2BF8B

Crystal structure of sumo modified ubiquitin conjugating enzyme e2- 25k
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
YIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN-CONJUGATING ENZYME E2-25 KDA
publication title Sumo Imodification of the Ubiquitin Conjugating Enzyme E2-25K
pubmed doi rcsb
source organism Bos taurus
molecule tags Ligase
total genus 17
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2004-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2bf8B00
2BGFA 2JZ3B 5IA7A 2FIFA 2J0KA 1GUAB 3RZWC 2EMSA 2MCNB 2JF5A 3BINA 4GOCA 3QK0A 4TV3A 4URKA 3DVNU 3QAQA 1C3TA 3B08A 4TQ1A 4EZKA 2DZIA 4JLCA 1YQBA 3AU5A 2C5LC 3QQ8B 5CX3A 1E8XA 4X57B 2ZPNA 2CHZA 2XBBC 2DYOA 2K25A 3DVGX 3PGEA 5C23A 4EOYA 1KM7A 1L2NA 4W9GA 4HJKA 2KMCA 1P9DU 4HPMB 3T8MA 2FCMA 2O6VB 1E8ZA 1YIWA 3ML9A 2BYFA 2KJRA 2DAFA 4KZ0A 5JHAA 2ZJDA 4KZCA 1V80A 3V6EB 1CMXB 4FJVB 5D6JB 1UBQA 1V9JA 2JVCA 4ICUA 3ZRFA 1EUVB 1UGMA 2LXAA 3WIMA 3UQAA 4HDQA 3VHTC 3VTWA 2KTRA 2KTRB 4WJQA 4DDGD 4DBGA 4F8CB 2V4LA 4MSQB 4ZYNA 3PREA 2FCNA 3UINB 2GBJA 1I35A 4MGYE 4M8MA 2HJ8A 3IHPC 3NZSA 2KC2A 3RT3B 4KIKB 4EKUA 1WF9A 1E8WA 4MJSB 4MJSA 3ZRCA 5KHQA 1IYFA 3QIJA 4FJZA 2MWSB 5DCNA 1WGDA 1KLVA 2DX5B 1C1YB 3A1QA 1NI2A 3A1QB 4HCNB 1RFAA 2MW5A 4DXAB 2K6DB 2LRWA 5DPSA 2N4FA 2O6VD 2Z0EB 2AYOB 3DBHI 3ZDMC 2NBVB 4EUTA 2QHOA 1XD3B 1Q5WB 3Q3FA 3DDCB 3H7PA 3H7PB 3VTUA 3APFA 1SGHA 3PHXB 4MSMB 5LLIA 1UBIA 4K7UA 4DWFA 2V1YA 3EC8A 5FR6A 1JRUA 3DBSA 5KHOA 1EF5A 2M8SA 3KUDB 1V2YA 4W9KA 2L0FA 1UZXB 1V5TA 2CR5A 3WAOA 1ZW7A 1KOTA 4G3XB 4ANXA 3ZW3A 2G45B 3X23A 1I42A 2D3GA 4ZRJA 4ANUA 1WR1A 4AJWA 3KUZA 5JHBA 1Z2MA 4P7IA 4B9KA 2G4DB 3AXCA 2LVPA 1WE7A 4ANWA 3DBRI 1WJNA 2IO1B 1WYWB 2MA9B 3RUIB 2JUOA 2Z0DB 4EZJA 2C7NB 1LQBA 5E6NA 4OVUA 4W9DA 2IY1B 1WJUA 2KDEB 4WJOA 2IBIB 1UELA 1OGWA 3QC8B 2D2QA 1A5RA 2LVOA 4GDLA 4GDLB 2GBMA 3EFUA 4KSKC 4IW0A 4EEWA 2BPSA 3WAPA 3GOEA 2WDTB 3DVNV 2KK8A 3QJZA 3JW0X 1WGRA 2A5UA 2CKHB 2JXXA 4KDIC 4ANVA 2C9WB 5E6PA 1OEYA 5AEKB 5EDSA 4EZLA 5L83A 2K1FA 3NHEB 3JVZX 4GIVA 5E6OA 3VUWA 3TIXA 4XZ4A 3V6CB 3A33B 4FJYA 2LWPA 1OEYJ 5CTRC 1QZEA 3NY5A 4MEMA 1WGHA 2ZCCA 4M0WB 4E74A 3K9PB 4ASWC 4NJ7A 3L08A 4GSWA 3DPDA 3X0WA 2IO2B 4MELA 3EHVA 2M1MA 1TBEA 2KQ7A 2M17A 3PTFC 2MSED 1WZ0A 2G3QB 3ZVVA 4RMAA 3TJPA 2LI5A 2AL3A 1WIAA 4NQLB 3UF8A 2I1KA 3RULA 4DHZE 4MDKE 4MGKE 1LFDA 3ZNHB 4DK5A 2L0TA 2UWQA 4K7WA 2LGYA 3ENEA 1ZGUB 2ZPYA 1WM2A 2KZRA 4B95A 3NS8A 2L76A 2ZCBA 1ISNA 5AZGA 3ZNZB 4RM9A 3V60A 2L00B 4BKTA 1XQQA 3KUCB 2BKFA 4RM8A 2O2VA 2O2VB 4W9FA 3ZTDA 2FIDA 3HK0A 1P0RA 2AEHA 3AULA 3IG3A 4FN2A 1GNUA 4G0NB 2LZ6A 2NVUI 2KX3A 2NBUA 2BYVE 4BOZB 4NPNA 4XC2A 1J19A 2DHZA 3A4SC 5JZEB 2FCQA 1H4RA 1V81A 1V6EA 2NPTA 2NPTB 2UYZB 2WWZA 4JL9A 4J6IA 1TZ1A 3W1YA 2FCSA 5D2MB 2CHWA 2MBQA 4I6LB 3OAWA 3ECIA 2KFJA 2MBEA 3W1SA 3ML8A 2J0JA 3QA8A 4IWOA 4W9JA 4MH0E 4A20A 3APDA 2R2QA 4AP4C 2KDBA 3C0RB 2LUEA 4W9EA 4TQ0A 3R66C 1WMHA 2K8CA 3A9JB 2N9EB 2ZVNA 2MP2A 3A9JA 3IVFA 2D10A 2WX0A 3L0WB 3PHWB 4GN1A 3R7QA 1AARA 2BKRB 2DZKA 1WXMA 2N7EA 3PRMB 4WJNA 4IM0A 1F9JA 4PYZA 3PZDA 3DOWA 3ZDTA 1YX5B 2AWTA 5G2NA 4AJYB 3RZFA 1E8YA 3KYDD 3SU8X 1SIFA 3PLVA 5J18A 1WE6A 2ZNVB 3QCAA 1VD2A 3PRPB 4K7SA 1D3ZA 2WYQA 2IO0B 4MM3A 4W9HA 1PQSA 2DYMA 5D7GA 2RPQA 2RGFA 4LDTB 1E90A 3PS6A 1S3SG 4LJOB 2M0XA 2NS5A 2DZMA 4G11A 3VVWB 2REXA 2LGDA 3B1LX 5L95C 1J8CA 1Z5SB 4ICVA 3ZO5B 4N9F4 3QWZB 1U4AA 2KWUB 3HHMA 1SE9A 1WRDB 3PPAA 2JZZA 1M94A 4IG7B 2ZZPB 4HWIB 1K8RB 3GZNI 2EKEC 1IP9A 1BT0A 3H6NA 1R4MI 3M62B 3I3TB 4MGZE 2LASA 1WX9A 3ZNGC 4MGIE 4PYUA 4IUMB 1WM3A 2NBWB 5TR5A 1WX8A 2IZVB 4IWQA 3TMPB 3TBLD 2J7QB 1WXVA 3KVFB 4BKSA 1V49A 2PE9A 5CHVC 4NY0A 3QARA 3LDZE 1WGGA 2KLCA 4G50A 3IBEA 1R4NI 2N9XA 3ALBA 2JWZA 3VUYA 2ZNVC 3VAWA 1WX7A 3SD5A 4LDTD 2VRRB 1WGYA 3HM3A 3PVLA 1YX6B 3ZNID 1P1AA 4GGQA 2KWVB 2JRIB 1FXTB 1RLFA 3VFKA 2RR9A 2KNBA 1WI0A 4DHJB 2N1WA 4KVGB 3CMMB 2DZJA 3CSTA 2JY6A 1UH6A 3R7RA 4JGHB 2KVRA 4IM3A 5AZFA 3KW5B 2IYDB 2KTFA 1LM8B 2KDFB 2L3ZA 4WWPA 3VUXA 4PS3A 2KANA 3H1UA 4XX5A 1WR6E 2DAJA 4NQKE 2HD5B 4NAWA 4NAWB 1NBFC 3KH0A 4PS7A 4NNJB 3RYTA 3HM6X 2MBOA 2WX1A 3QHTA 1ZKHA 2PPHA 3D32A 5CHWA 1EO6A 1S1QB 3M3JA 3VQIA 1E5WA 4WWNA 2D07B 3DCGA 3L17A 3V62A 1WXAA 2MBHA 3SHQA 2LD9A 2AL6A 5DPWA 4OVVA 5C1ZA 4F1SA 4DHJD 2R2OA 4E3CA 3U7DA 2C7HA 2L7RA 4GXBA 3ZIMA 5GMVA 1KJTA 4BOSC 2NR2A 2KJ6A 3U30A 3VTVA 2K8HA 2D11A 2GBNA 3VXWA 2FNJB 2GBRA 2KKCA 3VDZA 3ZUNA 4BKGA 2DYBA 1WJ6A 4GMVA 4WAAA 3AI5A 3N3KB 3PLUA 1RAXA 2MRPA 4TUUA 3RD2A 3N32A 2J0MA 4A3PA 1OQYA 2A4ZA 5DPTA 3P2BA 4FHKA 3S2AA 2IO3B 2KDIA 4BBNF 3UGBB 4II2B 4KV2A 3UIPB 1E7UA 3DVGY 4I6NB 4IC7B 3WALA 1P3QU 4ZRIA 2RSUA 2BYEA 2EMTA 3OLMD 4CHKA 2XEWA 1EF1A 3UIOB 3ONSA 4FLHA 2FAZA 1J0GA 1X1MA 4AWJA 3M63B 1WMHB 2RD0A 3H7SA 2O6VA 4CYEA 2MP2B 3IFWB 3H9DA 3M95A 4KSLC 4HK2A 1Q0WB 1WFYA 3A9KA 3A9KB 3BY4B 3MHSD 3PSEB 4ZDVA 3L54A 2MBBB 1TGZB 1WH3A 4A3OA 2M4NA 1TTNA 2C7MB 5IAAC 5JH5C 3TL5A 4CO7A 2Z59B 1E7VA 5DPRA 3CSFA 1GC7A 4PS8A 5LXHA 4KDLB 5J17A 1WXSA 3RCZA 2ZVOA 2KC1A 4LCDE 1YD8U 3UQBA 1YJ1A 3WANA 2LVQA 3K9OB 4YL8A 4E71A 1XT9B 4GU2A 4BBNC 1H8CA 3L13A 4NJ6A 4WWOA 3JYUA 2OOBB 4KIKA 4IWPA 2FUHB 3AU4A 3OJ4B 1GC6A 2BF8B 3L10B 2KQSA 2MQJA 3W1SC 1GJZA 2LRUA 1T0YA 3OJ3A 5AZHA 3VH3B 2JPHA 4M8NA 2I1JA 5J2RA 3PT2B 3WA0A 3V61A 2MX2A 2JRHA 2MLBA 2YVCA 2BWES 4HCPB 1WJ4A 2Y5BB 4W9IA 3O65B 4TKNA 3U8ZA 5LXIB 1MG8A 2KMAA 3Q3JA 4K1RB 4AUQC 1L7YA 4B6WA 4BFRA 1VCBA 4WJPA 1Q1OA 4BVUC 2L05A 2G4SA 2N9PC 3LJ3A 2KJHB 3A4RA 1Y8RC 4IM2A 2PE6B 4FADA 2ZEQA 4HLEA 4GDKB 4GDKA 3NZUA 2JT4B 2KLGA 2N1VA 4HDOA 2K8BA 2KD0A 2LXCA 4II3B 1G6JA 4LJPB 3ZTCA 2GBKA 1WY8A 2GOWA 3CF6E 3N30A 4DDID 1RRBA 4FHJA 4FULA 4GB9A 4HXDA 3B0AA 2OJRA 2W9NA 3EECA 5HKHA 5CHFA 3T9LA 4HPLB 2K6QA 2N7DA 4DHZB 2LJ5A 5D94A 2KXJA 3JSVA 3JSVB 2B3AA 3MTNB 4K81A 3L16A 3APCA 3NOBA 3ZLZA 4AOFA 4W9LA 4FA6A 2PEAA 1HE8A 2HE7A 1LXDA 2XK5A 2XK5B 2C60A 2KN5A 1P98A 3WAMA 4BKSD 2HTHA 3TCAA 3MJWA 2KOXA 4JIOU 2CU1A 2YLMA 4JQWC 2LGXA 2ASQA 2KX0A 3VH4B 2KWCA 3SDLC 2GMIC 4FBJB 4WQOB 1UD7A 2KHWB 3QX1A 4EFOA 4HVBA 4ZRKA 4W9CA 1V86A 3R3MA 4I6PA 2PJHA 3ZKJC 1GG3A 3KYCD 2DENB 3DBLI 1OTRB 5G55A 1V5OA 2K39A 4F7ZA 3PRZA 3PV1A 3DQVA 1WZ3A 2CHXA 2CS4A 1IPGA 1NDDA 2BWFA 2IY0B 3HIZA 2L8JA 2V3SA 5BO4B 2NCNA 2KFKB 2KFKA 2KO3A
chains in the Genus database with same CATH superfamily
