2BFBB

Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
329
structure length
329
Chain Sequence
EYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
publication title A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 128
structure length 329
sequence length 329
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bfbB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bfbB01
1X7WA 5IMSA 2YICA 4GPEA 2G28A 1X80A 4MZXA 3EXIB 2FWNA 3LPLA 1W88A 3F6BX 4KXXA 4QELA 1UMDB 3EXG2 1U5BB 2IEAA 2Q5JA 1BFDA 5HGXA 3LQ1A 5AHKA 5ESDA 3F6EX 3DVAB 1UMBB 3AHDA 2NXWA 1PVDA 1OLSA 3FZNA 1X7YB 1Z8NA 1TKAA 5ERXA 3EXEB 3EXHA 1N0HA 1PO7A 2WVHA 3AHFA 4K9MA 2VK8A 2J9FB 2BEVA 4JU8A 5I5GA 2C3OA 3AHGA 5EJ5A 5EXDA 1WCIB 1NI4A 2C3UA 3UK1A 1POWA 4C7XA 4K9QA 4JUFA 3FLMA 2OZLB 2UZ1A 1YNOA 5DGTA 5EJ9A 3LQ2A 2BFCA 3IAFA 4GM0A 1QPBA 1X80B 3MOSA 3DUFA 1W88B 3RIMA 2Y0PA 5EJMA 1UPCA 2C3YA 2R5NA 2VBGA 1Q6ZA 3M7IA 3EYAA 1V1RA 2AG1A 2DJIA 1T9DA 1PI3A 1OLSB 2Q5LA 4GM1A 1V11B 3ZHSA 2C42A 2R8PA 5K6RA 1T9CA 2JI7A 5DGDA 3OOYA 3EXHC 2BFEA 1X7ZA 4KXVA 2JGDA 4COKA 1ITZA 2BEVB 1MCZA 4D5EA 5I5EA 1AY0A 2XTAA 3KOMA 1RP7A 2WVAA 5EJ4A 3HWX1 4GP9A 2VK1A 3LQ4A 2VBIA 2UZ1B 5I4IA 1V16B 2BEUB 4MPPA 2FN3A 5EJ6A 2PGOA 1UMCA 5EJ7A 3HWWA 2JLAA 2BFBA 2C3PA 4XEUA 1ZPDA 4KGDA 1T9BA 5HHTA 3IAEA 2JIBA 3M49A 2O1XA 3AHCA 1V1RB 1V5GA 2IHUA 3EXG1 3AHEA 2Q28A 1TKCA 3OE1A 5FEMA 1W85B 3L84A 2BFEB 4JU9A 1X7ZB 2UZAA 3ZHUA 3EXFA 1QS0A 4QQ8A 2IHVA 1X7WB 2BP7A 2JI9A 2BEWA 2JLCA 4K9OA 3AI7A 1DTWA 4QPZA 1UMCB 2BFBB 3EXIA 2R8OA 3AHJA 1UMDA 1V5EA 1U5BA 2BFDA 4GG1A 3AHHA 4JUCA 2Q5OA 2W93A 4ZP1A 4Q9DA 4RJJA 3EXHB 4JUBA 2WVGA 2C3MA 3EXEA 1JSCA 4WBXC 4KXWA 2JI6A 1OLXA 5ERYA 2EZ8A 4RJIA 3M34A 4FEEA 5K3SA 1YBHA 3EXFB 1NI4B 2XT6A 2IHTA 1QS0B 3HYLA 2VBFA 4D5GA 3D7KA 2EZ9A 4KXYA 1UPAA 4C7VA 3ZHVA 1OZGA 2BFCB 4RJKA 2BP7B 2G25A 2BEWB 2X7JA 3AHIA 4GM4A 1DTWB 3DUFB 2YIDA 2BFFA 1X7XA 1OLUA 4FEGA 5EJ8A 3EA4A 4K9KA 1QGDA 4KXUA 2PGNA 5DEIA 2BFDB 3E9YA 2QTAA 5EJAA 3JU3A 4K9NA 5I51A 3DV0A 4K9LA 1V1MA 2C31A 1YHYA 3ZHQA 5HYVA 2AG0A 4MPRA 1V11A 3FSJX 2JGDB 1UPBA 1Y9DA 2XT9A 1L8AA 1PYDA 2V3WA 1OLXB 5K6TA 2EZTA 1NGSA 4JUDX 5C4IA 2O1SA 3EY9A 3ZHRA 1UM9A 2QTCA 2JI8A 1YHZA 2EZ4A 5K2OA 1IK6A 1V16A 2BEUA 4MPJA 1POXA 3ZHTA 2VJYA 1R9JA 1OZHA 1YI1A 4MQ5A 2BFFB 1GPUA 1X7XB 4K9PA 2PDAA 1OLUB 3DVAA 4JUAA 1UMBA 1V5FA 1B0PA 3UPTA 1X7YA 2EZUA 1YD7A 2Q5QA 1KEKA 1YI0A 2E6KA 2Q27A 3DV0B 2J9FA 1V1MB 1TKBA 3M6LA 1OZFA 2PANA 5EXEA 2G67A 1W85A 2Q29A 1WCIA 2VK4A 1T9AA 2OZLA 1UM9B 1TRKA 5HJEA 1OVMA 4JD5A
chains in the Genus database with same CATH superfamily
1OX5A 1XTZA 2QRJA 3R5XA 4UNNA 5B3AA 3UAXA 2P9YA 3D6TB 5BN1A 4IJUA 4Q9JA 4CMGA 4O4HB 2AK3A 3CUEF 2DETA 1IQRA 4C87A 2YZ7A 3CCFA 3LVRE 3QLVC 5EIXA 3PENA 1C7EA 1P91A 2B0CA 2CBXA 2QB5A 1ZDMA 3K0CA 4NMLA 1HE8B 3VHRA 2QYOA 4R7ZA 4PC1A 1S8AA 1TK3A 2RG1A 2ROQA 2W6JD 1A9OA 1XTRA 1YONA 3UATA 1V26A 3COWA 2PMWB 1DPGA 3A4TA 4C1BA 2Y99A 4W5QA 3E82A 1VJTA 1KU6A 4RDXA 3D8UA 3LIIA 4PYKA 1FP7A 1BFDA 4RMGA 1FS4A 4CW7A 1NVAA 4FYPA 4ALNA 1MC5A 2BMWA 2HIMA 1IHOA 2PIDA 2WG1A 3TD9A 1FTYA 3NWOA 2X8LA 2C58A 2XOXA 1Z4JA 1HRDA 1PVDA 5JSZB 1E8MA 4O33A 4F97A 1DIOB 1X7YB 2H11A 1P0CA 2HXSA 1P31A 3L0OA 3PD1A 5DM0A 4FN4A 1L7VC 5CXXA 1P1CA 1I5OA 4J3FA 2X7XA 3WIOA 2ZAIA 5A2QA 2SHKA 1UUFA 5C1PA 2XD4A 4DR3B 2YHIA 3NHMA 2D1QA 4AYXA 1J2JA 1QTQA 4WD3A 5KWEA 4ZYVA 5COBA 4RTSA 1H9AA 4LPKA 3ZUPA 1LU9A 5JATA 2P67A 2VKTA 5KTSA 1SKYB 4M0MA 4O2RA 3SYMA 1I9CA 2H06A 1I10A 4D9IA 2ID8A 5JNVA 3CZAA 1Q19A 1RM0A 1BCRB 2XTMA 3GAAA 4YAJA 2CF5A 3GCXA 5B7PA 3U56A 2AEMA 1TM4E 4X1KB 5BN5B 5JG7A 3M70A 4K9QA 4NFYA 2D0DA 5JVDA 4N0EA 4NABA 4ZAVA 1XQ6A 2FSFA 1NXXA 1SVKA 3R6WA 3P9KA 4IWYA 5AXDA 3SE0A 4BN5A 4JP8A 5H1YA 1NN1A 3OF2A 4RETA 4AQDA 1JVNA 1XVUA 2OL4A 3A37A 1FJ2A 5CB4F 2IDMA 4AJ1A 2NNLD 1SEVA 3KPUA 2O3QA 2HV8A 3AUYA 4I66A 1GPDG 1XK6A 4URWR 4J4HA 4IICA 1QQ6A 3WL5A 2FPSA 5DNDA 2WJYA 3K0CC 3D4LA 1X1BA 4IO0A 4PLYA 3Q9NA 1YVUA 2FEPA 3MGBA 3IT1A 3WQBA 2XEDA 2F8MA 4FKMA 5EJMA 2I67A 1QKIA 1GKIA 2Y67A 4XB2A 4Z4IA 1MR3F 1QHNA 5FWDA 3RUPA 3P96A 4PEVA 2QLLA 4KPFC 2FDCA 1GAXA 2OCYC 3SQXA 1MVNA 1U7WA 1ISJA 3IUEA 2FKNA 2BJHA 1KH3A 5KYXB 5CX4A 4D9GA 1HLPA 1TIBA 4BNHA 5LB4A 4D7AA 1PV2A 1JBEA 2F9FA 2VPZA 3QKIA 4DG8A 1YQXA 5JD4A 5JNLA 2P3QA 3FNIA 5C5DA 4KR9A 1OPXA 3NVDA 3E1SA 5K9ZA 4HDCA 2CNNA 3B1XA 5EIEA 1Z2EA 1WUKS 1A5BB 1HNXB 5KAPA 5LR6A 4Q16A 1TT5A 1YBVA 1VQ1A 4UATA 3FCAA 1DKQA 2WD7A 3W1VA 5K0SA 2YOFA 2VQSA 1ML3A 4IDDA 2NV2B 3C7DB 4LRUA 4TROA 5K7SA 4PO8A 1E62A 1JHOA 2J5RA 2M6SA 1AY0A 3A4IA 3DO6A 3HCPA 3UK7A 1T5LA 2PKEA 3CNNA 5HF5A 4FT4A 1GTRA 5AWFC 1N6LA 1FQKA 5CFQA 1Q2UA 3QBEA 4NCAA 1ZGCA 2GPNA 4FZJA 5DNCA 1XQXA 2Y4NA 1JG7A 1OZ0A 4MV9A 3T38A 6YASA 4EFNA 3SC4A 4K87A 4GXQA 4MGIR 4QRDA 5GWXA 3RJ5A 2HMWA 3VRHA 1H66A 2AW3A 3X2SA 1V2HE 1SCQA 1UBJS 1TM7E 1UK7A 3EZ2A 4NZMA 4EUEA 2G5GX 2E5LB 4US0R 2FJUA 1S02A 3GC6A 1Z3IX 4WESB 4TL9A 5HE8A 4D0GA 1SXGA 2AG5A 3BD8A 3URKA 5ISMA 1XWFA 4E32A 4ILEA 5KS2A 1SU6A 2ZU0C 3JD3A 3J7AC 1Q11A 1Y5MA 2IYYA 4EARA 2YWFA 