2BF7A

Leishmania major pteridine reductase 1 in complex with nadp and biopterin
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
283
structure length
265
Chain Sequence
b'VPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLGDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structures of Leishmania Major Pteridine Reductase Complexes Reveal the Active Site Features Important for Ligand Binding and to Guide Inhibitor Design
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 96
structure length 265
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2004-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bf7A00
4NI5A 4CMEC 4OSPA 3WBBA 4XQCA 2NTVA 2FPGA 1Q7CA 4J4BA 1U1IA 1YL5A 4UUMA 2O2YA 2C5EA 4Z9FA 2PR2A 2EHDA 3NYWA 4IQ0A 3FN4A 3GDOA 4W82A 3PZRA 1HF3A 1WXDA 1HRDA 2AG8A 3GVCA 3OSUA 3SC4A 5L45A 2VQ3A 1IHYA 3ZV4A 1EK5A 2WD7B 4J49A 2YZ7A 5KJ6A 3K5PA 1EE9A 4LVCA 1EDOA 4CM8A 3TL3A 2YY7A 1UJMA 3JQ6A 5A9TA 5ES3A 3BHMA 1HZZA 3DDNA 4WLUA 4GX5A 4XJSA 2QZZA 4E5KA 1LRKA 2VN8A 1H2HA 4DQXA 1M2WA 2FWMX 2Q2QA 4KDFA 5A3VA 1P74A 4M86A 1T1SA 5T8KA 1BXGB 1JDJA 1IOLA 4CJXA 3JQAB 4NPCA 3GN2A 1G0OA 2A92A 3OH8A 4G5HA 4LRTB 1UXJA 4L4XA 5LCXA 4KTVE 2E49A 4WLFA 3ZWBA 4YAIA 1EUZA 3QHAA 2RHRA 2AA3A 3GG2A 1Y81A 1D1TA 4ZHSA 4BKRA 4QECA 4JIGA 2BI7A 1YWGO 2GASA 3GAZA 1V0JA 1XR3A 1XU7A 2FSVA 3GAFA 3IIEA 3JQCA 4PLGA 5DOVA 5L51A 1O89A 3HDHA 1EDZA 4MVJE 3VPXA 1YO6A 4RVSA 5AXCA 4BO0A 3JQ7B 4BGUA 5ICSA 3RFTA 2ET6A 2B35A 4IDGA 4XIYA 3H5RA 1HZJA 3VAZA 4PG6A 4PLCA 3I5MA 1G1AA 4FBGA 5CDSA 4BB5A 4DYVA 3PZBA 3WIEA 4E12A 1HE2A 1Z82A 4WEQA 3OA0A 4I5EA 3HFGA 1EBFA 1R16A 4TRJA 4YTEA 4NZ9A 1P45A 5T8KC 4OMUA 1XLTA 4PFJA 2CFCA 5KKAA 3AUAA 4E32A 2FP4A 1N1GA 1FJHA 1QG6A 3GEDA 2YFHA 3KYDA 4RVGA 1UZNA 5F5NA 4HY3A 4FJ1A 4QSMA 3WSWA 2DUUA 3QQPA 1IPEA 1WZIA 1BG6A 4IMRA 5I9MA 1FDSA 4R9RA 4A73A 1E6UA 2F1KA 2BF7A 4HFRA 3U4IA 4I9UA 5T5QA 3R1IA 1ZBQA 1SO8A 3MJSA 4KUHA 3VVBA 1R4NB 1G0NA 4YCAA 4FFRA 2QX7A 4E4YA 4XGKA 2ZQZA 3ZWYA 4CV2A 1NHGA 2OZPA 2V7PA 2V65A 1DIGA 1B26A 5JFOA 3DHYA 4W6ZA 4RO0A 3KSUA 4JP2A 4L4RA 3UXYA 1EUCA 5A4DA 1FDWA 2R2GA 4WOJA 1ZFNA 4TRNA 1YRLA 4H3VA 2UUOA 3AOEA 3C3XA 4OQYA 3FI9A 2NACA 3JD4A 1AN9A 2CMDA 4ONEA 4BNKA 1NVGA 3DBVO 3FNHA 3GQVA 5JMWA 2Y1EA 2GZ2A 1EK6A 4R4JA 5BQFA 2AE1A 2QRLA 3RCBA 5KJFA 2LDBA 3WGIA 1MV8A 1C0KA 1R12A 4ALIA 1X14A 1I33A 5KWEA 4J2HA 1O5IA 4EUFA 2Y0DA 3JYLA 4BKQA 4WUVA 1WNTA 2B83A 2EXXA 3QWIA 3HZZA 4DC0A 1LRJA 1UZMA 2YUTA 4RGBA 4YT5A 2UYYA 1L7EA 4C4OA 4L9RA 3ENNA 4L74A 4II2A 5HTOA 2NTNA 4XIJA 3WG9A 4B4VA 3R3JA 3KXDA 4W99A 1XQ6A 2Y1OA 5H82A 3ZWPA 4JLWA 3OETA 5CPBA 1PR9A 1NPYA 4GI2A 2ZYAA 4D3FA 4KUEA 1XSEA 1U3TA 3E18A 4MVJH 4GQAA 4HBGA 5KJ1A 9LDTA 1I2CA 1U3UA 3HFSA 2ZATA 3AOEC 3NT4A 1LX6A 3ICCA 3LT2A 4OJNA 4PLYA 2GLXA 4FC6A 3ZCXA 2CDAA 3CXRA 3AY6A 5JW6A 1JKFA 1C1DA 2BELA 3C7DB 3DQPA 3CEAA 1YDWA 3IL2A 1DAPA 4MINA 4NJOA 4BGVA 1YDEA 1DRUA 2P4HX 1SNYA 2ZTMA 1RM0A 4N18A 4MIYA 5DBGA 1GPDG 3SJ7A 2VUTA 5G4KB 1SB9A 2A9FA 3KETA 4RVUA 2NVUB 3OEYA 2PD6A 2WTBA 3ZNPA 4XKJA 5MDHA 5CP8A 3D4PA 4R3WA 5IG2A 2Q99A 1ISJA 2X1HA 3E8XA 5I7SA 1D7OA 1T1RA 2PZLA 1LSJA 4PG7A 2Z95A 2I76A 2PD3A 4KMSA 4XQEA 5C5IA 2IZ0A 2QIOA 4KQWA 2GNAA 2J5RA 2YV1A 4Q3CA 4MO2A 5TT0A 1HSZA 4KOAA 4D44A 4MKXA 4K6CA 4EGFA 3DFUA 1WPQA 4E31A 2GN8A 1KC3A 2D3TA 4CQLB 4B7CA 4UVEA 4D7AA 1MFPA 1C14A 5JPIA 2I3GA 4BV9A 4EI2A 4CR6A 3C7CB 4ND5A 4D0RA 3MCVA 4CMBA 1MXFA 1VE9A 1VL6A 2QRJA 1W6UA 4GGPA 3Q9UA 3L4SO 4D46A 5JDIA 4Q39A 3AOGA 4B3JA 3DMYA 1L7DA 1QYWA 3OJEA 4CM8B 4YACA 4WKGA 4CPDA 3F4BA 1BMDA 4OAQA 1X0XA 2UV8A 1IL0A 1T2AA 5B1YA 5JLAA 1WMAA 4LSWA 1E1MA 4NIMA 4OHUA 1FDUA 5B4TA 1JKJA 3PWZA 4OSOA 3EZLA 2VOJA 3ETGA 3V1UA 4OOFA 4IS2A 2HMSA 3GZNA 3IMFA 3DR3A 3PWSA 1W4ZA 3ZZNA 4CM3A 4CLRB 5B4UA 3H3FA 4EYEA 5DULA 3BMOA 3GUYA 3RJ5A 4TVBA 2C07A 1CQIA 1S6YA 2HMTA 4FFOA 1HLDA 1TT5B 2JJYA 5FFFA 4P22A 4R1TA 4AJ2A 1B2LA 3I9JA 4DA9A 4RF2A 3EMKA 2EGHA 4XYMA 3U9LA 3H4VA 4BO3A 1H6CA 3TQHA 3Q11A 3FNGA 5JDIC 3HUDA 2W90A 1KEWA 2DBVO 3MJVA 3RUFA 3V8BA 2UDPA 3PDUA 1LI4A 2C2YA 1NFFA 4U8GA 1GUYA 1HKUA 3PYXA 4K26A 4CQMD 5G0TA 5LDGA 2UVDA 1N8KA 4M89A 3TFOA 4WASA 1LC0A 3WQRA 5EIOA 3M1AA 1KVUA 3EVNA 1E7QA 3JSAA 2D1YA 2C54A 5BT9A 4NQZA 3RI3A 4FC7A 2O3SA 3I4FA 3OEWA 1HYHA 3RC7A 1QLHA 4IZHA 1V8BA 1X0VA 2BGLA 5KNLA 4ZJUA 3BMNA 5AXAA 4CM5A 4PLFA 3K92A 1P0FA 2XPCA 4JN6B 3W8DA 1GAEO 4UVIA 5A06A 3PP8A 3WSVA 5C7LO 2NADA 2YV3A 5BNFA 3QWBA 3ZWMA 4GWGA 2GZ1A 1GUZA 1HSOA 4PRKA 2X23A 3E6AA 3CH6A 4ZD6A 2DFDA 1EFLA 2AG5A 4EJ0A 1ENZA 1HDXA 4GSLA 2OXIA 3GK3A 4ZRMA 1Y9EA 4CM6A 3PJEA 1PX0A 4UEKA 3W4IA 3KOUA 1ZSYA 3I9OA 2W2KA 1PWZA 3FRJA 3KM0A 3LQFA 5CG1A 1E1NA 3PYLA 1N9GB 4BNVA 3W8EA 2R00A 3GZ4A 3HDJA 3I4CA 1O95A 1IULA 1LJ8A 1F14A 1RYEA 4PGFA 1YQDA 1U2GA 3JQFC 1DEHA 1VKNA 4IIVA 4IQ8A 2G76A 2Q45A 1E3LA 4LRSB 3ICPA 4NHEA 4OL9A 4G81A 4J3FA 4NFSA 3GEMA 4ZQEA 3WYEA 1P3DA 1ULSA 1Y7TA 5GMOA 1ZJZA 5GY7A 4OXKA 1F8FA 4YAJA 3RC9A 5G2OA 5EERA 3D3WA 1B15A 5G4LA 2OBYA 2WMDA 3K2BA 3VVCA 3WGTA 3ZWAA 3V2GA 4J7XA 1DJNA 3WIDA 5IXSA 4F6LA 1HDZA 1LRLA 1PR3A 3IUPA 1ISMA 1U4SA 