IPFA 1EBFA 4IQ4A 4Z9YA 1HXHA 4KBGA 1OFVA 4ZAYA 2XUGA 1O6GA 3BGIA 1TTHA 1HE2A 1G19A 3PEYA 4L0DA 3LQ1A 3HO6A 4N5MA 4LK2A 4BZXA 4R71A 5HW0A 2DQZA 1Z0KA 4LZWA 4AKHA 4KIWA 4AI6A 3NI2A 5CTJA 3T3GA 3JTMA 3TLGB 3W6PA 3AEQB 1FFEA 4ZDJA 5K8VA 5AVZA 1M83A 2OB2A 1W5SA 1SXJD 2QJTA 1YOBA 3OU7A 5HOQA 1IN5A 1EINA 1AXGA 4H3KB 2WFAA 3OTOB 5DCWA 1ZOOA 3E3NA 3NRBA 3JQGB 2QHXA 5DOZA 5JI2E 3YASA 2OV6A 3BE6A 2OFWA 3QP9A 2RGDA 5H3CA 5CD9A 2A1IA 4BN4A 3OPYA 2QM3A 3PNSA 2JGRA 1I2CA 5FTMA 1HEYA 3RI3A 3WWYA 3CVVA 4HWOA 2VDMB 4D46A 3G13A 4Q9NA 4QOJA 4IF4A 2W9XA 3VSEA 4V0NA 2J9FB 1FX1A 1SIWA 3A0RB 4MA4A 5FWYA 1E2UA 5DYWA 1JX6A 1JQJC 2AV6A 4I1UA 3SHOA 4MI1A 4IV0A 4DPKA 4RHEA 3F6SA 3CEAA 1P9NA 2XUKA 1FYXA 3C48A 4AZ3B 4DBLC 1M1UA 4GE0A 1JEQB 2CXTA 1RE0A 1IU9A 2GZDA 4QGFA 3BULA 4RMGA 4UUQA 1NNSA 3ADOA 2H4YA 1OWLA 3D4BA 1TAGA 3FPHA 4NV3A 4P7BA 5A4AA 2H11A 4M0PA 3D6AA 1MQSA 1YJAA 2RK4A 4NOJA 6AT1A 1UIMA 4D57A 4FB4A 2VVTA 4GGMX 1M6HA 1UKBA 1XDDA 3IAM6 4I55A 4D42A 2EG5A 1KAQA 1I9GA 2HD4A 1TMKA 3DHVA 3UHPA 2G0NA 3FOWA 5CJJA 3WLSA 1X7XA 4BKUA 2PU7A 3W7AA 4KJZA 1YDFA 4CR6A 1E6MA 1QCDA 4LHXA 2GPTA 4YRPA 3ENKA 3KIPA 3GLRA 3NJ8A 4FBLA 1BVYF 4L8VA 1E63A 1QS0A 2R4TA 4UBMA 3ILSA 4C78A 2O2ZA 2FY8A 5FOXA 1K8RA 2GERA 1QFZA 1D0IA 2ZSKA 3IDQA 4ZI7F 1ONBA 1YQEA 1UDXA 5IG2A 2HRCA 1I3CA 1TJ3A 2GBFA 2O23A 2JC3A 1X7WA 1W30A 4A2CA 4UAJA 3RVQA 2CBZA 5IVIA 1WWKA 2RFLA 4GUDA 4XQ0A 3GJXC 5JXHA 3ZCQA 1XTIA 3GLFB 2P11A 1QHHB 3DZJA 1DAPA 3MC1A 1YJQA 3I5UA 4XB1A 5FQNA 4JI1B 5IKXA 4OB8A 4XD7A 2JJ2A 1O96B 3N7TA 2V6IA 1Z0ZA 2GEKA 4HDSA 4BGDA 1FPMA 1KTVA 5KCMA 3CLRC 3HHPA 1QAQA 4R9SA 3WFZA 4E94A 1Z25A 4A23A 2HK8A 2YXDA 3SYNA 4QKQA 3WB9A 3N8KA 5JNVA 5KX5B 3RU2A 3MFQA 3MIZA 1YBHA 4MKXA 4I6JA 1OIWA 1EGVB 3OPXA 1SCDA 2AG0A 2R2AA 3DFIA 1VJDA 1CBUA 4M0DA 4MMXB 1X7DA 2NU8A 1ATIA 3JWHA 3AVYA 1P1CA 1RM3A 3CH4B 1CR6A 4RK0A 3TIIA 1QAMA 4NMMA 3C87A 4X8LA 2I4LA 4RTJA 2OPHA 2GNOA 1FB5A 1UMCB 2FN3A 1E2EA 3MJSA 3FJOA 2D3TA 3W2FA 4BN0A 1MVOA 1Y3BE 