1JWBD 1HTOA 5IA7A 1SE2A 2FIFA 4ZYSA 1KF6B 4GOCA 1SBBB 1CJEA 3QK0A 2J42A 3DVNU 1YJIA 1UWXA 3UI3A 2ZPNA 1C77A 2DYOA 2XBBC 5C23A 4EOYA 1L2NA 2KMCA 4HPMB 1TIFA 2K0PA 2FCMA 2O6VB 1E8ZA 2JXTA 1KRHA 2E3TA 1YQ3B 4ZOHC 4FJVB 2M56B 4OZCA 2L52A 3T3NA 2NTSA 2KTRA 4WJQA 3URYA 4ZYNA 3UINB 1UF0A 2FCNA 2JU6X 1WGKA 4MGYE 3P63A 2HJ8A 3IHPC 2YEPF 4MJSB 3IXSA 1IYFA 1HEZE 4FJZA 5DCNA 3A1QA 2MW5A 2LRWA 1PYWD 2AYOB 3ZDMC 4EUTA 2LGIA 3DDCB 3RI7C 1JCKB 3VTUA 1UBIA 2GRIA 4DWFA 2V1YA 3EC8A 5FR6A 1JRUA 3DBSA 4YSXB 3KUDB 1V5TA 2CR5A 3ZW3A 4LNFA 2D3GA 2L1AA 1WR1A 4HRSA 1WRIA 4AJWA 1SF0A 5JHBA 2WGSA 2G4DB 1WE7A 3DBRI 2MA9B 2Z0DB 2QC8A 5E6NA 3Q14C 1OQRA 1OGWA 4GDLB 1N5WA 4KSKC 4EEWA 1FO4A 1FFVA 3Q2AC 3RN9C 4KDIC 3QJZA 2A5UA 4S0RA 1UGJA 1WXQA 4KKIA 3VUWA 2LHEA 3TIXA 4FJYA 3DBLB 3BYTB 4M0WA 3K9PB 1YQ4B 2W54A 1FXAA 3X0WA 2IO2B 4S17A 4MELA 3EHVA 3R2TA 4ZRPA 2MSED 1WZ0A 4PK1A 3ZVVA 2LI5A 5T8IA 2J53A 3ZNHB 3W5VB 4P1BC 5AZGA 3Q8EA 4RM9A 2PKOA 2PMVA 3KUCB 4M00A 2BKFA 4RM8A 4TSSA 1UWMA 1E7PB 1EU4A 1N60A 4G0NB 2LGSA 1ET9A 2NVUI 3I57A 4A9AA 2RPVA 1JWMD 1J7CA 4BOZB 1IUEA 4XC2A 2OJWA 2NPTA 3W1YA 4D2KA 1TZ1A 4LTUA 2FCSA 2D3CA 2KFJA 2DBYA 2MBEA 4US8A 3ML8A 2Z8LA 4A20A 2BVCA 2KDBA 2WXLA 1WMHA 2K8CA 2N0SB 2MP2A 2D10A 2BKRB 2N7EA 3DBHB 1JW9D 4WJNA 2AWTA 1EM7A 1E8YA 3KYDD 3PLVA 3O13A 1VD2A 3PRPB 4MM3A 5D7GA 3DHHC 2RGFA 2IGGA 1E6EB 1S3SG 4LJOB 4G11A 2DZMA 2D3AA 5AUIA 3VVWB 2REXA 5L95C 5IKCM 2KWUB 1SE9A 1WRDB 1B1ZA 1YOVB 3B9JA 3GZNI 5IN7A 1BT0A 3H6NA 1WYGA 1WX9A 4PYUA 1WM3A 5TR5A 3AE7B 1F1HA 2J7QB 5CHVC 4NY0A 3QARA 3LDZE 2KLCA 5HHDG 1FRDA 3ALBA 2JWZA 2PTLA 2ZNVC 3PVLA 1YX6B 3ZNID 1P1AA 1RLFA 4JX1C 1WI0A 1LGRA 2DZJA 1UH6A 4IM3A 3KW5B 3P4QB 3Q3MC 1IBXB 2KTFA 3HVZA 3HVDA 1GOZA 3NS1A 4NQKE 2WXPA 1JWSD 4RGOS 4NAWA 1YN3A 4NNJB 3RYTA 2MBOA 2WX1A 4WIPA 3D32A 3IT6B 1EO6A 3AE4B 3VR9B 4DQOC 3V62A 2MBHA 3FILA 4RF1A 5DPWA 1MI0A 4E3CA 3P4RB 2C7HA 4XWTA 1KFYB 4BOSC 3W2DA 3U30A 2QSDA 5C3JB 1FXIA 2K8HA 2KKCA 2KQ4X 2OEDA 4WAAA 3N3KB 1RAXA 2MRPA 4TUUA 4AS1A 3N32A 4A3PA 3P1MA 2KDIA 2JWUA 4KV2A 3UIPB 1E7UA 1QOAA 3EFCA 4C56C 2RSUA 2EMTA 3OLMD 4CHKA 2QIEB 1E10A 3H7SA 2O6VA 3P42A 2QILA 1NYQA 3H9DA 3A9KA 3AEEB 1JQ4A 2MBBB 1AW7A 1L0YB 1TGZB 2WU5B 4XGAB 2C7MB 3EA6A 3TL5A 2IJ0A 2K5PA 1ENFA 2JYTA 3AEFB 2ZVOA 3UQBA 1QKZA 3WANA 1SEBD 3FKYA 4WQMA 1R4MB 1M4VA 2FUHB 1GB1A 2BF8B 2KQSA 4N58A 2MQJA 1GJZA 2LRUA 5GXGB 2MLBA 3RNCC 2BWES 1MVKA 4W9IA 3U8ZA 4K1RB 4BFRA 1VCBA 3J9CA 4WJPA 2FE8A 4BVUC 5EE3A 3DWGC 1N6ZA 1I4RA 4IM2A 2TSSA 2JSVX 4GDKA 2KT7A 4HDOA 3N1ZC 4II3B 4K3CA 1A70A 1HQRD 4FHJA 3FC4A 2LUMA 5HKHA 4YXDB 2N7DA 4DHZB 2LJ5A 3JSVA 1P98A 1HA5A 2HTHA 2RMMA 1I4HA 4JIOU 2PLPA 2KWCA 3RFZB 3SDLC 5MPOA 2JYEA 3QX1A 4ZRKA 1V86A 2SAKA 3R3MA 1AWDA 3ZKJC 1FM0D 5G55A 1DYQA 1K50A 1WZ3A 1TY2A 1MHHE 2BWFA 2LEKA 2IY0B 3KWVA 2V3SA 3AE1B 4WAFA 3RZWC 2ON8A 4USAA 1HZ6A 2I38A 4URKA 3ZGZA 3B08A 4C7YA 4EZKA 2DZIA 1YQBA 1D6EC 3GE8C 3AU5A 2C5LC 3BVZA 4M01A 5CX3A 4X57B 1VJKA 1VRAB 2AQ3B 3U7ZA 5HI1A 3PGEA 3VRAB 1FPYA 1YIWA 3ML9A 3CIRB 2KJRA 1YN4A 1V80A 3V6EB 1XCTL 5D6JB 3ZRFA 3TEZA 1ACCA 1EWYC 3UQAA 1TT5B 4HDQA 1D4BA 1T6BX 3VTWA 1NEKB 4F8CB 3C8YA 1I35A 4M8MA 3NZSA 5TSSA 2KC2A 2MEKA 4KIKB 2YEPB 4EKUA 1WF9A 1E8WA 5KHQA 2CJNA 2MWSB 1VZ8A 2BTEA 2K6DB 3IT4B 5DPSA 2N4FA 2O6VD 2Z0EB 2INNE 2NBVB 1Q5WB 3H7PA 1SGHA 5LLIA 4UDUC 3AEBB 3ZXRA 1EF5A 3Q3OC 1UZXB 1KOTA 1ZW7A 3X23A 1T0QC 1TYGB 4P7IA 3RUIB 2G1EA 4EZJA 2C7NB 1ET6A 2RDHA 4OVUA 4ZRQA 3R8BA 2IY1B 2KDEB 1UELA 2DWQA 2D2QA 2LVOA 1C9FA 4IW0A 3NZ3A 1TJEA 3GOEA 1VZ6A 2KK8A 1RYJA 5LNK1 2CKHB 2JXXA 3RPFC 3TUOA 5E6PA 4R3DA 5L83A 3NHEB 1C4PA 4GIVA 5E6OA 1JROA 3V6CB 4OW0A 5CTRC 1ZOYB 1C79A 2WXOA 4YSYB 3HRDD 2ZCCA 2WXNA 5HFYA 3DPDA 4MH8A 3MC0B 2M1MA 2M17A 4N6EB 2G3QB 4RMAA 2AL3A 3AE9B 3UF8A 2I1KA 3RULA 4MDKE 2QCZA 4DK5A 2L0TA 3N1XC 4RNAA 3ENEA 1RFKA 1ZGUB 2RDGA 2KZRA 5E6JA 2L76A 3N1YC 2VZKD 3ZNZB 3I5JC 1XQQA 4KX6B 2O2VA 3ZTDA 2FIDA 2ONQA 2AEHA 1F52A 1C76A 3AV8A 4RCOA 1XF5L 2LZ6A 3RNEC 4ARIA 1V1PA 2M19A 1J19A 2DHZA 3A4SC 4LNIA 4C80A 2FCQA 4J6IA 1MG4A 3SFEB 2MBQA 1I4QA 4YWGG 3W1SA 2J0JA 3QA8A 4XWWA 3R66C 1ZXIA 4CQNA 3A9JA 2ZVNA 3PHWB 3U7DA 3SR6A 4PYZA 3PZDA 3QCAA 1NYRA 4LDTB 2PW9A 2ZW1A 3RMKC 5EE0A 2LGDA 1J8CA 1Z5SB 4PT5A 4N9F4 1U4AA 3HHMA 4IG7B 2JZZA 1F2RI 1M94A 2ZZPB 4HWIB 3V3XA 2EKEC 2KACA 3KLSX 2LASA 2MH7A 4MGIE 4IUMB 2NBWB 2W3RA 1T5XD 2IZVB 4IWQA 4ITKA 1DOXA 2LHDA 1KLUD 1TKEA 1WXVA 1GAQB 1L4DB 3AM9A 3I63C 3IBEA 3AMZA 5BYRA 3VAWA 3SD5A 2VRRB 3HM3A 2N1WA 2JY6A 4JGHB 5AZFA 2KVZA 1GPXA 2IYDB 4C00A 2L3ZA 2QMTA 3I9V1 1WWTA 2LJIA 2J4XA 2CJOA 1SJHD 3EGRA 5G5GA 2HD5B 3KH0A 4EE2A 3QHTA 2PPHA 1S1QB 4NAMA 2N9LA 3DCGA 1YN5A 1TS5A 2MJDA 2WXQA 1YJJA 2KJ6A 2R61A 2GBNA 2GBRA 3VDZA 4GMVA 1AYFA 3AI5A 2JX5A 3GS2A 2WXMA 3DHIC 2J0MA 1OQYA 2A4ZA 2K22A 3P2BA 4FHKA 3RNGC 3UGBB 4II2B 3DVGY 3TEYA 3BVMA 3Q8AA 4A90A 3UIOB 3ONSA 1FNWA 1J0GA 2QEJC 3M63B 2Y5PA 4CYEA 4DXGA 4HK2A 3ABVB 4ZDVA 4A3OA 1TTNA 5IAAC 1OQQA 2IDYA 2J52A 2Z59B 1SSNA 3CSFA 4PS8A 3RCZA 1JALA 1XT9B 4GU2A 4BBNC 3L13A 1XCQL 4KIKA 1K53A 1XO3A 3AU4A 4OZBA 5BMIA 1T0YA 4KGTA 1L0XB 2JPHA 2D3BA 3PT2B 1CZPA 2Y5BB 4TKNA 3Q3JA 4WWMA 4B6WA 2N9PC 3LJ3A 1Y8RC 4J3OD 3NZUA 2JT4B 3B2GA 1KH0A 1NVID 3TSSA 2K8BA 1BUIC 2LXCA 1QILA 3LXFA 4LJPB 3CF6E 4FULA 3B0AA 1FRRA 2AQ2B 1F77A 2OJRA 3EECA 2BBCA 1L6VA 5CHFA 4HPLB 3MHZA 4K81A 4P1CC 1HE8A 2L83A 4HJGE 2XK5A 2KN5A 3WAMA 4L2YA 3BIID 1WSPA 2YLMA 1JRPA 1IGDA 3VH4B 1XLOA 4JPSA 4WQOB 1E9MA 4IDIA 4EFOA 3P4SB 4I6PA 3KYCD 3C19A 5BMGA 2K39A 4F7ZA 2CS4A 1NDDA 3KWLA 2L8JA 2GLSA 3GB1A 3ZJUA 2KFKA 4C4VB 2KO3A 3LYYA 5BMHA 2JZ3B 1I4PA 2J0KA 2MCNB 3BINA 1SXTA 4TV3A 1C3TA 4TQ1A 4BZAA 3IAM1 4JLCA 1E8XA 1VLBA 1PGBA 1VDVA 2IPKD 4W9GA 4HJKA 1CQVA 1P9DU 3NJTA 3T8MA 3E56A 4ACFA 3ETRA 2BYFA 1L5PA 2DAFA 5JHAA 4L1BA 2WXJA 4KZCA 1UBQA 1V9JA 2JVCA 2X8XX 1EUVB 3VHTC 2KTRB 1HXYD 2V3NA 1MHXA 1N5XA 5FR3A 4RH6A 3RT3B 3ZRCA 4MJSA 3SFDB 1ZP0B 2DX5B 1C1YB 2V4IB 3A1QB 4HCNB 1RFAA 4DXAB 3AEAB 3LB8C 3ZJVA 2HJ1A 2QHOA 2FUG1 3U4EG 3PHXB 4MSMB 1TS2A 1RM6C 1FCLA 3AEDB 4K7UA 1JWUD 1IGCA 3MJ5A 4W9KA 3WAOA 4ANXA 5FKAC 1I42A 1PGAA 4ZRJA 4DXFA 1F2RC 2UU7A 3KUZA 4OZAA 1Z2MA 3AXCA 2LVPA 4ANWA 1WJNA 2WU2B 2JUOA 2INPE 2BS2B 3RNAC 3W9CB 1WJUA 2WDVB 1I7HA 3QC8B 1A5RA 1YNTE 4GDLA 1EU3A 2BPSA 3WAPA 2WDTB 3L4PA 1WGRA 5AEKB 5EDSA 4EZLA 3JVZX 1PDXA 4BAXA 4MEMA 1WGHA 2W82A 3NVVA 3MP9A 1STEA 3Q8BA 4KGSA 4M0WB 4HROA 4NJ7A 3L08A 4A8XC 1TBEA 2KQ7A 4NZLB 4MT5A 2BB5A 1ZPSA 2SEBD 1TS3A 4DHZE 3H8HA 4K7WA 2KAJA 2L00B 4BKTA 2AQ1B 3HK0A 1P0RA 3AULA 3IG3A 3DHGC 2KX3A 2NBUA 3V05A 2BYVE 1QLBB 5JZEB 1UNSA 1H4RA 1V81A 2EKIA 2NPTB 2L32A 1T0RC 5D2MB 1QOBA 4I6LB 4JWUC 3OAWA 4W9JA 4IWOA 4MH0E 2R2QA 2JQRB 2LUEA 1L0VB 1FCCC 3ZQ4A 2N9EB 3L0WB 3R7QA 1TY0A 1Y56A 2WX0A 3IVFA 3MC9A 4GN1A 4NJCA 2DZKA 1WXMA 4LK0M 3AECB 4IM0A 5G2NA 4AJYB 3RZFA 3SU8X 1SIFA 5J18A 1WE6A 2QJLA 2ZNVB 4K7SA 1D3ZA 1V1OA 4YT0B 2WYQA 2IO0B 3E9SA 4W9HA 1PQSA 2DYMA 2RPQA 3Q69A 3PS6A 2M0XA 4KGRA 2HTME 3RNFC 3ZO5B 3QWZB 3M62B 1L4ZB 3ZNGC 5D3DA 1BMLC 3TBLD 1ZDVA 4BKSA 3T3OA 2PE9A 1WGGA 2E6XA 1R4NI 3TEWA 2N9XA 2WXHA 3VUYA 4LDTD 1WGYA 4YTNB 3ZJTA 1KLGD 4GGQA 1P7FA 2JRIB 1FXTB 3VFKA 4XE0A 4H2AA 4DHJB 2ACZB 3CMMB 2INCC 3R7RA 1IBXA 1HTQA 1PUTA 4WWPA 2V0GA 3VUXA 4PS3A 2KANA 3H1UA 1GB4A 1WR6E 2DAJA 2BB6A 1T3QA 4NAWB 1NBFC 1AN8A 1ZKHA 4GLSC 5BYSA 5CHWA 2HDEA 3M3JA 1E5WA 4WWNA 1TS4A 3EUB2 3BVGA 3SHQA 2INDC 3FILB 2LD9A 2AL6A 2B76B 1QT9A 1J7BA 2KDMA 4F1SA 4TMAB 1SE3A 2W3SA 3ZIMA 4LNOA 2ICIA 4B0EA 3VTVA 3MC8A 1FNVA 2M0AA 1OFFA 5H8YE 4BKGA 5C2TB 2ZW0A 1WJ6A 3PLUA 4C4VA 2XN9C 3CWIA 3GE3C 1QF6A 5DPTA 2D5GA 3S2AA 2IO3B 4BBNF 4JE3B 2KWDA 4IC7B 4WH4A 3WALA 4RF0A 2BYEA 1ESFA 3Q8CA 2XEWA 1EF1A 2DNFA 1HZ5A 4FLHA 2FAZA 4AWJA 2CU3A 1KTKA 1R7SA 3IFWB 4KSLC 3B2FA 4OHJA 3A9KB 1VZ7A 1FD6A 1Q10A 1WH3A 1F0ZA 2M4NA 5JH5C 4CO7A 2Q5WD 5DPRA 4P6VF 1GC7A 5J17A 1T0SC 4LCDE 1YJ1A 3HUIA 2LVQA 3K9OB 4YL8A 4E71A 2GI9A 4A55A 1H8CA 4NJ6A 4WWOA 3NUHB 2OOBB 4IWPA 3OJ4B 1GC6A 3DBRB 5H92C 3W1SC 2Y5CA 3OJ3A 4K3BA 4M8NA 5J2RA 4Q2JA 