4DGSA 1SPXA 2P5UA 3INRA 1GQQA 3B20A 1GFSA 3I6QA 1YB1A 4RVHA 1GEGA 2AW5A 3WICA 1DPGA 1N7HA 1U3VA 3E03A 2I67A 3K2EA 3K31A 2R00C 3FTPA 1XU9A 5KVCA 1O6ZA 3HB5X 4KQXA 1WMBA 2Q1WA 1NR1A 2Z1MA 1T2EA 4PLVA 3VZPA 2PY6A 1H0KA 3DOJA 4P4NA 3D4OA 1WP4A 1B8UA 2D8AA 4LW8A 3H9QA 3RUHA 1C3VA 2NU8A 5J23A 2BHLA 4WK6A 4QQRA 2YHIA 2GGSA 1DIAA 3L9XA 2EW2A 1YBMA 3DHEA 1LQTA 4JROA 3OJ0A 4AJEA 2LDXA 3JQAD 3GRKA 1O0SA 4TMFA 2GUGA 2IXAA 4Y67A 2VWQA 1ZCJA 2FPIA 2E4AA 4OM8A 4YT8A 1PJLA 4PLPA 4QEDA 5F1KA 5A9RA 4Z9XA 3UHAA 3ROQA 2YDXA 1E7SA 4I5GA 4LMRA 5TX7A 3FCOA 3PHJA 2VHVA 1H5QA 1KYQA 2EIHA 3WWYA 3D5TA 3AM5A 3W6UA 3HDQA 4KDEA 2X0RA 3DAGA 3ZU5A 3GVXA 2QRKA 4OO3A 4XQGA 5L4NA 1WZEA 2CY0A 1ZUD1 4B4UA 2PNFA 4Z6KA 5COBA 3ANLA 5ITVA 1J49A 3UF0A 3S1LA 5BNTA 3C24A 3GHYA 3KV3O 3AFNA 4YR9A 3VC7A 3RBVA 2EEZA 2XF8A 5JC1A 2FRDA 4R1SA 3TJRA 3WX0A 1Q0LA 3WMXA 1V9LA 4KUGA 4NU5A 5AVOA 2GPTA 1IUKA 1A4IA 5L9AA 1GUFA 4IQGA 4D3DA 1G6KA 4PG8A 1HE3A 4J0EA 1YOVB 3B1KA 2B0JA 3G79A 4NBVA 3DZJA 5L7TA 2O3RA 4CM9A 2QW8A 3VPFA 1Q1NA 1JW9B 4NBRA 1F06A 4JX8A 3EW7A 4BUCA 4EBFA 2PLAA 4F45A 3DZBA 4MVJF 2BGMA 3WGOA 3PWKA 5B4VA 4FPXA 2Y0CA 3TOZA 5CG2A 3RVDA 4FOOA 3A06A 3GZNB 3PHHA 1ZXBA 5LDHA 1HETA 5TIIA 3WDSA 1MP0A 1BVRA 3ZW8A 4I8XA 1X7GA 4RJTA 4LCEA 2IRWA 3BMOB 4TZKA 5IZ4A 1CQJA 4FFLA 3ONEA 1NHWA 3O9ZA 4D43A 3UGKA 3K96A 2VNSA 3FWZA 3EZYA 5JCXA 4BKPA 4O6VA 3OM9A 2I65A 5IN4A 4NNJA 1YS4A 2GD1O 4Y98A 3RUAA 3MZ0A 1CETA 1LSUA 1VKOA 4JBHA 3X2FA 4GL4A 3H8VA 4AG3A 3JQBA 4BNNA 5ADHA 2JCVA 2XAAA 4RV9A 5F5LA 3MOGA 2EF1A 4W7HA 4CUKA 2AEFA 2ZTVA 1X7HA 4O63O 4G2NA 5JO9A 1B0AA 1AXGA 1E6EA 4ZRNA 2IXBA 3FNFA 4ALJA 1WDKA 2R6JA 2W2LD 3JQ9C 4YT2A 3BXXA 2VRCD 3O38A 4R16A 4R68A 4TKLA 4PZDA 1CRWG 3VDQA 2GERA 3BMNB 4U5QA 4UVGA 4YEDA 5TSDA 3KB6A 4LCJA 3AJRA 3IP1A 3TPCA 2VHWA 4NJMA 3UCXA 3Q3CA 4OIMA 2VZ9A 2HU2A 3M2PA 3H65A 1IB6A 1DB3A 3ORFA 2VZ0A 4JNKA 2DQ4A 1GCUA 3BMQA 1XDWA 3JQBC 4DPKA 4BNXA 1BSVA 3O8QB 5L3ZA 4AJ1A 5H81A 2Y99A 5JAMA 3I1JA 2AQKA 3ONFA 2AEMA 2V6FA 4B3HA 4RPJA 3C7AA 1PZEA 3EHEA 5I8WA 1NPTO 3NAQA 3VKUA 1PGQA 3WTBA 4A03A 4LN1A 3MOIA 5TNXA 3VZQA 1E0DA 4HADA 3WXBA 5ENDA 1NP3A 2X22A 1YB4A 5JYEA 2PKRA 1BW9B 5K9ZA 2GN9A 4HFNA 3WLFA 1ZW1A 3HSKA 2FPPA 4J4TA 4QX6A 1WLYA 3HN7A 3SEFA 2IZZA 4MIEA 1ZJYA 4CM4A 2JD0A 1Y6JA 5I9LA 1XWFA 2X86A 2CF5A 2ILTA 4DXHA 2JHGA 2Y1FA 1A5ZA 2NNLD 1IZ9A 4FJ2A 1SB8A 1YGYA 1HDGO 1LDGA 1VC2A 1BHSA 5I7FA 4YJHA 1UAYA 5GZ6A 2O3TA 4YYZA 2HSDA 4M55A 2ZCVA 1K89A 2FR0A 4XB2A 4CMAA 3PHGA 4CV1A 3JV7A 1E1KA 1UZLA 2VT3A 5THQA 5K0ZA 4YJFB 5JSFA 2Q4EA 1NWCA 1P0CA 2YDYA 2BFMA 4E21A 1VJ0A 2WJPA 1GZ3A 2HRBA 4QUKA 2RIRA 4TVOA 4P4LA 1SZJG 2DBZA 2OL4A 1MX3A 4QO7A 5EJ2A 5ILGA 2H63A 2E37A 4UAGA 4CMHA 1V3UA 2F00A 4LVUA 3ZV3A 4N54A 5HWSA 4IXWA 2AQ8A 4G65A 5A04A 5JCJA 2PTGA 1XIVA 4CLDA 3TSCA 3MTGA 3S2IA 3NGXA 4CLXA 2YHIB 4M54A 4E6PA 1MXHA 1PQWA 2PZMA 1Y8QA 3L07A 4HP8A 1LLQA 1GCOA 4BNTA 1ZH8A 3GEGA 3INTA 2C20A 2O4CA 4N5LA 4CMIB 3TWOA 4BO6A 1FDVA 4H16A 4U7WA 2EWMA 4L73A 1WW8A 3E1KA 1CEQA 3L0DA 4U6QA 1YL7A 4YBZA 5KIAA 5G0WA 2ZTUA 3D1LA 4FCCA 1GR0A 4XQ9A 3OJFA 3BHJA 3W1VA 2HAEA 2I99A 1DFGA 1W8DA 3LDHA 3DAFA 3A9WA 3QLJA 3V2HA 2WDZA 3NX4A 4BNIA 5JY6A 6LDHA 3G17A 2X0IA 4PLTA 1ORRA 2B4QA 4YAGA 4MOWA 4BNJA 3NKLA 1YJQA 3AUUA 1I3LA 1CERA 2PV7A 3KHUA 5F21A 1H94A 5TQVA 3RD5A 4PVCA 4RZHA 2X6TA 3BA1A 1NTOA 4GX1A 4IIUA 4NFHA 3DAPA 4K6FA 4FQ8A 4ZICA 5EINA 1PL7A 2PZKA 3I9MA 3GVIA 5KKCA 4HUJA 4ND4A 3UVEA 3D3EA 1ADGA 5GZ3A 2H9IA 2Q4BA 4DIBA 5A9SA 1BDBA 2CVZA 4UUPA 5MGBA 1PJ2A 1XA0A 4IUYA 1E3JA 4P8RA 5IFLA 4BNHA 1VJTA 1CDOA 4RZIA 4B8WA 3NTRA 4PN3A 4GPD1 3RUIA 1UAGA 4ZQGA 4EJ6A 1P1KA 3F47A 3OFSA 1PS9A 4JBIA 4GAEA 3R0IA 1HDYA 3L6EA 1Z6ZA 3EGOA 2BFPA 2RBEA 2WWRA 3IUSA 3WQQA 1K6XA 2HRZA 4YDRA 4AICA 2VHYA 2VWHA 4TKMA 4I1IA 5ER6A 1EQ2A 3V2UA 2O4UX 2DVMA 3JD1A 1DC3A 1ONNA 1LU9A 4X54A 4AVYA 1ID1A 4XCVA 2ZB7A 3FTNA 4LK3A 3JQGA 4RQUA 1P33A 1SEPA 2RHCA 3CUKA 5CEEA 3RASA 4GMGA 5IDYA 1MFZA 3I52A 5DCWA 2P68A 1R0KA 4YJDA 1U8XX 5FYDA 3NT5A 4HX5A 5K6AA 1DIBA 1GV0A 4NK4A 3OICA 2WYUA 2NTJA 2O3QA 4DTIA 3ZNNA 4XB1A 4GBJA 2Y05A 3Q2IA 4RPGA 3NEPX 4CODB 3OA2A 4NJMB 3DTYA 5TRTA 4QO8A 2NV6A 1I01A 3LT1A 4JP3A 1TVEA 1Z73A 3G1UA 3NDJA 5HM8A 4N5NA 1NASA 4F3YA 1R66A 4URFA 1DOHA 2PFGA 1O94A 1E3WB 3BMQB 3SXPA 2VNAA 4XRRA 4BNWA 1GPJA 1JQBA 4J7CA 4MIOA 4A5OA 1AUPA 1LA2A 4BMVA 5B12A 5JY1A 3UCEA 3OIDA 1NPDA 3QA9A 2Q1UA 4ID9A 2DPHA 4ITUA 4JGBA 1BDMA 1T24A 1B3BA 3UH1A 1JVBA 1X7DA 3KO8A 4BL5A 2SCUA 2IZ1A 1DFHA 2NM0A 3GF4A 3R6DA 4J7UA 3FNEA 1Y9AA 2BFAA 1DSSG 3WS7A 4AJJA 4INAA 3NGLA 1ZEMA 3BYZA 4DMMA 4E30A 3C85A 3ZWNA 2AMFA 1HL3A 1C1XB 4BO7A 4PIVA 5K6AC 2ZIZA 1PS0A 3QWHA 2I5PO 1EEHA 4PZEA 4L8VA 4YRDA 1Q0HA 2H6EA 2HMUA 2X58A 5JXWA 2OBNA 4J4HA 3LYLA 1KERA 2NQ8A 1UDBA 2ZKLA 1XYGA 4TWRA 3TNLA 2GF2A 1Y5MA 3I83A 2ZJ0A 3QVXA 1LEHA 3MTJA 3FPLA 3KUXA 1AHHA 1P77A 1EVJA 3EYWA 2P9EA 5HS6A 4CUZA 2GN6A 3X2EA 3U62A 4CM7A 1NAHA 3A1NA 4ZQHA 3RFVA 3G0OA 1EZ4A 3PTZA 1Z7EA 3FF4A 4FFMA 3P5SA 2PD4A 5BNIA 1R4MA 1U8FO 3DOOA 3PK0A 4S1VA 2PGDA 4XR4A 4IDAA 4XWYA 1U5AA 3VHRA 2BLLA 2I6TA 2X5JO 3DMTA 2P9GA 