2BFCB

Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
341
structure length
332
Chain Sequence
AHFEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
publication title A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 127
structure length 332
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bfcB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bfcB01
2BFBB 1Z8NA 2XT9A 3OE1A 2NXWA 1IK6A 1MCZA 4JUAA 5I4IA 3AHDA 1X7ZB 3AHHA 3EXHC 2VK4A 3HYLA 1ITZA 1NI4A 2WVAA 1W85B 3JU3A 3AHGA 3DVAB 3EXG1 4D5GA 3AHFA 1OZFA 2OZLB 5I5GA 2QTCA 5C4IA 1V11B 3EXEB 5DGTA 4ZP1A 2JI6A 4MPPA 2JLAA 1X80B 2C3MA 4K9OA 3ZHTA 3LQ2A 1OZHA 3EXIA 1UM9B 1X7YA 1OZGA 2YICA 5K6RA 3ZHSA 2IEAA 1NGSA 1R9JA 2Y0PA 5I51A 3M6LA 1OLXA 2W93A 2BFEB 5HYVA 2BFDA 2J9FA 5HJEA 2BEVA 3EXFB 4COKA 5K3SA 2BEWA 4JU8A 1V16A 2Q5OA 2C3PA 4KXXA 1UPBA 2JIBA 4C7XA 1OVMA 1V1MB 2IHUA 5HHTA 1V5EA 2IHVA 1DTWA 2DJIA 4K9PA 2AG0A 3ZHQA 2O1XA 4FEGA 3M34A 2C3YA 1TKBA 2PANA 2Q27A 5DEIA 1B0PA 3LPLA 2XTAA 2UZ1B 2BEUB 3EXHB 3FZNA 2R8OA 1ZPDA 2Q28A 3AHEA 3UPTA 2VBIA 4K9NA 4K9KA 2G67A 3AHCA 2BFBA 2BFCA 1W88A 3M7IA 4MZXA 4MPJA 1UPAA 4MQ5A 2BP7A 2Q5LA 2WVGA 4KXVA 1POWA 2C3OA 2YIDA 4KXYA 1UMCB 2UZAA 4RJJA 2R8PA 3E9YA 5EJAA 1V1RA 4GM4A 2QTAA 2EZ8A 3ZHUA 1WCIA 4MPRA 1PO7A 4KXWA 1AY0A 2IHTA 2Q5JA 1YHZA 1QS0A 4K9MA 3EXIB 4Q9DA 3AI7A 1X7YB 1U5BA 3DV0A 3LQ4A 2C3UA 4FEEA 2VJYA 5EJ5A 1X7XB 2C42A 1T9CA 5FEMA 1Q6ZA 1T9DA 1UMDA 4JD5A 1OLXB 3IAFA 2VK1A 2BFDB 2J9FB 2BEVB 1UPCA 2JI7A 2BFEA 3EXFA 1YBHA 2BEWB 4XEUA 3HWX1 5K6TA 3L84A 1V16B 1OLUB 3EYAA 3DUFA 3IAEA 1YHYA 4GPEA 4JUDX 3F6BX 1L8AA 1DTWB 1JSCA 2R5NA 3ZHVA 1TKCA 4GM1A 5I5EA 4QQ8A 2JGDB 2BFFA 1X7WA 2XT6A 5EJ4A 1UMBB 3FSJX 4QELA 2FWNA 1PI3A 1RP7A 2X7JA 5ESDA 4K9LA 2Q5QA 2BEUA 1OLSA 3EY9A 5EXEA 3D7KA 2EZTA 5EJMA 1Y9DA 4GG1A 4GP9A 3HWWA 2PDAA 2BFCB 1W88B 4KGDA 1TKAA 4JUCA 2BP7B 1T9AA 1X7ZA 3F6EX 1POXA 1NI4B 4RJKA 4KXUA 1UMCA 3LQ1A 1T9BA 3RIMA 2Q29A 2EZUA 3FLMA 3AHIA 1W85A 4JUFA 1QPBA 3M49A 1V1RB 3DVAA 4WBXC 5EJ9A 2OZLA 2JI8A 1V11A 3EXEA 2FN3A 1TRKA 5EXDA 1WCIB 3MOSA 1V5FA 1X80A 2VBGA 2G28A 1YI1A 1YI0A 1QGDA 4C7VA 1UM9A 1PVDA 1YNOA 2JI9A 1QS0B 2VBFA 1U5BB 3DV0B 3UK1A 1V5GA 3EA4A 3EXG2 1X7XA 5HGXA 2EZ4A 1UMDB 2PGNA 3ZHRA 5IMSA 1PYDA 4JU9A 5ERYA 1YD7A 4QPZA 2PGOA 3AHJA 2AG1A 2JLCA 1N0HA 5EJ7A 5DGDA 3DUFB 1OLUA 1V1MA 3OOYA 2E6KA 2O1SA 2C31A 4JUBA 2WVHA 5K2OA 2VK8A 4RJIA 4GM0A 5ERXA 1GPUA 2BFFB 1X7WB 5AHKA 1BFDA 2JGDA 5EJ6A 5EJ8A 1UMBA 2EZ9A 2UZ1A 3EXHA 4K9QA 2G25A 1KEKA 1OLSB 3KOMA 4D5EA 2V3WA
chains in the Genus database with same CATH superfamily
