2BFCB

Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
341
structure length
332
Chain Sequence
AHFEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
pubmed doi rcsb
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
molecule tags Oxidoreductase
source organism Homo sapiens
total genus 127
structure length 332
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bfcB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bfcB01
4RJKA 1MCZA 1PVDA 1WCIB 2VBIA 2BEWB 3ZHUA 1RP7A 4GM4A 1POWA 5K6TA 2VK4A 5ERXA 1PYDA 1X7ZA 4QELA 5IMSA 2BFFA 2UZAA 1GPUA 3DVAA 3KOMA 2QTAA 3UPTA 3EXHC 2R8OA 1UPCA 3MOSA 2VK1A 1OLSB 1X7XB 5EJMA 1ZPDA 1NI4B 4JU9A 4K9LA 2PGNA 4MZXA 1UMDB 1NGSA 2EZ8A 1V11A 2W93A 3ZHVA 3EXFB 1JSCA 2BP7B 2BFBA 2VK8A 1AY0A 1UMBB 1QPBA 3EXG2 3EXIB 4K9MA 2UZ1A 3AHHA 4GM0A 2BEUB 1YHZA 4K9KA 3LQ1A 5DEIA 1UPAA 3L84A 2G28A 3F6BX 1YD7A 3FSJX 3AHEA 2DJIA 1TRKA 3M34A 4JD5A 1X7YA 2Q29A 1X7ZB 2C31A 2AG1A 2FN3A 2XT9A 1IK6A 3DVAB 4KXUA 2BFCA 2XTAA 2C3YA 1TKCA 1N0HA 2C42A 3ZHQA 3EY9A 2BEUA 3IAFA 4QPZA 1YHYA 5FEMA 2C3UA 5AHKA 3M6LA 2Y0PA 1V11B 3AHCA 2BFDA 3DV0A 3AHGA 5EJ5A 2JI9A 2EZ9A 2BFBB 4KXWA 1OZHA 4JUCA 2V3WA 1U5BA 1PO7A 4ZP1A 2YIDA 2UZ1B 3HYLA 4D5EA 1V16B 1PI3A 4KXXA 1TKBA 1OVMA 1UMCA 4JUFA 2PDAA 2FWNA 1OZFA 3UK1A 2JI8A 2BEVA 2WVHA 1BFDA 3F6EX 1X7YB 1OLUA 1W85A 3E9YA 4MQ5A 5HHTA 5HGXA 1YI0A 2BFCB 5I4IA 2WVAA 2WVGA 3HWX1 3AHJA 4MPPA 3EXHA 1POXA 5EJ4A 1V5GA 2J9FA 3AHIA 4K9QA 1DTWA 2O1XA 1V16A 5ERYA 1V1RA 1T9BA 1B0PA 2Q5LA 2C3OA 5I5EA 4MPJA 5EJ6A 2JLCA 4GG1A 4QQ8A 1W88A 2Q5JA 5EJAA 2BFDB 3DV0B 2IHVA 1V1MA 1T9DA 3M49A 2Q28A 2JGDA 2BFEA 2OZLA 4KXYA 3D7KA 3LPLA 1X80A 2JLAA 5EJ7A 4FEGA 3IAEA 1U5BB 1X7WA 4RJJA 5ESDA 2R5NA 1ITZA 4JUBA 4GM1A 2O1SA 4Q9DA 3AHDA 2Q5QA 2JIBA 2C3PA 1V5FA 1UMCB 1T9CA 1OLXB 4RJIA 2VBFA 2AG0A 4GPEA 1UM9A 2BEVB 4GP9A 5EXDA 1OLUB 1W85B 3AI7A 4KGDA 2QTCA 2C3MA 2PANA 1YI1A 3DUFA 1R9JA 4C7VA 3EXHB 2J9FB 2G25A 3EXEA 1DTWB 2E6KA 4FEEA 1V1RB 4JUDX 5HJEA 4KXVA 3FLMA 3ZHRA 4COKA 2EZ4A 1OZGA 2X7JA 1L8AA 1W88B 2IEAA 2R8PA 3RIMA 3HWWA 3FZNA 1OLXA 5EJ8A 2XT6A 1V1MB 3EYAA 1QS0A 2JGDB 2BFEB 3EA4A 2OZLB 3ZHSA 2JI7A 1Q6ZA 4WBXC 1X80B 2IHTA 1V5EA 1X7WB 1UPBA 2Q27A 3OE1A 1KEKA 2VBGA 1WCIA 3EXG1 2BEWA 2PGOA 4XEUA 1UM9B 1YBHA 4D5GA 4JUAA 5HYVA 3M7IA 5DGDA 1T9AA 5K2OA 5EXEA 1YNOA 3DUFB 2Q5OA 4K9NA 5DGTA 3LQ4A 1OLSA 1Y9DA 1X7XA 5I5GA 3EXEB 1NI4A 3OOYA 1Z8NA 2IHUA 4MPRA 1UMDA 5K6RA 2NXWA 4K9PA 1QGDA 3EXFA 4C7XA 3ZHTA 2EZTA 2BP7A 2YICA 2JI6A 2G67A 2BFFB 4K9OA 2EZUA 3JU3A 5I51A 1UMBA 1QS0B 3AHFA 5K3SA 5EJ9A 1TKAA 3EXIA 3LQ2A 2VJYA 5C4IA 4JU8A
chains in the Genus database with same CATH superfamily
1XDUA 3SOZA 1PFYA 2IOHA 1QF9A 2W11A 3ZCQA 4JDPA 2I76A 1YZHA 2AFIE 2BEJA 1XMJA 1NF9A 4O2AA 3B3GA 1UFQA 1YRLA 2O2EA 1OYVA 4QGGA 3JYLA 1RPAA 1PZEA 1UOOA 3K94A 2W58A 4PEVA 5LQRA 1N36B 4TWIA 5LOVA 3HGTA 4PNHA 4E12A 3EK2A 1DJQA 4OHOA 3ZS8A 1C0KA 4NABA 3GFGA 1F5SA 4H6PA 1EDZA 2HLHA 2WR8A 3THXA 2ZT8A 4Q4LA 2HYDA 5EMNA 1YCFA 4D3DA 1X7ZA 4QELA 3U9TA 4FWIB 1PL7A 5IMSA 2ZR0A 4MDFA 1ZO8A 4LBZA 5DDIP 3PIDA 3EX7C 4BMXA 1QYVA 1YZFA 3EZYA 4IDNA 4B4OA 2J4DA 2B3TA 4HWKA 4ZKDA 2QRKA 3C3XA 4CUJA 3DLAA 4FLMA 4TLLB 4TLCA 5E1OA 1YKFA 4QHTA 4TS4A 5HXAA 3BZBA 1E6UA 1YJBA 1C7EA 2DFLA 2IPLA 3HU2A 1HL3A 4NECA 2RH4A 4G01B 1PGPA 4WBSA 5HKKD 3RUPA 2DR2A 3KB8A 1GSOA 1PZMA 1F9AA 4FVTA 1PJ3A 3QXXA 4TRJA 1T2UA 4DIBA 3QFFA 4EQZA 1U1GA 3H5VA 3NAGA 3MCVA 4AZ0B 2OZEA 1E77A 2IHYA 2XYPA 4QPNA 2HBYA 3GLIB 2PGNA 1IBLB 1S6YA 3HMQA 4BE9A 1P5FA 1ZL0A 1TYBE 2CNKA 4RK0A 5AM1A 3K09C 1OC2A 2XTNA 3EFHA 5FYDA 4CEHB 2GZ1A 4H4EA 4M36A 1JG4A 4WA8A 4CT5A 4A0GA 4AJ1A 4UE3S 1OFUA 1HYQA 1RWBA 3G1WA 3L93A 4PPGA 4ROSA 5F3DA 4YS6A 3T5AA 3EG9B 2R4UA 1IB6A 3EXFB 4DMLA 1SB9A 1XJQA 5K6AC 4A1OA 4G6ZA 4QYIA 4DLVA 3DLTA 3C5CA 4W5NA 4JQOA 4QDJA 2EP8A 3UAVA 3NBZC 4DXDA 1GNTA 1B43A 3N8IA 4IVPA 2BI7A 5FDFA 1C5KA 4YREA 1KI8A 1T0HB 2H1HA 3I01A 1R37A 4GX2A 4C2UA 1I24A 1NN1A 4ILKA 3UJNA 3IL2A 2CXQA 3MJRA 2X8BA 3NBFA 2AN3A 1Z83A 1PQYA 4LZZA 4K05A 5AVTA 2VYVD 4KW7A 3BMQB 4UFNA 1GLVA 1LRKA 1NQ5A 3OF2A 3P9KA 5GM2A 4JB3A 3V4ZA 9MHTA 1F2TB 2BGRA 2FSGA 5HUJA 2XODA 1N2XA 4E2ZA 3LC7O 3I8XA 4JP5A 3UHPA 2HFKA 4DRXA 4EW1A 1PJCA 3K8ZA 2K6GA 4KWTA 3KUDA 4MQLA 3IB6A 4KJZA 4Q7LA 3HQ4O 3HCEA 1J99A 5LZ7A 1E6WA 2YS7A 1P2DA 1X92A 3DE4X 3AVWA 4FCTA 1Q44A 2C9MA 1E79A 3FVQA 3KR2A 1C1HA 1MJHA 1UT6A 2WF5A 5AM4A 3GD5A 3ZZ0A 4CM5A 5JAPA 4HDSB 2Z2JA 2JFGA 3LP5A 4DQLA 4Z4FA 5E9QA 1QP8A 3D4OA 4XGNA 1WP9A 2GYVA 4OJYA 4GPZA 1WS6A 3GJ3A 1HDYA 5C0OE 4AIIA 5D7BA 3VPXA 3IJ5A 3PDHA 2XOXA 1IY0A 4XOIA 1AB5A 4TS3A 5BOSA 1X7YA 2XXAA 3LUCA 3FCSB 5FL7A 3CUTA 4WZAE 5AVXA 4IICA 1QU2A 4M3NA 3AX6A 1X1TA 3HXOA 4L3OA 4Q4CA 4QPJC 3W8EA 2AN5A 2V6GA 1CUXA 1ZZEA 2PXHA 4JQCA 1EE2A 1A5TA 2CJYA 2YVLA 3O83A 3PA8A 2C3YA 1B1CA 2CVPA 2W90A 3H65A 5ES4B 2V59A 4M1TA 1XCGB 1XCOA 3R7WB 3I5UA 3VR4H 1ZEMA 2GM3A 5FI5A 1KBOA 2A33A 2PT6A 3TAUA 1B4DA 5D1NA 3NHJA 2MSDB 2UZ0A 4I4IA 3RU9A 4C0HA 4CMIB 1U3FA 1YUMA 4RF4A 5K51A 4DT1B 3VR6H 3M5DA 1RW4A 7REQB 4AM8A 1GZUA 3H05A 4D9BA 