4DRXB 5KOIA 2GSWA 2Q5IA 3HRKA 1E2JA 4LC0A 4M1SA 5EESA 4AY3A 1C7IA 1CNEA 1W75A 2OP1A 3OT1A 4KX5A 4NATA 4R8VA 4AJ2A 5EHXA 4KGDA 5E3JA 2WR8A 1XROA 2G04A 1T2VA 2ZS9A 4MNTA 4AKSA 3LW8A 1DAHA 4MI9A 1L4NA 5AJHA 2ZWAA 1WCYA 2N0SA 1FBNA 3C43A 2WHPA 3DTVD 5ICEA 3C4QA 1KJZA 4BN4A 1L5SA 5JNTA 2I91A 3QUTA 5ECGC 1E32A 1QYIA 4WNAB 4YJFB 1T9GS 3QW4B 2Y1WA 4Y9UA 4RTQA 4ZT3A 1CUEA 1Z37A 3H8VA 1SXQA 3IOEA 3PGVA 1LF5A 2C9DA 3EZFA 3EZ9A 2W6ZA 4HWTA 4Q4HB 5C8VA 3ADCA 3NVMB 5LN1A 4GZ3A 3PFNA 4PIVA 4DLVA 4LGVA 1U2PA 1YR3A 4QPCA 3B60A 4FFOA 4HXYA 3RSOA 2Q9CA 2Q28A 1NT2A 3H11B 1B2RA 1ORWA 3SHOA 1B16A 4FMBB 4M1TA 2UYQA 3P7MA 2HJHA 5AOVA 1SOUA 3KSRA 3OE4A 1KA9H 4Y6OA 2AD5A 2PZEA 1EINA 3SYRA 1QYXA 2P2YA 4FZ5A 2Q4EA 3L8DA 2HA3A 4JBXA 1LI7A 1ZM4A 5BSUA 3JWEA 5CIYA 1LSJA 3DF7A 5CPBA 1W19A 3WGIA 2HRBA 2Y93A 3WWYA 3O83A 4WJLA 1WULS 3BILA 3JYOA 2DWPA 1QP0A 1VYHA 2Q6IA 5C8YA 2I2XB 3EAQA 3PVSA 2G8NA 2YMMA 1ELOA 3TM5A 1CJMA 1DOAA 2WMOB 4C03A 3VO2A 1RWKA 1XMXA 4WY8A 4S05A 5HKLA 3KLPX 4JJFA 4JFAA 5T5QA 2R7LA 3LXXA 4G5HA 1NG9A 4AS1A 3TDNA 2QZZA 3D4BA 1R2QA 3DULA 4LYHA 1R8SA 4RTMA 3OZWA 4BMVA 3FIJA 1OAKA 1CERA 2PV7A 4IG9A 4J7CA 1RWVA 3ACBA 2QRZA 5CCDA 4RHEA 2QTHA 1XNJA 5JV5A 2R11A 2ZRAA 3LE8A 2ZIZA 3DL7A 5JMWA 2K7FA 4PGAA 1N6RA 3OUUA 1DWQA 4RZ3A 5IJ0A 3PKJA 3M2TA 4KLRA 4PNHA 1CUAA 2BMVA 2EFCB 3MJ4A 3QZUA 4GHWA 4HC4A 4FSHA 5JNRA 1RRVA 3PQ4A 3QKRB 1VECA 2AN9A 1F8FA 2QUKA 3NS7A 3QXXA 3SIRA 4CT0A 5GADl 4HRVA 4UAUA 3DBOB 4AF7A 4IJ5A 2PS0A 4L57A 3ZJ4A 5LDHA 2WJZB 5JH7B 1TEVA 2ZYIA 3H4TA 1FFXA 3NHKA 3VSDA 3R5SA 2V5VA 1UKEA 3MM4A 4H7JA 4KBGA 4ZP1A 3U0BA 2RMKA 3HCAA 3I9V1 1ZOOA 3OLWA 3MMNA 1PJ4A 4R4JA 3UJNA 1BEZA 2QY6A 1IL0A 2XGOA 5DPMA 3CWQA 3F73A 1Y1RA 3A1NA 1N57A 3K4HA 3TLBA 2X58A 3GUVA 1S7GA 1DU4A 2D00A 1AO0A 2QG9A 4F5DA 4MAMA 3JAWA 4NK5A 4CV3A 1PR0A 2R5WA 3JQGA 4FFNA 3EIQA 5MFPA 4M36A 4E03A 1LCIA 4NEHB 3OFND 5FTMA 1SHUX 5I8PA 4RJIA 3A1UA 3M34A 3BGDA 4TMFA 5AW3A 4E7OA 3OU6A 3R44A 4ZV4A 1WXWA 4DIFA 2I29A 4DUPA 4L5JA 2OP0A 1RM4A 1F20A 1TNDA 3MCTA 2LKCA 3NNNA 4LCJA 4QTTB 4C14A 2J0SA 2NZXA 1IY1A 4RD2A 5A5GA 1XF9A 3QBJA 3BRSA 1R4NA 1AUXA 3BB1A 2YOGA 4IHJB 4OHZA 2CL6X 5HM8A 1H22A 4OXRA 4ZI7F 2DTDA 5JYDA 2OLEA 3CSDA 4ZQFA 3UMBA 2VP5A 4LE0A 1NLYA 1QTRA 5JE8A 1N5RA 1RZUA 1UDXA 1HDYA 3SKYA 4DN6A 3KD3A 3UCFA 2V54A 3AEUA 1D1PA 1W49A 1XC7A 2MSKA 5DK6A 1XVVA 2QP4A 3R7WA 3W78A 4XD7A 5IDXA 2H4WA 2F3SA 1AV7A 1NX6A 1A7UA 2WF6A 3JYPA 4GMXA 1DJPA 1L8XA 2VDJA 5U4QA 3GFFA 4DAEA 2R8ZA 5LFAA 4RZSA 3AHIA 1X2EA 1QANA 5UKDA 2IPMA 3E35A 2R7NA 4TLLB 1P3Y1 2EJUA 1G42A 4OXQA 1VI2A 3BRWD 1USKA 3BJMA 2V9PA 1SOWA 4JGIA 1A5SB 4WCDA 4XX1A 4CLXA 4ESEA 1DCFA 4RVSA 4TYWA 4XZ3A 3QUCA 3NQ41 2JH3A 1FTWA 3WLRA 4GF5A 3N0VA 2BBSA 2F1HA 3OD5A 1N2IA 1WB6A 4J2HA 5G0VA 2ZTVA 4H3KB 3GLIB 4FFBA 1SWVA 2GCPA 2QTAA 5AM1A 3KT6A 3CRNA 1N0VC 2RAFA 4OATA 3OLCX 2PO7A 1CHDA 2CFRA 3GCZA 5EZSA 1IBMB 4H08A 1EA7A 3MAJA 1QYVA 4R9NA 1FC0A 2O5VA 2ZBFA 3HVHA 3KR2A 3MJTA 3C6XA 3K35A 1MA0A 2FG7C 1Y9DA 3CKKA 4JJEA 2OR3A 1C8KA 5TGDA 2R2GA 4EGQA 4KR7A 1L8AA 2ZE6A 5DHTA 1PYDA 2IDKA 4QOSA 3R7NA 4ZHSA 2X5JO 3NM6B 4QTZA 2G4LA 4LJ7A 4FYIA 3P32A 3CR7A 4X5OA 3PFHA 3VJMA 1UWKA 2H1WA 4B35A 4RS4A 2IODA 1QWSA 3N2GB 1ZU4A 3NC4A 4O6VA 2HSJA 2W6PA 4LHXA 5TF4A 4BP3A 3UHAA 4I3FA 5CH3A 3AOGA 3M6VA 1B0UA 3TMAA 1K3TA 1EB8A 1I36A 5DLYA 3U4MA 1A95A 1M6HA 2GEFA 3HEAA 4DABA 4QWWA 1QU3A 1M2OB 2QI9F 2ZE7A 3QPDA 5AJZA 2UUOA 3D1LA 3LBIA 5K20A 2KLHA 5LYJF 2ETVA 5CUQA 4D80A 1PT7A 2B8TA 2YVKA 1I3NA 1U28A 1Z68A 2RHGB 3WZ2A 1LGYA 1Z5PA 4HXEB 4F2PA 2PUWA 5K5EA 2P5YA 4Q1DA 4L75A 2AKYA 1DVRA 1PGPA 3OZGA 2BZ0A 2OHIA 4G85A 3ZLTA 4ZTUB 5B3LA 1ZIYA 3A1CA 3GEDA 1CY2A 2HHHB 3MMXA 1HURA 4DY4A 5EUQB 1JH9A 4ARIA 1L5GB 1XQ9A 1PR6A 4XGKA 4CG2A 1AUPA 1M0EA 1JQAA 1BOFA 3KQPA 4WFJA 3T0GA 4L95C 3Q3IA 4P35A 2YBEA 1Z0UA 5KTOA 1ZNZA 3IX7A 3WKBA 3QLUA 5IHXA 1UK9A 5WRFA 2QR5A 3QJYA 3RG2A 3OIWA 5ECDA 3QMMA 1XRLA 4DA9A 4IINA 1EDEA 4KVFA 4NYJR 4JUAA 4TMZA 1NASA 3H2JA 2II6A 1S3GA 4ETWA 2VDVE 3DOEA 3HE3A 4WFKA 5EL0A 1ZAKA 2GHRA 4LJKA 3NHPA 1TK9A 3PGJA 3CONA 3CKMA 1NIPA 5HIIA 1RYEA 1N0WA 2CK3A 4L51A 4ZVVA 4CQJA 5JZBA 4R05A 3LDHA 2MR6A 2I6SA 1GA1A 5CR9A 3ZWKA 2A9PA 3DDUA 1D2RA 1FPMA 1TYDE 4D8YA 1U04A 1V1MB 3OHMA 3LHSA 1Z2OX 4AZTA 5CCXA 1XALA 4REQA 3HJNA 3N0RA 2YKGA 3ROFA 4JCCA 1TDJA 3I01A 4YAWA 4MRPA 3AR9A 3NFRA 4LWPA 3P4XA 1I0LA 1PR5A 2XB6A 3R4CA 1NBIA 1ODJA 1XVAA 5FH9A 1DRVA 1XTTA 2DWCA 4KGXA 1P5HA 2VP9A 4LRTB 4Y2QA 2FFJA 2WT4A 1P1JA 3KOWA 1L3CA 4JSRA 4QFMA 2X8JA 4B3SB 3S2YA 4BQSA 1H23A 2CNWD 2ZPTX 4WNIA 1ZGHA 1FYXA 5BORA 3MJDA 3P0EA 4IEIA 3RYHA 2ZCUA 2XXAA 1MJGM 3ELUA 3MINA 2C4UA 2QXTA 3REQB 2H1VA 3DHNA 1XB2A 4X6UA 1ZESA 3ZVRA 4JITA 5IU6A 4KQIA 2GJKA 4WXPA 2AUTA 4WZBE 1A4RA 1W581 3HKCB 3EVNA 3L4EA 1X8KA 2MYPA 5KVVA 3ZLBA 2EYUA 3AXTA 2HA5A 4FBGA 4WDQA 3U7FB 5TARA 3OZTA 3UYKA 1U28C 1X3LA 2DR3A 2ZSFA 3NYQA 2H2GA 5FUBA 2QKYA 1K7CA 3ODPA 3OQIB 4GUAA 1EVIA 2RBGA 1GKYA 3AW9A 4QRHA 1QK3A 1E1LA 4OBEA 4YEDA 1LLDA 3I5AA 4BY9E 5BSWA 3OJ0A 2P7IA 4WLOA 1NA5A 3PPWA 4ODIA 1Z0DA 1Z0JA 4KEAA 4W8OA 3EC7A 