3V61A 3WA0A 2WXFA 4HCPB 4OVZA 2KYWA 3O65B 1MG8A 2KMAA 5HG2A 4AUQC 1L7YA 4XDCA 1XLQA 3AE5B 2G4SA 3GP7A 2KJHB 3A4RA 4JWSC 2PVGC 2ZEQA 4KKJA 4GDKB 4P16A 3AE3B 2KLGA 2N1VA 3AE6B 3ZTCA 2GOWA 3U52E 4DDID 4GB9A 4ZHPA 2IGDA 3T9LA 2K6QA 2KXJA 3JSVB 2B3AA 3MTNB 3L16A 3NOBA 1N61A 4FA6A 2HE7A 4BKSD 3MJWA 2KOXA 1N63A 2WXKA 3AB5A 4O1NA 4JQWC 2VZKB 2ASQA 2GMIC 2FBWB 1UD7A 1FNUA 3IAS1 2DENB 3DBLI 1OTRB 2K9XA 1V5OA 2NMQA 3PRZA 2WHIA 2CHXA 1IPGA 2NTTA 3VRBB 1ZDXA 3HIZA 5BO4B 2KVRA 3FAHA 2BGFA 5G5HA 1GUAB 2EMSA 2JF5A 3VR8B 3QAQA 2MJEA 3BK1A 3QQ8B 1FFUA 2CHZA 2X38A 3DVGX 2K25A 2V9HA 1KM7A 5IOIA 1YMHE 2N7JA 4KZ0A 2ZJDA 3DWMA 1CMXB 4N59A 4ICUA 1UGMA 2LXAA 3WIMA 4IKGA 4A6QA 3PZ7A 4DBGA 1PFDA 4DDGD 2V4LA 3TEXA 4MSQB 3PREA 2GBJA 3GZNB 3QIJA 1C4CA 1WGDA 1KLVA 1NI2A 1BXTA 2WS3B 1P7EA 2VH1A 3DBHI 3NRZA 1XD3B 5AUKA 1XEEA 3Q3FA 3H7PB 3APFA 3OG5A 4LNNA 1TZOA 5KHOA 1V97A 2M8SA 1V2YA 2L0FA 3BYYB 4G3XB 2MHJA 2G45B 4ANUA 4QAYA 4B9KA 2QDFA 2IO1B 1WYWB 1LQBA 1CK1A 4W9DA 3AN1A 4WJOA 2IBIB 1ROEA 2JZPA 3NG0A 2GBMA 3EFUA 5EE9A 3DVNV 3JW0X 4ANVA 3NVWA 2C9WB 1OEYA 1SIJA 2K1FA 4HEA1 4XZ4A 3A33B 2LWPA 1OEYJ 1QZEA 3NY5A 3U2SC 4M02A 4E74A 1D5XC 3Q3NC 4ASWC 2BS3B 4GSWA 1K52A 1DGJA 1QQRA 3PTFC 3AE8B 3KQ4A 1K51A 4REZA 3TJPA 1WIAA 1SJED 1QOFA 4NQLB 4XYCA 4MGKE 4HKQA 1LFDA 2WXRA 2UWQA 1I4XA 2LGYA 2ZPYA 1WM2A 4B95A 3NS8A 2ZCBA 1ISNA 3V60A 4RGMA 4W9FA 2O2VB 4FN2A 1NENB 2WXIA 1GNUA 1I4GA 2EELA 1DOYA 1V1PB 2IGHA 3NVZA 5EE1A 4NPNA 3NVYA 4RGTA 4RGNA 2UYZB 2WWZA 1V6EA 4JL9A 2G9HD 2CHWA 2WNMA 3PZ8A 4MACA 3ECIA 4YSZB 3APDA 5JXVA 3AEGB 4AP4C 3C0RB 4TQ0A 4W9EA 1FEHA 3A9JB 5D3IB 1ZE3D 1AARA 3PRMB 1F9JA 3ZDTA 3DOWA 1YX5B 4LNKA 1DOIA 1TKGA 4B0MA 2KMMA 2W55A 3N20C 3BWUD 2AX5A 1E90A 2BW2A 2OHFA 2NS5A 3B1LX 4ICVA 5I4DA 3R2IA 2PIAA 3PPAA 1K8RB 1IP9A 1R4MI 1XLPA 3I3TB 4MGZE 2LFIA 2H89B 1WX8A 3TMPB 3KVFB 2Y3AA 1V49A 3AE2B 3ZYYX 3N9YC 4G50A 2I2YA 1WX7A 4YTMB 1C4AA 1N62A 5BYQA 2KWVB 2RR9A 4IOIE 1C78A 2WDQB 2KNBA 4KVGB 3CSTA 2WDRB 1LM8B 2KDFB 4FXCA 4XX5A 4PS7A 2WQYB 3HM6X 3Q8FA 1JWAD 5IP4D 3VQIA 2XNAC 2D07B 3L17A 3W5UB 1WXAA 1ZUD2 4OVVA 5C1ZA 3MFGA 4DHJD 2R2OA 2L7RA 4GXBA 5GMVA 1KJTA 2NR2A 1ZXHA 2WP9B 2K3UA 3Q6BA 2D11A 3AH7A 3VXWA 2FNJB 3ZUNA 2DYBA 5IO9A 4HPPA 1JMLA 3RD2A 2H88B 2LMCA 4HKZE 1SB3C 1PGXA 4I6NB 1P3QU 4ZRIA 2WLBA 4ZHOA 3SEBA 1X1MA 3OWEB 1WMHB 1FIQA 2RD0A 2MP2B 2WXGA 2GB1A 3M95A 1Q0WB 1MJDA 1WFYA 3BY4B 3MHSD 3PSEB 1VR9A 3L54A 3BZDB 1B9RA 1E7VA 2PVOD 1QOGA 2KN4A 4MM3B 5LXHA 4KDLB 3BK2A 1FMAD 1WXSA 2KC1A 1YD8U 2RDBC 1UUPA 1V8CA 3JYUA 1EWCA 2BS4B 3L10B 4YTPB 2BQQA 5AZHA 3VH3B 2I1JA 2MX2A 1TKYA 2JRHA 2YVCA 1RWSA 2BT6A 2V3PA 1R4NB 1WJ4A 5LXIB 1Q1OA 2L05A 4RFBA 2PE6B 1SE4A 4FADA 4HLEA 2BYTA 3RNBC 1G6JA 2KD0A 2GBKA 1WY8A 3N30A 1RRBA 4HXDA 4ARCA 1E0ZA 1MFWA 2W9NA 4C7ZA 5D94A 4AQ7A 3APCA 3ZLZA 4US9A 2DLBA 4W9LA 4AOFA 2PEAA 4WURA 4LLGM 3ZXVA 1LXDA 2XK5B 2C60A 1LO5D 3TCAA 2CU1A 4XDDA 1D5MC 1NI3A 2LGXA 4L23A 2KX0A 1J7AA 3P4PB 1XXGA 4FBJB 2KHWB 4HVBA 4W9CA 1MPEA 2PJHA 1GG3A 2MJ3A 1XLNA 2N9KA 1L6UA 3PV1A 5FK9C 3DQVA 2VH2A 3WCQA 1D5ZC 2NCNA 2KFKB 3PO0A
chains in the Genus database with same CATH topology
2BGFA 2JZ3B 5IA7A 2FIFA 2J0KA 1GUAB 3RZWC 2EMSA 2MCNB 2JF5A 3BINA 4GOCA 3QK0A 4TV3A 4URKA 3DVNU 3QAQA 1C3TA 3B08A 4TQ1A 4EZKA 2DZIA 4JLCA 1YQBA 3AU5A 2C5LC 3QQ8B 5CX3A 1E8XA 4X57B 2ZPNA 2CHZA 2XBBC 2DYOA 2K25A 3DVGX 3PGEA 5C23A 4EOYA 1KM7A 1L2NA 4W9GA 4HJKA 2KMCA 1P9DU 4HPMB 3T8MA 2FCMA 2O6VB 1E8ZA 1YIWA 3ML9A 2BYFA 2KJRA 2DAFA 4KZ0A 5JHAA 2ZJDA 4KZCA 1V80A 3V6EB 1CMXB 4FJVB 5D6JB 1UBQA 1V9JA 2JVCA 4ICUA 3ZRFA 1EUVB 1UGMA 2LXAA 3WIMA 3UQAA 4HDQA 3VHTC 3VTWA 2KTRA 2KTRB 4WJQA 4DDGD 4DBGA 4F8CB 2V4LA 4MSQB 4ZYNA 3PREA 2FCNA 3UINB 2GBJA 1I35A 4MGYE 4M8MA 2HJ8A 3IHPC 3NZSA 2KC2A 3RT3B 4KIKB 4EKUA 1WF9A 1E8WA 4MJSB 4MJSA 3ZRCA 5KHQA 1IYFA 3QIJA 4FJZA 2MWSB 5DCNA 1WGDA 1KLVA 2DX5B 1C1YB 3A1QA 1NI2A 3A1QB 4HCNB 1RFAA 2MW5A 4DXAB 2K6DB 2LRWA 5DPSA 2N4FA 2O6VD 2Z0EB 2AYOB 3DBHI 3ZDMC 2NBVB 4EUTA 2QHOA 1XD3B 1Q5WB 3Q3FA 3DDCB 3H7PA 3H7PB 3VTUA 3APFA 1SGHA 3PHXB 4MSMB 5LLIA 1UBIA 4K7UA 4DWFA 2V1YA 3EC8A 5FR6A 1JRUA 3DBSA 5KHOA 1EF5A 2M8SA 3KUDB 1V2YA 4W9KA 2L0FA 1UZXB 1V5TA 2CR5A 3WAOA 1ZW7A 1KOTA 4G3XB 4ANXA 3ZW3A 2G45B 3X23A 1I42A 2D3GA 4ZRJA 4ANUA 1WR1A 4AJWA 3KUZA 5JHBA 1Z2MA 4P7IA 4B9KA 2G4DB 3AXCA 2LVPA 1WE7A 4ANWA 3DBRI 1WJNA 2IO1B 1WYWB 2MA9B 3RUIB 2JUOA 2Z0DB 4EZJA 2C7NB 1LQBA 5E6NA 4OVUA 4W9DA 2IY1B 1WJUA 2KDEB 4WJOA 2IBIB 1UELA 1OGWA 3QC8B 2D2QA 1A5RA 2LVOA 4GDLA 4GDLB 2GBMA 3EFUA 4KSKC 4IW0A 4EEWA 2BPSA 3WAPA 3GOEA 2WDTB 3DVNV 2KK8A 3QJZA 3JW0X 1WGRA 2A5UA 2CKHB 2JXXA 4KDIC 4ANVA 2C9WB 5E6PA 1OEYA 5AEKB 5EDSA 4EZLA 5L83A 2K1FA 3NHEB 3JVZX 4GIVA 5E6OA 3VUWA 3TIXA 4XZ4A 3V6CB 3A33B 4FJYA 2LWPA 1OEYJ 5CTRC 1QZEA 3NY5A 4MEMA 1WGHA 2ZCCA 4M0WB 4E74A 3K9PB 4ASWC 4NJ7A 3L08A 4GSWA 3DPDA 3X0WA 2IO2B 4MELA 3EHVA 2M1MA 1TBEA 2KQ7A 2M17A 3PTFC 2MSED 1WZ0A 2G3QB 3ZVVA 4RMAA 3TJPA 2LI5A 2AL3A 1WIAA 4NQLB 3UF8A 2I1KA 3RULA 4DHZE 4MDKE 4MGKE 1LFDA 3ZNHB 4DK5A 2L0TA 2UWQA 4K7WA 2LGYA 3ENEA 1ZGUB 2ZPYA 1WM2A 2KZRA 4B95A 3NS8A 2L76A 2ZCBA 1ISNA 5AZGA 3ZNZB 4RM9A 3V60A 2L00B 4BKTA 1XQQA 3KUCB 2BKFA 4RM8A 2O2VA 2O2VB 4W9FA 3ZTDA 2FIDA 3HK0A 1P0RA 2AEHA 3AULA 3IG3A 4FN2A 1GNUA 4G0NB 2LZ6A 2NVUI 2KX3A 2NBUA 2BYVE 4BOZB 4NPNA 4XC2A 1J19A 2DHZA 3A4SC 5JZEB 2FCQA 1H4RA 1V81A 1V6EA 2NPTA 2NPTB 2UYZB 2WWZA 4JL9A 4J6IA 1TZ1A 3W1YA 2FCSA 5D2MB 2CHWA 2MBQA 4I6LB 3OAWA 3ECIA 2KFJA 2MBEA 3W1SA 3ML8A 2J0JA 3QA8A 4IWOA 4W9JA 4MH0E 4A20A 3APDA 2R2QA 4AP4C 2KDBA 3C0RB 2LUEA 4W9EA 4TQ0A 3R66C 1WMHA 2K8CA 3A9JB 2N9EB 2ZVNA 2MP2A 3A9JA 3IVFA 2D10A 2WX0A 3L0WB 3PHWB 4GN1A 3R7QA 1AARA 2BKRB 2DZKA 1WXMA 2N7EA 3PRMB 4WJNA 4IM0A 1F9JA 4PYZA 3PZDA 3DOWA 3ZDTA 1YX5B 2AWTA 5G2NA 4AJYB 3RZFA 1E8YA 3KYDD 3SU8X 1SIFA 3PLVA 5J18A 1WE6A 2ZNVB 3QCAA 1VD2A 3PRPB 4K7SA 1D3ZA 2WYQA 2IO0B 4MM3A 4W9HA 1PQSA 2DYMA 5D7GA 2RPQA 2RGFA 4LDTB 1E90A 3PS6A 1S3SG 4LJOB 2M0XA 2NS5A 2DZMA 4G11A 3VVWB 2REXA 2LGDA 3B1LX 5L95C 1J8CA 1Z5SB 4ICVA 3ZO5B 4N9F4 3QWZB 1U4AA 2KWUB 3HHMA 1SE9A 1WRDB 3PPAA 2JZZA 1M94A 4IG7B 2ZZPB 4HWIB 1K8RB 3GZNI 2EKEC 1IP9A 1BT0A 3H6NA 1R4MI 3M62B 3I3TB 4MGZE 2LASA 1WX9A 3ZNGC 4MGIE 4PYUA 4IUMB 1WM3A 2NBWB 5TR5A 1WX8A 2IZVB 4IWQA 3TMPB 3TBLD 2J7QB 1WXVA 3KVFB 4BKSA 1V49A 2PE9A 5CHVC 4NY0A 3QARA 3LDZE 1WGGA 2KLCA 4G50A 3IBEA 1R4NI 2N9XA 3ALBA 2JWZA 3VUYA 2ZNVC 3VAWA 1WX7A 3SD5A 4LDTD 2VRRB 1WGYA 3HM3A 3PVLA 1YX6B 3ZNID 1P1AA 4GGQA 2KWVB 2JRIB 1FXTB 1RLFA 3VFKA 2RR9A 2KNBA 1WI0A 4DHJB 2N1WA 4KVGB 3CMMB 2DZJA 3CSTA 2JY6A 1UH6A 3R7RA 4JGHB 2KVRA 4IM3A 5AZFA 3KW5B 2IYDB 2KTFA 1LM8B 2KDFB 2L3ZA 4WWPA 3VUXA 4PS3A 2KANA 3H1UA 4XX5A 1WR6E 2DAJA 4NQKE 2HD5B 4NAWA 4NAWB 1NBFC 3KH0A 4PS7A 4NNJB 3RYTA 3HM6X 2MBOA 2WX1A 3QHTA 1ZKHA 2PPHA 3D32A 5CHWA 1EO6A 1S1QB 3M3JA 3VQIA 1E5WA 4WWNA 2D07B 3DCGA 3L17A 3V62A 1WXAA 2MBHA 3SHQA 2LD9A 2AL6A 5DPWA 4OVVA 5C1ZA 4F1SA 4DHJD 2R2OA 4E3CA 3U7DA 2C7HA 2L7RA 4GXBA 3ZIMA 5GMVA 1KJTA 4BOSC 2NR2A 2KJ6A 3U30A 3VTVA 2K8HA 2D11A 2GBNA 3VXWA 2FNJB 2GBRA 2KKCA 3VDZA 3ZUNA 4BKGA 2DYBA 1WJ6A 4GMVA 4WAAA 3AI5A 3N3KB 3PLUA 1RAXA 2MRPA 4TUUA 3RD2A 3N32A 2J0MA 4A3PA 1OQYA 2A4ZA 5DPTA 