3CLUC 3FOBA 3PRJA 4W5QA 2JRCA 2E21A 1SD5A 3HP4A 3LBAA 4M49A 4Q12A 1H5QA 2XVZA 3G1WA 4BRZA 3LO5A 1R8XA 2QXYA 3QVKA 3T0IA 3T1HB 4NDNE 1ESZA 2F00A 3IP9A 3NHKA 3ZJ5A 4CKBB 1M5UA 1VFPA 2Q9UA 3AIKA 3FTCA 1F2VA 1PQWA 3WP0A 2E1PA 3PFNA 1ZNQO 2C3PA 1CV2A 5CVVA 1D2AA 1JVBA 2C00A 3RRZA 1DKUA 2YNMA 2BFNA 1RXVA 1P1KA 1YXMA 4RPIA 3LPAA 3G2LA 4CMHA 3M9XA 2HW8A 1FFDA 1P75A 3P0EA 1P2UA 5I4IA 4KI7A 4Y9TA 3AR9A 3UV3A 1C3LA 4BC1A 2CJWB 4BO2A 4W6QA 4DANA 5CA1B 2VYQA 3CUUA 3C2QA 3C74A 4O4LB 3UJ9A 2X0RA 3G6KA 4LY6A 4POAA 5T41A 1U0OC 4WCFA 4F5WA 3F6RA 4MVJF 3RS4A 2CXXA 1R12A 4M9QA 4S0ZA 1NBIA 3P9QA 4RLQA 4TRRA 4X1OA 5A4DA 4B9EA 3TE6A 1TD9A 3GDHA 5EKSA 5JZSA 5IT5A 3U44A 3PG5A 2YN2A 3M3HA 3PDCA 4HNTA 1JRLA 4ASUA 1N0WA 1P1HA 5EPEA 1S1CA 4AMZA 4Z99A 2JRLA 2QN6A 4IJ6A 2YXLA 3V97A 3S1AB 4GEGA 3IPAA 2FOLA 3MLBA 3A37A 2FW0A 3GFBA 5EJGA 4HEA6 5C0OE 3EWAA 4NIMA 2GNAA 1LD3A 2IZ5A 5EHIA 2NQ8A 1XVLA 3VR1A 4EEZA 1S3IA 4A8PA 4BJ6A 2BFPA 2FJPA 3U9TA 2AUTA 4UHCA 1RQRA 2DERA 2VZLA 2ZJ5A 2GCGA 5CDFE 4ROSA 4YEDA 1KZGB 5JPDA 4XWOA 4IJVA 3TAXA 2FGKA 4NU0A 3JVIA 5LNK1 4DS3A 2X6TA 3IERA 3PNQA 1DZIA 3CCBA 3IAS1 3I8OA 4KCGA 4MPJA 5HQTA 2AKYA 2VP6A 1G64A 2G1PA 3K9GA 1F1JA 1S2DA 3I9NA 1USVA 2GN1A 4MRPA 3VVMA 4G9EA 4AZSA 4QYXA 3SEAA 2WA1A 2H2FA 4TQ9A 1MB3A 2V97A 2VRWA 3LUDA 3HA3A 4A2WA 5JH7F 3IQEA 1W85A 4M1QA 4CNBA 2FSIA 3CLRD 4OFBA 1BMQA 1CVLA 2D5AA 3O31A 3KUKA 4CE6A 3ZGZA 3A6FA 4RV4A 3FYUB 4G26A 1KZ6A 1D1PA 3O03A 2WF5A 3E9ZA 3QW2A 3OO1A 5HWSA 3KQUA 3DVSX 2HLHA 5AXDA 3Q0TA 4D74A 4DSOA 2GBGA 3ISJA 1JMYA 1IQUA 3FBGA 1JHPA 1Q91A 2ONKA 3UC9A 1FU4A 1ULHA 2A2ZA 2WSMA 2ZBFA 4DUYB 2C4NA 1ICIA 2Z8YA 5AI9A 1U8EA 3A6GA 2FFJA 1SOAA 2JCYA 2YYSA 1L7NA 3CH6A 4JT9A 3C45A 1SQFA 1ZR4A 4W7SA 4IXNA 4KRFA 3VHXA 4RDHA 2Q29A 2JANA 1H4QA 3FAKA 3SJZA 2IX3A 1N2CA 3QBTA 1HEIA 1VLLA 3BUSA 3NTOA 1HETA 2RHCA 2GNPA 3NC1C 4KR9A 5AK3A 2IYNA 2V7PA 2ZXEA 1NE7A 1JFTA 1GZSA 5AM2A 2AT1A 1K66A 1MNAA 2PMKA 4L5IA 3GPDG 4S1TA 2AX3A 5EINA 5KVQA 4ESEA 