3VNAA 4F4FA 2R86A 3FB1A 4DRYA 3PUVA 3M6FA 1G1MA 4KXXA 2W98A 2UUBB 5F21A 5JAIA 1FVXA 4CQLA 1W6UA 3JVDA 5T4HA 4EI9A 5HW0A 9LDBA 1CY4A 3BXEA 2VNHA 4RDCA 4WOBA 1NX9A 3QLUC 3LQ1A 4RADA 5TR9A 2AN4A 3D6FA 3IMGA 1QDLB 2PNFA 4IOJA 3PCXA 3MJVA 3DDHA 4MRMB 4YAEA 5P21A 4DLBA 5A9SA 4QNMA 4OLFA 2CFIA 2AS0A 3LFTA 4QGAA 3NT2A 5D85A 3WGMA 1ORTA 2QZPA 3BZUA 1DIAA 3FZGA 3ROTA 1E4VA 1N4DA 3QF4A 2UKDA 4BDTA 5DN9A 1T4GA 4M9QA 5D5PA 4AN0A 2VPTA 4HH1A 3CTMA 2WEKA 5FO0A 1YJQA 3FMPB 2QTFA 4EFDA 1LNZA 1L1EA 1WUTA 5DVZA 1DXYA 1VL2A 2EW2A 2VK8A 5TMBA 4FYYA 3VDQA 4PX9A 1I6WA 2JGEA 1X77A 2WF5A 3I73A 1B76A 3QE3A 1DC6A 3O0TA 1QFZA 2JEZA 1E9RA 3A6GA 3BGSA 2P9QA 4FDMA 3LCMA 1C1DA 2VTVA 3AO0B 4IDPA 2BR3A 3TD2A 3T7SA 4HFNA 4FDUA 3DZIA 3ICQB 1ZM7A 1T4DA 2ZBEA 4N48A 2W83A 4M49A 4AZ0B 2NU9A 5IAEA 1E9EA 1BVRA 4LRSB 1T6ZA 4KN5A 4BRUA 2NOAA 5I7UA 1QGUA 3INYA 2VYCA 4JDPA 2XWPA 4EVIA 3L0SA 5JS1A 1KZYC 1W34A 2FLVA 2NO6A 4FCTA 4N47A 4A1OA 3FPJA 3K70B 2L42A 5CURA 5BSEA 2C8LA 1KPHA 3IAHA 1YF3A 3SZ3A 2CKMA 3PDHA 2G9NA 2QTVA 1MOZA 3L6CA 5FBQB 2BFCA 3ETHA 5E2IA 2VQ6A 4N0MA 3O8DA 4QEDA 3L01A 3AI1A 1OBCA 3NOXA 5DHQA 2ZT8A 3E9EA 2CHFA 3FVRA 4XGIA 4OQYA 4FKBA 4CUZA 5FX2A 3MOSA 1UPUA 1BNCA 3S44A 5JEDA 2W2TA 2BCJQ 2XT0A 4PS1A 4B3GA 2ODWA 2YY7A 4JVSB 5LQKA 3TPZA 4TWIA 2P77A 4D4IA 3MF4A 3KSBC 2ZJ0A 1PQUA 2VJOA 2OWEA 1EZ1A 1KQ3A 3LQYA 4F9GA 1SC1A 3SF8B 3GJTA 5HE9A 3WLEA 5A06A 1IY8A 2Z4RA 3OEED 3QUSA 5LQJA 5LQMA 3QXGA 4R5HA 3TMKA 5FULA 3STTA 2AXNA 2OG1A 4UHEA 3CE9A 4CNQA 4L72A 5GGXA 1QPZA 1GSHA 1T9DA 3DXYA 4MEJA 4RF5A 5DTIA 4YP7A 1MFPA 2Q5LA 4UU7A 3O8OA 1EFRA 2O50A 4GBMA 1YS4A 4O2BB 2O2XA 4FINA 4P4NA 3UMCA 4DV4B 1V11B 1U0RA 2WZBA 1Q15A 3E27A 3O8BA 4IOLA 1I1QB 3TEMA 4ZKEA 1N6OA 3QFSA 1T9CA 4FNMA 1X7GA 3AV3A 5M3BA 3T5MA 3SVZA 5IC6A 3L1UA 1OIVA 3NHLA 4Y2XA 2EJCA 4P93A 4Q4AB 2H63A 5KPDA 3H16A 5EHQA 2YJZA 2GYUA 5C18A 1CE8A 4LTDA 1WKBA 2C4TA 5CJPA 1NYRA 3ESDA 5TRTA 5A1TA 1S2DA 4Z1MD 3P9NA 3ZZMA 3IDSA 2PJUA 3GQBB 3H42B 3JQBC 4BV9A 3WAGA 5LXTA 2V6FA 1RP7A 3LY7A 1WUHS 3NUGA 5DWDA 2XQJA 3BXZA 2H07A 3FKSD 4MYCA 2P0AA 2O8BA 1KAGA 2PL9A 3G2NA 3QE0A 4R98A 1XCLA 4YDHB 1MEEA 1IVNA 4RGQA 4QFDA 3DE7X 4H7KA 2JVKA 4YBZA 3ZCSA 5A3RA 2UV8A 4RFSB 1NSTA 1CY0A 2BEUB 2WTXA 3EF3A 4HEQA 4W8HA 5FPHA 1Y3FE 2XOKA 2EJWA 2W6IA 4B3JA 4OFWA 3R7DA 2P9TA 3WHIA 3AJDA 3WLLA 4B1FA 2ACVA 2QW1A 3FMOB 2GBCA 4V0RA 4BQQA 3ZVNA 1VPVA 2H1FA 1CS4C 2QYSA 4UDYX 1Y8CA 1K9SA 2JJQA 4UHHA 1ZD2P 3ZV6A 3TLGA 1OBFO 4EHDA 2V0GA 4DLUA 4GIBA 3CB2A 3MTAA 2WM2A 5L4SA 1P8AA 2ZB7A 1E5TA 1FX0A 3JAKB 2CEKA 4ZYYA 1L5KA 3L46A 5HSGA 4BFYA 2AMYA 3HBMA 1JHPA 5A4MS 4RANA 1BKDR 5EIHA 5C8XA 5EGSA 5C53B 1S1CA 3IXQA 4ALKA 4AS3A 3L4SO 3VOBA 2XEXA 4N01A 4DCMA 5HZMA 2AI2A 5IZCA 4L15A 2FPUA 2J6IA 4CMIA 3L4JA 2GAOA 4JLPA 1JG2A 3R20A 2PKWA 2ZYVX 1PQPA 3KKOA 4K8OA 5FBHA 1V6CA 4N7RA 2IHUA 1YR7A 3R8CA 1BDJA 2V45A 1PHPA 4NE2A 4ROSA 2GYVA 2J3LA 1T91A 5TT1A 5ADWA 1TYBE 4DLRA 2QRLA 4MH0R 4HX9A 3KQWA 1JEYA 1JQJC 5AI0A 1XK7A 1GO2A 3OT5A 3VZRA 3NDBB 3IAAA 1KI7A 3ND5A 3FM9A 3UAOA 4B6FA 3EEIA 2Q5HA 2VP6A 3BC1A 3GY0A 3WK4A 1YKSA 4FOTA 5D5HA 4ER3A 4PYLA 5J5CA 4G24A 4HVTA 1VFPA 3ANMA 1TAGA 5E38A 4B3DA 4C0KA 1JMYA 1XEXA 4D8XA 2AZXA 3HBJA 1Y3HA 5IAGA 3D3JA 3U09A 5ENVA 1W9MA 2C2ZA 4O5OA 2FEMA 3BN3A 1G21A 4C4YA 1HL3A 3JQFA 1CJSA 3JCZA 3C3BA 4FEAA 1S2IA 1FXSA 2XUFA 1GCOA 1E9FA 4FEYA 5EE9A 3U7RA 4CM9D 4KXLA 5KX5B 2ZYTX 2UZ0A 4JR2A 3S7ZA 3P2JA 1EXVA 1Y8RB 1GARA 2IHJA 3O8RA 1F4LA 1P2BA 5U1PA 2VL7A 1RC0A 1W46A 4KLAA 5FL7A 3TTVA 1N2CE 3H2IA 3PRYA 1QGOA 3ZWCA 2HTFA 1R9MA 2VXBA 5FTJA 3C3YA 3JD4A 5ALJA 1ZXXA 4YAGA 3L6BA 3V32A 3NFYA 3CLSD 4YP9A 2I62A 2IK8A 1ZVJA 3PPIA 5FWXA 3NIGB 2H9IA 3P97A 1MV5A 3FZEA 3QE4A 4O4IF 3WRYC 5AVZA 1MABB 4K46A 5KJEA 3BGVA 3C8MA 3OE7D 1HTWA 4INPA 2J08A 3PHLA 4B3HA 2ZXUA 3WYDA 4J7AA 3H5AA 5HUHA 2J9XB 1EJ2A 1P77A 1Q1BA 3L7BA 1G8GA 4IGIA 3RTAA 2BHTA 5C8DA 4K81B 4OJQA 3UH1A 1UFKA 2Q4BA 3OZIA 1RRMA 3AK4A 3GDOA 4BV2A 2ZKIA 3I76A 2P9BA 3EGEA 4MV3A 3RVLA 1X86B 3VKHA 4LVUA 3AHHA 3O8NA 4JUCA 1NQOA 2K2WA 4TTIA 1BTOA 1PFVA 3GT4A 4PO9A 3AU8A 1PL7A 1U94A 3DOJA 4ZMBA 3HK2A 3RAGA 2ORVA 1T8UA 2EHJA 2HNKA 3E0XA 1USIA 4P0PB 1OVGA 3C8HA 5E4YA 3VPHA 3OM0A 4HADA 3LQFA 3VAAA 2ZRKA 4KRGA 4MWSA 3KETA 4Y9SA 2NADA 4MRNA 2NM0A 3JQ6A 4LJ6A 1KJYA 4JASB 4MKGA 4P54A 2NSJA 4R1MA 5DOVA 5LWQA 5FNVB 4PZDA 1DC5A 2QPOA 1U8TA 3FYHA 3GI1A 1NTOA 4BLSA 5K45A 4GE0A 2GHTA 3TX2A 3EODA 4IP0A 5KU1A 1S2GA 1ODFA 2DWOA 5DI3A 1NKTA 1Q1AA 4N8SA 3SGLA 3EXFB 1IZ8A 1F6BA 4L4RA 1NI4B 4C01A 4DAOA 4F7DA 2C9YA 1R0WA 4TPKA 1SBNE 2A1IA 3ETLA 3KXDA 3USES 1NBMA 1YHNA 1Y9JA 1L5YA 3DBHB 4GP7A 2R6CA 2IQ5A 3AERB 3JQFC 1AMOA 4DWVA 2DQZA 7AT1A 3N0WA 1KO5A 1MC4A 1FPQA 1XCPA 4BBZA 5JROA 1W30A 5H9VA 1WMDA 1ZCBA 4H1HA 4N3BA 5EIBC 2GEVA 2RGBA 5DP1A 3TJRA 2LV8A 1B74A 1J7KA 2C5SA 2AV6A 2JFNA 1X9IA 2P75A 1PG5A 3AGPA 3QW2A 1SC6A 4N6NA 1FDSA 5H0IA 3KO8A 3QKWA 5IKMA 4ZOEA 2JLUA 3LLVA 3VI4B 4KE7A 1XZQA 1NL3A 1NBHA 4AXBA 1YIOA 5C4GB 1YB6A 3RVSA 3TVDA 1Y5NA 2Y6UA 3GPIA 1TFUA 4KGVA 1CP3A 1K0UA 4P4UA 5D87A 4ZCLA 3G68A 3ZY3A 1AM4D 