3P2BA 4FHKA 3S2AA 2IO3B 2KDIA 4BBNF 3UGBB 4II2B 4KV2A 3UIPB 1E7UA 3DVGY 4I6NB 4IC7B 3WALA 1P3QU 4ZRIA 2RSUA 2BYEA 2EMTA 3OLMD 4CHKA 2XEWA 1EF1A 3UIOB 3ONSA 4FLHA 2FAZA 1J0GA 1X1MA 4AWJA 3M63B 1WMHB 2RD0A 3H7SA 2O6VA 4CYEA 2MP2B 3IFWB 3H9DA 3M95A 4KSLC 4HK2A 1Q0WB 1WFYA 3A9KA 3A9KB 3BY4B 3MHSD 3PSEB 4ZDVA 3L54A 2MBBB 1TGZB 1WH3A 4A3OA 2M4NA 1TTNA 2C7MB 5IAAC 5JH5C 3TL5A 4CO7A 2Z59B 1E7VA 5DPRA 3CSFA 1GC7A 4PS8A 5LXHA 4KDLB 5J17A 1WXSA 3RCZA 2ZVOA 2KC1A 4LCDE 1YD8U 3UQBA 1YJ1A 3WANA 2LVQA 3K9OB 4YL8A 4E71A 1XT9B 4GU2A 4BBNC 1H8CA 3L13A 4NJ6A 4WWOA 3JYUA 2OOBB 4KIKA 4IWPA 2FUHB 3AU4A 3OJ4B 1GC6A 2BF8B 3L10B 2KQSA 2MQJA 3W1SC 1GJZA 2LRUA 1T0YA 3OJ3A 5AZHA 3VH3B 2JPHA 4M8NA 2I1JA 5J2RA 3PT2B 3WA0A 3V61A 2MX2A 2JRHA 2MLBA 2YVCA 2BWES 4HCPB 1WJ4A 2Y5BB 4W9IA 3O65B 4TKNA 3U8ZA 5LXIB 1MG8A 2KMAA 3Q3JA 4K1RB 4AUQC 1L7YA 4B6WA 4BFRA 1VCBA 4WJPA 1Q1OA 4BVUC 2L05A 2G4SA 2N9PC 3LJ3A 2KJHB 3A4RA 1Y8RC 4IM2A 2PE6B 4FADA 2ZEQA 4HLEA 4GDKB 4GDKA 3NZUA 2JT4B 2KLGA 2N1VA 4HDOA 2K8BA 2KD0A 2LXCA 4II3B 1G6JA 4LJPB 3ZTCA 2GBKA 1WY8A 2GOWA 3CF6E 3N30A 4DDID 1RRBA 4FHJA 4FULA 4GB9A 4HXDA 3B0AA 2OJRA 2W9NA 3EECA 5HKHA 5CHFA 3T9LA 4HPLB 2K6QA 2N7DA 4DHZB 2LJ5A 5D94A 2KXJA 3JSVA 3JSVB 2B3AA 3MTNB 4K81A 3L16A 3APCA 3NOBA 3ZLZA 4AOFA 4W9LA 4FA6A 2PEAA 1HE8A 2HE7A 1LXDA 2XK5A 2XK5B 2C60A 2KN5A 1P98A 3WAMA 4BKSD 2HTHA 3TCAA 3MJWA 2KOXA 4JIOU 2CU1A 2YLMA 4JQWC 2LGXA 2ASQA 2KX0A 3VH4B 2KWCA 3SDLC 2GMIC 4FBJB 4WQOB 1UD7A 2KHWB 3QX1A 4EFOA 4HVBA 4ZRKA 4W9CA 1V86A 3R3MA 4I6PA 2PJHA 3ZKJC 1GG3A 3KYCD 2DENB 3DBLI 1OTRB 5G55A 1V5OA 2K39A 4F7ZA 3PRZA 3PV1A 3DQVA 1WZ3A 2CHXA 2CS4A 1IPGA 1NDDA 2BWFA 2IY0B 3HIZA 2L8JA 2V3SA 5BO4B 2NCNA 2KFKB 2KFKA 2KO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BGF A;  2JZ3 B;  5IA7 A;  2FIF A;  2J0K A;  1GUA B;  3RZW C;  2EMS A;  2MCN B;  2JF5 A;  3BIN A;  4GOC A;  3QK0 A;  4TV3 A;  4URK A;  3DVN U;  3QAQ A;  1C3T A;  3B08 A;  4TQ1 A;  4EZK A;  2DZI A;  4JLC A;  1YQB A;  3AU5 A;  2C5L C;  3QQ8 B;  5CX3 A;  1E8X A;  4X57 B;  2ZPN A;  2CHZ A;  2XBB C;  2DYO A;  2K25 A;  3DVG X;  3PGE A;  5C23 A;  4EOY A;  1KM7 A;  1L2N A;  4W9G A;  4HJK A;  2KMC A;  1P9D U;  4HPM B;  3T8M A;  2FCM A;  2O6V B;  1E8Z A;  1YIW A;  3ML9 A;  2BYF A;  2KJR A;  2DAF A;  4KZ0 A;  5JHA A;  2ZJD A;  4KZC A;  1V80 A;  3V6E B;  1CMX B;  4FJV B;  5D6J B;  1UBQ A;  1V9J A;  2JVC A;  4ICU A;  3ZRF A;  1EUV B;  1UGM A;  2LXA A;  3WIM A;  3UQA A;  4HDQ A;  3VHT C;  3VTW A;  2KTR A;  2KTR B;  4WJQ A;  4DDG D;  4DBG A;  4F8C B;  2V4L A;  4MSQ B;  4ZYN A;  3PRE A;  2FCN A;  3UIN B;  2GBJ A;  1I35 A;  4MGY E;  4M8M A;  2HJ8 A;  3IHP C;  3NZS A;  2KC2 A;  3RT3 B;  4KIK B;  4EKU A;  1WF9 A;  1E8W A;  4MJS B;  4MJS A;  3ZRC A;  5KHQ A;  1IYF A;  3QIJ A;  4FJZ A;  2MWS B;  5DCN A;  1WGD A;  1KLV A;  2DX5 B;  1C1Y B;  3A1Q A;  1NI2 A;  3A1Q B;  4HCN B;  1RFA A;  2MW5 A;  4DXA B;  2K6D B;  2LRW A;  5DPS A;  2N4F A;  2O6V D;  2Z0E B;  2AYO B;  3DBH I;  3ZDM C;  2NBV B;  4EUT A;  2QHO A;  1XD3 B;  1Q5W B;  3Q3F A;  3DDC B;  3H7P A;  3H7P B;  3VTU A;  3APF A;  1SGH A;  3PHX B;  4MSM B;  5LLI A;  1UBI A;  4K7U A;  4DWF A;  2V1Y A;  3EC8 A;  5FR6 A;  1JRU A;  3DBS A;  5KHO A;  1EF5 A;  2M8S A;  3KUD B;  1V2Y A;  4W9K A;  2L0F A;  1UZX B;  1V5T A;  2CR5 A;  3WAO A;  1ZW7 A;  1KOT A;  4G3X B;  4ANX A;  3ZW3 A;  2G45 B;  3X23 A;  1I42 A;  2D3G A;  4ZRJ A;  4ANU A;  1WR1 A;  4AJW A;  3KUZ A;  5JHB A;  1Z2M A;  4P7I A;  4B9K A;  2G4D B;  3AXC A;  2LVP A;  1WE7 A;  4ANW A;  3DBR I;  1WJN A;  2IO1 B;  1WYW B;  2MA9 B;  3RUI B;  2JUO A;  2Z0D B;  4EZJ A;  2C7N B;  1LQB A;  5E6N A;  4OVU A;  4W9D A;  2IY1 B;  1WJU A;  2KDE B;  4WJO A;  2IBI B;  1UEL A;  1OGW A;  3QC8 B;  2D2Q A;  1A5R A;  2LVO A;  4GDL A;  4GDL B;  2GBM A;  3EFU A;  4KSK C;  4IW0 A;  4EEW A;  2BPS A;  3WAP A;  3GOE A;  2WDT B;  3DVN V;  2KK8 A;  3QJZ A;  3JW0 X;  1WGR A;  2A5U A;  2CKH B;  2JXX A;  4KDI C;  4ANV A;  2C9W B;  5E6P A;  1OEY A;  5AEK B;  5EDS A;  4EZL A;  5L83 A;  2K1F A;  3NHE B;  3JVZ X;  4GIV A;  5E6O A;  3VUW A;  3TIX A;  4XZ4 A;  3V6C B;  3A33 B;  4FJY A;  2LWP A;  1OEY J;  5CTR C;  1QZE A;  3NY5 A;  4MEM A;  1WGH A;  2ZCC A;  4M0W B;  4E74 A;  3K9P B;  4ASW C;  4NJ7 A;  3L08 A;  4GSW A;  3DPD A;  3X0W A;  2IO2 B;  4MEL A;  3EHV A;  2M1M A;  1TBE A;  2KQ7 A;  2M17 A;  3PTF C;  2MSE D;  1WZ0 A;  2G3Q B;  3ZVV A;  4RMA A;  3TJP A;  2LI5 A;  2AL3 A;  1WIA A;  4NQL B;  3UF8 A;  2I1K A;  3RUL A;  4DHZ E;  4MDK E;  4MGK E;  1LFD A;  3ZNH B;  4DK5 A;  2L0T A;  2UWQ A;  4K7W A;  2LGY A;  3ENE A;  1ZGU B;  2ZPY A;  1WM2 A;  2KZR A;  4B95 A;  3NS8 A;  2L76 A;  2ZCB A;  1ISN A;  5AZG A;  3ZNZ B;  4RM9 A;  3V60 A;  2L00 B;  4BKT A;  1XQQ A;  3KUC B;  2BKF A;  4RM8 A;  2O2V A;  2O2V B;  4W9F A;  3ZTD A;  2FID A;  3HK0 A;  1P0R A;  2AEH A;  3AUL A;  3IG3 A;  4FN2 A;  1GNU A;  4G0N B;  2LZ6 A;  2NVU I;  2KX3 A;  2NBU A;  2BYV E;  4BOZ B;  4NPN A;  4XC2 A;  1J19 A;  2DHZ A;  3A4S C;  5JZE B;  2FCQ A;  1H4R A;  1V81 A;  1V6E A;  2NPT A;  2NPT B;  2UYZ B;  2WWZ A;  4JL9 A;  4J6I A;  1TZ1 A;  3W1Y A;  2FCS A;  5D2M B;  2CHW A;  2MBQ A;  4I6L B;  3OAW A;  3ECI A;  2KFJ A;  2MBE A;  3W1S A;  3ML8 A;  2J0J A;  3QA8 A;  4IWO A;  4W9J A;  4MH0 E;  4A20 A;  3APD A;  2R2Q A;  4AP4 C;  2KDB A;  3C0R B;  2LUE A;  4W9E A;  4TQ0 A;  3R66 C;  1WMH A;  2K8C A;  3A9J B;  2N9E B;  2ZVN A;  2MP2 A;  3A9J A;  3IVF A;  2D10 A;  2WX0 A;  3L0W B;  3PHW B;  4GN1 A;  3R7Q A;  1AAR A;  2BKR B;  2DZK A;  1WXM A;  2N7E A;  3PRM B;  4WJN A;  4IM0 A;  1F9J A;  4PYZ A;  3PZD A;  3DOW A;  3ZDT A;  1YX5 B;  2AWT A;  5G2N A;  4AJY B;  3RZF A;  1E8Y A;  3KYD D;  3SU8 X;  1SIF A;  3PLV A;  5J18 A;  1WE6 A;  2ZNV B;  3QCA A;  1VD2 A;  3PRP B;  4K7S A;  1D3Z A;  2WYQ A;  2IO0 B;  4MM3 A;  4W9H A;  1PQS A;  2DYM A;  5D7G A;  2RPQ A;  2RGF A;  4LDT B;  1E90 A;  3PS6 A;  1S3S G;  4LJO B;  2M0X A;  2NS5 A;  2DZM A;  4G11 A;  3VVW B;  2REX A;  2LGD A;  3B1L X;  5L95 C;  1J8C A;  1Z5S B;  4ICV A;  3ZO5 B;  4N9F 4;  3QWZ B;  1U4A A;  2KWU B;  3HHM A;  1SE9 A;  1WRD B;  3PPA A;  2JZZ A;  1M94 A;  4IG7 B;  2ZZP B;  4HWI B;  1K8R B;  3GZN I;  2EKE C;  1IP9 A;  1BT0 A;  3H6N A;  1R4M I;  3M62 B;  3I3T B;  4MGZ E;  2LAS A;  1WX9 A;  3ZNG C;  4MGI E;  4PYU A;  4IUM B;  1WM3 A;  2NBW B;  5TR5 A;  1WX8 A;  2IZV B;  4IWQ A;  3TMP B;  3TBL D;  2J7Q B;  1WXV A;  3KVF B;  4BKS A;  1V49 A;  2PE9 A;  5CHV C;  4NY0 A;  3QAR A;  3LDZ E;  1WGG A;  2KLC A;  4G50 A;  3IBE A;  1R4N I;  2N9X A;  3ALB A;  2JWZ A;  3VUY A;  2ZNV C;  3VAW A;  1WX7 A;  3SD5 A;  4LDT D;  2VRR B;  1WGY A;  3HM3 A;  3PVL A;  1YX6 B;  3ZNI D;  1P1A A;  4GGQ A;  2KWV B;  2JRI B;  1FXT B;  1RLF A;  3VFK A;  2RR9 A;  2KNB A;  1WI0 A;  4DHJ B;  2N1W A;  4KVG B;  3CMM B;  2DZJ A;  3CST A;  2JY6 A;  1UH6 A;  3R7R A;  4JGH B;  2KVR A;  4IM3 A;  5AZF A;  3KW5 B;  2IYD B;  2KTF A;  1LM8 B;  2KDF B;  2L3Z A;  4WWP A;  3VUX A;  4PS3 A;  2KAN A;  3H1U A;  4XX5 A;  1WR6 E;  2DAJ A;  4NQK E;  2HD5 B;  4NAW A;  4NAW B;  1NBF C;  3KH0 A;  4PS7 A;  4NNJ B;  3RYT A;  