3GG2A 3F5SA 2DT8A 3GRKA 4N0DA 5B1HA 1L5YA 3Q7RA 4CRWB 1YHNA 1DUVG 3PLNA 5H5JA 1YIDA 1IN1A 2LXNA 2X1HA 3TOZA 4OF4A 2C96A 3LT2A 3QUTA 2ORVA 4DLAA 1F2UA 4O63O 3H1PA 4NKRA 1DSSG 5EERA 2PWYA 4YJ2B 5I4CA 5IKMA 3JATA 4JXXA 2NZVG 4ZCIA 3O8LA 2NO6A 3KUDA 2IHJA 4Y1RA 5AJXA 4Q19A 3ZE6A 4UAUA 3HRHA 3N8DA 4N3AA 2JLAA 2ZM6B 1K4MA 4L2IA 4H7DA 3H18A 3RF7A 3W8DA 1BWRA 1DEKA 1L4KA 3ZC3A 1CUAA 2ZSDA 3U3JA 1C7JA 4GIBA 4DZTA 2PX3A 1Q92A 3OCWA 3TEMA 3W9YA 1HPLA 4F92B 1O7JA 1HFJA 2JI9A 2O2XA 3NTUA 4UNRA 2NUTB 2R00A 2TECE 4D8WA 3M81A 1IJFA 2ZR8A 3E03A 3U0BA 4ER5A 1AMNA 4WY2A 3NFRA 4X20A 5AK6A 4FFPA 3KQYA 4E6EA 5KWVA 1Y8AA 1TTQB 3NALA 1S02A 2QVYX 3IIIA 3AX6A 1B3BA 1RJEA 4AVYA 5GONF 1XXHB 3PNOA 1FP1D 2JGAA 1DRKA 1N7IA 3ZWDA 4BLPA 1XXLA 2XB6A 3VSCA 1G5RA 2JA2A 1Y9JA 3OEEA 3QU7A 2JIMA 1NPTO 3QV1A 4OQLA 3THXA 2AI2A 2BFBB 4LI3X 2DWUA 2G4LA 3TVDA 1LU9A 4DLBA 4ENPA 4YIKA 5BNWA 1ACMA 2HBZA 4JLUA 5JS8A 4WADA 1ZEJA 4JUFA 2DYKA 2FW6A 5F73A 4KTVE 5GVRA 5A5DA 1EZZA 5JZVA 3D1LA 1JH8A 5CURA 4FEGA 5L3SA 1RP1A 1WXQA 3ZWQA 3SDSA 2X77A 1TM3E 3HDYA 3BXGA 4PQFA 3SR0A 5ER9A 5B2FA 1ND5A 3EXFA 4RA6A 3W05A 1M1YA 2IEAA 1DCMA 4PR0A 1S9HA 3AGQA 3BIJA 3Q3GE 4UASA 4RANA 5JYDA 3H19A 4IHJB 3VFDA 2Q4BA 1RQ2A 1OIVA 1KXZA 1FJXA 1UKYA 4ZXPA 3ICPA 1KZ4A 3TZQA 5I9TA 2IH5A 2F7SA 5CTAA 1G7CA 1ZJZA 1E8MA 1JQ5A 3TAHA 5TARA 3AHCA 2OCIA 1W47A 1IBSA 2GCEA 3A6DA 1E2KA 1JN0A 2QVGA 2X2FA 2D13A 3T8YA 5GP1A 1EPUA 2QGZA 4YCLA 1LB1B 3WMWA 1N5MA 1UEJA 4TLLB 4DXHA 2C94A 3N39C 5ALHA 3BJEA 3JWGA 5D3ZA 1KFJB 1YFLA 3UJHA 1IMJA 3CZAA 3JQ6A 4KE7A 4L95C 1RMTA 1F6DA 1P39A 4XIYA 4Y2GA 3SZGA 3U80A 1YQ9A 4C2AA 3HEAA 3Q7PA 4JYAB 2BEJA 2RGBA 3TD9A 1HOXA 4OSPA 3ZYCA 1LBIA 3PGLA 4B85A 1EA7A 1CHNA 5TQ2B 3RU7A 1X94A 2WIFA 4QSMA 1F3OA 4WTOA 2AFHE 3REQB 3ZDZB 3LVQE 2QT9A 4DAEA 1H2ZA 5J58A 1KDTA 2QL5A 2V7EA 1TF5A 4R9VA 5LQJA 3F6EX 3G02A 4AQDA 2FTKE 2WWIA 4JDUA 1JKXA 3H6GA 1PRYA 1E6EA 4FN4A 4H7JA 4JLKA 1Q20A 4RMNA 2A78A 3DOOA 2XUIA 5DIZA 4AZ0B 1VB5A 2WKSA 4KLCA 