1D8AA 1URPA 3DEJA 3KM0A 4MR7A 3KEQA 1LEHA 4TSRA 2OAP1 3CF0A 1VTKA 3N2YA 3PHJA 3COZA 4CPDA 4ZTUB 1A8UA 1HE2A 1OZAA 2DBQA 3NWOA 1QOZA 3O2SB 4ALKA 1U2TA 4WK0B 3VVLA 1JVNA 1HYBA 2IKQA 3HKDA 4J3JA 4KRGA 1YZVA 1NU6A 1YMUA 4TS1A 3JASA 4ACAA 3UMBA 4YV7A 3M70A 2XUOA 4LRWA 1U3WA 2CVOA 4NAUA 3I23A 4PZDA 3F7NA 1U0JA 3NJ4A 1VMAA 1G66A 3DKKA 5L45A 1M2FA 3UUWA 3BIFA 3SJ7A 4RPGA 3K9WA 1V8DA 1MFPA 1YJ5A 4OHPA 2NT4A 5DWDA 5ULLA 4CI9A 3D8NA 5ILOA 2B9EA 4DR4B 3OPMA 1N5MA 1AOXA 1W73A 3DBVO 4P93A 1O57A 3DBHA 2PX6A 1I0LA 1NDQA 1H6DA 2V0CA 4KXWA 2C9DA 2PBFA 3OZEA 4YRQA 2PKYX 3D9QX 5GONA 5CNKA 5JD3A 3ZZTA 5KDOA 3S8EA 3QSYA 1HMYA 1EWQA 1DLIA 4Y2QA 3PIIA 1FTWA 1WW8A 5IVDA 4QDZA 5LB4A 4MW2A 3ZXYA 1JA9A 4AJ2A 4ZP1A 4M0CA 3IPRA 3DOJA 4IV8A 4MICA 1KVUA 3I58A 4UNPA 1R0KA 3LQFA 1I3OA 1DS6A 2GT1A 3QVXA 2VXOA 2NO5A 5BSVA 2WJVA 3H1PA 3DZJA 1JKIA 1UP4A 4ZZ0A 3W7AA 2PMBA 3BCRA 1Y42X 1NXSA 2O8NA 4I55F 3HJTA 2P1DA 3LYUA 1HC7A 4FIZA 1VE1A 1FFBA 4WY8A 4YRJA 3TL3A 1SQGA 3CX7A 4WX2B 4YONB 5JHGB 1THTA 1OMOA 4HAZA 2JD0A 4N3AA 3ROQA 4KRFA 2ZRAA 4JROA 1ENOA 3GJ8A 1HFKA 1JPJA 2HC9A 3OZVA 1W581 4GOXA 1E2PA 2ET6A 1V3UA 5HIJA 1S8AA 2Z83A 4IHKA 5CHYA 1NUUA 3EF1A 3HSYA 2A9QA 2GN2A 4Z9XA 1NF2A 1BKSB 5BYKA 1UC4B 2FZ4A 3T1HB 2W43A 4OFBA 3V1UA 1T1GA 2ICAA 3PD1A 4R41A 2C4WA 5BQ5A 1EFPB 3VYRB 1G2PA 2JC3A 4J7AA 4IQFA 1QF6A 1GCOA 2WYUA 3DFMA 3RU2A 1JV2B 1F2UA 2VRBA 4XXHA 4D9HA 2AE2A 2Y1KA 5CLHA 5J2UB 4ZTBA 4FDAA 3ER8A 1HSZA 1KJZA 2AZMA 3U4DA 3ED5A 3EEFA 2J0VA 4K9QA 2RC6A 5J5VA 4DABA 2YWCA 4DUZB 5ECGC 4LJKA 13PKA 1OUMA 3WG9A 4UTNA 1SG6A 4YCJA 4CCYB 1CTQA 4ZOLA 2GA9A 3OT1B 5J2TA 3NC4A 2EHDA 2DFKB 1NBIA 3G8DA 1BRTA 3DAGA 1PNQA 4GBJA 2F1IA 3K09A 5FKJA 4BP3A 5C1OA 4WVLA 2QP3A 1W9HA 1QO7A 2P2CA 3G68A 5G40A 4DLWA 4DAEA 3BE5A 2XBUA 2EX4A 1F12A 4DJJA 1PL0A 1MX3A 2O7QA 5G1NA 2Q9AA 3QVSA 1E4VA 3I5MA 3EWAA 4MUIA 4OLJA 4F71A 5AVWA 4UPDA 5B1DA 5K6AA 2SICE 4KXMA 1QLWA 2HGZA 2XMPA 4MR8B 4ND8B 1PT7A 3SR0A 4E07A 1WPGA 2OHJA 3FIJA 5ANRB 1KMNA 1LVHA 1N8TA 1FP7A 1SXHA 3T94A 3VPSA 5LKAA 4KAFA 3DLBA 1GRRA 4CKYA 2AZDA 2J59A 4QBGB 3THRA 4E5SA 1C3XA 3QVTA 2ZQ5A 1X80A 4C20A 3HDQA 1C9MA 1DAIA 2NO7A 3PVCA 1SURA 4FN5A 3VRHA 5B4TA 4DBLC 4QXOA 3FB4A 4BUZA 3GUHA 4CDGA 4R7GA 1NVVQ 1X7WA 4OHUA 4U0KA 1WXDA 4OMCA 3K1JA 1MOQA 1PX0A 2NUPB 3AW8A 4C4YA 1ISSA 2R2AA 2R6ZA 3G2KA 4Q02A 5DZSA 5NLLA 3C1AA 1H0HA 1CXZA 2HCJB 4B8ZA 4A0RA 1EH5A 2O59A 4KUEA 2Q3MA 4Q9HA 4DSUA 4H2DA 1DIBA 1BN6A 2NV2B 2R11A 2MU1A 2ZW9A 3HKCA 1X1QA 1RYFA 2ZIXB 2GZ3A 1CUZA 1VPDA 2H2GA 3W2EA 1OFVA 4CQLA 2P1ZA 5KTTA 5HW0A 1WHSB 3TTTA 3RYIA 4RK5A 5KTMA 5FI3A 1PK8A 1OLXB 4RJIA 3GP8A 1QX4A 1BXZA 3GBVA 3MJCA 3TOZA 2VH1A 4YXWA 5E9AA 1LI5A 3BCHA 3CX6A 3CW2A 3DHVA 3A9VA 3OWHA 5FOUA 4OGFA 1MT3A 4CMJA 1CIPA 1XROA 5DMHA 1OX4B 4P3OA 1DC6A 2PANA 5CLIA 4B6PA 5G53C 4I5GA 2ZSFA 5CURA 4AG6A 2X9LA 1HETA 3GXBA 3E48A 4W1QA 1JXQA 1RJDA 1MABB 1MOZA 2FK7A 1XWWA 1FFSA 2I4LA 2Z43A 3ADOA 3L0DA 2ADOA 2OCAA 4L4ZA 1QO0A 2CV2A 3PQ7A 2BM1A 1JAZA 3T5CA 3ZK7A 4D96A 3F47A 4LZWA 2FB9A 2BKLA 1L4NA 5FLKA 5DVZA 3IIEA 2BMAA 2ECKA 2I2WA 3PPWA 1YJCA 3D8SA 2WM8A 2O0MA 4JVSB 3EGXB 2P3QA 3AZQA 1SC3A 4BVHA 4E7OA 1TCAA 4DA9A 3PTAA 3AJDA 4ETNA 2Z8YA 4WN9A 4E51A 2RGNC 3MEQA 2QTFA 2Q2WA 3SVTA 2AD5A 4LDPA 1IXSB 1I8TA 2GKOA 6REQA 1R6AA 3AI2A 5JASA 1L8AA 1C3EA 3NUZA 4OAQA 3S5UA 1WSDA 1I1QB 4AIRA 2W4MA 2VRCA 1U2QA 4TKLA 4FUTA 2AD1A 2DF8A 1X1RA 3T3EA 3ASZA 4RNDB 3NTXA 4D99A 3AY6A 1F8XA 3A06A 4LISA 4U2FA 5DWVA 1Z6YA 5HFAA 3SYKA 4M7RA 1QKJA 2DM6A 2OZLB 1NMYA 3A1EA 1KEEB 5HKAA 1H9BA 5DIFA 5JS7A 5C52B 4QKQA 3BJZA 4BL5A 4M8SA 2Q6KA 1ESMA 3HL4A 4F0JA 1Q1ZA 1NP7A 1C30A 2HIHA 1TQ2A 1E0DA 1I5EA 2DP4E 2NMVA 2Z9BA 3DDCA 4JLBA 1M2VA 3KR9A 3OCUA 1WTCA 4OEHA 1C7ZA 5D00A 3K0CC 1VHWA 1UPBA 2YFHA 1LF5A 2XYHA 1AD2A 1VB3A 3AL3A 1K8QA 2V0GA 1Y33E 3E6AA 4P1ZA 1JBKA 2X9GA 4CYMA 4A16A 1Q7GA 4IDEA 3SMVA 4JX9A 4DV7B 2Q41A 3O8LA 2O4CA 1YFZA 3VTAA 3C43A 3VKHA 3F5FA 5EAIA 5FTKA 1ZCFA 3LXRA 4F4UA 5KYUB 1KMQA 2JCBA 1CZLA 5ALMA 1G5IA 2YINC 2HSEA 4U7GA 4ED9A 3C5EA 3R6TA 1E8NA 4IDBA 1OAOC 2ZSJA 5A3JA 4MWOA 4HNVA 3IV7A 5U4QA 4XTCS 1XJ5A 5HDQA 1TRHA 2QVBA 3GVPA 1N34B 5IF9A 1BQ4A 4PLFA 4DOMA 5DHPA 4BFSA 3DMDA 3C8UA 3GUVA 2AW3A 3KXPA 3ENVA 1T29A 2AHOA 3UXEA 4Z2YA 1Q1NA 1QFSA 4LS3A 1OXBB 1U7ZA 1RI2A 1U7WA 1XMPA 3ABRB 4MKGA 5CX1B 4YP7A 2IYTA 3DOFA 1QYCA 1CKEA 3OEWA 2R1VA 4HDMB 3GNSA 3A8TA 3BWYA 4IQGA 4BGUA 3OZTA 2ZUTA 4UTXA 3GMDA 5ECYA 2WSYB 2X2OA 2I6SA 3B82A 1MAVA 1X15A 3I09A 1OV4A 4A03A 1OB2A 2O2HA 5BXYA 3U60B 3R77A 4Q3OA 3UAXA 4PQGA 2C2YA 2IDJA 5ELXA 4JLPA 3CN9A 2ZRIA 3DXYA 1FSPA 5JBIA 4GUAA 1X9GA 3PUIA 3RBVA 3USES 4ZMSA 3ZQUA 1AN9A 1SBIA 5KKNB 3PQ4A 3J7AC 1AHPA 1UJNA 1C81A 3EGDB 3F96A 3CRW1 3C15C 4IFTA 4TV8F 1E4EB 1K27A 3KKMA 1GFZA 1Z3IX 4Q1DA 5F1YA 4MVYA 3CNNA 3OO1A 3NNDA 4DLSA 3GLIE 2ZCJA 4QLBA 2CYBA 3L7MA 1V1JA 3BL5A 4IGAA 1EXWA 2X2PA 3G1TA 4NE2A 4OJMX 4CQJA 1PHRA 1TKAA 2NTEA 1UAGA 3KPYA 3VI3B 1AKNA 1Y3HA 2A86A 1Q74A 2AMYA 1HEYA 4RUKA 2I6TA 3TFOA 1YRQA 3OT5A 3U9SA 3BWVA 4Y30A 5K9ZA 2WFMA 4Q0MA 3HBLA 3GCWA 4WLNA 1VKOA 3FHOA 4YAKA 