3HM6 X;  2MBO A;  2WX1 A;  3QHT A;  1ZKH A;  2PPH A;  3D32 A;  5CHW A;  1EO6 A;  1S1Q B;  3M3J A;  3VQI A;  1E5W A;  4WWN A;  2D07 B;  3DCG A;  3L17 A;  3V62 A;  1WXA A;  2MBH A;  3SHQ A;  2LD9 A;  2AL6 A;  5DPW A;  4OVV A;  5C1Z A;  4F1S A;  4DHJ D;  2R2O A;  4E3C A;  3U7D A;  2C7H A;  2L7R A;  4GXB A;  3ZIM A;  5GMV A;  1KJT A;  4BOS C;  2NR2 A;  2KJ6 A;  3U30 A;  3VTV A;  2K8H A;  2D11 A;  2GBN A;  3VXW A;  2FNJ B;  2GBR A;  2KKC A;  3VDZ A;  3ZUN A;  4BKG A;  2DYB A;  1WJ6 A;  4GMV A;  4WAA A;  3AI5 A;  3N3K B;  3PLU A;  1RAX A;  2MRP A;  4TUU A;  3RD2 A;  3N32 A;  2J0M A;  4A3P A;  1OQY A;  2A4Z A;  5DPT A;  3P2B A;  4FHK A;  3S2A A;  2IO3 B;  2KDI A;  4BBN F;  3UGB B;  4II2 B;  4KV2 A;  3UIP B;  1E7U A;  3DVG Y;  4I6N B;  4IC7 B;  3WAL A;  1P3Q U;  4ZRI A;  2RSU A;  2BYE A;  2EMT A;  3OLM D;  4CHK A;  2XEW A;  1EF1 A;  3UIO B;  3ONS A;  4FLH A;  2FAZ A;  1J0G A;  1X1M A;  4AWJ A;  3M63 B;  1WMH B;  2RD0 A;  3H7S A;  2O6V A;  4CYE A;  2MP2 B;  3IFW B;  3H9D A;  3M95 A;  4KSL C;  4HK2 A;  1Q0W B;  1WFY A;  3A9K A;  3A9K B;  3BY4 B;  3MHS D;  3PSE B;  4ZDV A;  3L54 A;  2MBB B;  1TGZ B;  1WH3 A;  4A3O A;  2M4N A;  1TTN A;  2C7M B;  5IAA C;  5JH5 C;  3TL5 A;  4CO7 A;  2Z59 B;  1E7V A;  5DPR A;  3CSF A;  1GC7 A;  4PS8 A;  5LXH A;  4KDL B;  5J17 A;  1WXS A;  3RCZ A;  2ZVO A;  2KC1 A;  4LCD E;  1YD8 U;  3UQB A;  1YJ1 A;  3WAN A;  2LVQ A;  3K9O B;  4YL8 A;  4E71 A;  1XT9 B;  4GU2 A;  4BBN C;  1H8C A;  3L13 A;  4NJ6 A;  4WWO A;  3JYU A;  2OOB B;  4KIK A;  4IWP A;  2FUH B;  3AU4 A;  3OJ4 B;  1GC6 A;  2BF8 B;  3L10 B;  2KQS A;  2MQJ A;  3W1S C;  1GJZ A;  2LRU A;  1T0Y A;  3OJ3 A;  5AZH A;  3VH3 B;  2JPH A;  4M8N A;  2I1J A;  5J2R A;  3PT2 B;  3WA0 A;  3V61 A;  2MX2 A;  2JRH A;  2MLB A;  2YVC A;  2BWE S;  4HCP B;  1WJ4 A;  2Y5B B;  4W9I A;  3O65 B;  4TKN A;  3U8Z A;  5LXI B;  1MG8 A;  2KMA A;  3Q3J A;  4K1R B;  4AUQ C;  1L7Y A;  4B6W A;  4BFR A;  1VCB A;  4WJP A;  1Q1O A;  4BVU C;  2L05 A;  2G4S A;  2N9P C;  3LJ3 A;  2KJH B;  3A4R A;  1Y8R C;  4IM2 A;  2PE6 B;  4FAD A;  2ZEQ A;  4HLE A;  4GDK B;  4GDK A;  3NZU A;  2JT4 B;  2KLG A;  2N1V A;  4HDO A;  2K8B A;  2KD0 A;  2LXC A;  4II3 B;  1G6J A;  4LJP B;  3ZTC A;  2GBK A;  1WY8 A;  2GOW A;  3CF6 E;  3N30 A;  4DDI D;  1RRB A;  4FHJ A;  4FUL A;  4GB9 A;  4HXD A;  3B0A A;  2OJR A;  2W9N A;  3EEC A;  5HKH A;  5CHF A;  3T9L A;  4HPL B;  2K6Q A;  2N7D A;  4DHZ B;  2LJ5 A;  5D94 A;  2KXJ A;  3JSV A;  3JSV B;  2B3A A;  3MTN B;  4K81 A;  3L16 A;  3APC A;  3NOB A;  3ZLZ A;  4AOF A;  4W9L A;  4FA6 A;  2PEA A;  1HE8 A;  2HE7 A;  1LXD A;  2XK5 A;  2XK5 B;  2C60 A;  2KN5 A;  1P98 A;  3WAM A;  4BKS D;  2HTH A;  3TCA A;  3MJW A;  2KOX A;  4JIO U;  2CU1 A;  2YLM A;  4JQW C;  2LGX A;  2ASQ A;  2KX0 A;  3VH4 B;  2KWC A;  3SDL C;  2GMI C;  4FBJ B;  4WQO B;  1UD7 A;  2KHW B;  3QX1 A;  4EFO A;  4HVB A;  4ZRK A;  4W9C A;  1V86 A;  3R3M A;  4I6P A;  2PJH A;  3ZKJ C;  1GG3 A;  3KYC D;  2DEN B;  3DBL I;  1OTR B;  5G55 A;  1V5O A;  2K39 A;  4F7Z A;  3PRZ A;  3PV1 A;  3DQV A;  1WZ3 A;  2CHX A;  2CS4 A;  1IPG A;  1NDD A;  2BWF A;  2IY0 B;  3HIZ A;  2L8J A;  2V3S A;  5BO4 B;  2NCN A;  2KFK B;  2KFK A;  2KO3 A; 
#chains in the Genus database with same CATH topology
 1JWB D;  1HTO A;  5IA7 A;  1SE2 A;  2FIF A;  4ZYS A;  1KF6 B;  4GOC A;  1SBB B;  1CJE A;  3QK0 A;  2J42 A;  3DVN U;  1YJI A;  1UWX A;  3UI3 A;  2ZPN A;  1C77 A;  2DYO A;  2XBB C;  5C23 A;  4EOY A;  1L2N A;  2KMC A;  4HPM B;  1TIF A;  2K0P A;  2FCM A;  2O6V B;  1E8Z A;  2JXT A;  1KRH A;  2E3T A;  1YQ3 B;  4ZOH C;  4FJV B;  2M56 B;  4OZC A;  2L52 A;  3T3N A;  2NTS A;  2KTR A;  4WJQ A;  3URY A;  4ZYN A;  3UIN B;  1UF0 A;  2FCN A;  2JU6 X;  1WGK A;  4MGY E;  3P63 A;  2HJ8 A;  3IHP C;  2YEP F;  4MJS B;  3IXS A;  1IYF A;  1HEZ E;  4FJZ A;  5DCN A;  3A1Q A;  2MW5 A;  2LRW A;  1PYW D;  2AYO B;  3ZDM C;  4EUT A;  2LGI A;  3DDC B;  3RI7 C;  1JCK B;  3VTU A;  1UBI A;  2GRI A;  4DWF A;  2V1Y A;  3EC8 A;  5FR6 A;  1JRU A;  3DBS A;  4YSX B;  3KUD B;  1V5T A;  2CR5 A;  3ZW3 A;  4LNF A;  2D3G A;  2L1A A;  1WR1 A;  4HRS A;  1WRI A;  4AJW A;  1SF0 A;  5JHB A;  2WGS A;  2G4D B;  1WE7 A;  3DBR I;  2MA9 B;  2Z0D B;  2QC8 A;  5E6N A;  3Q14 C;  1OQR A;  1OGW A;  4GDL B;  1N5W A;  4KSK C;  4EEW A;  1FO4 A;  1FFV A;  3Q2A C;  3RN9 C;  4KDI C;  3QJZ A;  2A5U A;  4S0R A;  1UGJ A;  1WXQ A;  4KKI A;  3VUW A;  2LHE A;  3TIX A;  4FJY A;  3DBL B;  3BYT B;  4M0W A;  3K9P B;  1YQ4 B;  2W54 A;  1FXA A;  3X0W A;  2IO2 B;  4S17 A;  4MEL A;  3EHV A;  3R2T A;  4ZRP A;  2MSE D;  1WZ0 A;  4PK1 A;  3ZVV A;  2LI5 A;  5T8I A;  2J53 A;  3ZNH B;  3W5V B;  4P1B C;  5AZG A;  3Q8E A;  4RM9 A;  2PKO A;  2PMV A;  3KUC B;  4M00 A;  2BKF A;  4RM8 A;  4TSS A;  1UWM A;  1E7P B;  1EU4 A;  1N60 A;  4G0N B;  2LGS A;  1ET9 A;  2NVU I;  3I57 A;  4A9A A;  2RPV A;  1JWM D;  1J7C A;  4BOZ B;  1IUE A;  4XC2 A;  2OJW A;  2NPT A;  3W1Y A;  4D2K A;  1TZ1 A;  4LTU A;  2FCS A;  2D3C A;  2KFJ A;  2DBY A;  2MBE A;  4US8 A;  3ML8 A;  2Z8L A;  4A20 A;  2BVC A;  2KDB A;  2WXL A;  1WMH A;  2K8C A;  2N0S B;  2MP2 A;  2D10 A;  2BKR B;  2N7E A;  3DBH B;  1JW9 D;  4WJN A;  2AWT A;  1EM7 A;  1E8Y A;  3KYD D;  3PLV A;  3O13 A;  1VD2 A;  3PRP B;  4MM3 A;  5D7G A;  3DHH C;  2RGF A;  2IGG A;  1E6E B;  1S3S G;  4LJO B;  4G11 A;  2DZM A;  2D3A A;  5AUI A;  3VVW B;  2REX A;  5L95 C;  5IKC M;  2KWU B;  1SE9 A;  1WRD B;  1B1Z A;  1YOV B;  3B9J A;  3GZN I;  5IN7 A;  1BT0 A;  3H6N A;  1WYG A;  1WX9 A;  4PYU A;  1WM3 A;  5TR5 A;  3AE7 B;  1F1H A;  2J7Q B;  5CHV C;  4NY0 A;  3QAR A;  3LDZ E;  2KLC A;  5HHD G;  1FRD A;  3ALB A;  2JWZ A;  2PTL A;  2ZNV C;  3PVL A;  1YX6 B;  3ZNI D;  1P1A A;  1RLF A;  4JX1 C;  1WI0 A;  1LGR A;  2DZJ A;  1UH6 A;  4IM3 A;  3KW5 B;  3P4Q B;  3Q3M C;  1IBX B;  2KTF A;  3HVZ A;  3HVD A;  1GOZ A;  3NS1 A;  4NQK E;  2WXP A;  1JWS D;  4RGO S;  4NAW A;  1YN3 A;  4NNJ B;  3RYT A;  2MBO A;  2WX1 A;  4WIP A;  3D32 A;  3IT6 B;  1EO6 A;  3AE4 B;  3VR9 B;  4DQO C;  3V62 A;  2MBH A;  3FIL A;  4RF1 A;  5DPW A;  1MI0 A;  4E3C A;  3P4R B;  2C7H A;  4XWT A;  1KFY B;  4BOS C;  3W2D A;  3U30 A;  2QSD A;  5C3J B;  1FXI A;  2K8H A;  2KKC A;  2KQ4 X;  2OED A;  4WAA A;  3N3K B;  1RAX A;  2MRP A;  4TUU A;  4AS1 A;  3N32 A;  4A3P A;  3P1M A;  2KDI A;  2JWU A;  4KV2 A;  3UIP B;  1E7U A;  1QOA A;  3EFC A;  4C56 C;  2RSU A;  2EMT A;  3OLM D;  4CHK A;  2QIE B;  1E10 A;  3H7S A;  2O6V A;  3P42 A;  2QIL A;  1NYQ A;  3H9D A;  3A9K A;  3AEE B;  1JQ4 A;  2MBB B;  1AW7 A;  1L0Y B;  1TGZ B;  2WU5 B;  4XGA B;  2C7M B;  3EA6 A;  3TL5 A;  2IJ0 A;  2K5P A;  1ENF A;  2JYT A;  3AEF B;  2ZVO A;  3UQB A;  1QKZ A;  3WAN A;  1SEB D;  3FKY A;  4WQM A;  1R4M B;  1M4V A;  2FUH B;  1GB1 A;  2BF8 B;  2KQS A;  4N58 A;  2MQJ A;  1GJZ A;  2LRU A;  5GXG B;  2MLB A;  3RNC C;  2BWE S;  1MVK A;  4W9I A;  3U8Z A;  4K1R B;  4BFR A;  1VCB A;  3J9C A;  4WJP A;  2FE8 A;  4BVU C;  5EE3 A;  3DWG C;  1N6Z A;  1I4R A;  4IM2 A;  2TSS A;  2JSV X;  4GDK A;  2KT7 A;  4HDO A;  3N1Z C;  4II3 B;  4K3C A;  1A70 A;  1HQR D;  4FHJ A;  3FC4 A;  