4G8JA 2O4CA 2JHGA 2X2PA 5EZ6B 1XJWA 3RKRA 4FVTA 3QWBA 4FKZA 4I4IA 2Z1DA 1Q0LA 2B35A 2ZYIA 4RD1A 1X1EA 3FN4A 4F2WA 3ZCPA 1FVHA 2QAGA 3EGVA 1G8GA 2VT7A 5CNKA 2VA9A 1WS6A 2QMQA 2YUIA 4AUKA 3ZKWB 5K0BA 2I3AA 2C5AA 4HAXA 3ZDBA 3EXAA 4CMIB 3PEFA 2QE6A 1YZQA 2VBIA 4PS0A 4EPVA 2ZZNA 3D6HA 1NBEA 4REOA 3TRJA 1RVDA 3GRRA 3LVRE 2QN8A 3QX7A 3UTCA 2D1RA 2R79A 5LVAA 3I72A 1PR3A 1B8UA 4PYRA 5I9BA 3K30A 4PBTA 3CZ4A 4MAAA 1A4XA 2CN1A 2CDBA 3RNOA 5FOUA 1QQ6A 3FUUA 4YPFA 4HNUA 1O97D 1A0OA 4FZ5A 4XGIA 2ENWA 1NIPA 2IVFA 1JEJA 1Y34E 3CV3A 4IIEA 4LWZA 4O4HF 1Z38A 4OH1A 5EJ2A 3WIDA 2O19A 3ZBQA 4C7KA 3EMBA 2OA0A 2C97A 2AW5A 3BRWD 1KZ9A 2JGFA 4XX1A 2ST1A 3W5HA 1IHPA 4UVIA 3DOEA 3HEMA 1LQ2A 1Z6ZA 3CF4A 4FT4A 1TCBA 1V7PC 3SS7X 4HXYA 4G5XA 3DLAA 3AZQA 3IR7A 4KQMA 2PJDA 4OAPA 5IYZB 2DY0A 2AS0A 2J5RA 4OPMA 1XRJA 4GM4A 5FUMA 3D1JA 2E89A 5REQB 4UDNA 4YBZA 1JL3A 4O8ZA 1VHLA 4MQ6A 4W1RA 3TPZA 2EL9A 4QNNA 5A9SB 1QO7A 2FRDA 3U7EB 1GJRA 2VRCA 2D0OB 1WB6A 1IEQA 2LTAA 3KTOA 2OSVA 3AJ9A 4CLRA 4JWKA 4LNAA 4IDOA 4H4DA 4Z0PA 4Z4GA 2H4XA 2B3TA 2WT4A 2G67A 3FB4A 3H65A 4HUQB 4B09A 2QLMA 5JH7A 1R50A 3DM5A 4CGZA 3EDYA 1FY2A 4TSKA 2Y1XA 2E49A 4NG4A 4QASA 1JQKA 1JYFA 2BIFA 3DKVA 2C2BA 3ESAA 1SNYA 4BQIA 4PE5B 5FOWA 4QQNA 4HX2A 1REQA 3HKDA 2ZW9A 4RGBA 5EE1A 3VMFA 1Y7TA 3OFJA 3N87A 1ZQ1A 1BJKA 1R0KA 4WNCA 1PCXA 1RYDA 4TT8A 4W63A 3UK6A 3J7AC 3QKWA 4QU0A 3QPVA 3Q72A 4HVLA 3K0EA 1IVYA 3PUVA 4HV4A 3A4NA 3BFPA 4O4IB 4WINA 2WW8A 4K9LA 2BGTA 2NO1A 4YHHB 3OQHA 1XMJA 1NTOA 4P08A 1RPJA 1QIGA 4ABYA 4EYOA 5B3JC 1MAHA 3H0KA 3PGA1 3PQ3A 1ZIXA 2HMAA 2D74A 1IRXA 5CX4A 3ND6A 1PZNA 4C08A 1XEXB 2ERYA 3UO8B 1YASA 4QFBA 3C5WP 5TGDA 3TLCA 1OTHA 4RTQA 4PO8A 1OX5A 5A4FS 1VI5A 4U00A 1E3SA 3ZTWA 3OMLA 4G4JA 4N5IX 3M4YA 4S1NA 4KVGA 1HLPA 5I01A 1AKNA 3BGOS 2QV7A 4Y6OA 4JBXA 4N82A 4Q16A 1LH0A 3WNZA 4WXYB 4LY0A 5L53A 2VAXA 3GAFA 3N1UA 5E1DA 1R6XA 1GGEA 2NXCA 3GWGA 1T36B 4OQMA 1R0BA 1U9CA 2PR7A 1EK1A 4ZT6A 5IAKA 1RI4A 4WEOA 4A4DA 1GZVA 4GBJA 