3B70A 4BQPA 1NFRA 1SOWA 1E6WA 2PKQP 3RWBA 2GN4A 5BSFA 5A5FA 3K73O 4F6CA 3WJ7A 4R41A 2C5AA 2OORA 1Q7GA 1HDRA 2Q3EA 3UW3A 1I8TA 4KP7A 3UFXA 1NX6A 3S2GA 4RDHA 3EY4A 4KTTE 1ISGA 5A1TA 2DBQA 4NBWA 4TQGA 1ENOA 4PLZA 3WGHA 1J4AA 9LDBA 1DRWA 4QXMA 3GPDG 3CPSA 3UKOA 1NFQA 1K3TA 1I36A 4QT0A 4BOYA 1HYEA 3ETDA 2QYTA 4MKZA 1Y8QB 3D7LA 1LXCA 3A4VA 1LNQA 4IPTA 4JCOA 2FN7A 4ROSA 3AFMA 2TMDA 2VHXA 4RORA 3AUSA 3NJ4A 2WEKA 3FWNA 1OAAA 3OJOA 3H7AA 4BVAA 2J3JA 1RM5A 1IE3A 3GFBA 1DO8A 4XYLA 3DMTC 1K5HA 1ONOA 2O23A 2XXJA 1N1EA 1J6UA 4IDFA 2ZB4A 1F12A 1EUDA 4A26A 4JQCA 4J6FA 3ZU4A 2HMWA 4J1SA 1BXKA 1I3MA 2G82A 3LLSA 4DLLA 5A3JA 1I32A 2GR9A 2QHXA 3B6ZA 1PS8A 5EMHA 1AXEA 2B4RO 3NDRA 1FF9A 4JJFA 1PGPA 2AQIA 4XEHA 4YRAA 3NV9A 5TT1A 1E92A 2OMEA 4R1NA 2DC1A 1R0SA 3CE6A 5LC1A 1UH5A 3KYDB 4R1UA 3RU9A 3FPCA 4NK5A 5DCUA 4BMNA 3GDFA 2DUWA 2VYND 5EQDA 3TZHA 5JAIA 4K28A 4RLSA 3CINA 4D42A 1FMCA 1BRMA 2VUUA 5I8ZA 1PTJA 2YQ5A 4JBGA 3OQ1A 3ASVA 3EK2A 1D3AA 1E5QA 2CUKA 1EE2A 3WNVA 1KVSA 4Y6PA 2J5QA 1CF2O 3DZGA 2B37A 3HADA 2GCGA 2POQX 4QFCA 4LGVA 4I5DA 1HDOA 2DAPA 2HJRA 3JQ8A 5DN9A 4ESOA 3E9QA 2ZTLA 4I5FA 3N58A 1SAYA 5DT9A 2VYVA 3SJUA 4FOSA 1MG0A 2FY8A 4WECA 1N2SA 1IPFA 1X1TA 1Y8RA 3E5MA 3GMDA 3MWDB 2PZJA 4RPHA 2CD9A 1U4OA 1EFKA 2JAHA 2ZB3A 4DREA 1A7KA 2OO5A 3QVTA 4J43A 5AXBA 4AL4A 3U5TA 3BTOA 5JNLA 3ZU2A 2EKPA 3QJ5A 3PFWO 2NLOA 3B1JA 3FD8A 2D2IA 3U4DA 4AJHA 2V6MA 1IY8A 2C82A 2YYYA 1HT0A 2DKNA 3H6KA 5TGDA 5IF3A 1CIVA 1U9JA 1ZNQO 4HXYA 5G0UA 1GZ6A 1X13A 4CV3A 3GOHA 4BV8A 5CDYA 1VL0A 4BMSA 4CR7A 2VCYA 1D1SA 3E9MA 2O50A 2Q2VA 3BTUA 3I23A 3HG7A 3ZWCA 1QYXA 4FIZA 5JS6A 1ENYA 1SBYA 1EVZA 1TT7A 1Z7BA 1Q2XA 4XYGA 3WR5A 3W8FA 1IYZA 3DWFA 3LLVA 2J8ZA 3UN1A 1CYDA 4AJKA 4AJNA 2YW9A 4Q3NA 1Y5RA 3L6OO 3NJ8A 4IGEA 1YBAA 1J0XO 2E6UX 4MVJM 5IJZA 2DU8A 2YJZA 4WPGA 5JDCA 3WGZA 3PQDA 5L4SA 2AE2A 1RKXA 1C1DB 2I9PA 3OHSX 4D79A 1UXGA 3JYQA 1SC6A 4XA8A 3OQBA 2VWPA 3QY9A 3DZHA 1Y1PA 3KEQA 2Y0EA 4FW8A 2AQHA 3F1LA 5C7OO 4EUHA 2B4TO 1MLDA 2C2XA 1K6JA 3ZWWA 2FZEA 1FK8A 2D5CA 4JJIA 2IYOA 4GKBA 3DZIA 1B16A 1DXYA 2X4GA 2BH9A 4J90A 1U7TA 1Z45A 4IS3A 1KY5A 3W6ZA 1V6AA 1BXGA 3FBTA 4JJGA 4IJVA 1I3KA 3ZWXA 3FSRA 3JQAA 1YQXA 1ADBA 1ISIA 4R3NA 4ZN6A 4KWHA 3JQEA 4PLWA 3TZQA 1TI7A 1PIWA 3N7UA 1GU7A 1H9AA 3MJEA 1LSOA 2DFVA 4O59O 4DUPA 2DM6A 3GUCA 1MC4A 2JKVA 3WWZA 4DIFA 1ARZA 5JDCC 1VM6A 3K8ZA 2AXQA 1NR7A 3S2EA 2VTEA 3ENKA 2RAFA 1A9YA 2QZ9A 3ZHYA 3FR7A 4ALKA 4IXTA 3JQ7A 3LZ6A 1TXGA 5BSHA 1U3WA 1SEVA 2EGGA 2JD2A 1L1FA 4ZQFA 3ADPA 3BTVA 2Q49A 4EZBA 1GYQA 1PGOA 3DZFA 3HNPA 3RUCA 3ZHZA 3U0BA 3T4XA 3AY3A 1ZMOA 3QIVA 4IINA 3GMSA 3DFZA 3GT0A 5CHEA 4W7IA 2FR1A 3L77A 1YVEI 1KY4A 1TLTA 4IZIA 1TB4A 5AOVA 1QP8A 1I30A 1WAMA 3BHIA 3GLQA 1T2FA 3WTCA 1ZZEA 2C7GA 2BMAA 5U1PA 1LDEA 4RPLA 4RL6A 4CM9D 1XELA 1GZ4A 2XXBA 3WGGA 3DBRA 4MVJI 1RYDA 2HMVA 2Z5LA 4B8ZA 5L40A 1C0IA 1GQYA 4DL9A 1LC3A 4E5MA 1KOLA 3P7MA 3SVTA 3TN7A 2GO1A 3QRWA 5F1OA 4MVJA 1R4NA 4RVFA 1OMOA 5C7IO 2BD0A 1D4FA 1GDHA 1DHTA 4YWJA 1LUAA 1ZIDA 3AU8A 3VTZA 1HLPA 4MVJG 2HUNA 3WGYA 4HFMA 4DC1A 4ND1A 5A05A 3U49A 1PJ3A 4JK3A 2ZK7A 1GD1O 5TJ9A 4E2YA 1PWXA 5BSEA 1ZVMA 2O7QA 2WYVA 1GY8A 1PJSA 1PJTA 5EN4A 4Z0HO 3QV1A 1ZK2A 1C0LA 2I3AA 1ZSNA 3QVSA 3DTTA 1P44A 1LDNA 2DTXA 4B7XA 3W4JA 1UXKA 1SMKA 1QSGA 4YPOA 3ANMA 3F4LA 5T64A 2J3HA 4II3A 2X7HA 3LC1O 5B37A 5EPOA 3M1LA 3O26A 3UOGA 4WE3A 3GR6A 2A4KA 3ITKA 5AQ1A 4NG5A 4I9NA 1E77A 4NBUA 3F46A 4FGWA 4L76A 3S55A 4WLEA 3TDKA 1PL8A 1JU9A 4BO9A 4Z0TA 3L9WA 4TROA 1X1EA 4TZTA 3Q0EA 1T2DA 2JCXA 1RPNA 3ZHXA 3JTMA 1DJQA 3LT0A 3I9KA 3VPHA 4J1TA 4M49A 3WFIA 4YRBA 1U28A 1XQ1A 3GVPA 4CMGA 2QQ5A 3IP3A 1GTMA 3IDSA 3GRPA 3JD0A 4BNUA 8ADHA 1DRVA 4A10A 2BKAA 2XOXA 4TRMA 2FZWA 1H93A 5AYVA 5TF4A 4NDNE 3RIHA 3IKVA 5CDGA 3JQ8B 3K9QO 1P31A 2W2KB 5C37A 5JE8A 3OMLA 2EV9A 5CAEA 4CMEA 2C29D 4NMHA 4E5YA 1Y8RB 1VLLA 3EVTA 1RWBA 1YB5A 5T57A 3TZCA 1LQUA 3JD2A 4GLLA 4P4GA 4E13A 2X9VA 1OBFO 5L53A 3ZNQA 3TF5A 1TEHA 3N74A 4CMKA 2X8LA 5G4KA 1UP7A 1HE4A 2WYWA 1HYGA 2NVUA 1JAYA 1GADO 4IDDA 3AM4A 3MJ4A 4Y6RA 4IJUA 3VOSA 2IYPA 4AJOA 2A35A 3D3WB 5DBFA 2AEJA 3IOYA 3PHIA 1JWAB 4XDZA 1XEAA 1NM5A 1ZK4A 1MUUA 3F5SA 2C0CA 4E2XA 3H3JA 1DIRA 1GEEA 4Q3DA 1A4UA 1VPDA 3LF1A 1P1HA 2H1SA 3RBXA 1T4DA 2EJWA 3H5NA 3RC1A 4BKUA 2CDCA 3B1FA 1SOVA 3CTMA 4IBOA 4RF4A 4WGGA 3ITDA 1XHLA 4CQLA 4IY1A 1BWSA 3ZN2A 3GGPA 4QFDA 2ZJ1A 3WOHA 1JVSA 3PPIA 5DP2A 3RSHA 1LLUA 2FMUA 4XX0A 3ST7A 1UUFA 1BTOA 2GSDA 1VRWA 3CIFA 4RF5A 3NUGA 3RC2A 4XR9A 3RKRA 1E3EA 2JD1A 1OI7A 1ADCA 5DNAA 3GNQA 2VOEA 4R51A 4GVLA 3H9GA 5KVVA 1S7CA 4Y9DA 4E5PA 1ML3A 2YFQA 1M6HA 4RLHA 3WMWA 4Z3KA 5JCJD 3JCZA 5CDTA 1N92A 3C1OA 1DDOA 4LSMA 4CUJA 3UAGA 3ZV5A 1ZXLA 3RQSA 1ZEJA 4CLEA 2YV2A 2Y66A 2YHUA 5KCZA 2IE0A 4UUNA 2DTDA 1MB4A 3LU1A 4CLRA 5JC8A 1R0LA 4MVJP 4I08A 2D5AA 5DP1A 2BGKA 3QE3A 1F17A 3F1KA 4ND2A 4J16A 1TT5A 2P91A 4Q3EA 3KBOA 4HNHA 3TFQA 1PL6A 1E7YA 3RUDA 5KTKA 4FFNA 1UP4A 3VZRA 4WOKA 1K2WA 5F3RA 4A2CA 5C3MA 2PA3A 4IDCA 5H83A 1NQOA 2G5CA 1FXSA 1X15A 4DPLA 4FB5A 3PGJA 1H6BA 1O9BA 4KZPA 4CL3A 3BMCA 1EVYA 1E5LA 4IM7A 3AUTA 1KS9A 2C59A 2OP1A 1DC5A 