1XZEA 3ZNQA 1UZNA 2X4GA 3RSCA 1QHGA 3QHQA 1A9RA 4J94A 4I46A 1Y82A 4JIMA 5CT9A 1PRYA 3T0GA 4MJ3A 4PAWA 5I7UA 3LWNA 3KQWA 1L5QA 1EZZA 3D0OA 2GR9A 3W77A 2Y76A 1FDRA 4UHEA 1XZPA 3TSOA 1KGSA 1O96A 3A4MA 5E7IA 3WHKA 5IKOA 3WLOA 5D6OA 3C1UA 1QIIA 2VRNA 4RK6A 4CI0B 5AW1A 1M1ZA 2FG5A 1FFXB 5K6TA 2G4LA 1RKQA 2B92A 1CJVC 4CKBA 2O2JA 1DIHA 1FQWA 3QE2A 3STVA 1HZJA 5T6MA 4KHPB 3AR4A 1DUVG 1BO6A 1QC5B 5K8IA 1KJJA 2WMDA 4MPTA 2D2EA 3I1YA 3LS2A 3H1EA 4TV8A 3C39A 2AC4A 3CY6A 1GTMA 1FTYA 3K9GA 5EP3A 1FZTA 2H31A 3IULA 3W9SA 4WXMA 5CH5A 1KO4A 1Z63A 2HHJA 3TD2A 3E15A 3IBSA 1NSFA 3HJCA 1NI5A 1ZLYA 3IHKA 5D8DA 5GV7A 1RCUA 4WK2B 1LBTA 3UGJA 3LFTA 1NMSA 2DWPA 2VLIA 3QKSB 5EJMA 5H5JA 3RS2A 1HURA 1O97D 4EA7A 2VTDA 3SHFA 5CPBA 3RU7A 2O8CA 1XXHA 3MGKA 1UBJS 4UHHA 5EKTA 5IBQA 3F49S 4HDCA 1QDLB 1P5HA 1RCFA 1S01A 3C3EA 3DWEX 3WFIA 4F9EA 3UBMA 4F9TA 1KMCA 2VUHB 2OCYC 4K9LA 4LOLA 3SEQA 4BVKA 4M89A 2GBIA 3FJ1A 4OGWA 1EX1A 1RM5A 2JAXA 1SUWA 5B7GA 1WG8A 3MVEA 1KYWA 1UMDB 2AG6A 1ELOA 3SFTA 1UAAA 2QAGC 4XUEA 4NJMA 3IDZA 5C9ZA 5A5DA 2ZWOA 5CDTA 3VPAA 4Z53A 2GJ9A 1ONPA 2OXRA 3LZDA 1PJTA 3MRSA 3ICVA 4IP0A 1FTSA 2YJGA 4RESA 1BXGA 4BDSA 2QL6A 3A1SA 4OHBA 4DQ0A 5T4FA 5JAHA 4R31A 4OVKA 3NJ8A 1USKA 3DTVD 5CCBA 3H86A 1LLUA 3DV2A 4YAGA 4YNBA 1QPBA 2X42A 3Q7EA 4LY6A 2AOVA 2HDNB 1EBUA 3QMMA 2ZBPA 4OQXA 4RDCA 4AECA 3WBBA 3QSGA 1SUEA 1XNJA 2AZTA 3TGLA 1GAJA 1I4OA 1L6RA 3PKIA 1N6PA 1EUCB 4IHJB 1AUQA 5T41A 1G7CA 2UVPB 3U3XA 2ZJ0A 4KQJA 1KY3A 2WHPB 3T0IA 3DDZX 2Z8ZA 3I2HA 3NWEA 1FDIA 4MAAA 5LP6F 3LQ1A 3KC2A 3K0CA 1D2RA 1BMDA 4X7BA 2FKNA 1GGVA 1O89A 3A26A 1K66A 1NV8A 4J76A 4UHFA 1JJ7A 3AY0A 4QXQA 5CLGA 2CD9A 4DA4A 3RBZA 1DX9A 1D2NA 2ZVJA 1P4SA 4K1LA 3AKCA 4Q3EA 4LTMA 5FPTA 4IIEA 2A5GA 3REQB 4LMRA 1ZCBA 1COWA 4I8DA 1YD7A 1Z6TA 3L6EA 1VHLA 4JQYA 1DXHA 3PNSA 2QTWB 2VPTA 4PPNA 5A6SA 4BVJA 1Z75A 1WHTB 1WUJS 4R9RA 3KLBA 3NTVA 2W4IA 3Q0EA 5JO0A 3O1HB 1C1YA 2CBZA 3S2SA 1TAQA 5E3IA 1U7HA 4BRZA 4BJ3A 4XARA 4EF6A 2LDBA 3KSRA 4OUDB 1H4SA 1BJRE 1ADBA 2FSVC 1UJ4A 2NN3C 1X0XA 1M1YB 3T9FA 1M33A 1OAOA 3PC7A 4B6SA 4CG2A 1G6HA 2AG1A 4CLRA 3V8MA 3NAQA 2GPTA 2VAWA 1GZHB 4OPMA 1G42A 1YZYA 2BV3A 2FN3A 2W22A 3N2LA 4RZHA 3RVLA 3GNQA 4ZYTA 3OMXA 1ISGA 4KODA 5CM8B 3AEQB 1STOA 1H69A 4NU8X 3N75A 2IYXA 1XEFA 1RQGA 1KTVA 3LWZA 2FOLA 3RQIA 2PZAA 5K0BA 5D51S 2ZGVA 1O4VA 2CXPA 4INJA 2QN6A 2YWEA 3K1AB 2IS1A 3LHFA 1UWCA 3RTDA 1CK4A 1MQ9A 4UHBA 1BVRA 4YASA 4EEZA 4YUYA 1A9OA 2V5UA 1YHYA 4R16A 5JC8A 1DFHA 3IVAA 5B3AA 1VJDA 1Y1PA 4KQCA 4AY4A 1DQYA 4LX0A 3GLGB 1EGVB 2YIMA 1YS7A 2VHUA 4K1XA 4XW2A 1INLA 4F6CA 2Z4SA 2D54A 3R6GA 3MRXA 4HLUC 3H17A 3ZLBA 1KS2A 3KVYA 4YJFA 4ZAFA 5EUQB 5LA6B 3RRXA 1RJWA 4EARA 1PHPA 1UKZA 2AQKA 1ZVQA 2CC2A 1W2GA 3ONNA 4C7OA 2WJZB 2PO5A 3DDNA 3RO7A 3WNVA 4IWYA 2FW9A 2C83A 4NJEB 4EFDA 2HRZA 4QC2A 1XLWA 1XTUA 1KS9A 1ZIPA 1IRXA 3AUJB 3NKLA 3SG0A 2JI9A 5BNIA 4BO0A 3ITNA 3PRJA 1XTSA 3TLGA 2DMRA 1X9IA 5FADA 1AK1A 3P9PA 4QUIA 1WXQA 2X76A 2IW3A 3B2QA 2GN0A 3OZUA 1Z2EA 3DXFA 2F55A 1XDZA 4UFOA 5HM6A 1Y6GA 3C7TA 1R66A 3EIQA 1JB9A 2AZ4A 3EW7A 1ZMRA 2G07A 2QOEA 3AILA 5ENDA 2V3WA 2HBZA 5BSMA 2D4AA 3OX3A 4XIGS 3IUSA 4KO2S 2IX3A 3JRWA 2I62A 2B4TO 2VDWB 1R88A 4FYWA 4YFYA 3RARA 4I1VA 3ADPA 4L6AA 4ZVMA 4WBNF 1XDGA 2C5LA 3FHLA 3UAOA 4U9UA 5DULA 4JS0A 4NCKA 4BXOA 2XXBA 5FUXA 2L2QA 2YFYA 5TVKA 1TCBA 2YHAA 3M6XA 4C6TB 3VPBA 1EP1B 4PM4A 1U7OA 2V5VA 5H83A 3T1YB 3LBHA 4H0CA 2F7SA 4IJQA 3O9VA 5BVGB 2QDXA 1O0SA 1IBSA 2IY9A 2UZIR 3A2LA 5DBHX 1TL7C 1CS4C 1F8GA 2VXBA 2FWNA 5B1HA 3H7IA 2EFJA 3QTBA 5J47A 1YE3A 1K7CA 4XI9A 4R2HA 5BSGA 3OESA 2WP8J 4XYBA 3PF9A 1FPQA 2A7QA 1CZNA 3D4LA 4OJQA 1HDZA 3ZDCA 2IFTA 3RCBA 1ZUNA 2WVHA 3I28A 4GU5A 1U3DA 2IUTA 4M7OA 1MBZA 3TW8B 3U3ZA 1ORIA 1ZM2A 2ID9A 2E7ZA 3RB8A 5BURA 3HU3A 4D9IA 1D09A 4TN1A 5J63A 1QKIA 4IF6A 4BPRA 2TYSB 1PFQA 2J0QA 3WWPA 3RFTA 4ZEWA 4P0QB 1QIDA 5BV2P 2PH1A 4GD3Q 2YNMC 1W1WA 5EIAA 2DTDA 5EGNA 2XT0A 4IDPA 4LK2A 3PNOA 3LX6A 5HOEA 4IAOA 4TUYA 4DCSA 3VOAA 1JYEA 1ZD1A 2J3HA 4WBNA 5F35A 2IGTA 4MK4A 4P3NA 3OLVA 4E2YA 3MT7A 3PTZA 1O03A 4TZTA 5ITVA 3AUAA 2P4EA 3C85A 1SNYA 3FYTA 1J8FA 1RU3A 1U90A 3HXLA 2EJVA 3LLCA 4PE5B 1Y7LA 1CR2A 5JWRA 2GVDC 2ZI7A 1ISFA 2QAGA 4ARAA 1CG6A 1EUZA 1UDXA 5FUYA 3AERA 2HCRA 2NQ2C 4BDTA 5IJ0B 1GFSA 2BWJA 2IZOA 2P9TA 1GSIA 3OE4A 1IL0A 1IUKA 4L15A 5L7YA 4MRSA 4PHTA 2Y1LA 3CE6A 1PL8A 3E22B 5CVDA 1KYVA 1WX1A 5CFNA 2ZS7A 1DINA 4RVHA 4ER3A 2IELA 4WN3A 3IMEA 1WOMA 1D6NA 2RBGA 3OOEA 1JDJA 4NYIR 3HBJA 3IV6A 1RJGA 3SR3A 5JRJA 5KWJA 1K6MA 3T4XA 1NUPA 1ULZA 4YRNA 3R24A 4ZCQA 5K4AA 5JVDF 1NKVA 3F73A 1CUFA 4PINA 3GFOA 1ZCJA 3PGLA 2FN4A 2WB4A 1S2OA 1Y9AA 5JJ5A 3I3OA 1JKMA 4B79A 4DV6B 3OTHA 2ZTUA 4GM1A 1ZRHA 2HEGA 3CX8A 4Y2VA 3NOQA 5KNCH 2RGYA 1SG0A 1JAIA 2WYWA 1JJBA 3WI7A 4NV3A 1E9BA 2WAXA 2C4MA 3OVMA 2PWYA 3P0FA 4ZQFA 3ZY6A 3P4XA 4DC0A 1SGWA 2G72A 1XG5A 5HOQA 2WILA 2A0WA 4MITA 3WIOA 2W42A 4DQVA 5ADWA 1MV5A 1AM4D 4ND4A 2XUAA 1L5GB 2QY9A 1R6VA 5JYCA 4P4SA 5KB3A 5CLJA 1NW9B 1Z4JA 1R9GA 1UM9A 2WJ3A 2YWBA 1A71A 1IJFA 4NOLA 2J85A 3EUAA 3JQ8B 3UMRA 5LCXA 3V80A 3FTEA 