4BAGA 4JVSB 2QDXA 3E7XA 3HUFA 4L0DA 1A88A 2JBAB 4FZJA 3ITEA 1DWUA 2NSDA 1MQSA 3W5IA 5BUSA 3CNQS 1CQIB 3HGMA 4OX9B 1KBZA 2VF7A 3UW3A 1MN6A 3JTMA 4MV9A 3SKYA 3P96A 1QTIA 2PKCA 4RPHA 3FMGA 2HA0A 4EY4A 4BVAA 2AYYA 1KETA 1YRHA 3CNEA 1Z5WA 3JALB 2V4MA 1QZZA 2GAJA 3Q0IA 4YMWA 4AL4A 3WL5A 4BV9A 2XMRA 5CITA 4DMGA 4UU1A 3WBKA 3OIGA 1MA3A 5KAMA 1A2OA 1J8YF 1REQB 3QZUA 4NMLA 4WNYA 4ZU1X 4NYIR 4XDHA 5LMUB 4PICA 4IXNA 1RMQA 4MQBA 5K8VA 3PUKA 1Y6FA 1N3LA 4RS3A 5HFAA 3GLRA 4Z9XA 2QP3A 3R44A 5F1PA 2Q0QA 3UGTA 4BMXA 5HCNA 3K8QA 4QUBA 2JFBA 3AVQA 4WUVA 4MIKA 1WABA 1JZTA 2OZLB 3OESA 1G20E 5BQOA 1SKUA 1XZNA 4N01A 3SQOA 1NATA 4GOKA 2FX3A 1Y1LA 1ID1A 1D4ZA 2JLZA 1SO8A 2ERXA 2G17A 1ZXLA 4DN6A 2B1IA 2C3MA 2K87A 3B6ZA 1CF9A 3H3XA 4WT7A 1DEOA 1VHJA 1YSCA 1FYXA 1AC5A 2QLBA 1Z2DA 1JQBA 1K5DA 3AFOA 2FWRA 1RI4A 3WYDA 1WVMA 1NKSA 3E9ZA 1CUZA 2NO7A 2YJ5A 4OATA 2A5YB 5J1TB 1NMQA 2VJLA 5B1DA 3WJ2A 4QDOA 2XMZA 4M60A 4D4HA 5JSUA 4B3FX 5GV8A 3E7WA 2YS7A 3CLRC 3CU5A 4H0CA 4R69A 5FTKA 5T67A 3VU1A 4E1AA 4EW6A 1DGQA 4AYWA 1XZEA 3JVIA 1XA3A 3W06A 3HHPA 1TYAE 2X77A 2W93A 3KLBA 1A7KA 5JYDA 3GFPA 1NWCA 3H97A 4L6CA 1RXCA 1RYNA 2B9VA 3MWKA 4R0VA 3DFUA 3ASVA 1YR6A 1VLLA 3EVZA 4K26A 5DTJA 3U3JA 4H7KA 1VE6A 2UXBB 3M8KA 4MKRA 3KAPA 4PC2A 2BT4A 2I8CA 5TQVA 1ISHA 4I1SA 4ZANA 5DXFA 2P11A 4DIFA 5C1PA 5JZBA 2HUNA 1HFJA 5L4NA 4F4HA 4B3CA 1Y8QB 1E96A 4KQXA 2Q5OA 4CODB 2O2SA 2QAGB 4FJ2A 4GC9A 5THXA 1O4VA 1A96A 3BQNB 3PQ8A 4UATA 3IA2A 1PR1A 2RONA 1HURA 1TTTA 4BZXA 2XZLA 2HTFA 2CK3D 4Y2TA 5TC4A 3L8EA 3DF7A 1ZLYA 1OVMA 1TPYA 2D1QA 4NG4A 3WI7A 4LSGA 4D41A 4XM2A 2H3HA 1CDDA 1YFZA 2OV1A 3CUUA 4C89A 2JDID 4DZZA 2ZREA 5TX7A 1A98A 5BN1A 5LYJF 1F7VA 5C0OE 4F4FA 1DHTA 4URFA 2OFOA 1J24A 1TVKB 1LDBA 2Z1MA 3GRUA 2G1UA 3O47A 3KG2A 3Q7SA 3GPIA 3OX3A 4PBTA 4PAWA 1PYGA 4JLBA 2B1JA 3ND7A 3OHPA 1MO2A 2H9IA 1MQ9A 3KXDA 4JENA 2IHJA 2VQDA 1XJCA 2BC9A 2ORIA 3N2IA 4NL4H 5LR6A 5CPFA 2QT1A 3QVWA 4OK5A 1GNTA 1E4YA 1XWWA 3STHA 1UBMS 1R5BA 3H7AA 3PGMA 2YMPA 3H8JA 1HG1A 4BKPA 4MVJP 2IODA 4P82A 5BQ5A 3LF2A 4B5LA 1GU0A 4EDFA 5U9CA 3DVQX 4TLLB 1O0SA 2GESA 1TYDE 1U2DA 3NH6A 5J4HA 4JA0A 4BPBA 1G2IA 2UZ1B 1HL7A 1SVNA 1QYXA 2GUWA 2G09A 2J67A 2BL4A 4NHOA 1FRQA 1ZUWA 5EZ6B 1YR9A 5FNVA 4XR9A 2W8BB 4K0RA 3C3YA 1FU7A 4ADSG 2F9MA 4H6VA 1P8JA 1XQWA 2YWCA 5H70A 1G21E 3IMFA 2LV8A 3BKXA 3QWHA 2ZRLA 1ZPDA 3HE3A 3OETA 3WHLA 2Q9AA 2Y2UA 3UPTA 5IK2A 4YDRA 4CT4B 1EMDA 1NX9A 2QEQA 1D4AA 2YJZA 3Q5EA 1K3TA 4NPHA 1SCDA 5HEKA 5BPFA 4U2CA 1JQ3A 1CUIA 2QF7A 4H27A 4QD3A 1F8UA 2RFLA 3UJNA 1TVCA 3OPYI 1JNXX 3OX1A 4O4LA 3PVCA 5HIKA 1T15A 4BHTA 1YRWA 2ZU0C 3H4IA 3GT7A 4X5OA 5LP6A 4J1SA 3NJ8A 1CCWA 5HW0A 2MSEB 4MZXA 2PQMA 3R0QA 4MPJA 5JMTA 2IYLD 4HR7A 1PFUA 5IAKA 3RFVA 1DXOA 2BP7A 4JGGA 3E9NA 2Q5LA 1FJXA 2CNWA 2P3OA 4S12A 2C3OA 5AW1A 2D54A 5T6MA 1ES9A 5IMSA 2WU3A 3ZDCA 1U7DA 1M2OB 2R8PA 2QN9A 5FL7D 4BEWA 1X1TA 3NAQA 3B60A 2H0RA 3T3HA 2NAFA 2WDZA 1TMKA 3PCTA 5BVHA 2HA3A 1ORVA 1JI0A 5IT9A 2OV3A 4QPCA 1Z6GA 2F1KA 3ODGA 2N1MA 4RYLA 3VA7A 3MEQA 3OJLA 3DE5X 1O94A 2PCJA 4O1MA 1FUEA 1EZ1A 4UEOA 3LY7A 4W63A 4E30A 