5CEJA 3GHHA 3EC7A 3TZ6A 1NXQA 3IJRA 3P2OA 4PG5A 3SX2A 1U5CA 4GSKA 4IJWA 1PZHA 4OKIA 4HNGA 2HKIA 3O4RA 3NTOA 4GWKA 2NVWA 3GG9A 1VSUA 4PLHA 3SLGA 2W4QA 1R15A 3C1TA 3PVZA 1E7WA 4Z3DA 4RF3A 2X9NA 2HK9A 3OP4A 5HA5A 2DTEA 1JTVA 3ONDA 1XG5A 3DBRB 1PJQA 3D0OA 3TL2A 2OOSA 4DIOA 4BNYA 1KEUA 3KYCA 2CF6A 1MA0A 2OUIA 3UICA 3V1YA 3QP9A 3ETEA 4BO8A 2IEDA 2NU7A 4PCVA 5FF9A 1KETA 5FI5A 4DPMA 1YL6A 1YONA 1YQGA 3LT4A 4BHTA 3EAGA 3H5AA 3VZSA 3HHPA 1PJBA 5TJHA 5T67A 1OC4A 5DBIA 1OC2A 5FWNA 4WCFA 4UVHA 1B8VA 1V3VA 3QWAA 1N9GA 4GLOA 2W8ZA 2X9GA 3PDJA 4FR5A 5I9NA 4C7KA 2OHXA 1CJCA 3VPSA 4CLOA 2JFHA 3DONA 2VTDA 3L4BA 4MPDA 4OXYA 1A71A 4BS9A 2PKQO 2PGLA 1NYTA 3U3XA 1KVRA 1RM3A 2IDZA 4DMLA 4HFJA 1ISHA 5IXYA 2NU9A 3F6YA 1YBVA 4BGIA 3GVHA 4C7JA 4W4TA 4FSHA 2HJSA 1JLLA 4Q9NA 1JA9A 3DB2A 4E0BA 4MP3A 2DPGA 3K30A 3MJCA 3ZV6A 4B4WA 3KVOA 1V35A 3BTSA 5IDXA 3H9UA 1J5PA 3ZDFA 3WYBA 3KZVA 3T7CA 4MDHA 4BNGA 4GX2A 3CMMA 4H7PA 4OQZA 1CWUA 4YXFA 3FHLA 5JAQA 3U4HA 1AGNA 3U09A 4Y6SA 4E3ZA 3WBFA 3ZI0A 1K0UA 4WCFC 2WD8A 3QSGA 3RJ9A 4S3MA 3GY0A 3PLNA 3E82A 4EEXA 1ZK1A 1KC1A 5DOZA 1EQUA 5COQA 4RQTA 2JFFA 3P19A 3VH2A 4NU6A 2DT5A 3DOCA 4MP6A 4DQVA 1P1IA 3L4BC 1DC6A 3W4KA 1B7GO 4XYEA 3ZGYA 2DLDA 3CZMA 3DEYX 2CVQA 2GRAA 2W98A 3PIIA 4FD3A 4NFYA 1QORA 4WCDA 2VT2A 3ROKA 4OKNA 1T4BA 4H15A 5GZ1A 4Y8VA 3S8MA 3AU9A 4J9VA 3L6DA 3AWDA 2WE8A 4WLVA 3ZH2A 2G1UA 2J5KA 2HK8A 4DBZA 1UXHA 2E82A 2BI8A 4CM4B 1D8AA 3AY7A 2CZCA 5IAAA 3T4EA 4J1QA 4BNMA 3LC2O 4U6SA 2V6BA 4ZA2A 3VH4A 1A7AA 3EDMA 1UDAA 4NBTA 3HE3A 4F46A 1ENPA 2NUAA 3D4NA 2BFOA 5DZSA 4PRLA 5TLSA 3WYCA 3OF2A 2HO5A 3VKVA 4YJHB 1QMGA 5EQFA 4WEOA 1ZSVA 4GKVA 4A7PA 1A72A 2GDZA 1I2BA 5CPFA 4XZ3A 2HLPA 3A28A 3PYMA 1Z74A 5A5EA 2VWGA 3H9EO 4DWVA 4NR0A 1QRRA 4J9UE 2X0JA 3KRTA 1B3RA 5KJEA 4BNLA 4IDEA 1DLIA 1IZ0A 2D4AA 4OYRA 5ER9A 1HE5A 3NRCA 3DL2A 2EP7A 3FR8A 3KLMX 1XGKA 2B69A 1KBZA 3I9LA 5KJCA 3ADOA 4DLBA 1UDCA 4U0KA 2PGJA 1OZAA 1YXMA 4B3IA 4ILKA 1YOVA 1HWYA 5EL0A 4BNFA 3TRIA 5JO0A 3GC6A 1E1LA 2IEBA 4DBVO 1I2ZA 2Q46A 4YAEA 5A02A 4YAKA 2O7SA 1HEUA 1KEVA 1NNUA 2X5OA 3IS3A 3OIFA 5L7YA 3EUWA 4O0LA 5BSGA 2WM3A 3UUWA 7MDHA 5G0VA 4XRGA 5JMPA 4XD2A 1V3TA 3BIOA 4BIIA 5U4QA 3WQSB 3NDIA 4M1QA 4BO2A 3PXXA 4O5OA 2IODA 1LDMA 1KIFA 4R5MA 4EITA 1JKIA 1QR6A 2NQTA 1NAIA 1GYRA 4FJ0A 5KVQA 4OH1A 3F3SA 1M75A 3GGOA 3A14A 2ZQYA 4R69A 3IJPA 3PEFA 4GX0A 1LLCA 4EJMA 3OQ6A 3AM3A 4RDIA 4CQMA 2JFGA 4UEOA 1I10A 3WJAA 1B8PA 4E5NA 5DDIP 5TC4A 4XJTA 2GZ3A 4GMFA 2B5WA 2JHFA 3BMCB 1DFIA 1P9LA 4DRYA 1BVUA 1E7MA 4FGSA 2A94A 1E3SA 4PZCA 4FN4A 1WWKA 4YJGA 5DCYA 5JYDA 5BR7A 5A9SB 4B7UA 3MWEB 1WDMA 3HJAA 4WNCA 4M87A 2P4QA 3WNQA 5IDWA 3JQFA 3MJTA 1UXIA 5HRUA 2V6GA 2VYNA 5HBRA 5ILOA 3OJLA 4CV0A 1I24A 1PSDA 2YQ4A 1EMDA 2VHZA 3WGQA 3PJFA 4OOEA 2EP5A 4MKRA 4O1MA 1ZK0A 3E5RA 3G1TA 3DXFA 4HV4A 3PHLA 1H6DA 3Q9NA 1NVTA 3F9IA 2WE7A 3KYCB 5G0SA 1LDBA 4BO4A 5FEUA 2P9CA 1QYCA 1P1RA 2JAPA 3BAZA 1NQTA 1BGVA 1LLDA 4ZVVA 1JWBB 3PQFA 4UREA 1K6IA 2VYVD 3PJGA 3RUEA 1T26A 3JD3A 3KSDO 3O8QA 4J2OA 3DBLA 5IDQA 4DQUA 5JBIA 3GNTA 4UULA 3LK7A 4QTZA 4WCFB 4XGNA 4YQZA 4A27A 5AXDA 3ZWVA 1KVQA 3Q1LA 4YB8A 2FR8A 1ISFA 3KEOA 2HCTA 3GN1A 3JQGB 1FDTA 3GNSA 3COSA 4YT4A 1DC4A 1W73A 1DLJA 2HDHA 4E2WA 4AJLA 2OGUA 4CMCA 3T7EA 1BW9A 4B79A 2ZYGA 4RPKA 4CLOB 4AJ4A 3TZKA 1M76A 1LTHR 1NQ5A 1A27A 2OFPA 3DBHA 1GYPA 3U4CA 5DF1A 3G49A 3PGXA 2CNBA 1PJ4A 4E2ZA 2RH8A 2EKLA 3CMCO 4AFNA 1WDLA 4WNIA 1T2CA 2GYYA 3LF2A 3QWFA 3GDGA 1DAOA 5HS4A 3CKYA 3JYOA 5A03A 1P1FA 2QYSA 2Y68A 1JN0A 2PWZA 1VL8A 1JAXA 3CSDA 1U2DA 5TS3A 1OOEA 1MG5A 4LISA 4EUEA 5KOIA 2WD7A 2TMGA 1T25A 2CVOA 2B5VA 4ZU3A 5F1PA 3IAHA 3D64A 5IN5A 4YJFA 3LSYA 1VJ1A 1NBOA 4AJIA 2QG4A 4DYDA 5T6BA 1W0CA 3STHA 3DC2A 2VUSA 4CL8A 4YVFA 5IZCA 3VTFA 4R9SA 3ASUA 3RU7A 2Y67A 2UUPA 3HWRA 3IQDB 1F0YA 2WSBA 1I3NA 1PJCA 2J3IA 4TSKA 1H2BA 4BO5A 4GH5A 5ENVA 4YA6A 1VI2A 1QV6A 4HWKA 1ZO8A 4MP8A 3E9NA 3JYNA 3ZHBA 1DIHA 3OIGA 1DBVO 2NVBA 4W9NA 3ULKA 1PZGA 5THKA 2HQ1A 4JXKA 3SBOA 2D0IA 4NH4A 2EJVA 4CMIA 1GV1A 1QLJA 1QYDA 1C0PA 4WLOA 1XKQA 2P2SA 2G17A 3PRJA 2AHRA 1Q7BA 1M67A 5L95A 4IDBA 5KVSA 2O2SA 3I9NA 3RAJA 1R4MB 3JQDA 2E48A 6ADHA 5ITWA 2RH4A 2EERA 4XGIA 3I6IA 1P1JA 3P2YA 5I7VA 3RROA 4BKOA 2FOIA 4J1NA 5IZCC 1EBUA 1YH3A 3GGGA 1BXZA 3H2SA 3HN2A 4FDAA 2J6IA 7ADHA 3VDRA 3PFFA 4RCVA 3PLRA 3ZW9A 3KYBA 3RKUA 1PQPA 4Z9YA 4CMJA 2EKQA 3Q6IA 2PK3A 1PZFA 1WVGA 1PQUA 2NSDA 1U7HA 3DO5A 3KLPX 1GQ2A 3NT2A 1OFGA 3BZUA 3H2ZA 3OECA 3ZNOA 3Q2KA 3RFXA 3AI3A 1M66A 3C8MA 4R54A 3RBZA 5CDUA 5L4LA 3LC7O 4W9NC 3H9JA 4D45A 1ULUA 1QXSA 1ZK3A 4CR8A 3PIDA 4D41A 1Z75A 3ON5A 1QYVA 1O8CA 2NWQA 3ROMA 1UR5A 2CDBA 4LMPA 4FFPA 2EG9A 2Z1NA 3D5QA 4L4SA 1YJ8A 4ZGWA 1NWHA 1N5DA 4OGWA 1A9ZA 3AK4A 4D3SA 2UAGA 4XDYA 1PGJA 3ZWOA 4DLAA 1N7GA 4K1LA 4N5MA 4TRRA 3JQ9A 3VH1A 4ZQBA 1ADFA 4MVJD 3ZU3A 2ZB8A 1MGOA 4UEJA 1YKFA 3DZKA 3ROPA 3AW9A 1HDCA 4WLNA 4A0SA 2VZ8A 4P38A 1NQAO 4OXNA 5CFZA 4L75A 3IC5A 2J3KA 3ANNA 2O3UA 3AI1A 2Y93A 4EDFA 2Q50A 3PI7A 3VPGA 4IGFA 1I0ZA 1VSVA 2O48X 2FSSA 1SCUA 1TA4A 1EVIA 4I9HA 4XYBA 3TOXA 4CQMB 3JYPA 4IMPA 4E33A 3AI2A 4ALMA 3HB4X 