2LUM A;  5HKH A;  4YXD B;  2N7D A;  4DHZ B;  2LJ5 A;  3JSV A;  1P98 A;  1HA5 A;  2HTH A;  2RMM A;  1I4H A;  4JIO U;  2PLP A;  2KWC A;  3RFZ B;  3SDL C;  5MPO A;  2JYE A;  3QX1 A;  4ZRK A;  1V86 A;  2SAK A;  3R3M A;  1AWD A;  3ZKJ C;  1FM0 D;  5G55 A;  1DYQ A;  1K50 A;  1WZ3 A;  1TY2 A;  1MHH E;  2BWF A;  2LEK A;  2IY0 B;  3KWV A;  2V3S A;  3AE1 B;  4WAF A;  3RZW C;  2ON8 A;  4USA A;  1HZ6 A;  2I38 A;  4URK A;  3ZGZ A;  3B08 A;  4C7Y A;  4EZK A;  2DZI A;  1YQB A;  1D6E C;  3GE8 C;  3AU5 A;  2C5L C;  3BVZ A;  4M01 A;  5CX3 A;  4X57 B;  1VJK A;  1VRA B;  2AQ3 B;  3U7Z A;  5HI1 A;  3PGE A;  3VRA B;  1FPY A;  1YIW A;  3ML9 A;  3CIR B;  2KJR A;  1YN4 A;  1V80 A;  3V6E B;  1XCT L;  5D6J B;  3ZRF A;  3TEZ A;  1ACC A;  1EWY C;  3UQA A;  1TT5 B;  4HDQ A;  1D4B A;  1T6B X;  3VTW A;  1NEK B;  4F8C B;  3C8Y A;  1I35 A;  4M8M A;  3NZS A;  5TSS A;  2KC2 A;  2MEK A;  4KIK B;  2YEP B;  4EKU A;  1WF9 A;  1E8W A;  5KHQ A;  2CJN A;  2MWS B;  1VZ8 A;  2BTE A;  2K6D B;  3IT4 B;  5DPS A;  2N4F A;  2O6V D;  2Z0E B;  2INN E;  2NBV B;  1Q5W B;  3H7P A;  1SGH A;  5LLI A;  4UDU C;  3AEB B;  3ZXR A;  1EF5 A;  3Q3O C;  1UZX B;  1KOT A;  1ZW7 A;  3X23 A;  1T0Q C;  1TYG B;  4P7I A;  3RUI B;  2G1E A;  4EZJ A;  2C7N B;  1ET6 A;  2RDH A;  4OVU A;  4ZRQ A;  3R8B A;  2IY1 B;  2KDE B;  1UEL A;  2DWQ A;  2D2Q A;  2LVO A;  1C9F A;  4IW0 A;  3NZ3 A;  1TJE A;  3GOE A;  1VZ6 A;  2KK8 A;  1RYJ A;  5LNK 1;  2CKH B;  2JXX A;  3RPF C;  3TUO A;  5E6P A;  4R3D A;  5L83 A;  3NHE B;  1C4P A;  4GIV A;  5E6O A;  1JRO A;  3V6C B;  4OW0 A;  5CTR C;  1ZOY B;  1C79 A;  2WXO A;  4YSY B;  3HRD D;  2ZCC A;  2WXN A;  5HFY A;  3DPD A;  4MH8 A;  3MC0 B;  2M1M A;  2M17 A;  4N6E B;  2G3Q B;  4RMA A;  2AL3 A;  3AE9 B;  3UF8 A;  2I1K A;  3RUL A;  4MDK E;  2QCZ A;  4DK5 A;  2L0T A;  3N1X C;  4RNA A;  3ENE A;  1RFK A;  1ZGU B;  2RDG A;  2KZR A;  5E6J A;  2L76 A;  3N1Y C;  2VZK D;  3ZNZ B;  3I5J C;  1XQQ A;  4KX6 B;  2O2V A;  3ZTD A;  2FID A;  2ONQ A;  2AEH A;  1F52 A;  1C76 A;  3AV8 A;  4RCO A;  1XF5 L;  2LZ6 A;  3RNE C;  4ARI A;  1V1P A;  2M19 A;  1J19 A;  2DHZ A;  3A4S C;  4LNI A;  4C80 A;  2FCQ A;  4J6I A;  1MG4 A;  3SFE B;  2MBQ A;  1I4Q A;  4YWG G;  3W1S A;  2J0J A;  3QA8 A;  4XWW A;  3R66 C;  1ZXI A;  4CQN A;  3A9J A;  2ZVN A;  3PHW B;  3U7D A;  3SR6 A;  4PYZ A;  3PZD A;  3QCA A;  1NYR A;  4LDT B;  2PW9 A;  2ZW1 A;  3RMK C;  5EE0 A;  2LGD A;  1J8C A;  1Z5S B;  4PT5 A;  4N9F 4;  1U4A A;  3HHM A;  4IG7 B;  2JZZ A;  1F2R I;  1M94 A;  2ZZP B;  4HWI B;  3V3X A;  2EKE C;  2KAC A;  3KLS X;  2LAS A;  2MH7 A;  4MGI E;  4IUM B;  2NBW B;  2W3R A;  1T5X D;  2IZV B;  4IWQ A;  4ITK A;  1DOX A;  2LHD A;  1KLU D;  1TKE A;  1WXV A;  1GAQ B;  1L4D B;  3AM9 A;  3I63 C;  3IBE A;  3AMZ A;  5BYR A;  3VAW A;  3SD5 A;  2VRR B;  3HM3 A;  2N1W A;  2JY6 A;  4JGH B;  5AZF A;  2KVZ A;  1GPX A;  2IYD B;  4C00 A;  2L3Z A;  2QMT A;  3I9V 1;  1WWT A;  2LJI A;  2J4X A;  2CJO A;  1SJH D;  3EGR A;  5G5G A;  2HD5 B;  3KH0 A;  4EE2 A;  3QHT A;  2PPH A;  1S1Q B;  4NAM A;  2N9L A;  3DCG A;  1YN5 A;  1TS5 A;  2MJD A;  2WXQ A;  1YJJ A;  2KJ6 A;  2R61 A;  2GBN A;  2GBR A;  3VDZ A;  4GMV A;  1AYF A;  3AI5 A;  2JX5 A;  3GS2 A;  2WXM A;  3DHI C;  2J0M A;  1OQY A;  2A4Z A;  2K22 A;  3P2B A;  4FHK A;  3RNG C;  3UGB B;  4II2 B;  3DVG Y;  3TEY A;  3BVM A;  3Q8A A;  4A90 A;  3UIO B;  3ONS A;  1FNW A;  1J0G A;  2QEJ C;  3M63 B;  2Y5P A;  4CYE A;  4DXG A;  4HK2 A;  3ABV B;  4ZDV A;  4A3O A;  1TTN A;  5IAA C;  1OQQ A;  2IDY A;  2J52 A;  2Z59 B;  1SSN A;  3CSF A;  4PS8 A;  3RCZ A;  1JAL A;  1XT9 B;  4GU2 A;  4BBN C;  3L13 A;  1XCQ L;  4KIK A;  1K53 A;  1XO3 A;  3AU4 A;  4OZB A;  5BMI A;  1T0Y A;  4KGT A;  1L0X B;  2JPH A;  2D3B A;  3PT2 B;  1CZP A;  2Y5B B;  4TKN A;  3Q3J A;  4WWM A;  4B6W A;  2N9P C;  3LJ3 A;  1Y8R C;  4J3O D;  3NZU A;  2JT4 B;  3B2G A;  1KH0 A;  1NVI D;  3TSS A;  2K8B A;  1BUI C;  2LXC A;  1QIL A;  3LXF A;  4LJP B;  3CF6 E;  4FUL A;  3B0A A;  1FRR A;  2AQ2 B;  1F77 A;  2OJR A;  3EEC A;  2BBC A;  1L6V A;  5CHF A;  4HPL B;  3MHZ A;  4K81 A;  4P1C C;  1HE8 A;  2L83 A;  4HJG E;  2XK5 A;  2KN5 A;  3WAM A;  4L2Y A;  3BII D;  1WSP A;  2YLM A;  1JRP A;  1IGD A;  3VH4 B;  1XLO A;  4JPS A;  4WQO B;  1E9M A;  4IDI A;  4EFO A;  3P4S B;  4I6P A;  3KYC D;  3C19 A;  5BMG A;  2K39 A;  4F7Z A;  2CS4 A;  1NDD A;  3KWL A;  2L8J A;  2GLS A;  3GB1 A;  3ZJU A;  2KFK A;  4C4V B;  2KO3 A;  3LYY A;  5BMH A;  2JZ3 B;  1I4P A;  2J0K A;  2MCN B;  3BIN A;  1SXT A;  4TV3 A;  1C3T A;  4TQ1 A;  4BZA A;  3IAM 1;  4JLC A;  1E8X A;  1VLB A;  1PGB A;  1VDV A;  2IPK D;  4W9G A;  4HJK A;  1CQV A;  1P9D U;  3NJT A;  3T8M A;  3E56 A;  4ACF A;  3ETR A;  2BYF A;  1L5P A;  2DAF A;  5JHA A;  4L1B A;  2WXJ A;  4KZC A;  1UBQ A;  1V9J A;  2JVC A;  2X8X X;  1EUV B;  3VHT C;  2KTR B;  1HXY D;  2V3N A;  1MHX A;  1N5X A;  5FR3 A;  4RH6 A;  3RT3 B;  3ZRC A;  4MJS A;  3SFD B;  1ZP0 B;  2DX5 B;  1C1Y B;  2V4I B;  3A1Q B;  4HCN B;  1RFA A;  4DXA B;  3AEA B;  3LB8 C;  3ZJV A;  2HJ1 A;  2QHO A;  2FUG 1;  3U4E G;  3PHX B;  4MSM B;  1TS2 A;  1RM6 C;  1FCL A;  3AED B;  4K7U A;  1JWU D;  1IGC A;  3MJ5 A;  4W9K A;  3WAO A;  4ANX A;  5FKA C;  1I42 A;  1PGA A;  4ZRJ A;  4DXF A;  1F2R C;  2UU7 A;  3KUZ A;  4OZA A;  1Z2M A;  3AXC A;  2LVP A;  4ANW A;  1WJN A;  2WU2 B;  2JUO A;  2INP E;  2BS2 B;  3RNA C;  3W9C B;  1WJU A;  2WDV B;  1I7H A;  3QC8 B;  1A5R A;  1YNT E;  4GDL A;  1EU3 A;  2BPS A;  3WAP A;  2WDT B;  3L4P A;  1WGR A;  5AEK B;  5EDS A;  4EZL A;  3JVZ X;  1PDX A;  4BAX A;  4MEM A;  1WGH A;  2W82 A;  3NVV A;  3MP9 A;  1STE A;  3Q8B A;  4KGS A;  4M0W B;  4HRO A;  4NJ7 A;  3L08 A;  4A8X C;  1TBE A;  2KQ7 A;  4NZL B;  4MT5 A;  2BB5 A;  1ZPS A;  2SEB D;  1TS3 A;  4DHZ E;  3H8H A;  4K7W A;  2KAJ A;  2L00 B;  4BKT A;  2AQ1 B;  3HK0 A;  1P0R A;  3AUL A;  3IG3 A;  3DHG C;  2KX3 A;  2NBU A;  3V05 A;  2BYV E;  1QLB B;  5JZE B;  1UNS A;  1H4R A;  1V81 A;  2EKI A;  2NPT B;  2L32 A;  1T0R C;  5D2M B;  1QOB A;  4I6L B;  4JWU C;  3OAW A;  4W9J A;  4IWO A;  4MH0 E;  2R2Q A;  2JQR B;  2LUE A;  1L0V B;  1FCC C;  3ZQ4 A;  2N9E B;  3L0W B;  3R7Q A;  1TY0 A;  1Y56 A;  2WX0 A;  3IVF A;  3MC9 A;  4GN1 A;  4NJC A;  2DZK A;  1WXM A;  4LK0 M;  3AEC B;  4IM0 A;  5G2N A;  4AJY B;  3RZF A;  3SU8 X;  1SIF A;  5J18 A;  1WE6 A;  2QJL A;  2ZNV B;  4K7S A;  1D3Z A;  1V1O A;  4YT0 B;  2WYQ A;  2IO0 B;  3E9S A;  4W9H A;  1PQS A;  2DYM A;  2RPQ A;  3Q69 A;  3PS6 A;  2M0X A;  4KGR A;  2HTM E;  3RNF C;  3ZO5 B;  3QWZ B;  3M62 B;  1L4Z B;  3ZNG C;  5D3D A;  1BML C;  3TBL D;  1ZDV A;  4BKS A;  3T3O A;  2PE9 A;  1WGG A;  2E6X A;  1R4N I;  3TEW A;  2N9X A;  2WXH A;  3VUY A;  4LDT D;  1WGY A;  4YTN B;  3ZJT A;  1KLG D;  4GGQ A;  1P7F A;  2JRI B;  1FXT B;  3VFK A;  4XE0 A;  4H2A A;  4DHJ B;  2ACZ B;  3CMM B;  2INC C;  3R7R A;  1IBX A;  1HTQ A;  1PUT A;  4WWP A;  2V0G A;  3VUX A;  4PS3 A;  2KAN A;  3H1U A;  1GB4 A;  1WR6 E;  2DAJ A;  2BB6 A;  1T3Q A;  4NAW B;  1NBF C;  1AN8 A;  1ZKH A;  4GLS C;  5BYS A;  5CHW A;  2HDE A;  3M3J A;  1E5W A;  4WWN A;  1TS4 A;  3EUB 2;  3BVG A;  