2QVCA 3V32A 4GP7A 4GM4A 2B5WA 5KTRA 1RMTA 5DIZA 4NNPA 4O1HA 1MABA 5AYVA 2NO0A 4IGIA 4LHYA 3U7QA 4OAPA 2WQ6A 1NKTA 5EHZA 5I45A 3KJIA 2IIBA 2PXAA 1YQWA 3K0EA 4BQIA 3C8MA 4E2WA 1T3HA 3I6QA 4B2IA 3GBPA 2HBYA 1XG5A 3L6BA 4RKYA 4C04A 4OXQA 4CCWA 3UKJA 4GBMA 2OBNA 5AP9A 3LU1A 3N2EA 3FNQA 3FJOA 3Q85A 5IAEA 1L5KA 3NTQA 4LOAA 3KBOA 4QTZA 3EF0A 4CM5A 5ANRB 2QJRA 3WK6A 3T7AA 2VJKA 1DIHA 5DYNA 3PKIA 2EFGA 2N46A 4X1YA 1N0WA 3CLSC 4C0BA 4DCSA 4EDHA 3WYFA 4JKIA 2BPOA 1ODFA 3GRPA 2CJPA 3COZA 3OTGA 4J7AA 5AM1A 4IDOA 1HTWA 4C7BA 5KWJA 3EY4A 3S99A 3CVXA 4RD2A 5JPCA 5SYMA 2Q1UA 3VR4D 3R8CA 2FSSA 2HIGA 2GZ3A 4Y9DA 2WE8A 4XASA 5BWCA 4UZSA 1L7VC 2JH3A 2DU8A 3GPBA 1NXTA 2PUCA 5JCPA 3O4HA 3JYHA 1L8XA 2YZGA 5AK3A 4N9QA 4U3JA 4UBOA 1C9EA 1KZGB 1NZJA 2I2AA 5JXHA 1A8UA 2DM6A 5JXGA 3KEQA 2AFIA 3U3DA 2NUAA 4BNYA 3HFJA 4DIKA 4BKUA 3EZ2A 1SBHA 4YAOA 1KDVA 1Q2XA 2YVQA 2EGHA 4XAQA 3V34A 1SQ6A 1B8PA 3JTEA 4G3XA 2H9YA 5JAQA 3D6HA 4FD3A 5LP6C 5CMLA 5FOUA 1OUMA 1EQAA 3HWX1 2W2XA 1Y4UA 5GONB 5AJXA 3H5TA 3MHPA 4MO9A 1VJ5A 2IFTA 5D7BA 5EIHA 3LY8A 5I7VA 5K7SA 2VK2A 3THYB 1ZI8A 3KPWA 3NIWA 1YZFA 3TCKA 3SEAA 4GOLD 1EXVA 4MW1A 1RVDA 4EY7A 4KQGA 4M8LA 5C32A 4A23A 1H23A 3WAJA 3F6BX 1WY7A 1SVKA 2VDQB 3KO8A 3P5BA 4NU6A 4N8DA 3QI2A 4O4IB 1GY8A 4OL9A 3CH7A 4M1MA 2KYRA 3PFBA 2GBCA 1LPNA 3ZEAA 4B82A 3TTWA 4BNFA 5B37A 1BXRA 1PVVA 2N47A 1TKCA 4TKUA 4AJ9A 3G9XA 4OAOA 1XPUA 2AOUA 1GGMA 3I76A 2AW5A 4DLXA 3N7UA 2WWVD 2CNDA 4YLYA 3TPFA 4I0WB 4I50A 3OKCA 3EA5A 4FD2A 4FSXA 2EHJA 3HY4A 4KQ6A 4PWYA 2Z2YA 3QF4B 2JKYA 4UNIA 2X58A 4ZO8A 4UCXA 1ZJYA 5DJ5A 3DLCA 4TS3A 3V1KA 4IVNA 1PJBA 4RVFA 3GJYA 5L3SB 1E89A 4POAA 3HCFA 5KKAA 3D43A 2J9YB 2HOQA 3UJAA 1YQTA 3TIVA 5KTOA 1TF5A 3D3WB 3MMSA 4GPZA 2VHXA 1PIWA 4EHAA 1MD9A 5IHXA 4JUIA 2QIPA 2AQIA 2P9FA 1ZKMA 1IRIA 2QRQA 5CXSA 2KS6A 3AT1A 1PWXA 2QRVB 1B8VA 5TSDA 5M5BA 3PG5A 3EIOA 3F6YA 1SC6A 2NXJA 2BHNA 3CNOA 4H31A 2IPXA 4Q1FA 2BWJA 4RQTA 1KEZA 4IH4A 1CQIA 1XVTA 2WWHA 4N03A 4UZFA 2AOWA 1P5HA 1ONBA 1CU1A 2NT4A 3QK7A 4HB4A 4E09A 1VHLA 1R6AA 1S2DA 4OHOA 1QHEA 3IAAA 3KQSA 1Q15A 4MWEA 3BMOB 3A4LA 3AUKA 3JALA 5IW8A 2ST1A 2FEOA 2AVNA 3PPXA 5J1SB 3T1HB 1E92A 1SPXA 1SVIA 3MGGA 3OKPA 5EUQB 1POXA 2ILVA 2RD2A 1SZPA 4RVUA 5HDBB 2V7EA 2H2AA 3M3PA 1REQA 2OZPA 1JKMA 1KRHA 2J33A 3WTCA 4BLWA 4M0EA 4D9GA 1ILWA 1G9TA 4UEKA 3SX4A 4R8MA 3ROGA 1ZC3A 3V33A 1U9IA 4FI3C 2I6TA 2AMFA 4MI6A 4PF1A 4AQYB 1DZIA 1Y6JA 1PVOA 2QLFA 5EJGA 4E1VA 2NT3A 2C4NA 1XTQA 4G1VA 3RT1A 4WK6A 4JOBA 4DWWA 3IJ5A 4DLSA 3PXBA 1ULHA 2OZLA 1Q22A 2FHSA 3URMA 5HJ5A 2JAWA 5JO0A 1P9OA 4DJAA 3C48A 1M7BA 2C5AA 4F4JA 4NMWA 3AMVA 2FEKA 3D6VA 3F97A 4L72A 4R2JA 4CHTA 4E2YA 4ZKDA 1H9CA 5DMHA 1YACA 4FC7A 2Z0MA 4Q9NA 4CI0B 1G20B 2WSSA 4PLFA 4FI3F 4DMHA 3TLEA 2VDJA 1XLVA 2FPIB 4L6IA 3LA8A 1DDOA 2C98A 3R3XA 5T41A 1PS0A 2FZGA 5EESA 2XAUA 4HQNA 4OQXA 