4RC9A 3DVRX 4QYIA 4BBZA 1ZZGA 3NS7A 4M7RA 4O2LA 4NZMA 1RI1A 3LT4A 3R7WA 3OTIA 2W70A 2G4CA 2X23A 2QTNA 2X7HA 1SC1A 3SC4A 4E1AA 2LUOA 3DE4X 2BCJQ 3AERB 2WFLB 5HXAA 1T5DX 1G59A 4LF5B 4TL8A 3CTPA 2FZEA 3V1KA 4A6PA 4JC0A 2QX9A 3TW6A 1UZUA 4EG1A 3TW8B 3AZOA 1TUBA 1FQJA 4RVUA 2R0QC 2AEEA 1REQB 1CYDA 5FHQA 1NSTA 4JT2A 4UCWA 3QEAZ 4XH9B 2X0IA 3HBMA 2WA2A 2BDUA 3OCUA 3OY7A 1PR6A 3EQ8A 3OHSX 3M4NA 2V6MA 1IN4A 1Q1EA 2XVMA 3O9VA 5FPQA 3SEZA 3MWDB 5H9WA 1N3LA 1ZESA 5HP4A 3SP1A 1R5NA 1SKAA 4MB6A 2DR3A 3JX9A 2BM0A 4C04A 3UV6A 3HV0A 1G5TA 1E1YA 3D4NA 3EX7C 1QVAA 2NU9B 3AHFA 5AIBA 1WMBA 1SXJB 1LS1A 1Z39A 2I1VB 5B6IA 5LMCA 5EUCA 1E59A 1MN6A 4LNUA 3IILA 5HS4A 4TKVA 4JKIA 1QTIA 2JCXA 2PGOA 1UDRA 3OT4A 3LD9A 4M1KA 1IZ8A 1AS0A 2BEWB 2YOFA 3LWDA 4K8OA 2PT5A 1KFCB 2HIAA 4TN1A 2BUBA 3NVKI 3M6UA 2AL7A 3T3EA 1QZUA 1P0PA 4Y3UA 3AXTA 4J6FA 4IDPA 3LC7O 1G7SA 3OD5A 3CSDA 3U40A 1IC6A 3BJZA 2XTNA 5JPCA 4YAEA 1Y9EA 1WW8A 2O48X 1JAYA 4NQZA 2X41A 2GSDA 1Z2CA 1CSEE 1COWA 4EJMA 4B8YA 4FX5A 4DHEA 3AVPA 1JFRA 3EK2A 1F4LA 3BAFA 3GMTA 1R5BA 5FRDA 5I7FA 1L6IA 3MSCA 1GGHA 4J75A 3E23A 1HY3A 3PRYA 5H9VA 4Z8YA 1O58A 2FP4B 4UHJA 2JI8A 4QUGA 4XVCA 1M0EA 1DFIA 4DM7A 5K20A 2BMDA 4P7GA 4RNDB 2XMPA 3RAJA 3I28A 3IR5A 3KB2A 2IE0A 3E2MA 4XYBA 5EIWA 1AV7A 4I55B 3VKHA 1ISHA 1DEAA 1GPLA 1ONNA 1B3RA 1RYEA 2WSLA 2ZSBA 3K0FB 4MWTA 3ER9A 3L0CA 1KE1A 3OM9A 5AHXA 1H3NA 5JZMA 4HXFB 5B2EA 3JQ8B 4RTMA 2OHXA 3KWFA 1SHTX 3THWA 4HDRA 4HLCA 5EJ9A 4N0QA 3ROEA 1BH6A 2AMFA 4JJKA 4MUYA 2QA5A 2EKBA 1JEAA 2Z30A 5AXCA 2AHRA 3KQTA 3P27A 4MV4A 5EHQA 4D9MA 2QLJA 3L01A 2BE7A 3VYTB 3HJNA 1O0BA 4M38A 2GPWA 2V6BA 4IQ8A 2CCKA 1SC3A 4KIUA 4BO4A 4EKIA 1M7HA 1WAMA 1KMMA 3FVVA 4XX0B 4HAOA 5BV2P 3QEBZ 1I7NA 3HGMA 2WQ6A 2CV0A 2XNCA 2QD3A 4QX6A 1N2SA 4E30A 3G89A 2FEOA 1E66A 3H17A 4D8TA 1T3HA 3MLEA 3OF5A 5THQA 2V6FA 4OI1A 5IAGA 1CDZA 4HGZA 3C6MA 2Z8ZA 4KV9A 1VXOA 2JLCA 3E7FA 2HCBA 1ZGJA 2HBRA 3KWLA 4LOJA 3PQDA 1GUDA 2ZANA 4FDAA 3MIIA 5DWQA 3LWNA 1X87A 2IEBA 