3SHQ A;  2IND C;  3FIL B;  2LD9 A;  2AL6 A;  2B76 B;  1QT9 A;  1J7B A;  2KDM A;  4F1S A;  4TMA B;  1SE3 A;  2W3S A;  3ZIM A;  4LNO A;  2ICI A;  4B0E A;  3VTV A;  3MC8 A;  1FNV A;  2M0A A;  1OFF A;  5H8Y E;  4BKG A;  5C2T B;  2ZW0 A;  1WJ6 A;  3PLU A;  4C4V A;  2XN9 C;  3CWI A;  3GE3 C;  1QF6 A;  5DPT A;  2D5G A;  3S2A A;  2IO3 B;  4BBN F;  4JE3 B;  2KWD A;  4IC7 B;  4WH4 A;  3WAL A;  4RF0 A;  2BYE A;  1ESF A;  3Q8C A;  2XEW A;  1EF1 A;  2DNF A;  1HZ5 A;  4FLH A;  2FAZ A;  4AWJ A;  2CU3 A;  1KTK A;  1R7S A;  3IFW B;  4KSL C;  3B2F A;  4OHJ A;  3A9K B;  1VZ7 A;  1FD6 A;  1Q10 A;  1WH3 A;  1F0Z A;  2M4N A;  5JH5 C;  4CO7 A;  2Q5W D;  5DPR A;  4P6V F;  1GC7 A;  5J17 A;  1T0S C;  4LCD E;  1YJ1 A;  3HUI A;  2LVQ A;  3K9O B;  4YL8 A;  4E71 A;  2GI9 A;  4A55 A;  1H8C A;  4NJ6 A;  4WWO A;  3NUH B;  2OOB B;  4IWP A;  3OJ4 B;  1GC6 A;  3DBR B;  5H92 C;  3W1S C;  2Y5C A;  3OJ3 A;  4K3B A;  4M8N A;  5J2R A;  4Q2J A;  3V61 A;  3WA0 A;  2WXF A;  4HCP B;  4OVZ A;  2KYW A;  3O65 B;  1MG8 A;  2KMA A;  5HG2 A;  4AUQ C;  1L7Y A;  4XDC A;  1XLQ A;  3AE5 B;  2G4S A;  3GP7 A;  2KJH B;  3A4R A;  4JWS C;  2PVG C;  2ZEQ A;  4KKJ A;  4GDK B;  4P16 A;  3AE3 B;  2KLG A;  2N1V A;  3AE6 B;  3ZTC A;  2GOW A;  3U52 E;  4DDI D;  4GB9 A;  4ZHP A;  2IGD A;  3T9L A;  2K6Q A;  2KXJ A;  3JSV B;  2B3A A;  3MTN B;  3L16 A;  3NOB A;  1N61 A;  4FA6 A;  2HE7 A;  4BKS D;  3MJW A;  2KOX A;  1N63 A;  2WXK A;  3AB5 A;  4O1N A;  4JQW C;  2VZK B;  2ASQ A;  2GMI C;  2FBW B;  1UD7 A;  1FNU A;  3IAS 1;  2DEN B;  3DBL I;  1OTR B;  2K9X A;  1V5O A;  2NMQ A;  3PRZ A;  2WHI A;  2CHX A;  1IPG A;  2NTT A;  3VRB B;  1ZDX A;  3HIZ A;  5BO4 B;  2KVR A;  3FAH A;  2BGF A;  5G5H A;  1GUA B;  2EMS A;  2JF5 A;  3VR8 B;  3QAQ A;  2MJE A;  3BK1 A;  3QQ8 B;  1FFU A;  2CHZ A;  2X38 A;  3DVG X;  2K25 A;  2V9H A;  1KM7 A;  5IOI A;  1YMH E;  2N7J A;  4KZ0 A;  2ZJD A;  3DWM A;  1CMX B;  4N59 A;  4ICU A;  1UGM A;  2LXA A;  3WIM A;  4IKG A;  4A6Q A;  3PZ7 A;  4DBG A;  1PFD A;  4DDG D;  2V4L A;  3TEX A;  4MSQ B;  3PRE A;  2GBJ A;  3GZN B;  3QIJ A;  1C4C A;  1WGD A;  1KLV A;  1NI2 A;  1BXT A;  2WS3 B;  1P7E A;  2VH1 A;  3DBH I;  3NRZ A;  1XD3 B;  5AUK A;  1XEE A;  3Q3F A;  3H7P B;  3APF A;  3OG5 A;  4LNN A;  1TZO A;  5KHO A;  1V97 A;  2M8S A;  1V2Y A;  2L0F A;  3BYY B;  4G3X B;  2MHJ A;  2G45 B;  4ANU A;  4QAY A;  4B9K A;  2QDF A;  2IO1 B;  1WYW B;  1LQB A;  1CK1 A;  4W9D A;  3AN1 A;  4WJO A;  2IBI B;  1ROE A;  2JZP A;  3NG0 A;  2GBM A;  3EFU A;  5EE9 A;  3DVN V;  3JW0 X;  4ANV A;  3NVW A;  2C9W B;  1OEY A;  1SIJ A;  2K1F A;  4HEA 1;  4XZ4 A;  3A33 B;  2LWP A;  1OEY J;  1QZE A;  3NY5 A;  3U2S C;  4M02 A;  4E74 A;  1D5X C;  3Q3N C;  4ASW C;  2BS3 B;  4GSW A;  1K52 A;  1DGJ A;  1QQR A;  3PTF C;  3AE8 B;  3KQ4 A;  1K51 A;  4REZ A;  3TJP A;  1WIA A;  1SJE D;  1QOF A;  4NQL B;  4XYC A;  4MGK E;  4HKQ A;  1LFD A;  2WXR A;  2UWQ A;  1I4X A;  2LGY A;  2ZPY A;  1WM2 A;  4B95 A;  3NS8 A;  2ZCB A;  1ISN A;  3V60 A;  4RGM A;  4W9F A;  2O2V B;  4FN2 A;  1NEN B;  2WXI A;  1GNU A;  1I4G A;  2EEL A;  1DOY A;  1V1P B;  2IGH A;  3NVZ A;  5EE1 A;  4NPN A;  3NVY A;  4RGT A;  4RGN A;  2UYZ B;  2WWZ A;  1V6E A;  4JL9 A;  2G9H D;  2CHW A;  2WNM A;  3PZ8 A;  4MAC A;  3ECI A;  4YSZ B;  3APD A;  5JXV A;  3AEG B;  4AP4 C;  3C0R B;  4TQ0 A;  4W9E A;  1FEH A;  3A9J B;  5D3I B;  1ZE3 D;  1AAR A;  3PRM B;  1F9J A;  3ZDT A;  3DOW A;  1YX5 B;  4LNK A;  1DOI A;  1TKG A;  4B0M A;  2KMM A;  2W55 A;  3N20 C;  3BWU D;  2AX5 A;  1E90 A;  2BW2 A;  2OHF A;  2NS5 A;  3B1L X;  4ICV A;  5I4D A;  3R2I A;  2PIA A;  3PPA A;  1K8R B;  1IP9 A;  1R4M I;  1XLP A;  3I3T B;  4MGZ E;  2LFI A;  2H89 B;  1WX8 A;  3TMP B;  3KVF B;  2Y3A A;  1V49 A;  3AE2 B;  3ZYY X;  3N9Y C;  4G50 A;  2I2Y A;  1WX7 A;  4YTM B;  1C4A A;  1N62 A;  5BYQ A;  2KWV B;  2RR9 A;  4IOI E;  1C78 A;  2WDQ B;  2KNB A;  4KVG B;  3CST A;  2WDR B;  1LM8 B;  2KDF B;  4FXC A;  4XX5 A;  4PS7 A;  2WQY B;  3HM6 X;  3Q8F A;  1JWA D;  5IP4 D;  3VQI A;  2XNA C;  2D07 B;  3L17 A;  3W5U B;  1WXA A;  1ZUD 2;  4OVV A;  5C1Z A;  3MFG A;  4DHJ D;  2R2O A;  2L7R A;  4GXB A;  5GMV A;  1KJT A;  2NR2 A;  1ZXH A;  2WP9 B;  2K3U A;  3Q6B A;  2D11 A;  3AH7 A;  3VXW A;  2FNJ B;  3ZUN A;  2DYB A;  5IO9 A;  4HPP A;  1JML A;  3RD2 A;  2H88 B;  2LMC A;  4HKZ E;  1SB3 C;  1PGX A;  4I6N B;  1P3Q U;  4ZRI A;  2WLB A;  4ZHO A;  3SEB A;  1X1M A;  3OWE B;  1WMH B;  1FIQ A;  2RD0 A;  2MP2 B;  2WXG A;  2GB1 A;  3M95 A;  1Q0W B;  1MJD A;  1WFY A;  3BY4 B;  3MHS D;  3PSE B;  1VR9 A;  3L54 A;  3BZD B;  1B9R A;  1E7V A;  2PVO D;  1QOG A;  2KN4 A;  4MM3 B;  5LXH A;  4KDL B;  3BK2 A;  1FMA D;  1WXS A;  2KC1 A;  1YD8 U;  2RDB C;  1UUP A;  1V8C A;  3JYU A;  1EWC A;  2BS4 B;  3L10 B;  4YTP B;  2BQQ A;  5AZH A;  3VH3 B;  2I1J A;  2MX2 A;  1TKY A;  2JRH A;  2YVC A;  1RWS A;  2BT6 A;  2V3P A;  1R4N B;  1WJ4 A;  5LXI B;  1Q1O A;  2L05 A;  4RFB A;  2PE6 B;  1SE4 A;  4FAD A;  4HLE A;  2BYT A;  3RNB C;  1G6J A;  2KD0 A;  2GBK A;  1WY8 A;  3N30 A;  1RRB A;  4HXD A;  4ARC A;  1E0Z A;  1MFW A;  2W9N A;  4C7Z A;  5D94 A;  4AQ7 A;  3APC A;  3ZLZ A;  4US9 A;  2DLB A;  4W9L A;  4AOF A;  2PEA A;  4WUR A;  4LLG M;  3ZXV A;  1LXD A;  2XK5 B;  2C60 A;  1LO5 D;  3TCA A;  2CU1 A;  4XDD A;  1D5M C;  1NI3 A;  2LGX A;  4L23 A;  2KX0 A;  1J7A A;  3P4P B;  1XXG A;  4FBJ B;  2KHW B;  4HVB A;  4W9C A;  1MPE A;  2PJH A;  1GG3 A;  2MJ3 A;  1XLN A;  2N9K A;  1L6U A;  3PV1 A;  5FK9 C;  3DQV A;  2VH2 A;  3WCQ A;  1D5Z C;  2NCN A;  2KFK B;  3PO0 A; 
#chains in the Genus database with same CATH homology
 2BGF A;  2JZ3 B;  5IA7 A;  2FIF A;  2J0K A;  1GUA B;  3RZW C;  2EMS A;  2MCN B;  2JF5 A;  3BIN A;  4GOC A;  3QK0 A;  4TV3 A;  4URK A;  3DVN U;  3QAQ A;  1C3T A;  3B08 A;  4TQ1 A;  4EZK A;  2DZI A;  4JLC A;  1YQB A;  3AU5 A;  2C5L C;  3QQ8 B;  5CX3 A;  1E8X A;  4X57 B;  2ZPN A;  2CHZ A;  2XBB C;  2DYO A;  2K25 A;  3DVG X;  3PGE A;  5C23 A;  4EOY A;  1KM7 A;  1L2N A;  4W9G A;  4HJK A;  2KMC A;  1P9D U;  4HPM B;  3T8M A;  2FCM A;  2O6V B;  1E8Z A;  1YIW A;  3ML9 A;  2BYF A;  2KJR A;  2DAF A;  4KZ0 A;  5JHA A;  2ZJD A;  4KZC A;  1V80 A;  3V6E B;  1CMX B;  4FJV B;  5D6J B;  1UBQ A;  1V9J A;  2JVC A;  4ICU A;  3ZRF A;  1EUV B;  1UGM A;  2LXA A;  3WIM A;  3UQA A;  4HDQ A;  3VHT C;  3VTW A;  2KTR A;  2KTR B;  4WJQ A;  4DDG D;  4DBG A;  4F8C B;  2V4L A;  4MSQ B;  4ZYN A;  3PRE A;  2FCN A;  3UIN B;  2GBJ A;  1I35 A;  4MGY E;  4M8M A;  2HJ8 A;  3IHP C;  3NZS A;  2KC2 A;  3RT3 B;  4KIK B;  4EKU A;  1WF9 A;  1E8W A;  4MJS B;  4MJS A;  3ZRC A;  5KHQ A;  1IYF A;  3QIJ A;  4FJZ A;  2MWS B;  5DCN A;  1WGD A;  1KLV A;  2DX5 B;  1C1Y B;  3A1Q A;  1NI2 A;  3A1Q B;  4HCN B;  1RFA A;  2MW5 A;  4DXA B;  2K6D B;  2LRW A;  5DPS A;  2N4F A;  2O6V D;  2Z0E B;  2AYO B;  3DBH I;  3ZDM C;  2NBV B;  4EUT A;  2QHO A;  1XD3 B;  1Q5W B;  3Q3F A;  3DDC B;  3H7P A;  3H7P B;  3VTU A;  3APF A;  1SGH A;  3PHX B;  4MSM B;  5LLI A;  1UBI A;  4K7U A;  4DWF A;  2V1Y A;  3EC8 A;  5FR6 A;  1JRU A;  3DBS A;  5KHO A;  1EF5 A;  2M8S A;  3KUD B;  1V2Y A;  4W9K