1XD9A 2ZWVA 4EY6A 2Q62A 3HZZA 1MZVA 1Q7GA 1OA0A 1U6IA 2JCBA 2IA5A 3TLAA 1T2CA 3HWSA 1DG1G 3C0KA 3L43A 4IRUB 2QL5A 4C7OA 4TT8A 1HQYE 1T8WA 1V3QE 4N5DA 4YH1A 3COPA 4BLOA 4NE7A 4BEJA 2J33A 1PQWA 3FJOA 5DEIA 4RQAA 3CO0S 1IIRA 3INTA 3E9YA 1C1XA 3COYA 4EQ6A 1GGEA 2AQKA 3TBHA 1RNLA 4R0VA 4B7AA 2HGZA 4Y7CA 4HAYA 3S8EA 2OV3A 3DV0A 1NQXA 3RVRA 1Z28A 2GLUA 2PUBA 5DNWA 1ZCZA 2D1YA 2P30A 3WP1B 3ZHQA 1LK7A 3KTOA 4NP6A 4JHXA 3RK0A 1D5CA 1YFJA 3VR4D 4D6PA 4YCJA 3TQRA 2BUCA 1DT3A 2PE5A 2C4NA 3RJTA 3PUIA 5DBGA 3ELWA 3X1ZA 1BMDA 3H1AA 2VCHA 3WDLA 1GDTA 3H2YA 5FV7A 2IOFK 1KJ9A 4HGQA 1YJBA 1YI8A 2WC1A 5F5LA 1YZTA 2BFWA 2H31A 3USCS 4E2WA 4FXOA 1BVYF 4GSYA 3Q6IA 3BDIA 5DYWA 2HHCA 1KR2A 1V96A 3D8BA 2WTMA 5TDHA 1DV2A 1XDGA 1E18A 4L2IB 4MXDA 1VBFA 5EIFA 3VVLA 2GTIA 1VLZA 1DUVG 4N5NA 3WGHA 2CFCA 5TS3A 3JYHA 1QU2A 1HKUA 3B78A 3RVPA 3PDUA 1XNHA 4BJ5A 4EO4A 5F2NA 2VYVD 1QNFA 4JOBA 3SNHA 4Z4HA 2XWSA 2MCFA 1FNMA 3TQCA 1ZUD1 4CMJA 3GIDA 2HZBA 4ZV9A 5JYEA 2XUJA 4Z8XA 2FAXA 3HYSA 3K16A 1TYZA 1S8OA 4TSRA 1U8ZA 3LL7A 1KU0A 2YN2A 1XPJA 1POXA 1H2BA 1UBRS 2WFLB 3I53A 4QYWA 1IZ9A 1YV9A 3W9BA 4QOHA 2IYRA 2JHGA 3OJWA 4WCFB 1YFLA 3KT3A 3T3HA 2IYTA 3OEYA 4MUNA 3HI6A 2C1ZA 2Q8NA 3NZEA 1QZXA 4MKZA 4R68A 1I6KA 1GITA 2BFFB 3CQ9A 4QU9A 9LDTA 3STXA 3LS2A 4FOOA 1BX1A 1OLUB 4NJEA 5C1DA 5CDUA 1T3SA 3OJEA 1N2JA 2YDYA 4GECA 4I9UA 3JVUA 2PKRA 5JQGB 2Y4OA 3OLXA 1NRXA 4UD2A 1OXSC 3VA7A 1B23P 3WHKA 3GCGA 3ZWWA 2IV7A 3CISA 4A6DA 1WVIA 1ZD1A 2BOVA 3OA0A 3C3CA 2XVAA 3WICA 4C4SA 5LB2A 4E5UA 3T4UA 3OC6A 1TECE 5D00A 1YBFA 5CT5A 1E94E 2PX4A 3Q3VA 3Q87B 4IXDA 3DDOA 2X0JA 3DTYA 2ZKLA 4S35A 3O1JC 1QF6A 1GL6A 4Z4CA 4RK0A 2MINB 1KEZA 1B2LA 1FOEB 1U3VA 1Z4MA 2V6GA 2FW6A 1VSVA 2HJ9A 4GLFA 4I1VA 5T4BA 3A70A 3LX5A 3OZRA 1C9YA 3QWFA 3WWEA 2Z2IA 3C3XA 4IOMA 4P80A 4OXKA 1W4LA 3LYAA 3D0QA 4G63A 4L8LA 1AQLA 2ZB2A 1L4UA 1P7PA 1VP3A 3V8MA 3DZCA 1YQQA 5L3ZA 5KTNA 4W6QA 2QTMA 2H2AA 3HH8A 3EGXB 4BMNA 1Q7BA 5F5NA 3EQ7A 1TA9A 4X61A 4AO6A 4UZFA 2G63A 2A1TS 1N2GA 4C6TA 3EGDA 1O4VA 4GNKA 4W1SA 3K1AA 4ZALA 4QGSA 1X1AA 4M21A 5G1OA 1E3DA 5A03A 2OCIA 1W73A 2Z5VA 4PC2A 4E22A 1C4WA 4LYFA 1HT0A 5JCXA 1XV5A 4J8PA 2LDXA 1HLGA 2D4HA 1VP9A 2MU1A 4MUBA 3G5LA 3QYJA 4ZI7B 1TVEA 2N46A 2Z98A 3GRRA 2YICA 1WZCA 1X6VA 2PR7A 1TPYA 4WXYB 1P2TA 1R1DA 2ZR0A 4KL8S 1UJCA 4EPVA 1RWPA 2WU0A 1X80A 5BQ3A 4EF5A 1B6GA 4B73A 4DLXA 4GYKA 1PLJA 2FWNA 3KV1A 5LDGA 3WYBA 1W88A 2O19A 5AKJA 5B30A 1VGQA 4TWAA 3PQDA 3GZNA 4KDRA 1YT5A 2A1UA 2HA0A 1XZCA 3WDSA 1F3LA 2IZ0A 4HLNA 1U5BB 4YS6A 5HIKA 2ZBGA 3FPBA 3SIXA 4FJ0A 2DCMA 5FHQA 1BA3A 2R47A 4NMMA 1W5SA 3ZH9B 3JYQA 3VPDA 2XCRB 3ECAA 3AHDA 4Q39A 4YJGB 4HRXA 3SJUA 4EELA 2O3TA 4EF4A 2J0UA 4XSVA 5EMNA 2PMKA 5C5IA 4QYMA 3UAWA 2BSXA 5GAJA 3S27A 4X9XA 1CQIB 1FLAA 2AUMA 2PXHA 1ZH4A 3JARA 3WO0A 2FFRA 2TMYA 3FDIA 2LCQA 1VHQA 1XQYA 5M04A 2CDRA 4ZVSA 2OESA 4LK3A 4Y2VA 1J49A 1KGSA 1JZTA 3U3KA 2Z08A 4NENA 4YV7A 3TQTA 3ZW9A 1T2EA 3F47A 2HPAA 3NBUA 5DK4A 1A88A 1TLLA 4IS3A 2ZUFA 2QX9A 3QX3A 3HXKA 2Y1DA 2YWRA 1AQYA 1TVCA 3T1OA 3BCRA 2X5NA 3QSGA 5K99A 2FGKA 2IVZA 4HWRA 3EGOA 5CFZA 1B3RA 1PG0A 2PFKA 5KNCH 4TTRA 2CF6A 2MYUA 5GVRA 5CDSA 1W47A 2V9ZA 3C5CA 3QVXA 3SR0A 3ZCPA 2GEJA 1G20E 2HIAA 2ZSIA 4AQYB 3D3NA 4ARZA 1T5OA 3S1AA 1FLVA 4FX2A 3RQSA 2HO5A 4BX3A 3V8VA 1GNRA 1XMQB 1Q0QA 1KYYA 3DMYA 1BRTA 1QR6A 2CVFA 2PJDA 3KHTA 5L53A 1TQ4A 1IOWA 5K3CA 2B9VA 3OZFA 4OY3A 4TLEA 3OU7A 1RQRA 4FNGA 5IASA 2R0QC 1UEIA 3ND7A 3UT5A 1L4HA 1O94D 4RE5A 3SQNA 4X65B 4U2GA 3L6EA 3ET5A 5LYJB 1VBNA 5DDIP 4HB0A 1H2RS 4KFSA 1J0DA 3HN2A 2VVTA 2ZJ8A 2EKQA 4DM3A 5BNIA 4Y30A 3NTOA 2WHYA 2XB4A 1EVLA 1VJDA 3GGGA 3NGLA 1U0FA 2C57A 3H6GA 3Q8WA 5DTMA 4JLSA 2XAUA 3BMOA 2B7LA 1CQPA 4GMHA 4IGKA 2Q6LA 2W48A 4V2IA 5FOSA 3TSOA 4Z4QA 4GKVA 2FOXA 2OBYA 1RLMA 2XIJA 4DPKA 4RWEA 1HDZA 4YWHA 4QEKA 3H5NA 2F55A 1PUJA 3V4FA 3KB8A 2PYZA 4ZIRA 5CLJA 2KBEA 4CCSA 2F90A 3ZV4A 5JHHB 1Y4DE 4CETA 4QT0A 1OXBB 2QAGA 2R44A 3FPAA 2RB4A 3B6JA 2D2VA 3H6KA 3ID6C 5IBPA 1OV4A 1Y7PA 4ARUA 4CDNA 4JODA 2F3TA 1Q7RA 2DJIA 4K1XA 5K51A 6LDHA 4EJ2A 1C3VA 2YYZA 2B69A 5KJ6A 3G2HA 2DH5A 4F12A 1R6TA 3VNSA 1RYHA 4EGCB 1VSBA 2DRIA 2P68A 2R1VB 2I7XA 2PLNA 2IPOA 3OMLA 3FUUA 3I5XA 2CLCX 4ITUA 4BCDA 4G25A 4NMHA 4ECEA 3DVQX 3P4UA 5F78A 4AT1A 1K92A 3CJRA 3L8GA 4QL3A 3MUEA 3TFOA 4A36A 2YWXA 2FQXA 3UXEA 3E1KA 3MD9A 3SMVA 3ZN2A 1G2PA 4G37A 3R9IA 3RS7A 4EI7A 2RGDA 1G7RA 3IS3A 4GE3A 1R6DA 3BREA 3TQFA 2WICA 2GVDC 2EL7A 3K9WA 4FYXA 4BL5A 4GC5A 2ZI7A 5JVDF 3I1JA 4HQFA 1S96A 1X1EA 4R3UC 4BNTA 3LHFA 3A4NA 3GR6A 2H4YA 1WQ3A 3KOMA 1P1KA 4ENUA 1LTKA 1VKZA 2A9KA 2GFHA 2VDNB 2VTEA 3NEPX 4G9BA 4HN9A 5ALPA 5BQPA 3S0JA 1M7HA 1EFDN 1Z6ZA 3OOEA 4RQBA 4ALJA 7YASA 5J47A 1VMKA 3NHUA 4LHVA 1U8UA 4KO2S 4TXHA 4N0PA 1E3MA 7MHTA 2JAXA 5TPWB 2LKDA 3KWFA 5FKJA 2B4RO 3PWZA 2OSBA 5JJ5A 5FI5A 4OB8A 1CQJB 3T06B 3M1YA 5CHYA 5T6BA 2VAMA 1Z63A 1IEQA 4P32A 3TRJA 3EG5A 3WQHA 2P3SA 1XPOA 2Q0QA 4E51A 3KS9A 3S1LA 1CUGA 5AI6A 4HTFB 1AA9A 4ICIA 1G8FA 2DPHA 4YCLA 4PRYA 5EJ7A 4QXPA 3M6IA 2AXPA 1RACA 2DUWA 3OM1A 4IQ4A 1QVZA 4ZOAA 4UCXA 3UV6A 