3P19A 4HQ0A 4KN9S 4UNIA 1CQZA 4B83A 4KSBA 1UBCA 1QGOA 3UT0A 1JX6A 2EBHX 3UPDA 4AK9A 1E2FA 1T3SA 1Y8AA 3I0MA 1PT5A 5H81A 4M99A 3BQNB 1XDBA 4FZRA 3BXGA 1E69A 1SVLA 1V39A 1CYDA 3K4PA 4HTFA 4NSNA 3AZPA 2GEBA 4RA9A 4CR7A 4H6XA 4G56A 4LVOA 1XZGA 1ZK0A 2VP9A 4AJOA 2I8LA 4H6WA 3DFUA 5AOBA 4U02A 1IEVA 1BHO1 4AG5A 3WL3A 3O8RA 1HE3A 4EABA 2RGRA 3R0JA 3WK7A 2P5UA 4G9GA 1KZ9A 1IDOA 2ZRBA 4OQDA 3IKTA 1ZSYA 1GZ5A 1V1RB 5E9JA 4KE6A 4MQ6A 1LDGA 2QSYA 2WM3A 4PGMA 1WZEA 2WF7A 3OCYA 4JHXA 1YBVA 3DPUA 3HKBB 4QXAA 1OV6A 3EUFA 4X44A 3ZWWA 3GRAA 3MOGA 4LOKA 4DJFC 1BTOA 2V6JA 2R6AA 1NIJA 2AH5A 2ZWMA 2PM8A 4U2GA 2IW1A 1YS4A 1AGPA 2XYGA 3UIEA 4BNUA 2ZZNA 3ERCA 1EM8B 2VJKA 4BKUA 1R0RE 1VIVA 3SGLA 1EFTA 4PN7A 4MVXA 1CY1A 2COUA 2WU1A 3V42A 4ZVKA 1XU9A 2XOEA 1N6LA 1SCJA 4MLZA 4XIYA 1NVXQ 3SHVA 1T9GR 1JWAB 1VBMA 1UQTA 1Z6GA 2ZJOA 3MWGA 3JD1A 2BMFA 3DOIA 3O8NA 1VI2A 4LYEA 5FV7A 3TI9A 2BFOA 3WNBA 4HH1A 1E3IA 1ZK1A 3KV1A 3EA4A 4TLMB 1WPQA 3QWIA 5KOJB 1SK8A 4KYVA 1S8OA 2QTVB 4P35A 4EB6B 4GF5A 4UJ5A 1GGNA 2XWSA 4PBSA 3RYFA 4RHUA 4AROA 5U4XA 3O91A 3OX1A 4D57A 3DE5X 3WMGA 3BRQA 2WIJA 2AKEA 2JZNA 2XRFA 1FJXA 4L3VA 1AKEA 4FW9A 1T8RA 3OCCA 4XB2A 2HK9A 3RUCA 2QLBA 3WJ7A 4Z7NB 1MVNA 3AR7A 2AHRA 4RF2A 1I1OA 4NCHA 3RV4A 3SQXA 4UU7A 1MB4A 1WCIA 5IJ9B 4ZYXA 1W4AA 3DO6A 2I3DA 3NCHA 4YRIA 1XYYA 2HNBA 3B53X 3EOBI 5EYPB 5DCLA 3L0CA 2P65A 1W76A 1ZJYA 4JEHA 1PT9A 1U2DC 1UBGA 4PPQA 3VNVA 3FHJA 2K2QB 2SNIE 4NCIA 2QYTA 2UXDB 1WCXA 3DAFA 5D3MB 3ELWA 4MV1A 4OQZA 1B8VA 1K7EB 1T10A 3RVBA 1FXSA 4YRZA 2CK3A 3BMOA 4P32A 2DR0A 2A5LA 2O7VA 3MGBA 1N5OX 3RUAA 4CIVA 1XU7A 1DKOA 4R0VA 1ECBA 2Q3EA 3AF2A 3CF6R 3CZCA 4AMGA 2VJLA 4FS3A 1FRNA 1MB3A 5LP6B 2WI8A 1VMIA 3BAZA 1KAOA 3Q0TA 4KFSA 3K8OE 4B6GA 3OI7A 3TLMA 3LNTA 2A35A 2QRUA 3ED1A 3C6YA 4N3NA 2B34A 2RFLA 2YNMA 4XLTA 3L0IB 1O0CA 3FGNA 2IY8A 3HP7A 4KUGA 2BRUC 1FRVA 1CB0A 1GGEA 1OLSA 1KGDA 2IODA 2YZGA 4KTVE 4L4YA 1O94D 5KCMA 5FIUA 3FGZA 4EATA 2F8TA 2D3WA 2XLCA 5CFPA 2D5AA 4Z0PA 1SUPA 5A9SA 4QOJA 1PQPA 1ZS9A 2EEPA 3LK6A 4NV1A 3LV8A 3E3OA 2NSJA 4V0SA 3VYVA 4AKIA 3OLWA 2P4SA 3UCXA 3QG5A 4REMA 1U1CA 1G3UA 1P3Y1 1Z0JA 3TRJA 5K01A 2V7VA 2AJDA 1TC1A 4P92A 4D44A 4YCCA 5DT2A 1M2NA 2OBBA 2QN3A 2D13A 5C7IO 1G55A 1Z8DA 4BB6A 4ZZIA 1A0OA 4Q1BA 2VOJA 5F7ZA 1ORWA 4G0NA 1RMTA 3F4KA 4QDKA 1ILEA 2HLNA 4I9FA 2X2EA 2WJ4A 2IHBA 4Q48A 4C21A 2JEOA 4DCMA 2UYQA 5FTNA 5I51A 1XZCA 2OP1A 3GCDA 5TDHA 2EJWA 3JAKA 4PAQA 1QS0B 1VG1A 3FLBA 1CDOA 1RP1A 1MB9A 1FP2A 4Q1EA 2QTGA 4MYTA 4WEOA 5A4KA 5FA5A 3I42A 1CY7A 1M72A 5DOVA 1E9VA 1BX1A 2Z1NA 4O2BF 1N0VC 4QFBA 1L3BA 2QBYA 4G4IA 3QYAA 4A10A 2NPFA 1V3VA 4HGYA 1JXAA 4ZHSA 1VLZA 4GSLA 5FWYB 5F4ZA 1B8UA 1MUUA 1F38A 4HNAA 2WAAA 1W5AA 3SXUB 5C4IA 3NC1C 1SKAA 3RAGA 3T1TA 4YIKA 5AW9A 3AP2A 4ACBA 1ZKDA 3W0LB 3DBIA 2Q7OE 4BLQA 2PUAA 2WW8A 3JQAB 1TF2A 1RTTA 3FWNA 3IUEA 2ODWA 1II8A 4AXXA 1E1RD 5LXTA 4WOPA 5I9LA 4ETMA 4KIUA 3TNFA 1NJGA 5CEEA 2G1JA 2FZLA 1FS4A 4TSFD 3V5NA 2WM2A 3QKTA 4PYJA 2J07A 1BD3A 1POWA 1Y3CE 1WXEA 2DUWA 3HR8A 1NMQA 4MMXB 3UAGA 3LCMA 2MIIA 4GDMA 2BHNA 4N6NA 1BGXT 3VUEA 2C5FA 4PLGA 4BO3A 4DEVA 5EP2A 2R5FA 5LYJF 2FE4A 1H4TA 2Q3LA 2EX0A 4M22A 4CF3A 1XAHA 2O48X 1FTQA 4EI7A 1JXMA 1KRHA 4ZGBA 1TJPB 1MO6A 4AVYA 4HDQB 3HDTA 4OY3A 2FEOA 4BATA 4D9JA 2GN4A 4BNIA 2IBTA 1MRSA 2QTAA 3AEKA 3TTWA 2AG8A 1OXMA 2CHUA 2ZSIA 2B2CA 2PL1A 5KDLA 3UFXB 3EY4A 2Z57A 2ZI4A 1YR6A 4TTVA 4KGVA 3X1ZA 5A4FS 2B6HA 2IYOA 2YZKA 3RRZA 4BB5A 4CQNA 3TW6A 2I91A 1WMEA 1SG9A 3TUIC 1SZJG 4PCVA 4PHGA 4C3OB 1G21B 1ML3A 5L3SA 2R1TB 1PKEA 2HSWA 3NTOA 3TRDA 4CMCA 1RR6A 4JB2A 1M1YE 1Z35A 3N59A 2Y77A 4M0DA 4M0PA 4ND6A 5HUQA 5L3ZA 2O07A 4JI1B 1MW9X 1QV7A 1SUCA 3I2JA 1YVDA 2R79A 1BMFA 1J90A 1DCMA 2ZJYA 4IIJF 2BH9A 2ERYA 1QO9A 4R3UC 4N8EA 3I9KA 3CWQA 4X91A 4YGXB 3R7BA 3WXBA 421PA 4EG6A 2PLNA 2ZXFA 4QDOA 3BN3A 2I34A 3IRVA 3IT1A 1TZMA 4U7WA 2WQ6A 3H5OA 3V7WA 3PX7A 3MPUA 2A1IA 2VSQA 4MHTA 3NDRA 3KE9A 5FPKA 1IN7A 4MWZA 4A26A 1QGUA 5LYJA 1BS9A 1Q12A 1W0KA 3OZSA 2P2SA 4IMIB 1UMBB 2X14A 2VDUE 5J1TB 5E8RA 3NFRA 2W2VA 3LUPA 1XYVA 3SPXA 3TRIA 4KACA 4U3JA 4WLVA 4DA0A 3BD8A 5A4DA 1MV8A 2PUDA 4DUGA 2PCJA 3CUYA 1EFHA 2H16A 4KP7A 3IAHA 2QD3A 2YC2C 3MHTA 4MZDA 4V03A 2BSAA 1TW2A 2BEUB 1YHZA 4C1NA 1X42A 2JEYA 2JRLA 1N25A 3WNCA 3VH3A 1FUEA 2XDAA 4S1OA 4EDHA 4REOA 3EOAI 4KH1A 4YMHA 2AIRA 3E23A 3TTSA 5F98A 3SOPA 1E98A 3ZU5A 1TUBA 4AZ3A 4RMJA 3KTAA 1GTL1 2GASA 4JXZA 2P4HX 2OHGA 3Q7RA 4G89A 1Y0BA 2G09A 5LLDA 4XDYA 4KQKA 4E0BA 3VHXB 1UXIA 4ZHQF 5FWXB 1J2YA 4WKNA 2HPAA 3O74A 3Q8LA 3SHWA 2Z9DA 1B6TA 1W1UA 4IIJA 4Q93A 1U2DA 3P20A 3U81A 4F6RB 1HKUA 3IIMA 2EBUA 2IP2A 2QUJA 4YI3A 1TUGA 1OKKA 5EKXA 3T4PA 3U9LA 4I7EA 2AOTA 3OX2A 3PDJA 2WTNA 1PJAA 1AKYA 4LUCA 1XC7A 3K2BA 1E64A 2PTHA 5GMOA 1NULA 5TQ2B 3DVAB 1L1RA 3DHNA 1MXHA 4CNBA 2YJNA 3COVA 4CR8A 5EEGA 3WB2A 4X64B 1G7SA 1M1XB 1TU4A 1W94A 3IC5A 4PBTA 2V96A 4CF7A 1VCNA 1TTTA 5IAGA 1ZOOA 4DY4A 1AMNA 1ABEA 2Q1WA 3C3JA 3KXDA 1J2TA 2HU7A 3NBUA 2BRUA 5GGXA 1MRNA 3VYWA 2A67A 4G8BA 3VDRA 1LRJA 1MMFB 3EY9A 2FU5C 3UH1A 2R44A 5IBRA 4D3ZA 4BQIA 1E7RA 3H4TA 