1EK2A 4GW3A 4KZPA 1PK7A 3G9QA 5JNRA 3KPWA 1PT8A 4AO7A 3ZWCA 4Y2HA 3PPIA 5C3MA 1J9GA 4WJZA 1SJ9A 3E82A 3RK4A 3ZS8A 2Q5IA 4HATA 3VC2A 5IBQA 4LE2A 3VUEA 3R24A 1TJYA 3FPAA 5DYNA 3QVVA 2TRSB 1U2TA 4MV7A 1ZMBA 3ABRB 5IVPA 1FS5A 3JAMA 3S2YA 4GR9A 4TL9A 1U2ZA 1FUUA 1AQLA 2DY1A 2VT2A 2BI8A 3UWOA 9LDTA 2YY6A 1C9NA 3JZMA 1HEUA 4NHOA 5LPNA 2QQ5A 3KYDA 4G5OA 2AQ8A 2BBWA 3AIOA 4K46A 2PX5A 4MKGA 4NAHA 3U7JA 5ELXA 2AZTA 1YTUA 1NVTA 3H75A 4YLYA 1EFVB 5JMPA 2DRIA 3ZLTA 2YV2A 3CUEF 3B9PA 3CZCA 5CYFA 4PGAA 1V8BA 2FZVA 3I3OA 4M0UA 2VYND 3HB9A 4BL5A 2WJPA 4Q4LA 2PUDA 3GD5A 4RKYA 1EM8A 2UVQA 3OFVA 2XQIA 4KQWA 5BQ5A 3MBIA 3DB2A 1TO6A 1CVRA 3IIEA 2V9ZA 1LPNA 3MOSA 4GRAA 1LQUA 4TYQA 4UOEA 5JEEA 4NCKA 4NEHB 3GLIA 1IM8A 1UJ6A 3RC1A 4NNJA 1Y5IA 3OOHA 4MV9A 3F78A 4JBNA 3RIXA 3GLIB 4FK8A 3LJKA 3WGNA 2ZRGA 2O7RA 3N2EA 4HRYA 1JE0A 3L0SA 5FP0A 4ND7A 4UHEA 4DIEA 1YJ5A 2WP0A 3WQSB 1ZNZA 1DMRA 5DASA 3CLKA 4GGPA 2VJMA 4LV8B 2CF6A 2JLYA 2P9FA 2K2QB 1HRDA 2PZAA 3C3EA 3D7MA 3I9JA 8LDHA 1NOIA 2FVXA 2Z83A 3KEFA 3VR4D 4BNHA 1O0CA 3KJZA 4LFCB 3EA4A 4F86A 2JAUA 3EGXA 1KI1A 1RC1A 3HUTA 2IEZA 3B2QA 2BM1A 3KOOA 4NBVA 5JRZA 5JFOA 1KQNA 3L8MA 2D00A 1T0IA 4BX3A 4BCCA 3ABSB 1IPEA 2CLSA 4RMJA 4UAVA 1OH7A 1T5TA 1RAIA 3H7IA 1JDBC 1AKYA 2H00A 5E3HA 2A5GA 1XTZA 2EF1A 2HX1A 2J08A 4R4JA 3E84A 3X3HA 1WCYA 4JP2A 1LLUA 3FLAA 4HAIA 4H1TA 2ZPUA 1ID1A 1EA5A 2QSJA 1R74A 4JASB 1FDIA 1KGDA 5CH8A 3NAQA 4V2UA 4DV1B 1UL1X 1XZQA 2X76A 4KGVA 1O6BA 5CAEB 3QYJA 1T1EA 3M0EA 3CINA 1UQTA 5C5IA 5CJ2A 5BPFA 1RCFA 1U1FA 4RW0A 1G9TA 5HKLA 4V0LA 2EKZA 3BRWA 5C37A 3NTRA 4K1XA 1QMPA 4X0EA 3TZBA 4LJ6A 2BGGA 2O50A 1N6KA 5E6RB 1NVDA 1TCVA 1E9RA 1E3QA 2D2FA 3CWCA 4EFLA 1B1AA 3T4XA 2MSLA 5IULC 4AS2A 3GELA 2CZCA 2FU5C 2C3MA 3OP1A 4Y7CA 3T41A 4DABA 2OK8A 4EECA 2ZB8A 3OQJA 1EZ4A 5CX1A 3O82A 2PYIA 5FOQA 3MBOA 1I6MA 2VP3A 3R3ZA 2E4XA 4JFAA 1L5GB 2QTTA 3FMVA 4AECA 1XDUA 2B4TO 3L46A 1DGQA 2OP0A 3DBRB 3RS3A 3TE7A 4S0XA 5CBKA 5IFKA 2HK6A 3QEKA 2I4TA 3BB3A 4HDNB 