1M10A 2ZRQA 4TTAA 5A5VA 2OGSA 2WW8A 1NPYA 3I37X 3PJGA 1EM8A 2R6FA 2QRKA 4HNSA 4OLAA 2W4QA 3LUBA 4DQLA 3O3NB 3NHZA 4JH0A 3EZXA 2CJWA 4YXWA 4MLDA 1R6BX 3M4NA 3CF2A 2FQYA 3QXSA 1GNSA 2IUYA 1BMTA 1Y5IA 3AMVA 3DOFA 3O4FA 1FDUA 4NVRA 4ZRNA 1GG2A 4ZJZA 4ZO9A 2IE0A 2O0HA 2XMZA 2ZDGA 2BR5A 2XMBA 1F8XA 5D3KA 2OWDA 3M49A 4UEJA 5AM3A 5IRCD 4W5OA 2C98A 5BW6B 3VNVA 1UBUS 2VDLB 2V58A 4L5CA 1SUEA 2WMYA 4PE5B 1VRCA 3GLFB 3PB3A 5FOQA 1NMEA 3EXG1 3FHLA 1TJ4A 3HA3A 2V7VA 2GXUA 3Q8KA 1KYZA 1M6WA 1TKCA 2IKQA 3DM5A 4UUBA 1DJQA 4UM8B 1TEZA 2I66A 2BHNA 4R2HA 3O8CA 3DXZA 1W85B 4INJA 3V1TC 3PX7A 1T8RA 5FYDA 4NMWA 1Z8DA 3ZD6A 3GGOA 1NOJA 3CVOA 3VGPA 1TGVA 2XX3A 3HVIA 4WZBB 4S0ZA 4QDKA 3LFHA 2ZYUX 5KKNB 4DSUA 5K0FA 5MGBA 4P5DA 3SPXA 3WGUA 4P0QB 1JTFA 3RLFA 1ORDA 3N3AC 1U9IA 1XMJA 3EGWA 3ND8A 3PA8A 4HNGA 5C9ZA 2PRSA 2ZCVA 3A36A 1ZM2A 4PYNA 4UBJA 1P60A 5BYBA 4EF6A 1MJGA 5IVHA 1U0TA 2O8EB 1YO6A 2BKXA 2J31A 5I8ZA 5HG0A 5JLAA 1YCFA 2PK3A 4EIWA 4XE5A 4OEHA 1MB0A 4A8TA 4RHFA 4LDJA 1HO3A 1YB7A 1T0PA 2CE7A 3HU5A 1IZ0A 4ZVUA 3ZE9A 5EHIA 5AUOB 4LE2A 2ZSBA 3C5HA 5EEGA 4C0LA 4WZZA 1FVOA 2YWHA 4Z9AA 3ZNPA 2HWWA 5CDFA 2XYVA 3HJHA 1O9BA 5C34B 3R6LA 3R6DA 3AI7A 4QDXA 4ER7A 3ST7A 4JV5B 4ZVQA 1YB1A 3HDTA 3BL8A 1V48A 1ENOA 1F2VA 5TPZD 4IEEA 4O02B 2OAQ1 5AVVA 2GD1O 5HVNA 1GZ5A 1WAMA 3LECA 1LFDB 5FO1A 5KO2A 2ZIAA 1F6WA 1GQSA 1R6UA 1RKXA 3CVJA 3Q9SA 3W06A 4EA6A 2CNLA 2Z4SA 4RL6A 3SJ7A 3PGMA 4DM4A 3H83A 4OUKX 1RI4A 3VPFA 2ZE8A 4I1PA 2FV8A 4Y8VA 5BSGA 2QR3A 4C5CA 3L3BA 3R3SA 4CG1A 1SCNE 3GWZA 3IVRA 1CS0A 5KNLA 4RA9B 1AZWA 3LC1O 1ZVKA 4D8TA 1CG6A 4FYMA 4AMGA 3FRJA 5DCUA 1E2LA 3ZCVA 4RJJA 4ZK2A 4P22A 3FCCA 1D1SA 2P9HA 4GQAA 3H3XA 3EH1A 1PJ3A 4QJ3A 5GZ3A 3G2MA 1EZ4A 3UJ7A 4YRKA 4XRRA 2ECQA 3C7CB 3KHUA 4IDGA 3T94A 2JI6A 1LVHA 3I0ZA 3OEWA 4HD8A 5MHTA 5ERYA 5C8YF 5JRJA 5B2ZA 3DBRB 4LVOA 4ENWA 1T6YA 4EBBA 5EPOA 1R5NA 1RJ9A 1BN6A 3AP2A 2OXFA 1CY8A 1PLKA 3IV7A 4R8LA 1KSHA 4YALA 2OFWA 3KAPA 5B4UA 1FRQA 4XUCA 3O3CA 4BJHB 3THYA 4AD8A 4IXTA 2WJVA 3D7KA 1U9IC 4IOKA 1A9ZA 3H4IA 4ZA2A 3ONVA 1K89A 3BXXA 1LEHA 8ATCA 2H9AA 1ODKA 3RC8A 3M5DA 4UXJA 3IULA 4HRAA 4NXMB 4QPNA 1W0CA 2K87A 3C4JA 3ICOA 4AB1A 2I9PA 3EVBA 3UT0A 2DERA 4W5NA 1ZRSA 1N9ZA 3LOQA 4JYMA 1YC5A 2ZSKA 1G8KA 4BQEA 3JQ8B 4FI3C 4TWRA 4MB6A 5CVDA 2J0QA 1O08A 4QLAA 3RS9A 2VPWA 2X5OA 3WB9A 3MTQA 5EIOA 1RE1A 4KE6A 2QPAA 2E4UA 4TGLA 5G53C 3TEJA 4BVHA 2QM7A 3B6IA 4I9GA 4FSDA 4PR0A 4E3ZA 3GVIA 3WLPA 2OM6A 3ASVA 4IF4A 3U4AA 1PN3A 2B36A 1FB5A 3OCCA 4AJJA 3QEAZ 1UF9A 4TSKA 1NJFA 2XNDA 2Z57A 1CD5A 4MUGA 2NU8B 2J07A 2WABA 2G71A 3ABZA 3QMWA 5AOBA 3ZEAA 1TC2A 4KPGA 2GKOA 3G7SA 2K4MA 1PLLA 3ILXA 4II7A 1LRKA 3T1NA 2QT1A 1IRIA 2ZATA 4MQMA 1AE1A 2DH6A 1EGMB 5CYFA 3EQ6A 2VSOA 3MWJA 3KXPA 4IXMA 4BE9A 4EPWA 4L16A 4XWGA 4BMPB 4DJEC 3C6QA 1ECBA 1Z36A 2HBQA 3DAPA 1BGWA 4JQCA 4K9LA 1GZUA 4L3WA 1DAEA 3WI7A 4NFLA 1Y1SA 4UOEA 3FVWA 1DZIA 2P11A 2OMEA 1ND6A 3N8DA 3QWAA 4F3TA 2YS7A 2V8OA 5BUSA 1JDBC 5DM4A 5AM0A 3NIBA 2JCYA 4EY7A 4YCCA 1GAWA 2B4AA 1LW7A 1RXSA 3U40A 1DC7A 3I58A 3B89A 2XGJA 5E9WA 1GOTA 3U4QB 4I8DA 2CLLB 4D0NA 1SG6A 1YIDA 2OCPA 4GPD1 4WZAA 5DGIA 4JB3A 1L7EA 5COAA 4G2NA 3BMQA 5M5BA 5EJGA 1J09A 2Q3CA 4M1QA 3TLJA 2CHQA 2O5EA 1Z2AA 1NBWB 1U6KA 2BFNA 4RD1A 4RIGA 3PSHA 1K4KA 2QTCA 2H8KA 1QAQA 1RRFA 5A4FS 5JJCA 1UQRA 3MRSA 5E6UB 3FNFA 4AI6A 1MC1A 4H6XA 3G2IA 2C2HA 2JFXA 2QYHA 3MAAC 5HJ7A 3TLEA 1XVTA 1ISFA 3DD1A 1G98A 4OAQA 4F1WA 1NJ1A 5ITZA 4ZO7A 5HF8A 2ZJ1A 3S2UA 4YRQA 2J7PD 3RI3A 1KL7A 1B43A 2JHCA 2EAUA 4Y18A 4QDJA 1U7ZA 3FE2A 4J29A 3SXUB 1ZNYA 3HLTA 2Y3IA 3OOSA 1P75A 3VGJA 1J5PA 1TF2A 2D7JA 3BK2A 2IH5A 1NJ6A 1H5NA 4GOJA 4Y2SA 2JA1A 3PFCA 5DRTA 4OA8A 4XJSA 4E5MA 4EB6B 4R9RA 1TW3A 3O2JA 3CRVA 3P9SA 1A77A 4O4IB 5ILQA 5ANRB 2XQFA 1VJ5A 1BE0A 1LXCA 2O7QA 4HDOB 2DTXA 3ZBQA 4CKXA 1S2MA 1LDBA 2PSFA 1LDMA 3ZHBA 3U61B 3NAQA 1YDFA 2Z8ZA 3R9WA 4BLWA 1GYPA 3E9QA 4J1TA 5A1JA 4QG3A 2LW7A 4WH0A 5LSAA 5DTJA 3DPSA 3LHDA 4UU0A 2B4YA 1ZK4A 3QVGA 5D6OA 4ZC8A 3ZZUA 1DV1A 1GAEO 2EZUA 1GPYA 3TCKA 1WPXA 2Q5QA 3NASA 5GZ1A 3BMCA 2XOEA 1A9QA 4DQUA 5FOVA 2XMQA 3IE2A 4DLSA 2BBWA 4P4TA 2POQX 1AKQA 1UXOA 2JLBA 3GEBA 4WKBA 4D74A 3TQHA 3UOAB 1LX7A 1H6AA 2R6DA 2J9FA 4NU6A 1KFJB 4Q7MB 4RVGA 4TQUS 3T12A 4EKNB 4AROA 1SH7A 1YZHA 1VMIA 4J0FA 2Y1GA 3VH4A 2BKVA 1OYVA 2MSEB 1XZLA 3BA6A 2I71A 3DT8A 3N8HA 1AGPA 4OPMA 5IS2A 2ID7A 2C97A 2ZRCA 4XD2A 1ADJA 9ATCA 3KXLA 4WVFA 5FYQA 1KGDA 4L27A 2QRVB 1NAHA 2QX8A 3ESYA 3A1EA 4LVNA 5CIQA 1SGWA 2G6BA 1KDPA 5FBKA 2WG0A 1N2CB 4LSZA 3T5PA 1GDDA 4YQZA 4DV0B 3RHTA 3ABSB 2W6CX 2V97A 4BV8A 4C4PA 4C6RA 7MDHA 4C4AA 2XMSA 1FU8A 1LY1A 1NHGA 1Z2PX 4NJMA 3HC7A 3IA2A 4HAXA 4INZA 3LDAA 4U9IS 1XLVA 3SX0A 3T9CA 2WAMA 4BE7B 5HQ3B 1WBBA 1RQ2A 1L0BA 3NTXA 4KV7A 1MP0A 1OB2A 4L9SA 1GPH1 1JQDA 4QHSA 4B6PA 4BLPA 3L6OO 4BYMA 2BSAA 2GPWA 2I8CA 2VDMB 3A1WA 5I7HA 4RK6A 3SSOA 5JPCA 2ABWA 3UFXA 4DJDC 4QBFA 4O2AA 3VR5A 1H5UA 2HKIA 1V8BA 1E9SA 1QVAA 3MLEA 3R3VA 4JR0A 1CR0A 4I9FA 2FSUA 4HRYA 4Y1GA 4U2BA 5ULLA 3ZDQA 4DMLA 1SQFA 1MORA 2AG6A 3AUKA 1EGAA 3SI7A 4G0VA 3R7LA 2ANCA 