5JY6A 1Y4AE 1MOSA 4EL5A 2I78A 4WESB 2QX7A 2WKQA 4FMBB 2A5YB 2OESA 4P5EA 1ZJ5A 4PTZA 5B1SA 4N0PA 3M6LA 3UW1A 1QFYA 5EFZA 3HV2A 3KSMA 5AKZA 2F3SA 4OHKA 1SIWA 1VLQA 2HBRA 2OO3A 4FYHA 4UKDA 3S28A 3PXCX 1KTIA 1F14A 2HF7A 4YCDA 1APBA 2W8ZA 4HZUA 3I2KA 2AVDA 3HDHA 4JZYA 1V11B 1ZSNA 1Z36A 1FP4A 2RK4A 1QLHA 3GUUA 3ND6A 1CPYA 5HFNA 4ARBA 1YA8A 2VFAA 3C0KA 1V6CA 5C8YB 2MSWA 1VMDA 1TZCA 1EFLA 2H00A 3EMDA 4FZ5A 4PXYA 5AVJA 3ON5A 5ALGA 1XZHA 1PG0A 4R7TA 2ZJ1A 5FR2A 3VO2A 1HNXB 3CH7A 5JIBA 1ENYA 3HVIA 4A8JA 3L05A 4XRRA 3UO8B 3TM4A 1RYYA 4JDUA 2ZJ7A 3ZZMA 1YZLA 3E3MA 1J7KA 5G2OA 2AQ8A 2ORIA 3TKLA 4B7CA 4W5TA 3ZBTA 4E1VA 3O1LA 2BZSA 4BMYA 3G7NA 4D4KA 5FNZA 3ZJTA 2WHXA 4FKBA 3HWSA 1QRTA 5DP2A 2G70A 5IN5A 2WWWA 2G5CA 3L8MA 3Q1LA 1GEEA 2FN9A 4M8NE 5EWMA 3UNXA 1IJBA 4QNNA 3GB9A 4CM3A 5IKEA 5JCJD 2CSXA 5TQ0B 4RKWA 1AA6A 4XWTA 4RIGA 4YP6A 1NXXA 2E55A 2GKSA 1X8KA 4YJ2F 1OVMA 5EMJA 4WVFA 5IARA 5F76A 1UBKS 4B34A 3PI7A 4YPFA 1JHYA 5EINA 5J1SB 5EXXA 4NMWA 1WDWB 4C0QC 3RD5A 5K0TA 3UK1A 4EHJA 3GJ7A 1NR1A 3BMNB 4D97A 2NU7B 4YAJA 1IM5A 2QZJA 3C3MA 3GMSA 3I6BA 5IYZA 5IM4F 3VMFA 2EKLA 1OLUA 3T1NA 5HBGA 1P6UA 5AK3A 1KZHA 2VYVA 1D7OA 3WWEA 1UFKA 1F3LA 3B6KA 5EZSA 4YP5A 3MCTA 1DG3A 1LGYA 5DLEA 1U3VA 2BVNA 3DD5A 4UTZA 5KAPA 2DUJA 2QRJA 1W6RA 5AHRA 1AUVA 3ZE8A 2WTUA 3L3BA 3AVXA 1C7FA 4LNUA 4L6IA 3WMWA 1NURA 3CLSD 1POXA 4UMFA 4CKWA 3GEMA 3Q3GE 3I8OA 1EP2B 4KLZA 4LXXA 2WJYA 3B3QA 3IQWA 5AKJA 4EMTA 3IEIA 4YYZA 3GOQA 2IEGA 3ZU4A 2A1UA 2QJTA 1C2YA 1C80A 2XMRA 1FVXA 1XJCA 4M6WB 5TSDA 4QTXA 1RXVA 1JEJA 3GT4A 1ZH6A 2KM1A 2PX4A 2WUEA 3OEHD 2OCPA 4X8HA 3TQFA 1ORRA 3G5AA 2Q5LA 3MSCA 1S3SA 2A4MA 5P21A 3BRSA 8GPBA 5EIXA 1RQLA 5BW4A 4Z4IA 1J1IA 3ESDA 4BFXA 2I9PA 3KU1A 4Y6QA 4E46A 4YJ2A 3MINB 1MU0A 4PR0A 3ZGYA 2YYYA 2XWBF 4HUQA 4JXKA 4LF4B 2BFDB 2AEEA 2FPGB 2G77B 4EJSC 4MUMA 2OOKA 3L7LA 4TMFA 1FOEB 1EESA 2OBXA 1XQ6A 2D0IA 2OMKA 2OZVA 1IATA 3EVEA 4KR3A 3H87A 2M1ZA 2RAVA 2PLRA 2ZIFA 1OB5A 4ZVOA 2H18A 4RPLA 2X3YA 4U9IS 5C1IA 3P1JA 1X8JA 4GWLA 5CK5A 4AJHA 2C54A 3ZKAA 5DHAA 1A7UA 5T6BA 2F48A 2I54A 1T4MA 1GUAA 5HKBA 1HOXA 1U5BB 4E03A 4Q3AA 4D8WA 4P38A 4FZJA 3A9TA 4RJJA 3SEZA 2X0RA 3T3IA 4QBFA 4QO7A 1N8NA 1WEKA 4JUBA 4MVJG 2JIPA 4Y6GB 2IIVA 4IJ5A 3J7TA 4AZWA 2JLSA 1WKBA 4KIGA 4N40A 4FCCA 2HV8A 2VPIA 1DCTA 1UKVY 4N3CA 5AFSA 1DFGA 3F7MA 4JL5A 3C16C 2D5BA 2ROQA 3W8DA 1Z5NA 4AJPA 4B45A 4DSOA 4U7TB 3TSWA 3H13A 1DQPA 1HM5A 1ES9A 3CO5A 3AM1A 1JFFB 2NU8B 5DFAA 4Z4HA 2HI0A 2PVPA 2YVKA 4ZVNA 4PO9A 1THMA 5CA0B 2CDNA 1ZKMA 2G0NA 4P2BA 1Y9EA 2DWQA 5DHTA 2J9YB 4JL6A 3W90A 1P1KA 2BEVB 4JR2A 4MQBA 4OBEA 4O4JF 5ADVA 2WB2A 5C8VA 2H0QA 3G02A 1ATZA 4FYMA 3J80A 4U1RA 2WT8A 3ETLA 4MS1A 3NWBA 1WU7A 1A4UA 2GHTA 1DV2A 1A7JA 4O63O 5HSGA 2FZCA 1CQJA 1J2UA 3G49A 3O7MA 3A05A 2R6CA 2IU3A 4HD8A 4NR0A 1JJAA 2Q7XA 3JQ7B 4CCAA 1S9DA 1Q0UA 1KJQA 1CUVA 4WLFA 1IQUA 3IDSA 5JHHB 1H1TA 4N65A 2Z58A 4W1RA 2RCYA 3SC2A 1D0SA 1P81A 1P2UA 2PXAA 3GMIA 3N5KA 4YR7A 1H23A 1M7HA 3BX1A 3UWPA 5JLJA 4JKOA 5KHOC 5KS2A 3VNAA 5KYYB 2Q49A 1Z4MA 3P9SA 1Q0PA 1GQOA 3BJMA 1RWVA 2V4MA 5BNWA 1ISPA 4WK6A 3LKBA 4HEQA 4R1LA 3G5TA 4WWHA 4TYNA 1EK6A 1RJ9A 3F8SA 4MYSA 6PFKA 1XTQA 3VHQA 1GPLA 2EZ4A 3QFHA 3JARB 1K6JA 4UD6A 2AYZA 5B30A 1OZGA 3CRRA 4YCSA 1QMPA 3ICQB 3GZTB 2BYTA 3LDHA 2R60A 1XO1A 3CT4A 2GXUA 3MW8A 4DNXA 2FR0A 1OIVA 2QRNA 5SZKB 1BVHA 3E27A 4QLOA 2O2ZA 4PCAA 4IR7A 4M7PA 1FSSA 4QTZA 2VHTA 4Y1EA 3V4RA 2P4QA 4TTAA 3V4FA 4O4JA 2HEIA 4J9UE 2PGXA 4R69A 3A2KA 1GZ4A 1XKLA 4LXQA 1ZJ4A 3INGA 3OCXA 3MT9A 1QOPB 4GP6A 2ISCA 4TTQA 1QVAA 1JG3A 1XLVA 3KKEA 5EWLB 1ZIYA 4C4XA 1NW6A 3MK31 3IALA 1TMGE 1XD2B 1Z6XA 5ALIA 4ZRNA 4E6EA 5AI9A 2DPGA 4ARIA 5FUVA 1YRBA 1LW6E 4X1YA 1F6DA 3K9CA 5ARCA 2C1EA 4QZVA 1JBQA 2EFYA 3EVDA 2IV7A 4RULA 1G2IA 2WG0A 2TMDA 3D5QA 1NVEA 1XDWA 2A88A 2CUNA 1C7JA 2PX0A 3MYRA 1DXYA 2Q27A 3B3FA 4Y6SA 4MX8A 2WU8A 4EWLA 3M6MD 4RJTA 3GH1A 3UATA 2ATXA 4XOUA 3F2VA 4BO7A 5JI2E 4Z0NA 1Z07A 1XQ1A 4MVJD 5DSZA 5BT9A 1UMKA 3A4YA 3GZNB 1RQNA 4GBED 3KQTA 4QQRA 3V7YA 4JJAA 4HNQA 4AMUA 3V46A 4RJ2A 1IWBB 2Z2XA 5DXJA 5EKUA 3U1VA 1Z0SA 4NLLA 1R0LA 4DQKA 3VI4B 4LE2A 2IWHA 3TW4A 1P3DA 3BIOA 3EVGA 3I73A 3M83A 3KVRA 5G0VA 2NZWA 3L7JA 4HS4A 5HYVA 2VQFB 5JTTA 4NEGA 2W0SA 2ZB8A 3PB3A 2EJUA 3A1DA 4F11A 2X58A 2CLFB 4AAYA 4RDXA 2OG2A 4YV0A 1N2HA 2GAFA 1HE1C 1GAWA 3GK3A 1BW9B 2IXEA 3L6UA 1R4AA 4P9NA 1EHYA 4ZMBA 2HA2A 3GHYA 4JR0A 4F56A 3OZCA 4IIHA 2QMEA 5KAMA 2B9VA 3U4GA 4FYIA 5CR9A 3HCPA 3PQ8A 3MWDB 2EIHA 2HCBA 1PGOA 2HF2A 1U6JA 1C7IA 4G4SP 1J8MF 1GZDA 3CW8X 4RH3A 2VSOA 2AK2A 1MA3A 4H18A 2XB6A 4G0WA 2R5WA 1D04A 1PTKA 2O2SA 4RGQA 1QG6A 2P9BA 4RKEA 1WVMA 4XWOA 1Z47A 2XQGA 3QVGA 1K9VF 3RJTA 4F92B 3E70C 2VG8A 4TM7A 2QUHA 2R66A 5FCDA 5LIPA 1UIMA 2I4IA 1E2KA 4ZDWA 4PG4A 1N8KA 2FP4B 3JYOA 3OQ6A 1G21E 2ZIAA 3HRIA 3MTDA 3MT8A 4N5HX 4C7XA 3ZKWA 4EJSA 2G67A 4FWBA 3S1LA 1JQKA 4LWZA 4N6OA 3WIEA 4UUOA 5HS4A 2FDCA 4GOKA 4L4SA 4MYRA 2ZCVA 3E1GA 1SIOA 2ZYAA 1JNXX 3QU4A 3H11B 2HHHB 3IT0A 1BCRA 3L04A 3EEIA 4DNPA 4ZV9A 4EZEA 1O97C 2GK3A 1WETA 2G40A 1KAEA 1CP2A 1DOHA 2RJ3A 2GD6A 2ZJ4A 