3GFGA 4IJKA 5I7EA 3MEQA 2EW8A 2ZYDA 2B36A 4Z0PA 1E3IA 1F8GA 3KSZO 2JCYA 3ABIA 4UUOA 3G3EA 3K6JA 4HKTA 3IKTA 1B14A 4J0FA 4L0QA 4U0JA 3F5QA 3GPIA 4DVJA 4R01A 5CEFA 3C1AA 4EEZA 2X5KO 1PEDA 1LSSA 1ZMTA 2W2LA 3OBBA 4D0SA 3S2FA 3QVOA 3R3SA 5COAA 2VRCA 1GL3A 3WLEA 1LDYA 4YJGB 4BB6A 4BGEA 4EW6A 1NVMB 3I3OA 2D59A 3O03A 1E7RA 2PH3A 3PJDA 3SLKA 1UP6A 1ZKMA 3V1TC 1R37A 2Y1CA 4CM1A 1XCBA 1R6DA 2RCYA 2CSUA 1HTBA 3INGA 2PH5A 4BO1A 2C7VA 5FI3A 3WB9A 2P5YA 1AHIA 1H6AA 1RJWA 2G0TA 5L7WA 5U9CA 2BRUA 5JAZA 2X0NA 1PU2A 1RM4A 3M2TA 3GA0A 3LVFO 3UCFA 1DHRA 1AE1A 3VH3A 4K9DA 3KTDA 1M6WA 3QVWA 4J91A 4WJZA 2ZCUA 2Q1SA 4R5HA 1QV7A 2O3JA 3DHNA 1Q0QA 2OP0A 2Q1TA 1E3WA 4BNZA 4ND3A 1ONPA 3E48A 3GH3A 4N7RA 4Q3BA 2FHSA 3DBLB 4UVDA 4FS3A 4YQYA 4CLHA 1IHXA 4BQRA 3M6IA 4PVDA 3NTQA 4GVXA 5EESA 1MC5A 1LBEA 2Y1DA 2JL1A 4GGOA 1KEPA 1QKIA 3QW2A 4ALNA 4KWIA 4M8SA 5ICMA 4ALLA 1HXHA 1YE3A 3PQEA 3SC6A 4MJLA 1PGNA 4Q3AA 2DBRA 1KVTA 1H9BA 1C1XA 4PG4A 8LDHA 4RVDA 3FBGA 2H5LA 4AJPA 1I5RA 3DBHB 2NU6A 2VRBA 3HQ4O 2HK7A 3CZRA 2Q2WA 3V5NA 2Y1GA 4B4OA 2I66A 3WFJA 3HDYA
chains in the Genus database with same CATH superfamily
1RJDA 2AJCA 2EHJA 4MW0A 4OSPA 1QVAA 4V0SA 4BAUA 5BV8A 2ON6A 4TLDA 4EKEA 3H2YA 2NTVA 4LOHA 5FR2A 2Q9UA 5C1DA 1YL5A 4X7RA 5DYIA 3S5UA 3NHJA 3DEKA 2EHDA 3NYWA 1WMEA 4W82A 2WOJA 3PZRA 1HF3A 2A9JA 2WF8A 4HRXA 4RTSA 3EW9A 1D1QA 2G9ZA 1VIYA 1IHYA 3OPXA 2KI5A 2WD7B 1UF9A 3ELBA 4N3AA 4NYMR 3IXMA 1Y8CA 4MI1A 5KJ6A 4LDQA 3V4OA 3PRKE 4HRAA 5FWXB 4HQNA 3JQ6A 4HNAB 3ZVLA 1DBRA 3OQVA 1E69A 4RQBA 4FINA 1HZZA 1Q21A 1VP3A 3CR8A 1RWWA 3GCDA 1BRTA 2YBEA 5SZKB 3UPDA 3I42A 3SMQA 4XJSA 3AIKA 2HF7A 821PA 2VN8A 4I1YA 3RJZA 1O97D 3UJBA 1M2WA 2Q2QA 3N2ZB 4KDFA 5AVWA 1YJAA 2NUPA 2PS1A 4ARZB 2QORA 1WQ1R 1ZGAA 2R1VB 3GUUA 1T1SA 2P2DA 4OJYA 3WO0A 2O2JA 3IMGA 3TW8A 2MT9A 3EXFA 5F9FA 5B1HA 1A9RA 3RBAA 1NF3A 1TZCA 4ZOEA 3JQAB 2Q5LA 1EX6A 4NPCA 5BMOA 2ZSJA 1IN7A 2P0AA 4F9GA 1RLTA 3OH8A 4HB0A 3LHSA 4C6RA 4ZT2A 4L4XA 5KWVA 1NXVA 1ZKDA 3UT5A 2CNDA 2OMKA 2E49A 3VUFA 5FA6A 2B1IA 3LYAA 1XOIA 4YRJA 4YAIA 4GM0A 2AA3A 3E15A 1JEQB 2QL5A 4AT1A 3KQHA 4BBPA 4QECA 4KNYA 2WP0A 4JI2B 3BXGA 1TYZA 4UDOA 2GASA 4U2DA 2XUZA 3JQCA 3GAFA 3RC8A 1TK2A 5L51A 3B6JA 3SHOA 3M1YA 1RQPA 3GGJA 1FDIA 3REOA 1V1MB 1ZICA 3VPXA 4TQAA 4Y9SA 1QIIA 4BO0A 2I54A 2BISA 3IUQA 2IH4A 4XIYA 1G16A 1W59A 2COKA 1R6XA 1N32B 3TG2A 3PRHA 3UV6A 5JNRA 3TM4A 1E1DA 3N7TA 3GA7A 1RHQA 1G1AA 1SUAA 1ZA1A 2W7TA 3QUSA 1WA5A 3WKAA 1G8YA 4BB5A 5KYGA 3AFIA 4DYVA 2DPMA 3CWQA 3DYIA 3EFOB 4CEIB 4E12A 1HE2A 1WUKS 4WEQA 3KEFA 3TD9A 4G6ZA 3T7SA 1A8HA 4HVLA 3H5TA 3FPHA 4OHBA 2FQ1A 5CYFA 1RLOA 4OMUA 2PGNA 1OXUA 4KX5A 1J0BA 2CFCA 4E32A 2XECA 2C5HA 5LR6A 3K53A 1D09A 1QG6A 2H2WA 2JLRA 2CLCX 4QSMA 1GG9A 3WSWA 3DTNA 2XMPA 2DUUA 3QQPA 3D7RA 1Z2DA 5E7MA 2ZPAA 3FMVA 3IUBA 4G9BA 2QWXA 3OVMA 5FWDA 2V58A 4DRZA 1Z5OA 2A0KA 1G2IA 4EKDA 1I1OA 1WHTA 1YJBA 5LA6A 2IS1A 1C7JA 2GN0A 3GJXC 2ZJFA 1G0NA 1YC5A 3KJGA 1HQCA 4FFRA 4A6PA 2DWCA 5AHRA 2C1ZA 2A6PA 4PPFA 4CV2A 4TUYB 5IJWA 1M6EX 4FP9A 4F86A 3DHYA 3N05A 4W6ZA 4RO0A 1VJRA 4JP2A 3O4HA 3LHKA 3UXYA 3PNMA 2VSQA 3F6RA 4LDZA 3WDMA 4DNPA 4Z4FA 4FZVA 2R2GA 4R31A 2ATXA 3TIFA 1QK5A 2BFEB 3J80A 2ZBUA 1YRLA 5F9MA 2PL5A 2UUOA 3FXAA 1ESZA 1MIHA 3OE7D 4TXLA 5K8VA 3JD4A 1AN9A 1PQYA 4ONEA 3B5JA 3DBVO 3EPRA 2H0AA 4LJ9A 1NBIA 4R4JA 4EECA 5BQFA 3KZMA 2ZSDA 3E2IA 1U2EA 2WV7A 4PO1A 3U7QB 4M37A 1XLTC 1ECLA 4UOEA 4OATA 2JLXA 3RIYA 4MYDA 2Q5CA 1ISSA 3EJ6A 1MV8A 3OPYI 3O1HB 5KUTA 2GVDC 1OX6A 4ALIA 5J2TA 3VISA 2XTMA 3AEKA 2Q8NA 4ZRDA 5KWEA 1Q1AA 5FNVB 1VSTA 2JGIA 4BKQA 4PC7A 3SSMA 1WNTA 1R6BX 2NOAA 2R0QC 5DGCA 2W6IA 4Q4CA 2EFJA 2PBRA 3L7OA 4DC0A 4DJFC 1LRJA 1UZMA 4D5GA 3ISTA 1L7EA 3MCAA 3ENNA 1PRYA 4L9RA 3T9EA 4II2A 1VMKA 3FHJA 5K8IA 1C2YA 3T9CA 2FPKA 1ZJ4A 4B4VA 2VP6A 3R3JA 3O1LA 2FTKE 2ZYIA 3AR8A 4JLWA 3EIEA 4AYTA 2WFMA 2QL9A 1PR9A 4YHHB 2EBWA 3OSZA 1IC6A 4P2BA 4RESA 2VA8A 1JECA 1VIDA 2IUEA 3Q6NA 3QVGA 5KJ1A 4E7OA 1I2CA 3DJYA 2F48A 1U3UA 3CE9A 3STXA 3NT4A 3L1UA 3EXEA 1RAHA 4U2BA 3ICCA 4DR6B 1XVAA 3PFCA 1V71A 1I51A 4FC6A 4PLYA 4OYHA 4QARA 3LZCA 5F52A 2QR3A 4ZT5A 3VBEA 1K08A 1A9XA 2Q6VA 3AY6A 3H11B 5H16A 1JDBC 2DQZA 2XGOA 1KI4A 5LXTF 2OB2A 4LMAA 1COWA 1Y1LA 5CM9C 1X8XA 2PUFA 3KJQA 2AG6A 4M2LA 4JJ6A 1RP7A 3PC4A 1DRUA 2ZTMA 4G25A 1RM0A 5KX5B 4PQGA 5CNIA 1LTQA 3DL0A 3SJ7A 9MHTA 3IP8A 5GJBA 2VUTA 2OXEA 2FX5A 5B3JA 1RPAA 1TD9A 2YC4C 4I1PA 3VGJA 5G4KB 1SB9A 2A9FA 1IM5A 1P2UA 1ZYUA 3LP6A 2PX5A 1O8BA 2I03A 2X13A 3IB3A 4QDXA 5TGTA 3TOVA 3IOCA 3BM5A 2NO7A 5L3SA 3A2LA 4R3WA 1ISJA 4Q9DA 4DY4A 1NW6A 2W6CX 2Q5QA 1IEWA 3E8XA 1VOTA 5BO5A 4EJ2A 2WHPA 4KPEC 3W5AA 1LSJA 1OU0A 3A0RB 3CLSD 5A1JA 2NXCA 5JS8A 1PT8A 3OZBA 3ZDDA 1EIWA 3IALA 2QIOA 1K88A 1SUCA 2GNAA 2J5RA 2YV1A 4Q3CA 4MO2A 4DMHA 4ISCA 1F48A 1MO3A 2FWJA 1R8XA 3HJFA 1MRSA 2YIVX 4K6CA 3UMRA 1WPQA 2Q2NA 1JDSA 2GN8A 3Q0TA 3OZVA 1YCFA 4YAFA 2IV3A 1MFPA 1C14A 1CUZA 5JPIA 1JPJA 4EI2A 4ECEA 3TECE 3KYJB 2W6NA 3EXHB 4QUEA 1HQKA 3I28A 4XX0B 4B33A 5JAOA 4RHTA 1H69A 1G9XA 3CJTA 2IZ6A 3ZE9A 5EWLA 2QN7A 3M0EA 4A82A 4FDLA 3CWCA 2AZTA 2ZUWA 4B3JA 