2NO1A 4RESA 1C1YA 4X7PA 2Q7DA 3FDFA 1DCKA 1REQA 2B61A 1DKLA 3FETA 3IURA 3MBKA 3MVEA 3NCHA 3NT5A 2PZGA 3LLSA 1UMDB 4HHEA 1WXFA 2CMKA 1US8B 2ZTHA 1CXZA 4IIGA 3ZU2A 1ZNWA 4LYDA 1O57A 5ESDA 5E8RA 1C3EA 2V3VA 2VJQA 1Y3DE 1XI2A 2RJOA 3GEPA 2OC9A 3JWGA 3QUBA 4LOHA 4Q3KA 1PZGA 4BAUA 3TG8A 1RHUA 1Y8ZA 5FPKA 1AN9A 5LBIA 1CB7A 4J1TC 2HI0A 3OJXA 5AHXA 2NVUA 1GTG1 3KOUA 2G6TA 4RS3A 3U3DA 1OH6A 3L0YA 2BISA 1G8MA 2BWJA 2Q1YA 4RH3A 3NR2A 5A5DA 5E9JA 5ERXA 4D98A 1YKFA 3VHXA 5KVCA 2QVBA 3W5HA 4E21A 3LVBA 3QEMA 4NFHA 2YR0A 4LHEA 3SX4A 1Z39A 4AULA 5BMVA 5B58C 3H3FA 4L22A 4PAQA 4O0MA 1QH8B 2ZIXA 1P3JA 5NULA 1Z6PA 3NU1A 5IF3A 2GGSA 1Y98A 1TUGA 1Z9BA 4QUEA 2AFHE 2VP0A 1IE3A 3BZWA 3M9WA 4E5YA 1QO0D 3KIPA 6PFKA 2V6IA 3AIKA 4M53A 1SG0A 4BZWA 5CCEA 4YMTA 1ZVQA 1DZ3A 4CIDA 3QXCA 3OZAA 5K2MA 3TQSA 5EE1A 2R6HA 1TA4A 3L9XA 3IALA 4MKXA 1QYCA 4XOUA 5DHSA 2GZAA 2IS4A 2I65A 6REQB 4CEIB 4ID3A 1TCAA 2NPIA 1NVBA 2XLCA 4MW5A 1B6RA 3AEQB 5JBQA 2O2GA 2OZLB 2CNKA 3I5YA 1WZ2A 1EVKA 1KTIA 4PHCA 4YV0A 4O4JB 3WA6A 4YRBA 1VA5A 5I7EA 1AMUA 3X1DA 4A7PA 3AV0B 3DEZA 1OUMA 1X3SA 1HXHA 5A4KA 1YMUA 4IDHA 1NE7A 3FN4A 3H97A 1VG0B 4YIHA 3R3HA 3AW8A 4PYOA 1JDJA 1FCJA 5IJ9A 3FFWA 4QFCA 5CJJA 4ZPJA 1CUHA 2TSYB 5I7WA 4B44A 5ALZA 1PW7A 2O8FB 1G2OA 4LY6A 4DXAA 1BDMA 3RSZA 2HDHA 1JIJA 2J5QA 4EW3A 4KMSA 1L4EA 4KQEA 4EH1A 2B1GA 1UT5A 3KNZA 4HWGA 5HF6A 1UPXA 2J9ZB 2KYRA 1DBIA 3LH5A 3OZUA 4KGZA 3C5EA 4L7VA 2WJ6A 2ZBQA 3CY6A 4WEOA 1VL6A 1B15A 4MDFA 3MWKA 1DTEA 2YRFA 2I2DA 2OBBA 1CUYA 1FFHA 2JIZA 3D3QA 2KJQA 4UULA 3AGQA 2DAPA 5FI1B 1FK8A 4BEWA 2HV9A 4R8KA 2HPHA 1VMDA 4P82A 4R2WA 5DLDA 2XMGA 1U2DC 4GM1A 5IBQA 3N7TA 3BEOA 3TRHA 4A03A 5A0TA 3L6DA 3EISA 3KJXA 1C2YA 4CIAA 5EHNA 3C8ZA 1NXPA 4KXVA 2YY6A 2YVLA 4COKA 4CKCB 1NT4A 2ZB8A 2BEVB 4EYOA 3CNHA 4YO7A 5AR1A 4IMRA 1BQEA 5JSFA 3QOWA 4L3VA 1DARA 3NV7A 3INGA 4MJ7A 1K66A 2VYNA 3ZDYB 1B8NA 3ITDA 2VC2B 3QITA 2FN8A 3PR3A 2L17A 4RGBA 4S04A 3P4YA 3PS9A 2J9RA 1PX0A 1P5ZB 2YV2A 3C6BA 2VF7A 3RGGA 1NW8A 1NXVA 3GFOA 3O82A 4B34A 1WLSA 4NCBA 2PN1A 4KH1A 3DLTA 3F8WA 1JHVA 1XTBA 2VH2A 4QOFA 2QNIA 3W5JA 3SK0A 1KZ4A 2XGGA 4G97A 5J1TB 2FN3A 2X2PA 1UZMA 4LIPD 1NSFA 1GU7A 4L0QA 4N5LA 3KQQA 3VU3A 2OCXA 3GRPA 4IMPA 1T0JB 2IXDA 3HU3A 3HZRA 4R2JA 4HZUA 2IEGA 1E9BA 5CT4A 5L3SA 3BSYA 4M9XA 1KBOA 1SULA 2B98A 2IYWA 3D4PA 3CRZA 4MKFA 4ZVPA 3OBIA 1OH5A 4XEUA 5CNKA 4ZI3A 1IPHA 3DZ8A 4TT3D 5BOSA 2PRYA 1IHDA 4P4LA 3VKVA 3ZU4A 1O4WA 1EWKA 1Y89A 5FAXA 1QE0A 3A1DA 1GT91 4NCKA 3SQLA 1NYQA 1V4NA 3FYUA 3I09A 4F2GA 3DLAA 2ZIEA 3LO5A 4C76A 1YE3A 1EFAA 4IMIB 1OQAA 1PDWA 2MDTA 1V4VA 1LBEA 1XLUA 3NLLA 4RY0A 1C3XA 1WSWA 5DYYA 2XQKA 2I6TA 3QY9A 2QM3A 4YUWA 1AB6A 4CBVA 2I2BA 5D8DA 3HYCA 2OD2A 1RTTA 1SCKA 2P90A 4YT5A 1UEJA 2OBFA 3GOQA 3D8RA 3QELB 1N77A 4QJ5A 1RRPA 3LA8A 1AT1A 3WNQA 2J4DA 4BATA 4YRRA 4HBGA 2VA8A 3IDOA 3G0BA 4FD2A 5AJTA 4LQLA 5JCZA 5JLJA 5BR7A 4D3SA 3GDHA 3LUPA 4JJGA 3E22A 1J5XA 1WNTA 4DMKA 2IYSA 1BEEA 1FL9A 2JLVA 3P5SA 2FEKA 4L4SA 1ONSA 3INRA 4LV6A 4MVJA 5GJBA 3Q2OA 3QJGA 3K09A 4WLFA 1EH5A 1YB4A 3KL4A 3RIYA 2HF2A 5LXTF 2J9GA 3JASB 1LPOA 1ZIOA 3EG9A 4H1TA 3SQMA 2IUUA 1XZDA 4CI0B 3AVQA 3Q6NA 3ZVKA 1EK2A 2QRMA 3THOA 2QD3A 3HMKA 2F3UA 2JFGA 1XTIA 2POCA 4NKRA 2WSSA 4JJZA 2PBLA 2WYIA 3OO0A 3IQWA 4ES6A 1BMFA 2R4UA 3N58A 1ESZA 4MVJG 5TV2A 1RYNA 5JS6A 1JB1A 4HLQB 1SJ9A 4FM9A 4UBOA 2B34A 1NW9B 5EPUA 3RYIA 4KU4A 3GLUA 4NU5A 1D0IA 3C3KA 3K0BA 2D5AA 4MYRA 2XR1A 2LE0A 1G21E 4YPOA 2J5XA 5HOEA 1BVUA 2BDTA 3SNKA 3KAQA 1EI9A 5DE3A 3VBEA 5CDHA 2BE9A 4C0XA 5C46F 3C6KA 2WG2A 3HXPA 2ZR7A 3M4XA 2H08A 4W8GA 4PPNA 3MERA 4BWVA 4GI5A 4BFXA 4URYR 4DKJA 4X24A 3TIIA 1TQ8A 1MAWA 3M33A 1Y4AE 3FIUA 1I01A 4I1RA 1YWGO 4ABYA 1J8FA 1WB9A 1WVMA 4QEZA 4QVIA 2RHMA 4EVRA 1IVYA 1ZINA 5CLQA 2PMEA 2JIOA 4UEQA 3CEHA 4KQWA 4XVQA 3TBKA 5FLXA 2RGGA 2BELA 4GXTA 3FYUC 5CH8A 2JBAA 5J58A 3ZY2A 2HA4A 3VI3B 2H51A 1A8PA 1ZEJA 3JPYA 4Q4JA 4WAUA 3L1JA 1P74A 4MUEA 3GOHA 1RJEA 5ICGA 2GARA 4FJ2A 4NJOA 1HF3A 3BWVA 1I4TD 2OHVA 1F2UB 1WV0A 2HUPA 1V5IA 1KI3A 4MX8A 1NN0A 4XR9A 1QLJA 1T36A 4MPDA 1PW5A 4QECA 4DNXA 5BUZA 5CB8A 1PTKA 3LQKA 3ZGXA 4B6RA 3OIUA 4DIMA 1FLDA 4KUEA 3S2IA 1K5DA 4DUGA 5BSFA 1G20B 3O03A 4Z9FA 5HZKA 5JTUA 5IXSA 5B1SA 2ZULA 3A1SA 3K32A 2CUZA 2HRRA 2IBTA 1XMVA 3RLIA 3WYEA 1QR2A 2CZQA 3P20A 1AGNA 1RAIA 3K09C 2J5BA 2GWHA 2PKQP 4FC7A 1LV8A 2NQTA 4HDSB 1U1EA 2AXEA 1XELA 4H31A 3VZPA 4BNNA 2JLWA 2UDPA 4PSCA 4TUYB 1QYWA 1ISGA 4L5BA 1XXHE 2AN5A 2XDQB 5BSKA 1N75A 4BHTA 2B1QA 1QB8A 1QS0B 2NSLA 1XA0A 3DOOA 5FUQA 1K6EA 1ZYUA 1ZEMA 4QJIA 2QBYB 2R65A 4EKGA 4EG3A 5LLDA 2SICE 2X2FA 3SHQA 2H2IA 3K9HA 3RO7A 3F9IA 3DZFA 4ZHQA 4MDEA 3MUNA 2VXOA 1N5DA 1ZZGA 4LWZA 3CUKA 4GMFA 3LT4A 1FQJA 1MKYA 1NBME 1RWQA 1TK2A 2UZ3A 1XX6A 4UTVA 4MQ4A 1DKUA 2BEWB 3NBQA 1GCIA 1JYEA 3W34A 1Q14A 3L6UA 3MSCA 4UU1A 4TTJA 1Y7TA 4XDZA 5CG1A 1TTPB 1Z18A 2PWPA 3CLTC 3KFLA 1TM2A 1M2HA 1P4AA 4OUDA 3UMSA 3ZG6A 3G88A 1C1HA 1MB3A 1D0SA 2WINI 1IIBA 4FGSA 4IZIA 4PSUA 4I19A 4QX6A 1RCTE 2FX3A 1E9CA 5DGXA 5EQTA 5FP0A 1QZUA 2ZRFA 3EIEA 2YMPA 4HDKB 4IW3B 3TI9A 2HSEA 