2ZR8A 3GJYA 1WOYA 1UC8A 4JB8A 2J4CA 1OHHD 2ORYA 1QDEA 1A4IA 3CVUA 2BCEA 2ATEA 1SUSA 3SF8A 5E95A 2AVNA 5B37A 5A5VA 3C5WP 4G1VA 1F6BA 1G7TA 1GQ2A 1RBQA 4EOGA 1YRWA 2C00A 1U63A 4D0NA 1ZD8A 1F1BA 2AFRA 2I29A 3LQQA 1CUUA 3EZ6A 3GG9A 1HDEA 4J1TC 4UU1A 4PGFA 5DHFA 4M60A 5T3YA 4O25A 3UXYA 4FFDA 4RXTA 2OD7A 1HFJA 4R1OA 2BKUA 1TQ8A 2AYXA 2PR2A 3WYAA 1QKKA 3BXOA 4BNJA 2R7KA 1W0CA 4LZPA 1QK5A 4NQZA 4UXHA 4MDEA 1PFWA 4G5QA 2QMQA 2GLXA 5K5EA 2H9AA 4FQ5A 4FJ1A 1J00A 3K9QO 1X1CA 3ZVRA 3QPVA 2RJNA 1OFUX 1IZ7A 1ETHA 4WFQA 4RANA 4FLEA 3I9OA 4YMUA 3LXMA 4WA7A 2DEUA 4RSGA 4FFVA 5HUHA 3CKMA 4ASUA 2ZTMA 3R5XA 4GXNA 3P26A 3O8QA 3CWCA 4ZT2A 2Y68A 1NX9A 7MHTA 3O92A 3TQCA 1DPGA 3IUNA 1KOFA 1AGNA 2DUNA 1VI6A 3FPBA 1QZZA 4JJFA 2VP3A 4KPUA 4M9QA 3QUCA 2HIMA 3NBQA 3S44A 3ONFA 2XDYA 3ORQA 2JHCA 2V8BA 2O8EB 3H04A 3MPOA 1NAIA 5DHRA 5IAOA 4XYEA 3TK1A 4XSHA 3QBEA 1NVFA 2CVFA 3CKYA 3AIMA 2RC5A 1HY3A 1YRHA 2WNHA 3R6LA 2EL7A 4Q1VA 2GRAA 1ADGA 2GWHA 3B9RA 4G07A 1IBKB 4C01A 5CBPB 2O8FB 1M1NA 3B1FA 3KQSA 1V48A 4DILA 4QOGA 4CIAA 1DQNA 1JLLB 1TZBA 1PR5A 2GYWA 3BDAA 5EIHA 1NXOA 5TLSA 1UJMA 3G88A 5ELMA 3I8SA 1S3IA 3KJFA 3F6PA 2VQ3A 4OK3A 2EZ8A 3JWHA 2DULA 3VR5D 1ZONA 1SUBA 3GRKA 2G8LA 3H3XA 3ZHVA 1I94B 1BS1A 3R4VA 4BE4A 2L69A 1A2OA 1HWYA 2NXNA 2R8RA 3L7OA 3OZFA 2TMKA 1L4LA 5L6LB 3AR5A 2YV2A 3N70A 1Q0LA 1CBUA 1H2WA 5BNTA 1VLLA 1QJCA 5DBEX 3R3UA 4QWWA 1JE0A 5JY1A 1ECJA 1OBCA 2OGUA 4WFIA 1CE8B 2QPOA 2QL7A 1QFJA 2SHKA 3EXIB 3WYBA 1S7GA 3H8JA 3AUKA 5C18A 2ATIA 1UFRA 5THXA 3B8HA 2H1CA 4PLWA 3UMCA 3BXHA 1U9ZA 1L5MA 2E85A 3BFXA 4JBXA 4D9EA 1JGTA 4AB1A 3LVRE 2QU7A 1M6VB 5JALA 1EMDA 2ZTLA 3DE1X 3QMPA 4C3UA 5AIBA 1SKUA 1XTKA 2GM9A 2IT1A 2Y27A 1SCNE 4GRDA 5EMKA 5IVIA 5FUQA 3S27A 2V98A 3IP5A 1IEQA 1ND5A 2VKTA 4O2AB 3WQHA 4OB6A 2XUHA 3R1IA 4MHSA 1CY8A 5D5QA 5JNVA 1S7CA 1U3UA 5GADl 5AYVA 5JAQA 5LOVB 2HRQA 3MMZA 3Q6NA 4Q5IA 4XH9B 5JR3A 3VNUA 4QM6A 2EC5A 1SM4A 1G5HA 1QZUA 1TMOA 3VKFA 1TGVA 1W96A 3RTGA 3KX2A 4TXJA 4BVLA 3THXB 4EP1A 4MWSA 1X7ZB 2HPHA 1IUNA 2BKXA 3OTWA 4XWAA 3RSHA 3FTQA 4AWAA 1XJ0A 1E2IA 2A78A 5DV9A 3HJAA 2J9XB 5EN4A 5TGDA 3E9NA 2VQEB 3WQSB 3WGTA 4KR9A 3DE7X 3UJPA 3IDOA 2IJGX 3BPSA 3JYHA 2GARA 3KQVA 3EVTA 2ZPTX 3RV3A 5FLXA 2O8EA 1H2XA 2XA9A 3K31A 3CR3C 2D7JA 3QUAA 4KZPA 1E89A 5HNKA 3KJNA 3C3YA 3VDNB 5CAEA 2RHHA 2Q2QA 5KOHA 3DL2A 2G6TA 1OFHA 2B8TA 3LDGA 2YHIA 4IMPA 1LPOA 4HPJB 1R8JA 2M1XA 5AK6A 5GZ1A 3P2EA 3FXAA 3TB4A 4CTNA 2I7XA 4KPYA 1LWOA 4IM7A 4ZYZA 1N3IA 2NPIA 3MTGA 2HXYA 4V1CA 2ID7A 1LU9A 3G0HA 3KT3A 5JO9A 5ALVA 4OHFA 1F20A 4UAUA 1ODTC 5CFZA 3H2JA 5CH3A 3S8MA 4Z4CA 2NZJA 1HRDA 2A9JA 1Q77A 1I14A 1LJLA 3Q9LA 3WK5A 1UXJA 4YLEA 4NYIQ 2RHCA 1WW3A 3TB6A 5B7NA 1PJQA 5BSWA 2OBLA 2XZTA 4IXWA 5HK9A 3EVNA 2C9CA 4QNMA 1EVKA 1A9YA 3HCFA 3HA7A 4R1TA 1M67A 1N5RA 1QIEA 5JXJA 3K0FA 4QYIB 3RJZA 4YPVA 4TYYA 1WZ2A 3QG1A 3JRNA 2LR0A 3HJHA 3B7GA 4KHZA 4MRAA 2C4TA 3HY4A 4Y2XA 1L4MA 2J48A 2X0JA 5KYTA 3W9BA 1NP3A 3GJ4A 2G63A 2JGRA 3E2MA 3CISA 4LNAA 5EFOA 5TMEA 2BFAA 3ZTWA 1RHKA 4I5IA 1PFGA 3W8RA 1G8KA 4OB8A 1KY5A 4N9QA 4QQFA 4KN5A 5EMMA 2J3DA 4N3GA 3I5AA 3EWIA 3RFUA 3TJZA 5AJWA 4DTIA 5E0OA 4J1TA 1FS5A 4DRXB 1U8XX 4RFLA 3TWOA 2JEZA 1IOVA 2Z2ZA 221PA 3RRMA 3OZAA 4RVUA 3A28A 5CB6A 2QP4A 1V35A 2NZXA 2OILA 3GFQA 5LC1A 1E58A 4K26A 1AU9A 1IXKA 4YECA 4P4TA 2CXHA 4TLEA 2YWDA 1EVJA 1AQIA 1CX9B 3ZHOA 4XTRA 3RIGA 2ZUFA 4M38A 1W2HA 4KQIA 2B35A 3OURA 3OOJA 4LFAB 3FETA 2GX6A 3N1UA 5BOSB 2XXAB 1BSVA 1X7YB 4ZVUA 2BMVA 4WNCA 1RZRD 2E4AA 1LPNA 3WAKA 3L2OB 4C4OA 4PZ9A 1A04A 4ZI7A 2GRUA 5A4JA 4U2EA 1N2ZA 2FWJA 4M9UA 1MF7A 2QW1A 1H66A 3JWEA 4I8IA 1DDGA 1E3MA 2PRKA 4Q03A 3RWBA 2Q46A 4CBVA 1YI0A 1ENZA 4QG7A 2IWRA 4LJYA 4AJNA 4UCWA 5KSOA 1JLMA 1MIHA 2JBWA 4F4JA 3FY4A 3A6EA 4MP6A 1AZTA 1RHMA 1F51E 1XZMA 2RMKA 4J0DA 3AIKA 3RK1A 2QUAA 3TMAA 3ZQKA 1DTWA 3O1IC 4OIFA 3QNMA 5B6PA 5I7OA 1Q2XA 4MROA 2O5CA 3BTVA 4MR7B 4LZLA 5DN6D 3KSBC 1USUA 4ZCRA 1TJ5A 5CLQA 2GS9A 3DMHA 2B30A 4KV9A 2PUEA 5FPQA 5LQDA 2JLCA 3O0TA 2OLEA 3HKDB 4KR7A 4IL5A 4Q7KA 3SM3A 2B4QA 3JX9A 2DPXA 3S2UA 5DNUA 1AV6A 3GJRA 3JASB 4LBYA 1V7PC 5G3YA 2JIDA 4MYDA 4OLAA 4D82A 2JASA 2Q1TA 2H2AA 3NHKA 1O58A 4MQFA 5ENVA 1I3MA 3VC7A 5A02A 5BWBA 1WBBA 3GRRA 2WABA 3IQHX 1XF1A 1M34A 3E1SA 4A2CA 1U0BB 4N18A 3CR8A 4LFCB 1XIVA 4HN2A 1JWLA 1PS0A 3R0VA 2YH2A 4YCAA 2ZI3A 3HHEA 2CZGA 2YOFA 3WKEA 1J9ZA 2QIPA 5IFLA 2YRWA 5G0TA 1U4NA 2FWMX 3DBHB 4MMYB 5A05A 3ZK8A 5GONB 3W3ZB 2Y66A 1I7SB 3R3JA 2BBOA 721PA 2HWUA 1IONA 1LTHR 2NYRA 1GHTA 5H16A 1WSAA 4G4GA 1OU4A 2Q6IA 4KVZA 4BMCA 4OHCA 5AXDA 4M0UA 2H1VA 1VL1A 1VBKA 2PWZA 2Z4TA 3A4NA 3LSYA 3MS2A 1JIVA 1UADA 2B1RA 1C9KA 5HF8A 1P4RA 3UUEA 3B6MA 1J21A 1V5FA 2O7SA 2YMLA 3GFFA 4ZI5A 2G80A 3A6GA 4UM7A 1C7QA 5B58T 4B3RB 1T6BY 3SDSA 2CW5A 3R0QA 1AO0A 3LAWA 1YXMA 3IOBA 3SSMA 1YU9A 1L8OA 2Q6TA 1SULA 2ILTA 2AMVA 2J5XA 1T3GA 3M4XA 4OXNA 4ZQGA 4EM6A 3PT5A 1KHHA 1QG4A 1Y3DE 1Y7IA 3OPYI 4LJ8A 3TRKA 3S29A 3ZVMA 5TE9A 1NC3A 5DOZA 3ZI0A 3ZWKA 2EATA 3KPUA 4M9ZA 2QN7A 1S3FA 4FINA 4YAIA 3CG0A 2DBVO 5EI5A 5KNBD 4FWTA 1FLVA 2XF2A 3C4VA 3NGLA 5CVUA 