2LZ0A 3VSEA 1P7ZA 1XCPA 1IBRA 2NV2B 4DT1B 4LJYA 3P0IA 4YACA 4YIKA 4HDRA 1BMDA 1H0RA 4RABA 1X0XA 3HR8A 3HXTA 3KPYA 2MOKA 3QEKA 5H9WA 1U81A 1N25A 5CJPA 3RW9A 1Q0UA 2A0UA 1EP3B 2BFFA 1JNYA 3MM4A 3ODPA 4LSWA 3TL6A 5JXHA 4OHUA 5ALUA 2G1PA 1JKJA 4ZV4A 1Z2AA 3U80A 1RXUA 2J87A 3HY3A 3K4QA 5D5QA 2X15A 1G7RA 1SOMA 3EZLA 5CDFE 2C4TA 3DEIA 3ETGA 4QRHA 1W4BA 3V1UA 1QZTA 4UDYX 4B09A 4MEBA 4OOFA 3DAYA 2QAGB 2VTKA 4E5VA 3IMFA 1KI8A 3DR3A 2HBZA 3D6UA 3T3HA 1XL0A 5CX1B 1L7QA 3D1VA 3QVJA 1F6WA 4GP6A 4F2DA 5KMGB 3O6VA 3PSAA 2C9CA 1RXVA 1KAHA 1UADA 4CTMA 1JA0A 2JJYA 2SKEA 2WRZA 2VT7A 4IRUB 4PYIA 3LDUA 3I9JA 4RF2A 1GNLA 1RAFA 4XYMA 2FP3A 2ZZKA 1XEFA 4GKKB 3MWGA 4BO3A 2XTZA 1ZC4A 2QP3A 1K63A 1M74A 3HWWA 4QKQA 2H2FA 3WK9A 4D0GA 3H86A 5JDIC 3V8BA 1QO7A 2JI9A 2UDPA 5AK5A 2CFSA 3PYXA 4CQMD 3M7IA 2XTJA 3A6PC 1DWUA 1II8B 2C57A 3C5EA 4CN8A 5JEEA 4YCLA 4MB2A 4I99A 4WASA 2GFIA 1VSBA 5LZ7A 2EARA 3RGGA 4B45A 4Y2JA 2PIDA 5JWRA 1E7QA 5IM4A 2WYOA 2D1YA 4MUIA 3A1SA 4KO3S 4C0LA 4Q9AA 4NQZA 3RI3A 2NSJA 2PO5A 1MJFA 2WV9A 3I4FA 3OEWA 3W3AA 4MIKA 4BLRA 4UPEA 2QSJA 3G8DA 2WJWA 4IZHA 4FXPA 1X0VA 1QC5B 1TUIA 2ABWA 4X41A 2XDAA 2YXEA 4WKCA 4M7PA 3TJZA 5JVDF 1S5PA 2V3WA 4MWCA 4IOJA 5AXAA 5HQJA 4M1YA 3ZY6A 2EVWX 4CM5A 1P7WA 3K92A 4HAOA 4JN6B 4PSCA 1B42A 4ANFA 2ZIXB 2WQ7A 3HCPA 2WYIA 4IX1A 3V7FA 2NADA 4O08A 1QHSA 1XZ8A 1Z88A 3O31A 2F9LA 5FPTA 1GM5A 4KXFB 4Q4HA 2W6JD 2GZ1A 2MSKA 1ZGCA 2PVSA 3ZD9A 4OI4A 5ABPA 2Y76A 2G0AA 1FY2A 1CQPA 3F49S 1VCHA 2MSLA 1JKXA 1ENZA 3R5TA 4C3OB 7REQA 1GSIA 2IPNA 3ROEA 4CM6A 1I6LA 3COZA 5DTJA 4ZEOA 3Q3GE 1OH7A 3V1MA 1BQ3A 4CQMA 3EISA 4UEKA 3KOUA 1ZSYA 3IKMB 4N3BA 5SY6A 5EJ6A 1N8NA 3GJSA 3KM0A 3KTOA 2OCYC 4DLRA 2BTQB 3CRVA 3DM9B 1B0UA 5TDHA 3MC1A 5JXIA 2XE4A 2QPTA 3E2MA 3NIDB 1N9GB 5HK9A 3HL0A 3UENA 2C92A 3K0FA 1O95A 2XBLA 4HH4A 4LNUB 5SV2A 2G9UA 3GOQA 2PKXA 2P1DA 3ZCSA 2YIDA 4MQUA 4C29A 3COPA 1RDFA 1U6JA 1IULA 2XNDA 4KIUA 5AOAA 4FK8A 3GI1A 3GO4A 1RYEA 2HTFA 2QROA 1GZDA 3IAEA 3V3KA 1CQWA 4PGFA 1YQDA 2ZWIA 1DEHA 4IIVA 1R8YA 2G76A 3A2MA 2NZYA 4FNOA 3AEQB 3K3PA 4C7VA 3DLBA 1Z7GA 2JHPA 5EEGA 5CLJA 3AF2A 4DV3B 4AQ7A 2XZPA 4G81A 4J3FA 5GJCA 3GEMA 1Y7TA 2JH3A 3D1JA 4IRMA 3O7WA 2WD9A 2HSGA 1SIUA 1X39A 5BOVA 4FLMA 4V0KA 1PFVA 5G2OA 4UPDA 3KKNA 5EERA 3SQXA 5G4LA 2WMDA 3EF0A 3VVCA 3WGTA 1OGIA 4TL6A 3X3HA 8MHTA 3BA6A 4V0QA 2EU8A 3NVAA 2WUGA 2ZETA 1EFRA 4XUGB 2K7FA 2UYCA 1UKYA 2XXAA 4KLNA 3X1MA 2WJYA 4IGAA 1CFJA 3AM1A 1ISMA 3UG6A 3I5YA 3WLSA 3INRA 1MT0A 5IABA 1I6WA 5JJLA 1TLLA 2AW5A 3DAHA 2VYFA 1Q3HA 1DPGA 1TGVA 4ETNA 2CJPA 3R5JA 3QIAA 2C9YA 5CXXA 5J5AA 1THTA 2Q1WA 3DVAA 4MR8B 3KCQA 1W44A 4PZPA 1XPUA 3G0GA 3IHWA 2GM3A 2P8SA 1ZH2A 3SGLA 1L4BA 5DSZA 2DWUA 1H0KA 1KYIA 3ZCTA 1C30B 1HMPA 3T7JA 2P9FA 4LW8A 4GWLA 4JFRA 1BCSB 1T0IA 1ST3A 1NYQA 2NU8A 4HDMB 3WK8A 3QVKA 2W37A 2SECE 2VDKB 4QQRA 3SJZA 4EY4A 4FHDA 4QVGA 4W5WA 1LQTA 4LXTA 5CR9A 1FCJA 4KXLA 1U63A 2PKYX 4LJLA 3AL3A 3JQAD 3UUEA 3KWLA 1Y98A 1HFJA 4BYGA 1I7DA 1M0WA 4RFVA 2FPIA 2E4AA 1L9XA 3LK6A 3V1KA 1U2DC 4YT8A 2DLNA 2HV8A 1JJIA 4WBSA 2FPOA 3JZDA 4F60A 4Z9XA 2V1XA 3B7PA 4QREA 4ZANA 1UOQA 2B1QA 3T8YA 4MV1A 1EFVA 3FCOA 3NHSA 4B83A 1L4EA 2P65A 1KYQA 3GMIA 1CFZA 2EIHA 4XM2A 4ZOBA 1DS6A 2IIVA 2PFSA 3AM5A 1JEAA 3W6UA 2D1TA 4MS3A 2WVJA 1NSTA 5ADWA 4KDEA 1YF3A 3DAGA 2ID9A 4JOBA 4RE6A 1BEZA 1N4DA 4S12A 3FLMA 5FBWB 1W30A 4EA6A 3QQ5A 5L4NA 2PNFA 4ACAA 3ANLA 1N5JA 1WNFA 3COYA 4B0OA 3WRXA 5ITVA 3GJ4A 5BYKA 1XXHB 3PGMA 4GI3A 4Z4CA 3GHYA 3HV2A 3KV3O 2RH9B 4LJ5A 2ZE7A 4LZPA 1P73A 4JKOA 1E1CA 3ND6A 2KLHA 2ZSFA 3WX0A 5EWJA 4JMLA 2YOHA 1M1YE 5EE0A 3WMXA 1YMVA 5AVOA 2CLDX 1JFFB 2HPVA 1WB4A 3IGFA 4YO8A 2DWQA 1NUUA 1JU3A 5B7GA 3LL7A 1GUFA 1RKBA 3DXZA 3MT8A 1G6KA 1JIQA 1XALA 1YOVB 3CX8A 5BN3A 1JH9A 2Z56A 1L5WA 5D7NA 5KSPA 3DZJA 5FO0A 1S4QA 2FB9A 4G89A 4C88A 3OPNA 3EDOA 1A76A 3WLHA 1XTZA 4FLFA 4NBRA 1QHHA 5CA1A 3EW7A 4BUCA 4EBFA 9GPBA 2CXXA 5K3SA 4EX6A 1CVRA 3ZK9A 3A6FA 3OZXA 3DZBA 5EE9A 3RS8A 2R9VA 3FFTA 5B4VA 2GILA 4LV5B 4TXNA 5LD2B 2CCKA 2QE7D 5D87A 3RVDA 3UJPA 3GZNB 1D4AA 1DAIA 3PHHA 4PC2A 2PUJA 3ZGVA 2XA2A 3HO8A 5LDHA 5TIIA 3GT7A 1JPUA 4KSCA 1E2GA 1VG1A 4LCEA 2N1MA 1G64A 1CQJA 1BHQ1 1Z3CA 2ZBQA 1N1MA 5DWQA 4ABTA 4OQEA 3IE0A 4N76A 3E70C 4LFBB 2WWXA 1Y7HA 3UM9A 3HXKA 4N9WA 2IKSA 4LOJA 4M1SA 3IPYA 3OM9A 1MDFA 1WBJB 2WJAA 4NNJA 2PUGA 3RUAA 3SNKA 5EE3A 4PZ9A 3HYLA 1KJIA 5J9FA 5EQTA 4CCYB 2REQA 2XDQB 1CJSA 4ZT6A 3U3DA 5ADHA 1FUUA 3WO1A 3MTBA 3QX3A 3C6QA 3STWA 1INLA 1BFUA 3KHSA 5HKKD 2O06A 3MOGA 4B6EA 4KYUA 2ZYVX 4F8YA 3LWBA 3PNYA 4IJ5A 5CVEA 5TQ2A 1IH8A 4O63O 3NATA 5FV4A 3DCNA 2QD2A 3L6UA 1AXGA 4ZRNA 1UBJS 1VCNA 3KKOA 2PGXA 2WMOB 1RKQA 3SC3A 1SQSA 3LFTA 4BV2A 1GPWB 3EWSA 4QU8A 3AEUA 2R6JA 4L5BA 3GJ3A 3FB1A 1J0AA 3JQ9C 3QPUA 5JCPA 3FKSA 3BXXA 4B7AA 4CE6A 3O38A 4TL7A 4XCQA 4FHCA 3VDQA 1KU6A 3R6LA 3WZ2A 3CY6A 3DZDA 1UIMA 4B5KA 3KB6A 4YRCA 1XEWX 4WINA 2HXGA 1V37A 2FEXA 2PMKA 3IP1A 4LCJA 4LDRA 4Q1BA 4H6PA 4OIMA 3UCXA 4KSYA 1KBOA 4WOBA 2HU2A 3NIBA 2OZVA 5FULA 3HKCB 3CLVA 3I72A 5DM0A 1DB3A 1BX0A 1R0YA 2OOKA 3MTQA 1T5HX 3ORFA 4GPIB 4LRQA 5KWSA 1LBHA 1M2OA 1ODJA 