3ZX5A 1YFJA 1P4GA 5C8YB 3A1VA 4RIHA 4AZWA 2ZIVB 4HX2A 1DXHA 1NVUQ 1HQYE 4D1YA 4DT1B 4B7AA 1A1SA 1L6IA 2PYIA 2WKQA 3DPSA 1YMQA 3HJAA 3SJ7A 3K72B 4JROA 3WLTA 2JH9A 4RXTA 4XTCS 3Q2OA 4JP5A 4LQ4A 3ZWQA 1C8VB 2ZG6A 4FIZA 4IIJF 2BVNA 3OJFA 5BN4A 3GHHA 1O95C 4Q7LA 2BONA 4LGCA 2JGJA 4WY8A 4RY9A 5AW9A 2I22A 1J2UA 2OGZA 4CMJA 3ZGZA 1YC5A 1XRQA 4EA7A 4LF4B 1DJLA 2REQB 2CF5A 1VOTA 3D8RA 4B1FA 2PPVA 4EJFA 4ZAZA 2XNHA 1VLZA 3OX2A 1I1QB 1PUXA 2DZDA 2R97A 2WIAA 2X23A 2XEDA 5DGCA 4ZAFA 5HA5A 4C6RA 4D4KA 1CJTC 4W5TA 4IJ5A 5DSXA 3ODPA 3IXQA 3P9XA 4QPZA 5BWOA 5JDCA 2QAGA 2WKPA 1P1IA 1NDUA 2VDOB 4JNKA 5KC8A 3L02A 1UK6A 1OYWA 1Y4AE 1HE3A 3QLVA 1H3EA 2HHAA 4KRFA 2PMBA 2PBRA 4YAJA 3WGYA 2QZJA 1N9KA 3CIOA 3ZK9A 1XO1A 2EC5A 3JQ7A 3P9YA 4QX6A 2Z9CA 4BFWA 2C5HA 2J32A 3M1LA 4RVCA 1FW6A 1S5PA 3E9QA 4DR2B 1MXHA 2BKVA 2PUWA 4TQUS 4YQEA 1WKBA 1KH1A 1TVKA 2ZULA 2IBSA 2HXSA 4LPSA 5KMGB 1U2ZA 4HTFB 5JO9A 3R3HA 1GPH1 3I09A 1KXZA 1AUPA 2WY2D 3H2BA 1JR4A 3WA6A 4DLYA 4GI5A 4S2UA 3ZY3A 2D7CA 1EK0A 4K1XA 4YP0A 3TZHA 4G0MA 4G09A 4NYMR 1JG4A 3R2JA 5ERXA 3SJZA 2YMMA 4RE5A 4AKSA 4B7ZA 4B3MB 3GN1A 4DCOA 5DK6A 4PSAA 2ZJ8A 3ML1A 2X1MA 3I9V6 4U7DA 4XWTA 3F47A 4AG3A 1AK2A 4KAXA 2H65A 3D02A 3ELDA 2IZ5A 3PJEA 4S3MA 5HRCA 1TLFA 2J6IA 3KALA 4GWKA 1JMVA 1EVJA 3CZQA 3KQVA 1HXHA 4M0UA 4PGGA 2KLBA 3SFZA 3WNVA 3DFIA 4D81A 2UZ1A 1JTVA 1QHGA 1RHRA 1FUYB 1I33A 1XDBA 1QIHA 1VLMA 2FOLA 2W8BA 3CLUC 3OIFA 4RZIA 1EUYA 1KE1A 3RASA 2MSNA 1JLSA 2IL1A 5JHGB 3VM6A 1O6BA 2ZSUA 4D97A 4ZYUA 2MYPA 2BDUA 1MDFA 1N2OA 3KOMA 5EMJA 4OLAA 1EEXB 1UBEA 4GLOA 4YCDA 2DWPA 2I87A 2JAQA 1SUAA 3N2GB 3SXUB 3KZOA 1R7RA 4OSOA 5HZHA 4QDKA 5C4MA 1RRPA 4S04A 5FWYB 5IVKA 4U6NA 4HDQB 4ZXPA 4AIIA 4BNUA 3K5IA 5FA5A 1W48A 1EUDB 4YYEA 1T0UA 5FYQA 2J0EA 1YZUA 2CMFA 4E88A 3ZKWB 1QVWA 2G63A 1EBBA 1ZOSA 5KEIA 3IJEB 4Z5XA 2C7RA 4S0XA 4H08A 3WWCA 4EYKA 2G1AA 2QORA 3GWGA 3NWPA 4MW6A 3UGJA 1BU5A 4LW8A 4E70A 4R01A 4YT2A 3EBLA 5ULLA 1TQ6A 1M2OA 2XW6A 3DHNA 1PNQA 4R40A 1T2VA 3OZCA 3KE9A 5A05A 2R8RA 4QRHA 1LLDA 1E2EA 4E2FA 3VKHA 1ZHHA 5JH7B 4ABTA 1X39A 2X0IA 2B37A 3DVLA 3PWKA 2OVFA 4GLLA 4GRDA 4RK7A 4C5BA 1R00A 1QM5A 4OP3A 2PUDA 2ODWA 1E5DA 3MW8A 4LHSA 4DCCA 1YDHA 2BGIA 4C7KA 1E4EB 1ZY2A 3F8SA 3G8CA 1CE8B 4HMQA 1B1CA 4PCVA 4CM3A 2HJWA 3ZLUA 4HAZA 1XMJA 4MRSA 1QJ4A 3C3MA 3IT3A 2JAHA 3VYUB 1K7YA 2IOQA 2XRFA 1H8HA 2XWBF 3Q9SA 5G53C 3LK6A 1A1VA 2EGGA 3ZJTA 2RK6A 1K0UA 5TS3A 3RQIA 2ZUUA 4RKRA 1ZR2A 3FVVA 1ZVVA 4D02A 3ESXA 5KSPA 4FBLA 5FOSA 1EVIA 3IFSA 4MWTA 1NVMB 1ETUA 5JJ5A 1OX4B 5EMLA 4JLWA 4AUNA 8AT1A 4KN8A 5IABA 1E4OA 1GPMA 5IULC 5E7QA 4NCAA 5CFMA 5C8DA 3LL7A 2LTAA 3WQRA 1G64A 4NC9A 4C4YA 1XXLA 3EC1A 3KPJA 1JFSA 3HUTA 1CQPA 2FPRA 2X9GA 4IHJB 3UXEA 5EKDA 3L5OA 3DBVO 3B8EA 3UMCA 2JEYA 4RD4A 3RKSA 1AA9A 2A58A 3KD3A 4MWBA 2NXEA 1D1TA 1G7CA 1K88A 2OLJA 3OZGA 4WHMA 5FA8A 