3KSAC 2C3MA 4QQKA 5DW3A 4GGPA 5AKYA 2Z2YA 3G5UA 4O4LA 3DM5A 2EF1A 4WV3A 5JPIA 3ZHZA 5BUQA 2Q4RA 4IGFA 1F2UB 1ZD5A 4Z1MA 1KKMA 2ZTVA 1U1DA 1XQYA 1SC4A 1T1EA 2XXJA 3G6WA 4PZZA 3LY5A 3VDQA 4D7AA 4OI4A 3SI7A 1NW7A 4DXHA 1Z37A 1MC8A 3AF1A 1TCCA 4IIUA 5HZKA 4RX1A 1Q1BA 1U8UA 4UU0A 3BHJA 3JVVA 4B76A 4EHAA 2IYFA 1S02A 2E5LB 4KO3S 5BN1A 4ZOLB 4WXRA 5D3QA 5J2TB 4W9MC 1AHIA 3F6SA 4JLMA 4DF3A 5LMCA 1G59A 3IKMB 5CTJA 1ADYA 1RXCA 5HDBB 3VJRA 4LY9A 2HRRA 3FN4A 3F8TA 4I0WB 3M5WA 4URFA 4BEVA 3JWPA 3CKLA 3PXEA 1SN7A 4OQEA 9LDBA 1TQ6A 1U8YA 3C14C 3HVKA 4OIMA 1HR0B 4PRLA 2HWKA 3TNYA 4PYRA 5BQXA 2W6OA 4NCNA 1Q92A 1AK2A 1RQ7A 2ALJA 3DB2A 5TJ9A 4OXRA 2MMGA 3ZGOA 2OHHA 1O94C 2FOXA 3CW9A 1CJBA 4HP8A 1LA2A 4IEEA 4LE1A 4D42A 5BSRA 2WHQA 3DO5A 3UKDA 4DBLE 2YXNA 2ZE7A 1X80B 1IUOA 1V6SA 6NULA 2K87A 1E1YA 3FLAA 3GEPA 1PTJC 4Y7CA 1N6HA 2BFWA 3FYUC 4J7XA 3KALA 5EIFA 5D86A 4G0OA 2GLTA 1X7WB 2FZKA 4H0FA 4MTCA 3R9XA 1JDVA 2GF2A 2HM7A 4JCOA 3G59A 3VYUB 1LBIA 5CB4F 3BD6A 1XJWA 1KBZA 3N39C 1L5SA 3HHPA 3TOCA 4A2PA 1T0BA 5CEFA 1JH8A 1W4LA 4QREA 1T34A 3P0RA 3DBLA 2IS6A 2VBGA 4MIYA 3I5XA 1PR0A 5E7MA 4BNFA 4KQXA 3RS8A 5F7OA 4DSTA 5K0NA 3HKCB 3DAOA 1VKRA 1Z2CA 3H9BA 3WRYC 5AVQA 1GAQA 4NMMA 1U0FA 2JLQA 2KSQA 4CQLB 1DBPA 4AY2A 1CY0A 1H94A 2IHJA 3RYIB 1DBVO 3K0SA 3ENNA 1TMYA 5CNIA 1VIAA 1KH3A 3B9QA 4YAOA 3TL2A 4EHLA 4RC9A 1WZCA 3HFRA 3A1WA 4QGAA 3ESXA 1YBHA 4D92A 4F8YA 2ZRQA 1TM7E 3EAQA 4IV0A 2G17A 2WQZA 3C3KA 3PXDA 2HQOA 1RABA 1J07A 1RWXA 2CCKA 3I2FA 2ZDHA 1GSAA 1NG1A 1CY6A 2LCIA 1A27A 2XHZA 3IOMA 4I4NA 3MT0A 1HLGA 1QK3A 4GX1A 4MVJM 1Y80A 3Q40A 5DLQC 2CUTA 5GGYA 3W06A 3FOFC 1JW9B 5MF6A 1PNVA 3LVFO 4EQ6A 1A97A 3I32A 4YMWA 1Y9DA 3ZDRA 3P9IA 2ZI5A 3K1TA 3E81A 3TSYA 2XKBA 3AP1A 1WRBA 4FFOA 5LQKA 3BRWD 4QL3A 4QECA 2W71A 4KBFA 1Z7WA 4ER0A 4A15A 3HU5A 4AP6A 2ASVA 3WLNA 2JIZD 1EWYA 3PGXA 2I3ZA 2JKVA 2VT7A 3IAXA 3PUZA 3F3MA 4GO1A 4Q9KA 1RMQA 2JANA 1B14A 3CS3A 1LC0A 1KYIA 4UUAA 5CDUA 4ZXPA 4WN9B 2HMTA 5REQA 2I4OA 3A1NA 2JHFA 2VSFA 1HDCA 1NTRA 3K70D 5BP7A 6REQB 3X1XA 1JT2A 2W6CX 4OLHA 1ZR2A 4QPPA 1PUJA 5AVVA 1JLHA 4WHMA 4JI8B 4HAXA 4NPCA 1DKRA 1XZJA 3UKJA 2VHCA 4JA0A 4JY7A 5KNDH 3JU3A 3MIIA 2B1IA 3CLTC 3GNTA 3KTDA 4PG6A 4RTRA 4W5RA 5F2KA 2QVZX 3AV3A 1RWKA 2MYTA 4L4XA 3IUPA 3F6YA 3OIDA 5K3AA 3ZH9B 4P4NA 4FM9A 1XZIA 3O3NB 4NC9A 4K5QA 2QIOA 5T5QA 4DMUB 1BDMA 2C07A 3QU7A 3DDWA 1SBZA 1I4WA 1C30B 4G0YA 4AQYB 2YYAA 1M2VB 2NUBA 4JU8A 2YHUA 4WXYB 3EASA 2J6HA 1ZVVA 1M83A 3IUQA 3LX4A 3ZV5A 3VH2A 2X0NA 5K0ZA 2JFQA 2HA5A 4ZIRA 3JD2A 3DLPX 1N32B 1X0VA 5CFMA 4MKHA 1TJ3A 4WKPA 4OQLA 4RH1A 2PVCA 1NBMD 1UK9A 4FUQA 4NDNE 2A5DA 3AGQA 1XK6A 3DQPA 3WADA 1P72A 4D98A 4ZT5A 3ZWAA 3FWZA 3FYDA 3JWIA 3FWKA 2FDXA 1TVMA 1GV0A 4DCOA 5H9VA 1SOAA 2HJWA 2IE0A 5BXQC 5CHEA 3ZV3A 2BUBA 5HEKA 2O2CA 1GPDG 2DSTA 2FFAA 2QVXX 3HDVA 4V0ME 2A4KA 2IYQA 2FX3A 1KFBB 2VK4A 1HA3A 2GMWA 1BD4A 2XWJI 3EDRA 3ETNA 4TYQA 5TPZD 3RF7A 4BGVA 4EVRA 5JJBA 3D6MA 4II3A 5F5XA 1Z8HA 1I80A 2QGNA 1T2NA 5F7XA 5AKXA 2YN2A 3C98A 3WTCA 2GD1O 1OI2A 2APJA 5BWOA 5IKXA 3ZDBA 4FFBA 4O2LA 3T5DA 1W49A 1UWKA 1YL5A 2ZPUA 4PC3A 2Z5FA 3FCXA 3PDIA 4ZVPA 2IITA 2RK3A 3K15A 3OIWA 3VZRA 4GKKB 3OH8A 1MG0A 1RAEA 4UCXA 2LXNA 3OC6A 1UPCA 4MI3A 2AOWA 2IV3A 4CQMD 1H1DA 3NVDA 1UODA 2J30A 4KR0A 5JE8A 4Z49A 4GGMX 1VP3A 4B6EA 2R1VB 3RS9A 1NVWQ 1L9XA 3KUUA 2A2ZA 4FFRA 3ZC3A 4JU9A 5JD6A 1E32A 2GAOA 2NSHA 4DPKA 4ZC1A 4EKNB 3WGIA 1UQUA 4GI3A 1CP3A 1OI4A 1SB8A 1XUOA 1LLQA 4ZQBA 5M29A 5HZMA 3NO4A 3SSNA 4LJAA 3GNLA 3NYWA 4JLAA 3CUUA 3PJGA 1Q0ZA 2OV4A 3SHOA 1K68A 2XLBA 3UY4A 3AVQA 4Z0HO 3MOIA 4W7IA 2YCBA 1QUEA 3O8BA 4B46A 3NEPX 5HMMA 3U3KA 3W6UA 1CHNA 3PI6A 2JJMA 4CODB 2PKCA 3T5TA 3UAZA 4RYLA 1EP9A 2DFDA 2JI4A 2P4UA 4I8XA 3UV6A 2PGJA 2JJQA 2CXRA 4FNMA 1JMVA 2OTCA 3HR7A 2Z3ZA 3VVCA 4IIDA 4E5KA 3H1GA 2XUQA 2O8DB 2X41A 3REOA 1GT6A 1O94A 2V58A 1GU7A 4LRYA 4FMCB 3TINA 3WZ2A 2P2YA 4UQLA 3AEZA 5CXUA 4FYVA 1X13A 3NHRA 1ODFA 1PTJA 1W93A 4KVAA 3RQSA 4GM0A 3VR1A 2R8BA 2CN1A 4BFYA 2ZUUA 1R8SA 2JAUA 1RWMA 4PGAA 3ZGNA 4WOCA 3GAZA 5I3CA 3AFOA 3KP1A 5AJUA 3NTLA 1IVSA 5JG7A 3SQOA 1UJ2A 4J4BA 1KA9H 3DGFC 3OZRA 1UK7A 3LQYA 1YAHA 4TLBA 4PAMA 5A2QA 3CLVA 3HI4A 3D81A 4JOSA 1WF6A 4ENWA 2PZ8A 2Q07A 2H3EA 3C3DA 3WRYA 4Z3KA 4MQEA 1H2ZA 4JXJA 3MB8A 3H1BA 3F5DA 1O96B 1TEVA 3O26A 3PE4A 3QOFA 3VKVA 3PSHA 3MJ4A 1XGKA 5LYYA 3UK2A 3ILHA 4ENTA 3F71A 1EI9A 1WNTA 2KJQA 2ZTHA 3I1IA 3PFKA 3MBKA 4J0FA 2DE0X 2LPMA 3WRWA 2A14A 4UPVA 4CKBB 4EO4A 1JR2A 3K6JA 3TF5A 1PZXA 5E38A 3OICA 4AUKA 1E8MA 5B64A 1QRDA 1TZJA 4TZKA 3NHWA 2HV9A 4TV8B 4DVGA 1Q50A 1V4NA 1L8LA 2AR0A 1I4LD 4LRQA 2D3TA 5D2CA 4EG1A 1M2HA 2XTAA 1O9BA 2HH9A 2JHAA 2JD1A 4ENSA 5CDYA 4U7PB 1GTSA 5KINB 1JVBA 1RYNA 1YGYA 2YJ3A 1N2JA 2BDUA 3ZHQA 5BT8A 4HXYA 2ZI6A 4J29A 2XCTB 1E1RA 1UKAA 4R6XA 1B7GO 2X6RA 3TAHA 1AQLA 3I39X 2DQKA 3QW4B 2AQHA 1NW8A 1DOZA 4TSFA 1Z34A 4LOHA 4P5PA 4CMGA 3R7NA 1YNSA 4JJKA 2O8CB 2CJWA 1C29B 1XXHB 4AO7A 1PJRA 3EDMA 3M2PA 3GLFA 4WGGA 4WJKB 3OQJA 2VBCA 3I0ZA 4LZNA 2DHQA 4MP3A 4B3CA 3N2KA 1YQTA 2ACWA 2H1LA 2OENG 4UVHA 3ZWBA 2RHDA 5AW0A 