3D6NB 1LDYA 1NP7A 3T5BA 5K6AC 1N1EA 2D7DA 5SZKB 2QL6A 2JK0A 2PIAA 2HRQA 3U16A 4ZD6A 3HPQA 2ZAMA 1NKSA 2QUBA 4UD6A 1T1IA 2G83A 3SM9A 1G4AE 3A10A 1HEIA 2RKWA 3GLKA 4R0MA 2AHOA 1GGFA 2P9FA 3G2JA 1OD6A 2LNDA 5KWVA 3FTEA 4XFDA 5HZGA 3ISVA 3RU3A 1A98A 1Z2CA 2DPLA 4KYIB 3U3XA 4ATNA 4QQKA 1JDPA 3GJYA 3G8BA 3ITKA 4E5DA 4YROA 4Q9HA 4MPRA 3N70A 3PQCA 5IT9A 3FBWA 5JSYA 1MO5A 1TT5B 1YKGA 1JJVA 2IW3A 1FMTA 2WD7B 4PAWA 4WKNA 3QXJA 5AVKA 3FMIA 1WB4A 5PNTA 4BKQA 2CXRA 3F7TA 3A9UA 1KC1A 4H17A 1O3YA 2A9JA 5DSZA 5TC4A 5DHFA 4H60A 4JUDX 4RW0A 4YCNA 4N3AA 1I1NA 2B2CA 3CLHA 4LRWA 3GFVA 2G70A 3GPCA 5GPBA 3WB2A 2W6NA 5JUWA 3CT4A 1J24A 1M6YA 4NG4A 1C7JA 1XRPA 3PLNA 4JB2A 3F3KA 1ADCA 4JKOA 1BH6A 4WHMA 3MJCA 4TV9A 4E11A 2WWRA 2QZJA 2LGJA 2O2ZA 2P4UA 2I6FA 3WZLA 2VFAA 2UUAB 3HB1A 3R3ZA 4DMUB 4P7KA 2AWOA 2O8DA 4MWBA 3T1HB 3BF7A 4P53A 4NBSA 3TOCA 4BPRA 3U17A 1BIFA 1R4MA 5BWBA 3K05A 5CK4A 5SZJA 1Z38A 3L4KA 4TKVA 3T15A 1JXMA 4G07A 4YI3A 3O2NA 2JAPA 3ULKA 5EVCA 3E7DA 2F64A 5SY6A 1DCTA 1YQGA 1M2EA 1PGOA 3H9BA 4X0EA 4GX1A 4JVOA 3WLHA 4YCBA 3VOAA 2FSIA 2ZYWX 4KIFA 1JGTA 1X7XB 1Z4NA 4K9PA 2PDAA 4EO7A 2H3HA 3ACCA 2X22A 3KZMA 2IXFA 2CLEB 3TS1A 1X9GA 2ISSD 4CFZA 3JQQA 4B80A 3EPJA 4CQNA 1WTCA 1NVGA 1AU9A 3TRFA 3WL3A 5IVKA 4UXHA 1CIJA 3U3ZA 1MVOA 3EJ6A 1GAJA 5HZHA 1YD7A 2HFJA 5G0SA 1U02A 3D6JA 1E2BA 1I4WA 5TS2A 1NW7A 4D81A 4G0UA 1L3BA 3RRNA 3L18A 2Z3ZA 3DONA 3QA9A 3WB1A 1OT3A 3E23A 3OM9A 5J5AA 1AG9A 3SKXA 1XCJA 2CXOA 2WBLC 5IVPA 3GPDG 4CR7A 1CEQA 1K8XB 1TKBA 5F3RA 2P1DA 1JT9A 2C83A 3AFGA 4Q3NA 5AO9A 1BQ4A 1DKPA 4K2HA 5JFTA 1UCFA 2BGLA 2BF4A 5EXEA 3CA8A 3GAMA 2GCEA 5JJKA 1E98A 5JZOA 3COJA 3VKWA 5A4DA 3D4OA 1NMYA 3E18A 3HVRA 1ZUHA 4X71A 3LV8A 4YGYA 1KK1A 1OLOA 2HF8A 3RS2A 4I36A 4ZVNA 1WVGA 3GN2A 1UIMA 4OP3A 4M0FA 4HB3A 3GLHE 3IV9A 3UVEA 2CY0A 1GUFA 3KSZO 4EMSA 4TMXA 1FW6A 5DEOA 3GJ6A 2WJGA 4LX0A 4RTNA 5JALA 3JYLA 2YV4A 4PYRA 4DWOA 4E1BA 4G6ZA 1PJSA 1D2NA 3UOGA 1P9NA 3PQ2A 1JVBA 2YXNA 3BBPA 4BMCA 5AKXA 4DANA 3DMNA 3E7XA 3FOEC 1JYFA 3AONB 3R9XB 4BMXA 1J9EA 10MHA 5LZ2A 1BDHA 2D5BA 5DYNA 4HK4A 3KSDO 1GCAA 2QE6A 4X64B 3OU2A 3DL0A 3KOYA 3AINA 1K86A 3ORHA 3QX9A 4V1CA 1HDXA 4OFZA 1DAIA 2ZI3A 3K9NA 2R6ZA 1VKRA 3MZ0A 2BTEA 1ULTA 4IVPA 2FMKA 3LC7O 5DYGA 1ZW1A 2MSDB 1SQGA 1QHHA 2GZSA 4BIMA 4DA0A 2UXCB 1BXRB 4LYJA 3QUAA 4DLNA 1USVA 1IN8A 4IDQA 2CGEA 2RE8A 1KEEB 1PG2A 4LF9B 2Q5JA 3FOBA 1ULBA 4BECA 2XCSB 1GT6A 1SXJA 2HLHA 4BMOB 3IP9A 1JR3A 1TTQB 3PJEA 4Q1EA 1BYUA 4B6EA 2QJWA 2QMUA 2JASA 3CJQA 4AJLA 4FFRA 1QRDA 3DPIA 4JMLA 3AT1A 1MX9A 2YOHA 2GZ2A 2H29A 1BAPA 1EXNA 1DBSA 1WPQA 4DR5B 3G8CA 4HAVA 1R15A 4OO3A 2ZUDA 4JC0A 1Z6GA 4A82A 1Z73A 2H16A 1CY6A 1W5EA 2CVQA 2JL1A 3ABIA 4GT1A 4UHCA 3ZZTA 1JLRA 3JAWB 2RD2A 3AHFA 4YX9A 2KW5A 4HN2A 2Q46A 1ZR4A 1RJDA 1GAQA 4IQFA 3OP1A 4MSUA 1U0HC 1M2KA 3K8QA 4ZYZA 5JARA 2Z1DA 2OXIA 5KKAA 2DXIA 2E82A 2HGSA 2WF8A 2PSDA 2HBZA 2D3TA 2LDBA 4GOLD 5CVVA 3VU0A 4X8HA 1FX1A 1R4NB 2PVSA 5I9TA 4HLCA 3FMGA 3FHOA 3PQ5A 5AUNB 2VWHA 4R1UA 2ZCJA 1E63A 2ZWMA 4RHTA 1J06A 1ESNA 2ODPA 1A9XA 4KW7A 4YBRA 2MYTA 1PWYE 2P5UA 3NV9A 4W99A 1BMQA 1D9ZA 3GJSA 5TLSA 4X1YB 1JJIA 1HLDA 4LHYA 1WMSA 3B1VA 4D3XA 3V55A 2XBMA 2ZGVA 4IQ0A 4M98A 4P6VF 1TMGE 3CRQA 5FQNA 5DTQA 3EF1A 1XP5A 5E9AA 2BHSA 2DC1A 3A6DA 4HQ6A 5TEVA 1QJ4A 3S81A 1A97A 5AIBA 4DIKA 2OCGA 2ZTMA 1OTHA 4KFCA 2OPHA 3STYA 4M38A 2SKDA 2CSXA 3L7LA 2HBRA 1JPNA 4UDNA 3WK8A 1EA5A 1L5MA 2QLMA 1AHPA 1UP6A 1FTGA 2O23A 4PX5A 2H59A 2YN0A 5FTNA 2X0KA 1JHYA 3AEYA 1ZC3A 1IM8A 3UKJA 1IBLB 1E4YA 2ZIVB 3UICA 3ZNQA 2ADFA 2W43A 4O1HA 2CDCA 4DIUA 4EG4A 2R5NA 1IG0A 1P4JA 1YJ8A 3MLBA 4AY5A 4M8KA 5JDCC 3V5NA 4IYJA 4RF3A 4OI1A 4HBZA 1H0HA 1JR4A 3ZR4B 3TQIA 1F2DA 1TIKA 2WF9A 3CPEA 1SXJC 4NQZA 4R9UC 1K8QA 2PXAA 1SO8A 1XSEA 2WU1A 5DBOA 3NKVA 4EG6A 4R6XA 3GLTA 2UUCB 1VC2A 3RVKA 2SCUA 2HL6A 3H9QA 2XODA 3OEHA 4YMUA 5K05A 3ROPA 5DW3A 3T95A 3T35A 1JHQA 2C94A 3DYVA 5KQMA 4EX6A 2FFHA 3HP7A 1OXTA 3MGKA 2ARKA 4BZQA 3QLTA 1ZG3A 2OQ2A 4CNBA 2ICAA 1F38A 3F0TA 4F8YA 1RQGA 2AR7A 1KHTA 1ENZA 1U80A 1EEXB 2VZLA 4H7EA 2WAXA 1OW3B 2DG2A 5FADA 2QIOA 1QGAA 3W77A 3DTVB 4JL5A 4RWZA 2FZKA 1LI5A 3AF2A 3QKSA 5EXSA 3UYLA 3V7NA 4B6SA 3ZCQA 1LS1A 2A5LA 3KTAB 4Z9XA 3RV4A 2I6QA 2IYXA 2ATVA 2PGIA 5JZVA 3WBKA 2D13A 2QZ4A 1JEAA 1XCOA 3PD0A 2FPPB 2QHXA 3AFHA 4PW0A 3TI7A 2OORA 2IYUA 5CA1F 3IAM6 3NEJA 3NXSA 3Q3JB 1GM5A 1E7YA 2DUUA 4F3CA 5CP8A 1N6KA 3QQ5A 5MN4A 3R0VA 3PI6A 1YRLA 1N2BA 2FVYA 3WLFA 1DADA 1V3UA 1UKAA 2HDOA 3F7OA 3H86A 4DDKA 2AFIA 5LD2C 2ZXEA 1HT2E 2R60A 1U90A 2NV0A 2QMEA 2QUJA 3NBMA 2AOXA 4ZCQA 2QMZA 3BA1A 2YJ6A 3TKLA 4IKEA 3V8NA 4CIXA 1XBTA 4KVGA 4S1WA 4YDSA 1J9GA 5AYVA 3L8CA 3U9LA 2ZPAA 1OTYA 1T2FA 2OD9A 5IM5A 3ANLA 2X8BA 3O9ZA 3W4IA 2WB4A 1AF7A 4WGGA 4XSHA 1QIEA 2A6PA 1YE5A 1VE9A 2VSFA 1WOYA 2ATEA 3DM9B 4I7EA 2QD1A 4TXJA 2V98A 3ZOKA 4CKBA 1X0VA 3TQOA 4J0QA 2JFOA 4EW2A 2NPOA 5F33A 1E1YA 3ESZA 1C0IA 1ECJA 1ZPDA 4LY3A 2VF8A 5FFFA 5JPIA 4HUTA 1B8VA 1YB5A 2O7SA 3KB6A 3UANA 2CL0X 4OIMA 4E46A 1P72A 2V0NA 4QYIA 3IT2A 2JI4A 2VHWA 2A0XA 2PQ6A 2NMVA 1UP4A 2O52A 4YRJA 