1A3CA 4BQEA 1FRNA 4OXQA 1AC5A 1WTAA 4NE7A 3G0IA 3EIFA 3TEJA 5LLDA 3D6MA 1A71A 4Y98A 3BMCB 3CZPA 3R6LA 1XRLA 5ERGB 5BQPA 4ZYVA 3RABA 3IJRA 2BFCB 2BRUA 4BV2A 4WBNF 1VLQA 1E3IA 2C77A 2EGHA 2FHPA 4Q4AA 1W94A 2PS3A 1G9SA 2VG8A 1JZQA 4H9GA 1G17A 4R05A 4LMBA 5AJTA 3RFFA 2Q8PA 1YC2A 2PZ8A 4YACA 1Y6ZA 2A0FA 3MWGA 3PDHA 3PQFA 4PPYA 5TGTA 3V34A 4MUAA 3EPPA 3CRRA 5IW8A 5DRTA 1K06A 3M33A 3PTZA 3RODA 1XYYA 2Y1LA 1U99A 4O4JA 3IO3A 1J09A 1RBZA 1PI3A 2QN9A 3O8OA 4OJNA 4OI4A 3SJAA 3L04A 4L4YA 5FAKA 2ZE8A 4B83A 4U9HS 1HTTA 3PP8A 1G98A 5KWJA 2CY0A 5FO0A 2C7PA 1SK8A 1G7RA 2IF2A 3L1VA 4Q7JB 1U0RA 3DBLA 3MT9A 1KYVA 4MVJI 1NVUQ 3AG5A 3W3AD 3ZQJA 5JSZA 1EAMA 1PF7E 3HVHA 4GNRA 4K6CA 2QTWB 3CLTC 2C59A 5DLEA 4OQDA 1DP4A 1KY5A 4JLWA 1N2EA 4JQCA 3OU2A 4O1HA 5H3LA 2H2GA 3LK7A 3ZZMA 1J5PA 3B53X 4FOSA 1QVRA 1KBOA 4PVDA 4WY8A 5ARBA 4GKVA 2D54A 4TZ6A 4WDQA 5I9SA 5ILQA 1JJFA 3B51X 1EP9A 4BMSA 1X7HA 2XGOA 3C8UA 1ZM7A 3JATB 1OASA 4OJTA 4P7KA 1UINA 4Z54A 2JCGA 4FYYA 1UP6A 3DTTA 2QAGB 3EEIA 2VZ8A 3IKVA 2RAVA 4D4KA 3SQXA 1T5LA 4V24A 3NT5A 4CKWB 3L9WA 3RRYA 3KRTA 3S4YA 3GH3A 2Y6UA 5DK6A 3FTFA 1QLWA 1ZCBA 4EUNA 4UTRA 1IOVA 4M8LA 4P5DA 4OXXA 5KKAA 3RS7A 1OV4A 2XVYA 5TB5A 4Q00A 5H59A 2GPNA 5L7YA 4KV7A 3O7WA 3CR3C 4TTVA 4B43A 1Y37A 3DYBA 2PNJA 2CJFA 1SCQA 4ZTZB 4KQIA 4BZWA 3DV2A 1PSZA 2QW0X 3L8FA 4ZVLA 4M1TA 3DMPA 3K6SB 1NNLA 2Q07A 5TSDA 1NXWA 5AW5A 2QV0A 1DQNA 4X84A 5F5XA 1D0SA 4A6EA 2BMWA 4IWNA 4N5HX 4G85A 5F2KA 4QTXA 2O7QA 3WHLA 3KOXA 1VSQA 4TS3A 5AKZA 4TKZA 5CYOA 4D0LB 2WI8A 4ZEMA 2R1TA 3NR2A 4GKBA 3UGKA 3W8RA 4DJFC 3I6YA 2UZ4A 6REQA 3KOWA 1I36A 3PNLA 3ZJYA 4CUKA 1NQTA 5HFAA 3WP1B 5GVSA 2P65A 3IUEA 4PC6A 1SCKA 1U8ZA 3KYBA 4ML3A 4Q0MA 3VAAA 1XPRA 4OSOA 2X5XA 2A3RA 4G0QA 2QTHA 1T26A 3A31A 3ZWYA 5FWDA 1BVHA 4NG5A 4QJIA 2FPIB 1GDHA 2R8ZA 1DARA 2CMDA 4FGKA 5F4BA 1P2DA 3OF3A 4GLBA 3VNBA 2WM3A 4MTCA 1MORA 4M0FA 3BA6A 3QI2A 5F52A 2QUIA 1C9KA 2YDXA 5HF8A 3Q5GA 2PQ2A 1EK6A 3GCWA 5A4JA 4PZYA 2BHRA 3IFSA 3A14A 