3ZZUA 4EH1A 4FFOA 3H3JA 3N3BC 1KHHA 3ZU6A 3N53A 4EHDA 3I34X 5AVYA 4LNUB 4MCJA 2FDCA 2TMKA 4NE7A 4M9UA 3V4ZA 4QDXA 4GP6A 5TV2A 4AS3A 2RH4A 4TKZA 3UJ8A 4I7EA 3B36A 4HK4A 3ZDFA 4X3OA 4V0OA 1B2RA 1QU3A 1T0BA 1WOMA 4EEZA 3R76A 2FPPB 4JVLA 1GTSA 5GONA 3TE6A 2CSUA 4A0RA 3I39X 1RPAA 3R8FA 3EG9B 4LOLA 4QFDA 3V2UA 1IQPA 3THYA 1JZSA 2W2OA 4WXHA 1S89A 2JFXA 4KPUB 4IJQA 2GS9A 2LKDA 4MS3B 4ZCLA 3S0JA 4OQMA 3SDZA 3IO5A 3IP3A 4LMRA 3CM0A 1JKIA 1LSSA 4CIAA 1V5EA 1ONPA 3C85A 4RK5A 3PUHA 2OCBA 4GRIA 4RTKA 1WUJS 4O4IA 3L9XA 4LTDA 4YCJA 3NKVA 2VA9A 3H2KA 3ZZMA 1Q0ZA 1G5RA 1H2BA 3UMRA 3BGSA 3DHWC 2H1WA 3GZJA 3ZLTA 1KR2A 3ULKA 1ILEA 3SHVA 2JIRA 4OLJA 3TTYA 4DV7B 1DINA 3DZJA 4Z4EA 4HNSA 5AVKA 1T8PA 4ZT4A 2X9QA 5IWCA 1X0XA 3QPDA 4AJHA 3FYSA 3RAPR 3DCIA 3CEJA 4LYAA 4KYTA 1F3OA 1BGVA 2PO5A 2RHJA 2XOXA 3LF1A 3QF4A 4Z0PA 4QG3A 1GU7A 2WHEA 4LXYA 3WGTA 2DHEA 3V80A 4Z99A 1IE3A 2MSWA 5L3SA 1LLCA 4XIJA 2HCRA 5LBTA 3SF8A 1YU6A 3EYWA 5CFOA 3D4OA 4M1ZA 1OXTA 1UBJS 2AEFA 2DBYA 3LPLA 1QVAA 4HLCA 2B4TO 3E70C 5K01A 1Z4LA 4YJ2F 5CFNA 2B3TA 1S3FA 6ADHA 4RM3A 3DAHA 1RACA 2AKYA 2X8WA 3A05A 3O9ZA 5J2TF 4C0KA 3MAAC 4GKJB 1TZCA 1VA4A 4F97A 2AJLI 2QLMA 3MB8A 3H5OA 3VSAA 1FYDA 3QNWA 4NV0A 3T6KA 3TTVA 4QLAA 2UZ0A 3DV2A 1J2EA 3SHQA 4RV5A 4BV8A 1Z4PX 4UOQA 3CVUA 4H16A 3SK0A 2PM8A 2A9KA 3PC3A 4GKBA 1MX5A 1EVEA 5L6LB 1M66A 1GZUA 1ST2A 3OPYB 4FW8A 1TJPB 3WS7A 2VTDA 1AKEA 4CWAA 4RY8A 2HLDA 4LTMA 2A7XA 2PZGA 3BMOA 4ZQCB 4BNMA 1VJ1A 4Q4CA 2IS4A 2NZJA 2X1HA 2XLCA 3HYCA 1WCYA 4R2MA 4TRJA 4XVRA 4LZWA 2PUGA 2O2DA 1SG0A 3SZ3A 4C0AC 3R0JA 3QEBZ 3HUDA 2PS1A 3CZPA 3ICWA 1Z6AA 2JKVA 1G6OA 4ECAA 3OFSA 5EIXA 1QUFA 3IPXA 1D2MA 4QGFA 1NBWB 1XMIA 3PENA 4FNGA 2O4UX 4FQ7A 1MIOB 5BT8A 2FEMA 4BJ5A 1MP0A 1J5EB 4XVHA 4ZK2A 2JGMA 2JRLA 4LC1A 2XKAA 2QX6A 3I9NA 2V0GA 2X1VA 2WD9A 4JQYA 3WIVA 5C2JB 4JV5B 3K9HA 2ZB3A 2OG1A 3MTGA 5ALIA 5HM8A 3I9LA 3AF5A 4P7JA 1F2UB 1XAIA 3CLHA 3HKBA 2JKZA 1VKHA 1Z9BA 3PQ4A 4BMZA 1RPZA 3KEMA 2X2OA 4PLYA 3AINA 3ESYA 3K9WA 3QBEA 1WMEA 1BD3A 1X14A 4B2YA 3C15C 1RD4A 3U09A 1GQRA 1LBQA 3Q10A 1G20A 1LCIA 1NU6A 3TS1A 2W6QA 4BQSA 3AKZA 3DKPA 3RB8A 1IOWA 2G07A 4YAWA 4LF9B 4ITRC 2QPAA 5ECGC 2VHTA 2X2PA 1OBVA 5K0TA 4C43A 1BQ3A 3GLIE 1UJ6A 5C8YA 4JSRA 3L0PA 1IC6A 1T3ZA 3VFDA 4QQRA 3WADA 2PYZA 3AWIA 3P71T 4YJ3F 4C14A 3NH9A 4DT1A 5BSGA 5JLJA 3ZDBA 2EKDA 4TWBA 2G76A 1PQPA 1UWLA 1LH0A 4KR6A 5A0FA 4OREX 2F3RA 1DBIA 3HXKA 4IIBA 1P1FA 2Y67A 4NBKA 4WTOA 3RTCA 4HYTA 3PNQA 2Y71A 1KFJB 2YINC 3RFFA 1QIFA 2P4QA 4E5SA 3U3KA 2ETXA 1ZHFA 1I7NA 4E5DA 4MVJD 5AKGA 3HB1A 4JELA 1C3JA 2NZYA 2REQA 1G6KA 5EP3A 2IV2X 4KQJA 4AJ2A 3HS3A 1GUAA 4R0NA 1DADA 1L5VA 4ENVA 3LRPA 1E1RA 3GCZA 5JXIA 2BGUA 2ECPA 1V96A 2W48A 4RO0A 2OM6A 2X13A 1WSBA 1CZKA 1OLUB 3CR8A 1L1EA 4FCWA 4JX8A 3H6GA 1RQNA 4BMYA 5DX0A 1QP4A 1J5XA 5ALOA 1JR3A 2O5RA 2O3UA 3EBOA 1R5OA 2IEIA 