3V4SA 3QFCA 2PUJA 2IY9A 3SZRA 1PZFA 2RGNA 4F96A 3UM9A 4F1KA 1N6IA 2ZDQA 5D7BA 2CKDA 1I80A 1XDWA 3C16C 4M1KA 4QTUB 4FS3A 5IM4A 3UXYA 3DUWA 4REOA 3OTWA 4JYBA 3R7AA 4Y1EA 3ER9A 4Q1AA 2D8AA 5IUJC 3UJAA 3RSGA 2ST1A 1PNTA 2XDYA 3W5IA 1T3HA 1E8NA 3C97A 4WI1A 5CXUA 5ADHA 3LHIA 4FHEA 3ZDEA 3Q9UA 2M9MA 1KMMA 2CV2A 2F1OA 3EUEA 1HMPA 4EG1A 1JHUA 4DCCA 4XEHA 5LKRA 2B4QA 1Z13A 1KOGA 1I2AA 1PHRA 1PK7A 1NE2A 2RARA 3BL6A 4CM1A 1QV6A 4X1IB 3ZHUA 4D4KA 1KYWA 1ORIA 3HB0A 1WD5A 4WXHA 5TQ2A 5AI8A 3L4BA 2O8NA 2P6PA 1NRJB 3F46A 4I1SA 2R1TB 3W5AA 3RYHB 4DPLA 4MW7A 1FP1D 2DQYA 3CIOA 3UUFA 4DGQA 3EDCA 3GP5A 2HIGA 1PJLA 1QIIA 3ZY6A 4ZCPA 1L4YA 2L2QA 4G0OA 4MYDA 1JRLA 3NC0C 1G7TA 1IN6A 2CV1A 2CLHB 1UJMA 1KKMA 1UAYA 4DZRA 2EP5A 3MTGA 4D4MA 4EHLA 4RTJA 2BGGA 1PDVA 2PL3A 4FVTA 2M1ZA 2YVQA 3OJOA 5MN6A 1K7XB 2F62A 3IUYA 3G7UA 4MJLA 2FWBA 3DEJA 3TKAA 3C48A 3T54A 1GGJA 4Q82A 1JN0A 5DM2A 2ZRHA 3HB7A 3PTLA 1JJAA 1SY7A 1HDGO 1II0A 3A6JA 3HZOA 1PNQA 2WHRA 3CKYA 3ZH2A 4CN9A 5CA0A 1QP4A 4Y2JA 1G18A 1H8EA 2BGUA 3EASA 4CQLB 2IHZA 4YMSA 1KFEB 4D97A 5CDFE 5GOTA 3J7TA 3QPBA 3H7IA 3SC2B 1YRQA 2ZDHA 3MTBA 1RCUA 2ZJ4A 2J6CA 2PMDA 3GLRA 4A8JA 5EFOA 3KJEA 4DKXA 3A31A 5A9SB 3I61A 2GXAA 2G72A 3PX2A 3T3EA 1L7XA 3QEKA 4MZDA 2WKRA 1SVSA 2B4TO 5JIBA 1VGVA 1E3LA 4U63A 4Y6GB 1W2WB 4G26A 4OHOA 3VPSA 4AG3A 3QF4B 3QVWA 4M76B 4OHUA 1SCBA 3K15A 4P58A 3VC3A 5AVRA 2M2IA 1E0DA 2RGNC 3WGTA 4EZBA 2YFHA 2RHLA 2CLOB 4GR5A 3ZS8A 1CYDA 2NZ2A 3A0UA 3CZPA 3H5LA 4H3VA 2R8YA 4XGNA 2AFHB 5KTTA 2AC7A 3I32A 1GUYA 1OASA 2A0WA 3ENVA 3EXEA 2JFPA 2ZRNA 4NDZA 2PKQO 2RDMA 3R6GA 3OTHA 3TD6A 2C2KA 1D4AA 2FI1A 2C7QA 3NM4A 2WLTA 1TW2A 1UKZA 1U8EA 2X2OA 1NFRA 3Q2KA 2VIIA 4XR4A 1TVKA 3DE2X 4CRWB 3G8YA 5B6IA 3OF5A 2H4ZA 4MV1A 2JZNA 1OB5A 3CV3A 3JZMA 2XRZA 1EGHA 1Z15A 3FNEA 2P9EA 3LZCA 1UC4B 3B2QA 5AM4A 2CJYA 1U3WA 2EFYA 2QGNA 1QGUB 4DSZA 4EWLA 2EZ9A 1JXOA 1XRRA 4GVLA 4CJXA 1UPAA 1XFAA 3HEMA 4YVFA 4C5BA 5C7OO 1LI4A 1PJAA 2I6XA 3T1VA 1KYVA 5K03A 3GBVA 1T34A 1R0RE 2XUAA 3CZQA 4AJ9A 1J21A 5ALXA 3VC7A 4DV2B 3VNQA 5F51A 2MSCB 3P2MA 2A5YB 2Q50A 3O8LA 2BFCB 2PGDA 3K20A 5G4KB 3ZS9A 3VYSB 1VIYA 3H1PA 1CX9B 2G25A 4ZQHA 1ZMRA 1JVSA 3NONA 1HC7A 4DCSA 2X7JA 1MAHA 2IEDA 4Y7DA 4ADSG 4B45A 4H35A 4NTZA 3OJFA 4NH0A 5KZMB 1YB2A 3CH4B 2EQ5A 2X9GA 4IFIA 1HFKA 3LUCA 3TZKA 1C0PA 1P7ZA 4GM4A 5T8KC 4DCJA 2ZJ2A 1E3QA 4NHEA 1COZA 3EW9A 4NARA 2XWJI 4DT1B 3PIDA 3GP8A 2CEAA 4F86A 1NW4A 3K72B 2ZJ5A 2HIHA 4TRRA 5P8WA 2G1AA 2B9EA 4Y9RA 2FG6C 2GK3A 4OVKA 2Q3HA 5THKA 3TK1A 1OKKD 2ECKA 1MG0A 3DKIA 1SA0A 3E7FA 3LSTA 2OCBA 2WD9A 5J3JA 1Q3HA 1PT6A 1PV1A 2QMHA 1IXSB 1YDHA 2QPTA 4RY9A 3JATA 1EFCA 3NBYC 3PUZA 2ZM6B 4U3JB 2IXEA 5JZ9A 4O4LB 4BNFA 3PRJA 3BHNA 1Z5UA 4AN4A 4LKOA 2X9VA 1RADA 1RI3A 3UO8B 3WGQA 5CBPA 2GBIA 4E4TA 1X94A 4PBRA 5I9MA 3FOZA 4PGFA 2KB0A 3HSSA 2XW6A 3C98A 3G5TA 3KFXA 4TV8A 3ES9A 5K4HA 1ADYA 3IEPA 3UPUA 4EL0A 3UK6A 1JEEA 1GZ6A 3I2IA 1CZLA 1KHHA 3LTEA 3OY7A 4MLPA 4LOAA 5F64A 3ZWYA 4Q3LA 4HEA6 4QVGA 3WMFA 1SR8A 4W1PA 1KSGA 1E2KA 1B14A 1JPVA 3G82C 3LPDA 4Q18A 5FA8A 4PYJA 1JQEA 1DJMA 2IH4A 1E1KA 4GRIA 3ZHRA 5GIOE 1JPUA 2FH5B 1QVRA 4Q24A 1ZK1A 1OI7A 3D5TA 3FI0A 4U0KA 4WLUA 5KTPA 5J2TB 3N7AA 3ADBA 1VCMA 4XPIB 2GJ4A 4DJ5X 3CURA 5D01A 4E2YA 4GX2A 3MTEA 4NPHA 5DFAA 3WK9A 1O95C 4KCGA 1R9GA 1IMOA 1BROA 1RHRA 3B9PA 1XEWY 3KC2A 3MB5A 4ML3A 4KQMA 5IZ4A 1GUAA 1RPJA 1SKUA 2O4UX 2PU7A 4II2A 3TVYA 4AZ3A 2K6GA 3IIEA 4R40A 4O8ZA 3OTGA 4L9WA 3A32A 4JNCA 1PJBA 1YNSA 1EFKA 4YR7A 1JWBB 3ZHTA 3KHSA 3VNRA 2FSPA 2WF7A 3OPMA 3BERA 1O6GA 3EAGA 3VQTA 4KPUB 1KIFA 3WC4A 4MQ5A 2EF1A 3IVXA 2P79A 1FX0B 3RROA 3V4PB 1JU9A 4XYGA 4EL5A 1MLDA 4HKTA 2BC9A 3F4BA 4PCUA 3T3NA 2WWIA 3LX4A 4H0CA 1E59A 4G0QA 3QMPA 5CGQB 4EI8A 4MS1A 1Y63A 3A9VA 4BO4A 1JNYA 1V5FA 2G76A 5CRIA 1GPJA 3SS8A 3WTCA 5D1HA 5DWQA 3G0OA 5C8ZA 4OQDA 1MTOA 1FRVA 1GKLA 1NUAA 4LUCA 4CMIB 1M5TA 5KDOA 1ZN2A 1UINA 2C5BA 3P26A 1QH1A 2G40A 2YVUA 4CF5A 1A8IA 5G1NA 1KVQA 2DKFA 4K28A 4TRMA 3ZDRA 5HNKA 3HDQA 1WMEA 4TTVA 1P8JA 3WFJA 3PJDA 4NXNB 3ESRA 4V03A 4PPFA 1GFSA 2O4CA 2Z8YM 2PM8A 3DQPA 4E1VA 1UOPA 4GKJB 2KM1A 1X87A 3KUCA 2E48A 1N2ZA 4G4SP 5BSVA 1L1FA 3KZVA 2WJHA 1GZVA 4R1TA 4U2DA 3GQVA 4E31A 3IPRA 5HRCA 1LC3A 1TAQA 2YFKA 1V3TA 1XCMA 5EWJB 1VXOA 4R84A 2A9RA 2I7CA 3SBOA 3UBTA 3Q8LA 1ZKMA 5ALNA 3H2BA 3S2ZA 1WNFA 2CHEA 1I0ZA 4KIWA 1G21B 2UXDB 2ZFUA 4BX8A 4EY8A 2GWRA 4JLKA 2Z2KA 5ILGA 4KYTA 4JNKA 3TLZA 1ZM9A 4DRZA 3R2JA 4ASUD 4ER6A 2WPDD 2ZP1A 3IDQA 3VZCA 2NZWA 1Y6ZA 4UMEA 2C07A 3M5WA 1KAEA 1KO7A 2XKAA 3U7IA 1Y3IA 3EWIA 1DEKA 1OVMA 4FHFA 3PXEA 4P34A 3SDSA 4AJKA 4M8LA 4D9CA 1BX0A 5DH9A 2PWBA 3UWSA 2PFSA 4QQNA 2ZI9A 1HZJA 3HY6A 2ZYAA 1KK3A 5DBEX 1CUXA 3S7TA 3OQ1A 2ZR9A 5DCYA 1V35A 1UZUA 2VI5A 1EE2A 2X6QA 2WILA 4KO4S 1Y4ZA 1E2HA 3VZDA 2GA9A 5HXAA 1B1AA 3LLMA 2OGWA 3ZWXA 1MF7A 4IDCA 3N8IA 4WEQA 3TTXA 4J1SA 4JI8B 1KVTA 1B42A 1W1UA 1EUCB 1P3DA 3AUJB 4IHAA 4R8SA 5L3RA 4KE8A 1OWNA 1JV2B 3WLKX 5B1HA 1AX9A 5FOUA 2PBZA 4OOEA 1ZH2A 5K3FA 1FFEA 5FWYA 5KOJB 3FAKA 3DVAB 1MXFA 1UXIA 1XEWX 1ORHA 4D9KA 3K92A 4AF6A 3A3NA 1JA0A <