4PYLA 1X8XA 2WJ3A 5H16A 2ZYRA 1TQ8A 1WY5A 5AM0A 4ASUD 1LBEA 4DW8A 1Q0SA 2ZPAA 4ZO8A 2GN2A 2CL0X 1YT5A 4D9EA 2G9VA 3BE5A 1KS2A 4D41A 2AIRA 3PT5A 3M1AA 4LC9A 1DU4A 4DSZA 2LWIA 3ES9A 1FFBA 3F96A 5E6SA 4R31A 3S1AA 4FDUA 1V1JA 1JIXA 3P2KA 2Q1XA 3Q3JB 2FAXA 1X2EA 4UDYX 4IS3A 3WI7A 5LIRA 4Z4FA 1BS2A 4CQLB 4YRMA 1M75A 1G4AE 3BBPA 3BWMA 3L1KA 3DZIA 1NVXQ 1TLFA 3QM1A 2N46A 4M60A 5JZ9A 4Q21A 1KHHA 1Z4OA 4X6YA 4MQEB 4IHJF 3LCMA 1W59A 2FMFA 3LLCA 2WC1A 1RYBA 3DTYA 3GGCA 3Q8WA 4MP6A 4BIIA 3RSOA 4BQOA 3SIWA 1NQ5A 3USES 4GX5A 1V8ZA 1O1YA 1ZHFA 1NT2A 4GOND 7MHTA 3TS1A 1BEEA 1SXHA 1IWBB 3QE3A 2D1TA 3WL8A 1G0OA 4NBUA 3TQSA 4O2BA 5BR8B 3ZVNA 4FR0A 1USUA 4MGIR 1F6BA 1L5MA 4ARSA 1H2WA 3AGPA 2IHTA 4FNOA 1RLMA 3MA0A 4MYHA 3KHKA 3H2GA 1AHHA 2FQWA 4DWJA 4PGMA 2YMLA 1F0PA 5F64A 3MWJA 4P4TA 1L5KA 4ZGWA 2YWDA 4U2BA 3A4YA 3MUOA 3FUWA 1YI8A 3VTZA 1JDJA 2OG2A 4UPVA 1PWYE 4YCDA 3DYIA 2WU4A 1UC8A 2OORC 3J7TA 1UR5A 2Y0DA 4TV8F 3H2IA 5BN5B 1NR7A 3TD2A 2Z6UA 1UOQA 2XNHA 4RK4A 3GARA 5FQOA 5C5EA 4OJQA 4K0RA 1GKKA 4QRDA 1V2GA 2G1AA 2QL6A 3H3JA 3KL2A 1XQYA 4WZZA 4FDVA 4D98A 3L92A 3EBLA 1Q84A 1C1XA 1KK0A 4Y9SA 1C14A 2RGWA 4WESB 3ZIAA 1C1XB 2QMYA 3JQ8A 4EPTA 1OH5A 4IFEA 4QAQA 5ALOA 4OIMA 1ISJA 1OIXA 4JYBA 1NR1A 3COJA 3HVUA 2FQQA 3OTQA 5EE9A 3BC1A 4AJIA 3SE0A 3X1YA 4I46A 4DDTA 1F8GA 2II6A 4XGQA 1BKDR 3AM5A 1IZ0A 4L3WA 3K9LA 4YDQA 4MUIA 4IDEA 3Q6NA 5AVTA 4C7OB 2O8BB 2XQJA 4YJ2F 2CGEA 2UUOA 3KKOA 1HDCA 2XMZA 3HCDA 3IT3A 3MCWA 3U3DA 4IVPA 4C0BA 5JECA 1NRWA 4BJ3A 3KV3O 2VDWB 4UHHA 5J4KA 2PBLA 1C9EA 3CVOA 4RCYA 2Q99A 4Q82A 4AY5A 2O8VA 1U4NA 2OM6A 1T4BA 3DFMA 1NFFA 1QGAA 2H31A 1Z18A 1ZUNA 4PFKA 3UT0A 1CQWA 2XEXA 1ZGGA 2BR3A 3BKXA 2FCRA 2A5LA 3G7SA 4FYPA 5F1OA 5L9AA 4BNIA 1FC0A 3F74A 2VPZA 3ZEIA 3WRXA 1JA1A 3OECA 3BXEA 4RELA 2JA1A 5C34B 1NVFA 1GUFA 2IP1A 3DDWA 4W7IA 2EKPA 3JYOA 5JD5A 4KIGA 1UOEA 1T0HB 2VPXA 3JD0A 1P5JA 4IIXA 4BNMA 5DHUA 1K6JA 3AVQA 4M1YA 3OUZA 2OV8A 3ZY5A 3U3OA 3NIWA 3A6KA 2CJPA 5G1OA 1QM5A 2QVCA