4O25A 3VHLB 5A62A 1F7VA 5DKFA 2IU0A 3RSFA 2X8WA 1WQ3A 3BMQA 3KQOA 4QUAA 1JLMA 5TY0A 3HR7A 2XR1A 1L4UA 2HIHA 3E7FA 4MHSA 4DPKA 5KNCD 5L3ZA 1XVLA 1H1LA 1V4VA 2Y99A 2ECQA 2X76A 3GAMA 1XQWA 3O3MB 1P2FA 2JLUA 3I1JA 3TLXA 1OU4A 4D74A 2AEMA 2V6FA 2Q4DA 2RCNA 2PV0A 1PZEA 3HS3A 4HYEA 1DXOA 3G5LA 4ZV9A 3FSEA 3KPVA 3R3UA 4W8GA 3VKUA 4LN1A 5TNXA 1YCGA 1RVDA 5A3QA 4I55F 1BD4A 1IWPB 1SC4A 1SIOA 3WIVA 2X22A 4IGIA 3SYMA 1NU8A 1BS1A 3CZ9A 3E7DA 5AKYA 1ZVVA 2NGRA 1IY0A 1SXIA 1QCZA 4JBXA 4P93A 3V8MA 4ZHQF 3W5CA 2Y4OA 5JZOA 3AF6A 5IF9A 5DNVA 4OI1A 1COZA 1T0PA 2VYCA 3KPWA 2O8CA 4R40A 1M0SA 3TEJA 1U0BB 1WLYA 4UBNA 1NQWA 1WCXA 2OSBA 4K9QA 3G2JA 2GYWA 2ZVDA 2VPPA 4XW2A 3IPXA 1DKQA 1GNQA 2YXLA 1KO7A 2JARA 4HTAA 3KDAA 1H05A 5C5EA 5K5EA 1XWFA 1HOXA 1WCIB 3OJXA 5F5XA 1HFWA 1BMFA 1B6GA 4KVFA 1FTNA 1IZ9A 2JATA 4WKPA 1QYIA 3W6PA 1LDGA 1VC2A 1UDRA 1N34B 4WJLA 3CVJA 2BEVB 2OD2A 3V7NA 1ONBA 1K89A 4CV1A 3I1IA 4A1FA 1E1KA 5THQA 1X1BA 3VGPA 4DRXA 3ED1A 1C3LA 3GRAA 1O6FA 5F7JA 1GXSB 1JHMA 4YJFB 5JSFA 5K0ZA 4R71A 4FMCF 4CEHB 4GGMX 2YDYA 2FETA 1XZHA 2YWBA 5EJMA 3RRFA 3DV9A 5A5DA 2R7LA 3DC7A 2OC9A 3DNMA 3F9CA 4KI7A 3KQTA 1AHPA 5LMUB 2XT6A 4KFRA 1SZJG 2OL4A 3HZRA 4QO7A 4O2BB 1D2RA 1XZFA 3M4ZA 5EJ2A 1OX5A 1TM3E 2E37A 3GRFA 2DJ5A 4QC2A 5I7RA 1TO1E 1KP9A 5K7SA 2JKZA 1GRCA 1NW5A 3KT8A 1SK9A 4ILEA 2B5OA 5HWSA 2AQ8A 2GM9A 2B8EA 2ZI9A 2YMLA 2PTGA 1M2JA 5A7HA 3TAXA 2G5TA 4MB0A 3S2IA 3UWMA 1FNNA 2WP8J 5LOVB 2YHIB 3VBCA 4AO8A 3QXXA 3MD9A 1FX0B 3GRUA 1MXHA 1PQWA 4OB8A 3AHIA 3L07A 1BH2A 3URMA 4ASUD 3SFVA 5K3OA 1DG3A 2VDLB 3P4UA 4FI3F 1ECFA 4EHKA 4P4SA 2IGTA 5LUAA 2C20A 3LT5A 5JTUA 4H16A 4L73A 1Q22A 1WW8A 3MUEA 3FSGD 1LBQA 1LK7A 3ANSA 3QBTA 1JHPA 3G8BA 5KDDA 5GVRA 5CCXA 3TRDA 5EUQB 1YT5A 4U7TB 5JUWA 1GR0A 1ZUWA 4OMFG 3BHJA 1ZIXA 3VR5D 3KU1A 3PQCA 1U0OC 2NO6A 1JGTA 2HMYB 5EP2A 3ZCUA 2KJQA 2XUOA 1DAHA 3C4QA 1VHDA 1NXWA 3DAFA 2BE9A 4QU0A 4ZEMA 1ZM7A 2Z6AA 4G56A 2UZ1B 2WDZA 1DCKA 2G88A 3KFLA 4Q18A 5ALNA 3SHWA 4PLTA 4IOKA 4RUKA 2CXRA 1P9OA 2JLSA 3AKEA 3EF1A 4MDYA 5LJIA 2YW2A 3SQDA 3TZLA 1A7JA 1Q95A 3NKLA 2LUOA 3IBTA 1N0IA 5AM0A 4DCTA 1NMZA 4MUAA 3MRTA 5LQSA 2VP0A 4LX0A 3ZE0B 1I3LA 4Y2YA 4ZQCB 5F21A 1R0CA 3WIBA 1T0BA 1EE1A 2NZVG 1EVLA 1D6MA 1GN9A 2X6TA 3FA2A 1NTOA 3LUJA 4G36A 2WF7A 4OMDA 2CJFA 2OXTA 1UBCA 3HKEA 3LW7A 2PZKA 3I9MA 3PXDA 3QXCA 2H11A 4WDQA 5KKCA 2J6CA 4X1YA 5KOHA 2YFKA 5DGTA 5FTNA 1U99A 1NVUQ 4KR9A 3UVEA 3BJRA 3SIPA 4B6OA 1VE5A 5GZ3A 4NOKA 5A9SA 4RKRA 3MWEA 3NONA 3BDAA 4P4UA 4W1QA 3BKWA 2BFBB 5H3CA 3B9RA 2OQRA 4P8RA 1E3JA 4YRKA 5MGBA 4TMTA 4HWPA 1GA6A 1VJTA 3U4QA 4QXPA 1CDOA 5I51A 4B8WA 2IP2A 1QRTA 1NMYA 5DHUA 5DFAA 2XT0A 3F6SA 4H0FA 3LP5A 3HGMA 2O19A 3I32A 4TMKA 4LHYA 4K2HA 4LTDA 2QVCA 1JKMA 1X7WA 1PYDA 3DBOB 2P8JA 4JYPA 4D0LB 4EVRA 2R65A 1T3HA 5AVTA 4BC1A 5JAHA 1HDYA 1CXZA 3L6EA 5CLGA 5B3KA 1Z6ZA 2AJ8A 1KKLA 5GGXA 3WQQA 1UAAA 1Y9ZA 1Z5UA 3IUEA 1S2OA 3N6VA 3AQ4A 4S2UA 5AP9A 4D99A 3A11A 3LLCA 4DV2B 2VHYA 3OTOB 4J07A 3ZZ0A 3C6XA 3TMAA 2EZUA 4HWTA 3AF4A 3DYVA 5ER6A 3A1TA 3Q3JB 2HJ9A 5FLYA 2ZZNA 1YRBA 2DVMA 3FW1A 1XRPA 3ELWA 3UH0A 1QGAA 1ID1A 1P9NA 3UO8B 4QOJA 4BY9E 2J33A 1JAHA 3BEOA 1NQUA 3V2IA 3JQGA 1WMFA 2ZROA 4YNBA 1SEPA 2SNIE 5CEEA 5D01A 2CWDA 4O3FA 3DA8A 3P2EA 1BA3A 4XCXA 1MFZA 4MWZA 1ZN8A 1UKAA 1XZDA 1MGPA 1R0KA 1UZAA 4KE6A 4UE3S 3EXG1 4HDNB 3O8OA 2VXBA 2QP9X 5CMLA 1NJ5A 1DAGA 2JANA 3NT5A 1B8OA 1LK5A 1RBYA 4NE2A 1BS9A 5K6AA 1XVTA 1EKXA 1EWKA 4NK4A 4WESA 2ASEA 5LQAA 4J2TA 4EM6A 2AOVA 2BM9A 4HVAA 2O2GA 3ZE6A 3EVAA 2QB5A 2Q5EA 4QOSA 1CUEA 1O08A 2Y05A 2PQ0A 3BJIC 3Q2IA 4QXAA 1UFQA 3NEPX 2IOFA 3OA2A 2JVKA 3WMGA 4BWYA 5IVKA 3AG6A 2VH5R 3NM5A 3OO0A 1VG0B 3G1UA 3NDJA 1NDUA 4Y2XA 5HM8A 3KWJA 3LCRA 2Z6UA 3ACBA 3C6YA 3NHKA 3PE6A 1MQ9A 4U7DA 3AVVA 5EOVA 1X1SA 1V7QA 5B1SA 3WV4A 4I3FA 1IRXA 4COKA 1EVQA 4U00A 1FIUA 2REBA 3O75A 3VFDA 4J7CA 1C9EA 5KINB 5JY1A 3LL4A 3VU8A 1W4CA 5AW9A 3OIDA 2Q1UA 2R96A 1IM2A 1ZOLA 2M98A 3PU6A 4D9FA 5ITSA 4QAQA 1U2RA 1X7DA 3P26A 4F92B 3KO8A 4L22A 2SCUA 2Z9DA 1THMA 3HFRA 3EZFA 3GF4A 1YV9A 3FKJA 3R6DA 3X44A 4J7UA 4EB6B 4EKNB 3HJHA 4YRGA 3WS7A 1KIAA 3EDQA 3K0HA 3BYZA 1E2HA 4INPA 4ZI3A 1VCMA 3ZWNA 3L18A 1KH2A 2HUPA 1J2UA 4BO7A 4E88A 2R1ZA 4WZBA 2QSUA 3I1FA 2CEKA 3QWHA 4MR9B 1EEHA 1C8BA 2Q7XA 4QJ3A 1KSFX 4P4TA 3R3YA 2NU6B 3B89A 3P9RA 2O8DB 2YXNA 1TJ4A 2C9OA 1V1RA 1UDBA 1CR2A 1CB7A 1C3OA 3X1ZA 1KA9H 4TWRA 2GF2A 1Y5MA 2OBBA 2ZJ0A 3QVXA 2I0FA 4DLKA 2HLDD 3MTJA 3MHTA 4RK7A 2V6IA 3PUHA 3KUXA 4RFLA 4YDSA 4RD0A 2VHTA 4TKZA 1A04A 4GD3Q 3N8IA 5HS6A 4CUZA 4HK4A 3G0OA 4KYTA 2FEOA 1R3UA 2PD4A 2FMKA 1U8FO 3PK0A 1UPXA 5HUJA 5HCUA 3RV3A 4XWYA 1SBTA 1U5AA 2J30A 3ROFA 3F6EX 1G98A 3VHRA 3GT3A 5KNCH 2I6TA 4NG4A 1WTAA 2G04A 1QHGA 2P9GA 1JSCA 4EHLA 5FBZA 4ZYTA 1NFRA 3KKQA 5DGXA 3NIGB 3WLRA 5EJIA 1T5IA 5A5FA 4GI5A 3K73O 4F6CA 2WZDA 3KK0A 2GZAA 1T5TA 1NGSA 1MB2A 2YJTD 5KYKA 3NP9A 3FH0A 1YUNA 1I8TA 2NZWA 4C4ZA 2NUPB 3CC8A 4D81A 4GDFA 1CRQA 3TGWA 3QA3E 2F3TA 4A3SA 4OHPA 5A1TA 3DKPA 2DBQA 5A4MS 4AN1A 4IXNA 3TW8B 3WGHA 1FTWA 1DRWA 1XAHA 4HAZA 1B8NA 1UQTA 1WF3A 3GPDG 3QMPA 4ENSA 2YIJA 1P1BA 1NFQA 