3F49S 3IAEA 2VYVA 3PRKE 4M9ZA 4DILA 2RGNC 4EB6B 1YBAA 5H7XA 5FPHA 1YUNA 1BHSA 4QM7A 1WZNA 5EP1A 1P3JA 4LWOA 4QU8A 4G01B 1SOVA 1G38A 3TDKA 1YVDA 3UVEA 1G8KA 4HTFA 1H2ZA 5KMGA 2Z6AA 1QMGA 1Y9ZA 3TJZA 1GDTA 3I32A 1IAVA 4XRGA 1QYVA 2V5VA 3GGCA 1IY0A 1H9AA 1L7QA 1E99A 4IIUA 2P6UA 4RTQA 3AUSA 2XB6A 2VDUE 3LUPA 3JD0A 5DX1A 2ZWPA 2CZCA 4U9HS 3WLHA 1M5UA 4HEA1 4I1PA 3LUBA 1X9IA 4IJKA 5DNUA 1NVDA 1RYFA 4BVKA 2JFYA 3R20A 4OQEA 2OV4A 3AW8A 4IH1A 4G89A 4YCBA 1I0LA 4JI6B 1QYRA 2ZJAA 2X7JA 1RQXA 4CMGA 4OIFA 5K8JB 2CXHA 4RWZA 2QUJA 2B82A 1RXYA 1B16A 2ECOA 3BQ9A 3ESAA 3PU6A 2JFNA 3K0FB 1SG6A 3Q3IA 3USZA 2BAGA 4C3ZA 2Q5QA 4QUHA 1A4RA 4MP6A 3IRUA 1OXVA 4LXTA 5GM1A 5GOTA 4F60A 3TJMA 1AQ6A 3W2EA 1L4BA 3WDLA 4GL2A 3FTEA 2W2PA 3RGWS 1GG8A 1MAWA 1PTJA 2NYUA 3LMKA 1G21A 3SXUA 3N2GA 1H1LB 1SJ9A 4MKGA 4J0IA 2XHEA 2ZSHA 1Q0TA 5EQTA 1WUYA 5EKSA 1JTEA 4QGGA 3G0IA 3V8PA 2H8KA 4Q3AA 3S5UA 1FFBA 2D0OB 3HWWA 5FWYA 3HY6A 5AVRA 1EUDA 1KZ6A 4HADA 3NAZA 3ZKWA 3ETLA 4N9WA 4BNDB 1RTKA 1OB2A 2AHRA 3CFYA 3RC9A 4IIVA 3UWOA 1SXPA 4CUZA 2QI9C 2XNCA 5TQ0B 1N8NA 3HDTA 2O2GA 2FZ5A 3UG6A 4C76A 1KPHA 3HYTA 5E9JA 2P4UA 1I13A 2Y0DA 3KSMA 3AKEA 4NBNA 3A0RB 4F9FA 5CB4A 3ZGXA 4XD7A 4ZZ2A 1JWAB 2C4WA 5REQB 1N1EA 3ETHA 3HL0A 4WK0B 4R7ZA 4MLDA 2QR3A 3CQ9A 1I6MA 3CUWA 5DNEA 3N8DA 5JH7A 2XB2A 3HWRA 3N0RA 2WM9B 3VPDA 4UJ5A 3V6LA 1HEUA 2ZSAA 2IDMA 1JILA 1HSOA 3OMLA 4IHKA 2DEUA 4GUDA 4PN7A 4HP8A 4KK3A 1WLYA 2QI9F 1EFLA 1W2WB 2BN4A 1E8NA 2QWXA 2R1ZA 3I5MA 1E4EA 3BH7A 4UMEA 3S2ZA 4YCNA 1NI5A 4MVWA 1NNSA 4B31A 1VJCA 3SX2A 5CYPA 1OFIA 3ZBQA 4WBXC 4C2AA 1ZU5A 2FW8A 3ICCA 3OZIA 2O5EA 1VA5A 1CKEA 2C00A 1K6MA 1PWHA 5HPYB 3TIFA 4QUGA 3FNGA 5HFJA 4HNHA 3CUSA 2COKA 1N4DA 2NADA 4DC0A 1ML4A 2H2WA 5L8VA 4R3UC 2ATEA 1OY1A 5KBYA 1TT7A 4C4SA 3V7NA 3HSKA 3TOVA 2PKQP 4MCIA 2CB9A 1JR2A 2G72A 3NOVA 4DEXA 2IQ5A 2AG6A 4HG2A 3AZQA 1PZMA 1QS0B 2IYUA 1U0NA 4FONA 3ROFA 1NYRA 2OAQ1 2WJ3A 4KJZA 3N39C 4BEBA 4DOMA 5IMBA 3I04M 2JGAA 3BGOS 3DV0B 4HNAB 3ZGYA 1UDWA 3BQMB 4IHJA 2RAFA 4OMFG 2YIMA 4KX5A 5KHOC 4ZOLB 1UKAA 1GKYA 2FW0A 3JQFA 1G8SA 1F5SA 1KI7A 2PJDA 3DGEC 3EMDA 3HN7A 3MCAA 4PG6A 4XI9A 5CH8A 3TZBA 3ZYZA 2WIFA 5KYUB 3KQNA 1XA0A 3EUWA 4UUMA 1DC5A 4DM4A 4LNUA 4FZ5A 1RZVA 1FRZA 2Q4BA 2FPUA 2WA2A 4RSGA 5ADWA 3RAEC 5HF9A 4OSEA 2C61A 2VH2A 3AIMA 4UM9B 3KTAB 2HFKA 2DLNA 2XUQA 3PIIA 4JOQA 4TSFA 3KR2A 5ERYA 2NXCA 2HLPA 5AW0A 3PL1A 3DP7A 3NETA 1H3NA 4TN5A 5EPUA 3PR2B 2OHXA 4KPUA 2VNKA 4AKTA 3AK4A 2C97A 1YS4A 3H9EO 3T3PB 1YCGA 1U0FA 2HZBA 2XNKA 1ZZGA 1R6UA 3ZC3A 1ENPA 1P4SA 3CF4A 3DT8A 3H5VA 5AKHA 5I4BA 2ZR7A 3J7AC 3CGWA 4E5NA 2RJOA 1NOJA 2H1HA 3ZWCA 2QX9A 2XQVA 4F5DA 3LI2A 2CWWA 1CR6A 2FE4A 2XUAA 5GY7A 1KAHA 2V1UA 1Y1KE 4UPDA 4MWCA 1YS9A 1FNCA 3I9KA 2NP7A 4DIUA 1EE9A 2QRLA 3GYGA 3KOUA 4W9RA 3ER8A 3C5CA 2HHCA 4HXYA 4Y67A 1DCFA 4RH3A 1ORHA 4IWXA 1DKPA 