A;  2L0F A;  1UZX B;  1V5T A;  2CR5 A;  3WAO A;  1ZW7 A;  1KOT A;  4G3X B;  4ANX A;  3ZW3 A;  2G45 B;  3X23 A;  1I42 A;  2D3G A;  4ZRJ A;  4ANU A;  1WR1 A;  4AJW A;  3KUZ A;  5JHB A;  1Z2M A;  4P7I A;  4B9K A;  2G4D B;  3AXC A;  2LVP A;  1WE7 A;  4ANW A;  3DBR I;  1WJN A;  2IO1 B;  1WYW B;  2MA9 B;  3RUI B;  2JUO A;  2Z0D B;  4EZJ A;  2C7N B;  1LQB A;  5E6N A;  4OVU A;  4W9D A;  2IY1 B;  1WJU A;  2KDE B;  4WJO A;  2IBI B;  1UEL A;  1OGW A;  3QC8 B;  2D2Q A;  1A5R A;  2LVO A;  4GDL A;  4GDL B;  2GBM A;  3EFU A;  4KSK C;  4IW0 A;  4EEW A;  2BPS A;  3WAP A;  3GOE A;  2WDT B;  3DVN V;  2KK8 A;  3QJZ A;  3JW0 X;  1WGR A;  2A5U A;  2CKH B;  2JXX A;  4KDI C;  4ANV A;  2C9W B;  5E6P A;  1OEY A;  5AEK B;  5EDS A;  4EZL A;  5L83 A;  2K1F A;  3NHE B;  3JVZ X;  4GIV A;  5E6O A;  3VUW A;  3TIX A;  4XZ4 A;  3V6C B;  3A33 B;  4FJY A;  2LWP A;  1OEY J;  5CTR C;  1QZE A;  3NY5 A;  4MEM A;  1WGH A;  2ZCC A;  4M0W B;  4E74 A;  3K9P B;  4ASW C;  4NJ7 A;  3L08 A;  4GSW A;  3DPD A;  3X0W A;  2IO2 B;  4MEL A;  3EHV A;  2M1M A;  1TBE A;  2KQ7 A;  2M17 A;  3PTF C;  2MSE D;  1WZ0 A;  2G3Q B;  3ZVV A;  4RMA A;  3TJP A;  2LI5 A;  2AL3 A;  1WIA A;  4NQL B;  3UF8 A;  2I1K A;  3RUL A;  4DHZ E;  4MDK E;  4MGK E;  1LFD A;  3ZNH B;  4DK5 A;  2L0T A;  2UWQ A;  4K7W A;  2LGY A;  3ENE A;  1ZGU B;  2ZPY A;  1WM2 A;  2KZR A;  4B95 A;  3NS8 A;  2L76 A;  2ZCB A;  1ISN A;  5AZG A;  3ZNZ B;  4RM9 A;  3V60 A;  2L00 B;  4BKT A;  1XQQ A;  3KUC B;  2BKF A;  4RM8 A;  2O2V A;  2O2V B;  4W9F A;  3ZTD A;  2FID A;  3HK0 A;  1P0R A;  2AEH A;  3AUL A;  3IG3 A;  4FN2 A;  1GNU A;  4G0N B;  2LZ6 A;  2NVU I;  2KX3 A;  2NBU A;  2BYV E;  4BOZ B;  4NPN A;  4XC2 A;  1J19 A;  2DHZ A;  3A4S C;  5JZE B;  2FCQ A;  1H4R A;  1V81 A;  1V6E A;  2NPT A;  2NPT B;  2UYZ B;  2WWZ A;  4JL9 A;  4J6I A;  1TZ1 A;  3W1Y A;  2FCS A;  5D2M B;  2CHW A;  2MBQ A;  4I6L B;  3OAW A;  3ECI A;  2KFJ A;  2MBE A;  3W1S A;  3ML8 A;  2J0J A;  3QA8 A;  4IWO A;  4W9J A;  4MH0 E;  4A20 A;  3APD A;  2R2Q A;  4AP4 C;  2KDB A;  3C0R B;  2LUE A;  4W9E A;  4TQ0 A;  3R66 C;  1WMH A;  2K8C A;  3A9J B;  2N9E B;  2ZVN A;  2MP2 A;  3A9J A;  3IVF A;  2D10 A;  2WX0 A;  3L0W B;  3PHW B;  4GN1 A;  3R7Q A;  1AAR A;  2BKR B;  2DZK A;  1WXM A;  2N7E A;  3PRM B;  4WJN A;  4IM0 A;  1F9J A;  4PYZ A;  3PZD A;  3DOW A;  3ZDT A;  1YX5 B;  2AWT A;  5G2N A;  4AJY B;  3RZF A;  1E8Y A;  3KYD D;  3SU8 X;  1SIF A;  3PLV A;  5J18 A;  1WE6 A;  2ZNV B;  3QCA A;  1VD2 A;  3PRP B;  4K7S A;  1D3Z A;  2WYQ A;  2IO0 B;  4MM3 A;  4W9H A;  1PQS A;  2DYM A;  5D7G A;  2RPQ A;  2RGF A;  4LDT B;  1E90 A;  3PS6 A;  1S3S G;  4LJO B;  2M0X A;  2NS5 A;  2DZM A;  4G11 A;  3VVW B;  2REX A;  2LGD A;  3B1L X;  5L95 C;  1J8C A;  1Z5S B;  4ICV A;  3ZO5 B;  4N9F 4;  3QWZ B;  1U4A A;  2KWU B;  3HHM A;  1SE9 A;  1WRD B;  3PPA A;  2JZZ A;  1M94 A;  4IG7 B;  2ZZP B;  4HWI B;  1K8R B;  3GZN I;  2EKE C;  1IP9 A;  1BT0 A;  3H6N A;  1R4M I;  3M62 B;  3I3T B;  4MGZ E;  2LAS A;  1WX9 A;  3ZNG C;  4MGI E;  4PYU A;  4IUM B;  1WM3 A;  2NBW B;  5TR5 A;  1WX8 A;  2IZV B;  4IWQ A;  3TMP B;  3TBL D;  2J7Q B;  1WXV A;  3KVF B;  4BKS A;  1V49 A;  2PE9 A;  5CHV C;  4NY0 A;  3QAR A;  3LDZ E;  1WGG A;  2KLC A;  4G50 A;  3IBE A;  1R4N I;  2N9X A;  3ALB A;  2JWZ A;  3VUY A;  2ZNV C;  3VAW A;  1WX7 A;  3SD5 A;  4LDT D;  2VRR B;  1WGY A;  3HM3 A;  3PVL A;  1YX6 B;  3ZNI D;  1P1A A;  4GGQ A;  2KWV B;  2JRI B;  1FXT B;  1RLF A;  3VFK A;  2RR9 A;  2KNB A;  1WI0 A;  4DHJ B;  2N1W A;  4KVG B;  3CMM B;  2DZJ A;  3CST A;  2JY6 A;  1UH6 A;  3R7R A;  4JGH B;  2KVR A;  4IM3 A;  5AZF A;  3KW5 B;  2IYD B;  2KTF A;  1LM8 B;  2KDF B;  2L3Z A;  4WWP A;  3VUX A;  4PS3 A;  2KAN A;  3H1U A;  4XX5 A;  1WR6 E;  2DAJ A;  4NQK E;  2HD5 B;  4NAW A;  4NAW B;  1NBF C;  3KH0 A;  4PS7 A;  4NNJ B;  3RYT A;  3HM6 X;  2MBO A;  2WX1 A;  3QHT A;  1ZKH A;  2PPH A;  3D32 A;  5CHW A;  1EO6 A;  1S1Q B;  3M3J A;  3VQI A;  1E5W A;  4WWN A;  2D07 B;  3DCG A;  3L17 A;  3V62 A;  1WXA A;  2MBH A;  3SHQ A;  2LD9 A;  2AL6 A;  5DPW A;  4OVV A;  5C1Z A;  4F1S A;  4DHJ D;  2R2O A;  4E3C A;  3U7D A;  2C7H A;  2L7R A;  4GXB A;  3ZIM A;  5GMV A;  1KJT A;  4BOS C;  2NR2 A;  2KJ6 A;  3U30 A;  3VTV A;  2K8H A;  2D11 A;  2GBN A;  3VXW A;  2FNJ B;  2GBR A;  2KKC A;  3VDZ A;  3ZUN A;  4BKG A;  2DYB A;  1WJ6 A;  4GMV A;  4WAA A;  3AI5 A;  3N3K B;  3PLU A;  1RAX A;  2MRP A;  4TUU A;  3RD2 A;  3N32 A;  2J0M A;  4A3P A;  1OQY A;  2A4Z A;  5DPT A;  3P2B A;  4FHK A;  3S2A A;  2IO3 B;  2KDI A;  4BBN F;  3UGB B;  4II2 B;  4KV2 A;  3UIP B;  1E7U A;  3DVG Y;  4I6N B;  4IC7 B;  3WAL A;  1P3Q U;  4ZRI A;  2RSU A;  2BYE A;  2EMT A;  3OLM D;  4CHK A;  2XEW A;  1EF1 A;  3UIO B;  3ONS A;  4FLH A;  2FAZ A;  1J0G A;  1X1M A;  4AWJ A;  3M63 B;  1WMH B;  2RD0 A;  3H7S A;  2O6V A;  4CYE A;  2MP2 B;  3IFW B;  3H9D A;  3M95 A;  4KSL C;  4HK2 A;  1Q0W B;  1WFY A;  3A9K A;  3A9K B;  3BY4 B;  3MHS D;  3PSE B;  4ZDV A;  3L54 A;  2MBB B;  1TGZ B;  1WH3 A;  4A3O A;  2M4N A;  1TTN A;  2C7M B;  5IAA C;  5JH5 C;  3TL5 A;  4CO7 A;  2Z59 B;  1E7V A;  5DPR A;  3CSF A;  1GC7 A;  4PS8 A;  5LXH A;  4KDL B;  5J17 A;  1WXS A;  3RCZ A;  2ZVO A;  2KC1 A;  4LCD E;  1YD8 U;  3UQB A;  1YJ1 A;  3WAN A;  2LVQ A;  3K9O B;  4YL8 A;  4E71 A;  1XT9 B;  4GU2 A;  4BBN C;  1H8C A;  3L13 A;  4NJ6 A;  4WWO A;  3JYU A;  2OOB B;  4KIK A;  4IWP A;  2FUH B;  3AU4 A;  3OJ4 B;  1GC6 A;  2BF8 B;  3L10 B;  2KQS A;  2MQJ A;  3W1S C;  1GJZ A;  2LRU A;  1T0Y A;  3OJ3 A;  5AZH A;  3VH3 B;  2JPH A;  4M8N A;  2I1J A;  5J2R A;  3PT2 B;  3WA0 A;  3V61 A;  2MX2 A;  2JRH A;  2MLB A;  2YVC A;  2BWE S;  4HCP B;  1WJ4 A;  2Y5B B;  4W9I A;  3O65 B;  4TKN A;  3U8Z A;  5LXI B;  1MG8 A;  2KMA A;  3Q3J A;  4K1R B;  4AUQ C;  1L7Y A;  4B6W A;  4BFR A;  1VCB A;  4WJP A;  1Q1O A;  4BVU C;  2L05 A;  2G4S A;  2N9P C;  3LJ3 A;  2KJH B;  3A4R A;  1Y8R C;  4IM2 A;  2PE6 B;  4FAD A;  2ZEQ A;  4HLE A;  4GDK B;  4GDK A;  3NZU A;  2JT4 B;  2KLG A;  2N1V A;  4HDO A;  2K8B A;  2KD0 A;  2LXC A;  4II3 B;  1G6J A;  4LJP B;  3ZTC A;  2GBK A;  1WY8 A;  2GOW A;  3CF6 E;  3N30 A;  4DDI D;  1RRB A;  4FHJ A;  4FUL A;  4GB9 A;  4HXD A;  3B0A A;  2OJR A;  2W9N A;  3EEC A;  5HKH A;  5CHF A;  3T9L A;  4HPL B;  2K6Q A;  2N7D A;  4DHZ B;  2LJ5 A;  5D94 A;  2KXJ A;  3JSV A;  3JSV B;  2B3A A;  3MTN B;  4K81 A;  3L16 A;  3APC A;  3NOB A;  3ZLZ A;  4AOF A;  4W9L A;  4FA6 A;  2PEA A;  1HE8 A;  2HE7 A;  1LXD A;  2XK5 A;  2XK5 B;  2C60 A;  2KN5 A;  1P98 A;  3WAM A;  4BKS D;  2HTH A;  3TCA A;  3MJW A;  2KOX A;  4JIO U;  2CU1 A;  2YLM A;  4JQW C;  2LGX A;  2ASQ A;  2KX0 A;  3VH4 B;  2KWC A;  3SDL C;  2GMI C;  4FBJ B;  4WQO B;  1UD7 A;  2KHW B;  3QX1 A;  4EFO A;  4HVB A;  4ZRK A;  4W9C A;  1V86 A;  3R3M A;  4I6P A;  2PJH A;  3ZKJ C;  1GG3 A;  3KYC D;  2DEN B;  3DBL I;  1OTR B;  5G55 A;  1V5O A;  2K39 A;  4F7Z A;  3PRZ A;  3PV1 A;  3DQV A;  1WZ3 A;  2CHX A;  2CS4 A;  1IPG A;  1NDD A;  2BWF A;  2IY0 B;  3HIZ A;  2L8J A;  2V3S A;  5BO4 B;  2NCN A;  2KFK B;  2KFK A;  2KO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...