4QT0A 1KI3A 3AV0B 3P2JA 4CDNA 3A0UA 3SHVA 4BTVA 5BOSA 2R6DA 4YUYA 4EG8A 4C2TA 2CMKA 4S05A 3AF3A 4EHDA 1SHKA 1SKYB 2IA5A 1W75A 2QTNA 3HSYA 4JCOA 4EUSA 1YE8A 2FGJA 2V4MA 4X6LA 5AI4A 4EGAA 4YCSA 4LDJA 1QPZA 3F90A 5A4JA 3P5BA 2BKLA 2JGNA 3L1IA 4P7GA 5LP6F 1K5GA 5KZMB 4FWIB 3MAAC 1WUIS 4E07A 4XYLA 1UWLA 2BJHA 2E5LB 4KR7A 2O23A 3N6RA 3H04A 1NN3A 4A8JA 3EIOA 3UV7A 1KO1A 3COJA 3RS0A 3IHKA 5BVGA 2UZ3A 3WLAA 1UINA 1EUDA 3VVLA 5E0KB 4A26A 5BSKA 3ABRB 5HDQA 2G82A 4DLLA 2OORC 1I32A 4MV4A 2QHXA 1UZUA 1SQFA 1PS8A 1PW7A 3L1JA 4L08A 1AXEA 2CLKB 2QTCA 2BYTA 3DYBA 3C97A 2EFDB 4K9KA 1H4SA 2YJ5A 3FHCB 1M2VA 5MN6A 2RGRA 5DCLA 4EW1A 2OMEA 3TQCA 4CI9A 2QJRA 2ZRFA 3AUJB 2BKUA 3CE6A 4PSUA 3UJCA 3SIXA 1UH5A 4OA5A 3SZ3A 1XZLA 2RGAA 1MAAA 3H5VA 4NK5A 4UD6A 4BMNA 1IPHA 1L4GA 2O05A 3GDFA 4CW7A 2YY6A 1F2DA 4O4IB 2VYND 4N9QA 5DXAA 4NBLA 3I2YX 1QRAA 1J97A 1YQTA 4K28A 2ZI7A 4YMUA 2ORED 3MXTA 5B55A 1MPTA 1BRMA 1O4VA 2VUUA 5FTKA 5I8ZA 2H92A 5BP7A 5IBCA 3BQMB 4JBGA 4M9UA 4UEWA 1E0KA 2DY1A 3BEDA 5LA6B 4LI3X 3EK2A 1E5QA 1IBCA 2P2LA 3EOZA 3RS3A 5AHWA 4PANA 4YRNA 1CF2O 1WKVA 2FKAA 2H57A 3G9QA 3N9IA 4UHKA 3SDZA 3ORSA 1HDOA 2DAPA 2PWBA 4WVLA 421PA 4DLWA 2E89A 3U60B 3HB9A 3N58A 2IPOA 3R7NA 2VYVA 3HGQA 4EPVA 5B6PA 2VPTA 2OBLA 1T0JB 4GP9A 4S1WA 5EJ5A 1N2SA 3NUQA 2OCLA 1TYEB 2VPIA 2HB6A 2HRDA 5AW7A 3DE4X 1CY8A 1EFKA 1TM2A 2JAHA 5GPBA 3F7MA 4J43A 3FGOA 4A2QA 1TAUA 2EZ9A 2XRYA 1L7AA 1V8ZA 4UTXA 1NBWB 2YWJA 5ALYA 5BWNA 5FXMA 5LYJB 4B3SB 3VOTA 1YVPA 5LBUA 3VXKA 1PR5A 3PFWO 3ZXXA 1AKMA 1DZIA 1MV5A 4I2VA 3HI4A 4REQA 1I0IA 2D2IA 3ICVA 1JEYA 1DL5A 1MEEA 4AJHA 5J2TB 2R66A 3AEKB 3WNBA 1NZFA 3JAMA 3KR0A 1L5ZA 3DXXA 1HT0A 3P32A 4D3YA 5TGDA 1I0LA 1E79D 4ZU1X 1E20A 1JHXA 1GZ7A 1K98A 5I4BA 5FRDA 4AUKA 4G41A 2AMJA 4NXMB 5FUBA 4CR7A 2WHYA 3PUYA 1W93A 1B1AA 3OY2A 1NBAA 5JS6A 1QQBA 1ENYA 4R2IA 4DG5A 4MO9A 5LBIA 3FGZA 1LPNA 1Q57A 4LF7B 3WR5A 3MPUA 1VI5A 4R1QA 3LLVA 4TMVA 1NLZA 3QVGB 3SXUA 3UN1A 4BUJA 4AJKA 4TSFD 1ZRHA 4WZBE 4AJNA 2R7NA 4Q3NA 1MB3A 3L6OO 5A3SA 2F9FA 4IZ6A 1ZCZA 4HDCA 4TLMB 4IGEA 4ITVA 1F51E 6Q21A 5CURA 4ZYZA 2YWFA 3R5HA 1M2HA 4EB8A 5JDCA 3WGZA 5DN6D 1QFZA 2FZLA 3NASA 4RH0A 1ZDMA 3O21A 2I9PA 2BJWA 5JFGA 1IY2A 1YKSA 4J03A 4XA8A 3BRWD 3BWYA 2ZYWX 5JYBA 4JLBA 1K2VN 1PV4A 1Y1PA 2Y0EA 3R75A 1WB6A 2DG2A 5C7OO 1PK7A 1QGUA 2O0KA 2PQ2A 4IVNA 3RRBA 3L8DA 5J4YA 1ORHA 2AG0A 1K6JA 3ZWWA 1Y3FE 6REQA 3IBCA 3ZXYA 2D5CA 5EP3A 4JJIA 1L2TA 1O77A 2DCUA 3RSQA 4D4MA 1U2SA 1U7TA 1ORTA 2B4KA 1DWQA 5L3SB 2N42A 4H18A 2P90A 1ZHHA 4ES6A 4JYZA 1I3KA 5EMJA 4ZOLA 3SVZA 2WHPB 3OWXA 1ISIA 4R3NA 4KWHA 3L6BA 2C4NA 2P9ZA 2XCQA 3AILA 1BN6A 2H3EA 3GBSA 2ZVQX 4XFKA 3AVUA 1RPZA 1PIWA 1VE7A 3AUXA 1I9CA 1RCUA 1GU7A 1H9AA 1W88A 3RWOA 3LWZA 3IODA 3KZXA 4R9NA 5EXDA 4QQNA 4XDHA 1E3MA 4PF1A 1RZRA 4LXHA 1TUEA 2RGCA 2XYGA 4L5IA 4AECA 4QD3A 1ARZA 2BHRA 4DIFA 1IBLB 2A1UA 1VM6A 5F1YA 2VTEA 3U44A 3U26A 1N2JA 3MJRA 3AIOA 3PUZA 3CF0A 4R9UC 3RYHA 4ENUA 3LZ6A 5KHAA 1WO8A 5BSHA 3VSCA 4ZQFA 2CMGA 3ZIAA 1PGOA 3HNPA 4E70A 1XI2A 1ILEA 4P3XA 4IVPA 5EIWA 3T4XA 3AY3A 5EAIA 3QIVA 4YMGA 1IZ8A 3GMSA 4NTZA 2CNWD 4M4SA 1KOFA 3WK4A 5CHEA 4QBKA 2B2NA 3TMKA 2YY5A 3W77A 2F67A 4DOMA 4KLCA 1E18A 5ECGC 4PGAA 4L95C 1TB4A 2VK2A 1QE5A 1QP8A 2B6HA 2BFFB 5AFSA 1H66A 2ILVA 2ZANA 2A9RA 3UFXB 2XCRB 3GCWA 3CF6R 1T2FA 2ST1A 3WTCA 5K6TA 2C7GA 3IBYA 4LYHA 1EAMA 1LDEA 4RL6A 4CM9D 4BMCA 3M6AA 3VPAA 1CPYA 2ZPUA 2OSVA 2PQMA 3LCUA 5FWAA 1GQYA 2G1AA 3DWIA 2GCIA 2HA6A 1CZNA 4DZZA 3R9WA 1KI6A 2J9GA 3FOZA 4JUFA 3UJ9A 3SVTA 1F2VA 3HY4A 4JT2A 5CTJA 3TN7A 2IGBA 2GO1A 3B5IA 3DFFA 5KPDA 2C78A 1KO5A 1SUEA 5IKXA 4MVJA 2V7VA 1DEOA 5BMVA 2HXSA 3CF2A 2A1TS 1Y1QA 1D4FA 3A9SA 3P20A 5JJ5A 2UXCB 1ZIDA 3AU8A 4KFUA 3O9VA 4RA6B 2OC4A 4MS1A 3VTZA 2YNMD 3FTEA 4C0XA 4HFMA 4DC1A 1MX9A 4U2FA 1L5LA 3X1WA 3ZTWA 2F1OA 4BEVA 4RWEA 4R2XA 4BP9A 3HR4A 4JK3A 4PONA 1UQUA 4YJ3A 1GD1O 4C76A 1AGXA 4E2YA 1PWXA 1XXLA 3EG5A 2HPAA 4QVIA 1A5SB 1Y37A 1GY8A 1PJTA 5EN4A 5GAJA 1TK9A 5EPEA 2YUIA 1EGHA 4UBKA 3HFJA 1OBCA 2OHVA 1FFXA 4WWHA 3L1HA 2I3AA 2QMQA 1HEIA 3HU5A 1ZSNA 1UFVA 4BWVA 1Y1RA 1P44A 4B74A 4B7XA 1V41E 3DW3X 4RHXA 1H4QA 1ZH0A 3OF3A 1NJ6A 1IOVA 2X7HA 4KJZA 2VG8A 3LC1O 4MUXA 3O26A 1QBKC 1VKHA 3GR6A 4NG5A 3JTEA 1HURA 4UZFA 1E77A 1V9CA 3GLRA 4FGWA 4NBUA 4QE3A 3GZJA 4XM0A 4D82A 1AKQA 4L15A 1DRKA 1PL8A 4CETA 1ADJA 1FJ2A 4BO9A 3CCBA 1AG9A 3C8DA 3O83A 5U4XA 1C0EA 2GLUA 3ZGNA 3G8AA 1BDHA 1USGA 4HSGA 4TZTA 4G0YA 3HO6A 1VIMA 4TYWA 1A8PA 3VPHA 1QHXA 3MAGA 4M49A 3U7FB 3F7OA 3L0ZA 4JU8A 3SHTA 2JI6A 1U28A 1PAUA 4CMGA 2QQ5A 2FWAA 2VJQA 1SHZA 4D8YA 2DSTA 1IVNA 1FFCA 1T10A 1Y33E 5CYPA 4HLDA 4TRMA 2XOXA 1W46A 4Y1RA 2GHRA 5IBRA 1C8LA 4A10A 5TF4A 2R47A 1FFEA 4OUDA 4QWWA 2ZJ7A 3AVTA 3WLPA 3WXMA 4EG5A 1CY6A 1XWWA 3WAGA 4MCAA 2CUTA 4GOJA 4E5YA 1VJDA 1Y8RB 1E0AA 1U5BB 2F8TA 2HA3A 3K0FB 1ZLXA 3U3RA 2OHFA 1Q74A 4LAFA 2MMCA 3BL8A 1JPVA 5T57A 5DHTA 1W87A 2DKFA 1UFKA 3TZCA 3JD2A 1IQ0A 5LLDA 3F96A 5K0NA 4AZTA 1E98A 1TEHA 4G0NA 4UM7A 4KKVA 3DE0X 1DMSA 4LOIA 4S1NA 3RVLA 1C9NA 1MORA 3OMWA 3LDFA 3SC2A 5KTTA 1NNEA 5LLTA 3H99A 2NVUA 4HS4A 4TVSA 1Y6ZA 4N49A