4K6GA 2F7SA 4NBRA 3AJEA 3X2FA 3EVFA 2HWKA 4YRMA 4ARSA 2D00A 2R8YA 2EF0A 2ID4A 3EJWA 1MX1A 3AJ9A 1H66A 3ECAA 5M3BA 3CNLA 2VNSA 3WRVA 4KAFA 4DIBA 1PLLA 4DLLA 3PC8C 1V9CA 1NQ5A 3N6RA 4FFSA 2K7FA 3BZWA 3PHLA 1OW3B 4IEFB 2LDBA 2ZS8A 4TYNA 1PEDA 1SPBS 1DAFA 1EFPB 1M8GA 2C9ZA 3ZD9A 3PQDA 1NYQA 1CG6A 2QMEA 2Z3VA 3F8WA 2CT8A 1ZK2A 2BJHA 2J41A 3UMJA 1PT8A 1WDKA 2SNIE 3KQQA 1YS6A 4CPDA 1KE2A 1GZ5A 1RJ9B 2C1XA 1J0CA 2XBUA 3GQBB 1JE1A 2ISSD 4M8KA 2V7WA 1J0AA 2GZ1A 3G5TA 3HL4A 4RHYA 4ENRA 1QKJA 1E1QA 1VI6A 4P3OA 4U7TB 4KPYA 4I2NA 2IEGA 2VT3A 5IC5A 4NNJA 1XD8A 2VYQA 3PHJA 1DZ3A 4AWAA 4ND4A 4WEQA 4IQGA 2X4IA 4L9WA 4NKRA 4PPGA 2AR7A 3OTQA 5J58A 1VMKA 2MSLA 3TL3A 4LV5B 3X1ZA 4CL3A 4C03A 1PHRA 3OPYA 2Y8EA 3FSGA 1RXEA 1SU6A 2AUNA 2PSSA 1KFEB 1N3YA 5DGXA 1DWOA 1JEEA 3NFYA 1P72A 3ZLVA 4LF6B 5IFLA 4D92A 2B21A 1E1CB 4NOLA 1DAGA 2AF3C 1Z8FA 3GRFA 4PQFA 5TF0A 4AS1A 1VXRA 1YZGA 3MUFA 2BM1A 5F52A 2I4LA 2B4RO 1KPIA 3OIWA 3VZRA 3PZBA 2QRJA 3E2MA 1CJBA 3GZ4A 5F2NA 2O2JA 5JD4A 1Z4KA 1MIOA 2HQOA 2MMCA 4ILKA 5EFOA 3UXHA 1T4BA 1M0SA 2B4YA 2BTQB 3U62A 3ZK7A 3OJEA 4FN4A 1E6KA 1RXIA 3HU2A 1AE1A 1ACJA 1JQLB 1TZBA 3OSZA 1FPQA 2Z2ZA 3LT4A 4MUBA 3C41J 4P7GA 4Q47A 5CA0F 3KAJA 1AVTA 1IRXA 1NRJB 2K7ZA 4TVOA 3IS3A 1UANA 3D6UA 3ZJUA 1JHAA 1F2UA 1K66A 4B3DA 4ZQHA 1BKDR 2PKRA 3ZWNA 3EGEA 4MPDA 3C3KA 4QWWA 3TIIA 1G66A 1GA4A 3AU8A 5JZMA 2Y0EA 4DMFA 2XCSB 1KEUA 3A58B 1SHUX 1JJFA 1V11B 3EW9A 2NVBA 3C3PA 3AEKB 4XM0A 4AQ7A 1JSRA 2MYNA 2QTLA 1ZJ4A 3A6GA 2WAOA 2H4YA 4WJZA 2C1EA 2MYUA 4ERXA 2FX5A 4D46A 4ER5A 4F86A 3UA3A 1H5QA 2QMZA 5C5EA 4W9NA 2WINI 5KQPA 2EX0A 4YH1A 1YE5A 1YZYA 3WYNA 5F5NA 3IT1A 4QBTA 2I03A 4P5DA 3GLIB 5I9MA 2OCDA 2FR8A 1P7ZA 3AWDA 4XUEA 3VR6H 3QVMA 4FOSA 1GP2A 4F11A 4LDPA 2ZU6A 4CF3A 2UVPA 1IN6A 1H8ED 2ZDHA 1J8DA 5EQFA 3ZY4A 2ISCA 4IDHA 1WL8A 4F0JA 4RMNA 2FWAA 5G3ZA 3R9IA 4X00A 1PD1A 2Q1YA 4D45A 2E37A 1A9ZA 2HMVA 2HYDA 3RIGA 1CYDA 3HGTA 3QFRA 2GUGA 1T2EA 2VC2B 2GQ0A 1U8YA 2LRHA 3NRBA 2PTHA 3BA1A 4R9NA 3KS9A 1A9TA 3MINB 3DLAA 4I6GA 5AJZA 4DNQA 4LBZA 3HZZA 4XB6B 4KN5A 2OZEA 2C2HA 5IRCD 3KK0A 3Q12A 5KOHB 2PGXA 3HA3A 4EB6A 5DHAA 2X1LA 1RHMA 4I55B 2RBGA 5T8KC 2FPGB 2Y4NA 1C7FA 3AR8A 2NUBA 4MUNA 5LWHA 1BSVA 2IKQA 2NVOA 1DARA 2DHCA 1JG2A 1JV2B 4JVNA 2EFCB 4O2RA 4EFDA 2Q4DA 2ZTUA 2HO5A 3BX1A 1E2KA 1UBTS 1LZLA 2NTYC 1EP1B 2PKXA 3HDJA 3AR2A 4HLDA 2FPSA 2Q6IA 2VPTA 2RB4A 3M4YA 4K9PA 3TPZA 1AHPA 2TMDA 2ZAYA 2ZB8A 3MJTA 1CR2A 5FWAA 1HEYA 3T3MB 3NYWA 5B4TA 3MUNA 2RGWA 1T1GA 5MGNA 2R751 2FWMX 4EI2A 1JJIA 5K4GA 2NO4A 3NTOA 1XZKA 4BX9A 5CFPA 2RHGB 3G0CA 4LFAB 3CTMA 5KX5F 4I1UA 1SULA 2E0IA 4M9CA 1BH2A 4KUGA 4RK0A 3KJFA 2C2WA 1VMDA 2PBLA 3MQ4A 4AUKA 2AKEA 2AH5A 4M54A 4F6RB 3DDHA 1T2AA 4TYQA 4G41A 2DVMA 1ABFA 4OQQA 5EHQA 3ZJ4A 2LP4Y 1RADA 3GO4A 4IFBA 1P2SA 3IAM1 3BJRA 4OM7A 4PBSA 3STYA 1U7UA 4B43A 2VTVA 1QIDA 