5WRFA 4N82A 2QJFA 4AY3A 3D4IA 4JLSA 3NIWA 5BOVA 4B7UA 3EUEA 1NZJA 2WYHA 5LJLA 1CUBA 4NJMB 2X0KA 4YUXA 4QODA 3AHCA 3CJTA 2PUWA 5KYXA 2YIJA 3DH0A 3VPGA 3ABSB 3D6HA 4OGGA 4PIVA 1BXGB 3ROXA 1EUDA 4AJIA 5EJ5A 3VSDA 3RKUA 1MJGA 4Q15A 5LM3A 5TT1A 3WZLA 3DAHA 4DV2B 5AW2A 4IQ4A 4RV5A 4JC8A 2GYUA 4UUQA 1SD1A 4YHBA 2W00A 3KBBA 3PC8C 1HQCA 2GEDA 1KI7A 1MG5A 1N4AA 4F4HA 1H4QA 4BEJA 1N3BA 3ZQ6A 1J0EA 2LUOA 3G5LA 3JZAA 4GS5A 4TKMA 4R2IA 1RWNA 2VXYA 5JSKA 1W36D 1FK8A 1G64A 1LK0A 1N8SA 4UW9A 1GAEO 1M0EA 3WMEA 3N6RA 2XCQA 4RBNA 4BMDA 3E9ZA 2XE7A 3O1JC 1G8MA 1N0UA 3GPIA 3H2KA 4OA8A 2NU6A 4BVAA 4KXXA 4CDRA 3QE4A 1N92A 2LV8A 2VPWA 5K3BA 1ZD4A 4UPEA 2CFCA 2Y2VA 1CNEA 4RD3A 1XALA 4L78A 3QUSA 2VA8A 2IUSA 1PFUA 1FB5A 4KWCA 3GLSA 2ID4A 4DAOA 2PDAA 1DMRA 4KDEA 1RWWA 2VHWA 3UWKA 4OU4A 1O0BA 1D07A 2HQRA 2C88A 2PQ0A 3PDWA 5FTJA 5FYQA 5A6SB 3ND8A 4C04A 1ECCA 3S40A 1NBHA 2BZ1A 3IE0A 3TZLA 3R5TA 3Q6IA 1O9GA 4N54A 3RIYA 5EPEA 3QW2A 5JISA 1YO6A 2XDWA 2QM8A 2RH5A 1RHQA 4K9RA 1JZSA 1W85A 3UWOA 1QQTA 3AKDA 3F1LA 1N7HA 2PLFA 3F2IA 3NBMA 4S12A 3E9YA 4U5QA 4YROA 3UG6A 4CLRB 2DT5A 3BICA 4CFSA 3LYLA 5K0SA 1KZ6A 1K92A 4KB5A 3GQBA 3BH6A 3HXKA 3LUFA 4P34A 4RVDA 4C06A 2CY0A 5FOSA 2C1XA 1GA6A 1LXCA 2RCNA 5F5LA 1NN3A 2MYUA 2PMWB 4EIWA 4BV3A 1ZGCA 3RTBA 3GYGA 2YXDA 1TM1E 3DGEC 1HT1E 3GX1A 5EJ4A 5AVZA 2PQMA 1P6QA 4R0MA 5D5HA 3T7AA 3WGGA 4UM5A 3B9PA 1E2QA 1L7BA 2FUG6 4E2XA 2GPNA 3IAAA 5CIQA 3CQ9A 5HA5A 1VBNA 3VGPA 4M49A 3IVMA 2NYAA 4A91A 1P0FA 4XA8A 3C6MA 3RR2A 7MDHA 3GT3A 3QNUA 3V6MA 4PG8A 1HOTA 5LVAA 1P1FA 1Z29A 4HFRA 2QRPA 4I5FA 1PGNA 4PQEA 5CRIA 3RWOA 5C7YA 4WTOA 4DPLA 4KAJA 3O95A 2ONZA 1NV9A 1T6ZA 3K8YA 1CS0A 4GG1A 3TQOA 2BMEA 1SPXA 4YJFB 4FNOA 2OWDA 4B4DA 1L4HA 2PUJA 5JQWA 5E4YA 4E15A 4ZGWA 1UINA 2A3NA 1PQWA 4XQCA 4C7OB 4OXXA 1BN7A 1IN8A 4MV7A 4NK4A 1P44A 1W48A 2IOYA 1A1VA 2H0AA 3NIFB 3FNIA 1X38A 1Q0RA 4FMPA 1T9DA 3LWBA 1R8XA 2AR7A 2FPSA 3GEHA 4QT0A 3MZ0A 3P71T 3KB1A 4ZWNA 2B82A 1A76A 1Q16A 2R97A 4GVLA 2AXQA 2HRDA 3T1OA 2FEKA 2HWWA 4MWBA 4IQ0A 4LOIA 3P9NA 2A9OA 3D3EA 4FEGA 4H1UA 3ID6C 4EA6A 4JC0A 3WV5A 1ORDA 2VJAA 3AMVA 2MYPA 3V34A 4HWOA 2JFUA 3X1MA 4I14A 3N53A 3PCRB 1NNEA 4RYDA 3W5IA 1PYOA 3RSQA 2IYAA 3AHDA 4BXOB 4RPCA 1W4BA 5HILA 1LQ2A 1UDCA 4PVCA 4XQ9A 1U8EA 4F38A 1IZZA 2DAPA 3ZNNA 4ES6A 3RT9A 4A0FA 5ALNA 5AJZA 1HDXA 1OJLA 2ZJ3A 3SKXA 1DRJA 1E5TA 1WLSA 2JCGA 4R8LA 5JNWA 4B9EA 3IT2A 1TEZA 2O8VA 2NZUG 5EJ2A 2P9QA 2ZB3A 4GPEA 2PH5A 4DIMA 3UMYA 4LKRA 3L6CA 5EERA 3VU9A 1QB8A 5DYTA 1ZUNB 4K3VA 4IVQA 1EB9A 3VV2A 3WJAA 3BHMA 2GPAA 3DL4A 3QQ5A 4PWYA 5FL7D 5AW8A 4MR9A 4JI5B 1N9GA 3AR3A 4IKEA 1D4OA 1G8YA 1XD9A 1HLFA 4HR7A 5JCJA 2ONCA 2HHCA 2XUFA 4UM9D 1OWLA 1P0PA 3D7SA 1ISIA 1DADA 1KFJB 4Q24A 3TDKA 4Z4GA 3ND9A 4EG4A 1SWWA 2FW8A 4KK3A 3VO1A 4IVRA 1R7RA 3AXSA 1E3DA 3KG2A 3CV3A 4TUYB 4BFCA 4M1YA 4DBVO 4ESOA 1DJMA 2OM2A 2WWHA 1ZINA 2ZBUA 1VDZA 1ZUHA 2QTTA 3V32A 4WBNB 1CJUC 2NAFA 3UAYA 4DADA 5HJEA 1A8SA 4XFKA 1A96A 1GSHA 4UMVA 1CIVA 3FLMA 4OTZA 4OKIA 2IXBA 5BW5A 1NM5A 2IUFA 1KI4A 3MQ2A 4XB1A 1NE2A 2QAGB 3AESA 4MO9A 4RDHA 2P9JA 2V6IA 3IMGA 4GP7A 3AERB 3SQWA 2IEAA 4EYSA 2MSLA 3HWWA 6Q21A 3FZNA 2PMCA 1ESNA 4NQRA 3N2NA 2XAAA 2XT6A 4DQUA 4ZFNA 2FWIA 3BSSA 3HLKA 3QY9A 5KVQA 4HMQA 1FRFS 2DETA 3OLYA 3Q3EA 4NBTA 2VJMA 1YFLA 4QU0A 1MPXA 5D3ZA 1ZN8A 1K6EA 2YN4A 2WIKA 3CU5A 4DWOA 5EJIA 1UCFA 4D3FA 4RTSA 4E7PA 2QX9A 3G89A 4F45A 3GGOA 5FHRA 3T12A 3U31A 4BY9E 2MSCB 1YR9A 1IIRA 1H42A 1ZH8A 3NATA 3OEHA 4JGIA 3ZWNA 4B17A 4ECEA 3RADC 1IQRA 4RLFA 2VAMA 2CVQA 1JSLA 3W05A 3R5SA 2YYZA 4B4WA 2FJ0A 1EAMA 1REQA 1OXXK 1XD8A 4DLAA 4GECA 1DKLA 3DEFA 2G9RA 1EIZA 5DBIA 5F21A 1KRWA 3BWEA 4KFTA 3SJCA 4NU6A 3MERA 2ACKA 1V3QE 3C7CB 1CDEA 2F3TA 2JG3A 3L8FA 4YRDA 3OFND 5LZ5A 1PCXA 2BY4A 1U3GA 3OBIA 4S1NA 5IPFA 3VU8A 3ZJ4A 1GCAA 1TU0A 3L7BA 4MWGA 7AT1A 1T8TA 1ZQ1A 2J6CA 4RH0A 4EB8A 2C8JA 3DXZA 4GPAA 3W8FA 2EGGA 4KTTE 3ESAA 4P4SB 1G8PA 3S7TA 3SIXA 4ANFA 2FHPA 1UM9B 1QRUA 3EE6A 4W8GA 5HE9A 5BW8A 1J8DA 1P2BA 5A0VA 2KW5A 1EFCA 3G0GA 2VHYA 1H1LA 3OG9A 3UFXA 5EXEA 1FSZA 4A7PA 1DAPA 4CMBA 1RI3A 4ITRC 4XEHA 5B5SA 2ZSBA 5TEVA 3GRVA 2ZRMA 4HTFB 4PGHA 1GPNA 1KDPA 4RA9B 3FDXA 4LQCA 3U0BA 1ZK4A 2DZDA 3OUUA 3VOTA 4DDUA 1X7XA 1UJBA 4OI0A 4UOEA 3F98A 3OEED 2IYSA 5IU6A 1NI4A 3PJRA 2QGFA 3HB0A 1E2HA 1U7PA 4MAFA 2JBHA 2O7NA 4MUEA 5BRAA 2Y05A 3ETJA 1RAGA 3RVPA 4ZV7A 4IXDA 4CDNA 3A1CA 1W9MA 2IOFA 1P5ZB 2J1LA 3F74A 3Q4GA 4OXIA 5DP1A 1MDFA 1SCQA 2HNKA 3VTKA 2JH8A 1GR1A 1W34A 4Q4AA 3EPRA 5DWQA 2NQTA 3BFJA 5E1DA 3ZE7A 2BP7A 1DTEA 4TMZA 2ODQA 4LJ4A 3GEGA 4I50F 1II9A 2FPLA 4JFAA 1K89A 4DCTA 3S6JA 1P39A 1XCPA 1OWOA 2AEJA 2QLJA 3LF2A 4GIBA 4GZ6A 4NDZA 2PYDA 1IHDA 2ADMA 3MUFA 5JWOA 5DU2A 2WKRA 5HCNA 3JQBC 3MAGA 2X0DA 3WL8A 1DG9A 1G0NA 2VH2A 2P9HA 3PHCA 2QM0A 1FLDA 3TXYA 3QKIA 4MVJF 3LBIA 3RG8A 3B48A 4S05A 1JI3A 2X5OA 3AFHA 1VXOA 1S5PA 3T15A 1SU8A 2ETVA 2VJYA 1YFKA 5CCDA 4IDAA 4AWBA 5AJTA 4QO8A 1QTNA 1WB6A 2YZ2A 3I30X 1L4KA 3ZS9A 1NAHA 4MJXA 4AJJA 5ITZA 2JKZA 4RW0A 3T6KA 3V48A 1Y5IA 3T7IA 1HDIA 3FFWA 4ZARA 4FR0A 5G02A 5DCYA 3UPUA 1K8RA