3QUSA 4G5HA 3K0FA 4B71A 2XCQA 1URPA 3QVUA 4AMBA 1VSUA 1P4AA 3F4KA 4P0TA 3G5MA 2QT9A 4G63A 1XZFA 1QCDA 1ZH2A 3TNFA 5G0TA 5LUBA 5G4KA 5HQTA 4QSMA 5IG2A 5JANA 3F3SA 4QULA 1TJ5A 2ZSJA 4P31A 1SD5A 1H1LA 3AHEA 4A2CA 3UOGA 4RZ3A 2JEOA 1JDVA 3PUWA 3NPMA 4F1KA 1GZ6A 2XADA 3GRRA 1VPVA 1NP6A 4UXHA 1EFTA 2E4UA 4EKIA 3NAGA 4Y0AA 5E6SB 1MC8A 4DQDA 4BNDA 3QYFA 3MSCA 4AMYA 2Y66A 4MVJM 2I9KA 1TCUA 4JQSA 4PIMA 1A5BB 3SS7X 3W5UA 5TQ0A 1Q84A 4RMGA 3EISA 3H9GA 1SIWA 4H17A 4PYIA 2D7JA 1GPAA 1R0ZA 1J90A 1VG1A 3PD0A 1W29A 4EB8A 1YGYA 1IUPA 1N7HA 4L4UA 3TW0A 1RM5A 5REQA 4HN9A 4ER7A 4WK2B 2YIDA 4N49A 1G8MA 4KXYA 1Q7EA 3ZY6A 1QFZA 1IDN1 2IK8A 1NXXA 1PWZA 3AEUB 3RC8A 2VFAA 3W5BA 3MFQA 5LD2C 1U65A 2XH8A 1T0IA 2CLLB 4XW2A 5HZMA 1U63A 4QU9A 1WD5A 4V38A 4KNWA 5F23A 4YHHB 5CTJA 1V7QA 1JDTA 4ZWNA 5EJ2A 4BE7B 3NHBA 1ZESA 3ACDA 4W5JA 1KYVA 3C5WP 3NDJA 3CUVA 1S7GA 2FJUA 4ASUD 3N5CA 3GP5A 4TKLA 4QATA 3JVUA 3D8BA 2TECE 1AUXA 1SHJA 1XPOA 3HCRA 4U7FA 1KSHA 2PV7A 4LECA 3TKAA 5TT1A 3SKXA 3CMCO 5EWMB 1ZZEA 2D0DA 1QOQB 3G68A 3OKAA 4B3XA 4EX6A 1GV1A 1ZIPA 3MA0A 3I53A 4B6RA 2WB4A 3B1YA 3HB7A 3RTAA 3TZEA 3O74A 4ER6A 4IYRA 4OO3A 1EIZA 4AM8A 5G0VA 3I9FA 1BXKA 5CCDA 4D4IA 4JBWA 2QP9X 4I9NA 4CEHB 3MJRA 3JVVA 4FHCA 4M0FA 1QS0A 1RDFA 4K9MA 3EXIB 3HR7A 1FLDA 1U4NA 4Q9DA 4COOA 2Y76A 3FRHA 3M5WA 4DBLC 3DV0A 2ATCA 4HNAA 5LKRA 1M2GA 4YRGA 3MPUA 2IXGA 4ZOLA 3V7WA 3NM4A 4LYDA 1YRQA 4NBSA 4PXAA 2QSUA 2JH8A 2CMKA 4EIWA 5BR1A 2BOVA 2ZKIA 2QSJA 2ZQ5A 3QXHA 4KZKA 4MX8A 3BHNA 1DHRA 3FOAA 2Z8XA 3E1SA 4G1EB 3PXAA 1N3IA 4XM1A 3NIFB 4WX2B 5KOJB 2CSXA 4GEGA 4QJ5A 1YJ5A 1ZLXA 1XEXA 4ZV7A 3VYWA 1L9XA 1K7FB 1ZN7A 5IJ0B 2A3RA 1VMIA 3KTAA 2DKOA 1M5TA 2XECA 4L5YA 1LLUA 3PVSA 4D7AA 1N2HA 3DDOA 4A2WA 1AA6A 4UVEA 1QC5A 4LGVA 2JIQA 3RVSA 1NUUA 2I1WA 1E7QA 1KYZA 3UB3A 4IDEA 3SBXA 6ABPA 3CE6A 3V4RA 3DOFA 1T2CA 2A78A 2VUHB 5FBRB 4OXRA 1HDZA 1OXKB 3DYBA 3QUQA 1HZZC 2HZ7A 1CUCA 1JJBA 2QN1A 3H1PA 4HDSA 4IQ8A 5HUJA 3SM3A 4CT0A 1ZGZA 2DTXA 2J5RA 1ORIA 3U4IA 1IZYA 4IOMA 4WN3A 1KPGA 2R66A 1SBCA 2M32A 2GTHA 4JYAB 1G55A 1QVRA 1SXHA 2FR1A 5IN4A 1A76A 3VU3A 4B3IA 4HUQB 2O8VA 1UC8A 2WJPA 1VMAA 3GT4A 4IIFA 5BQXA 3WKDA 3GARA 4ZYWA 5A4MS 2MINB 4RNDB 2VH5R 1XQVA 1OIXA 3TLJA 4DLWA 3V1NA 5HCIA 4GGPA 4YI5A 2YZMA 5FOQA 1LDMA 2ZE5A 3A1WA 1GQSA 3PK0A 2LZ0A 2ZB2A 4AMGA 2FWNA 1CUJA 3B5JA 3I9MA 4WW0A 4KUEA 5CVEA 1XZDA 4HNGA 4LDRA 2G8NA 1OWLA 1E9VA 2B5OA 1BRTA 3OY7A 3P9CA 4YAIA 1NHGA 4NPAA 4ZJPA 1EGQA 2VWPA 1F4VA 1ZHOA 3HRKA 4E3WA 4Z8XA 3C3JA 1RJ9A 2RIPA 4B83A 2P4EA 2GX6A 4YRCA 1V2HE 4Z1OA 2G9UA 1CJVC 4MICA 1TM2A 2WF8A 3D3EA 5JMWA 3Q41A 1O5IA 4M3NA 4A91A 4F6LA 2M9MA 5LPNA 4IXDA 1W0KA 4F4IA 1FMTA 3B9BA 3MCZA 2AFHE 1YRLA 1E4VA 1GSOA 1Y3AA 1EBFA 2V74B 4WERA 4CDGA 1IAQA 2GK6A 1SBNE 5B3AA 5GVRA 4BMCA 1OJLA 3FCOA 1XF1A 4HEQA 3UHFA 4JXKA 3T5BA 4PBRA 2H16A 4NMMA 2X3FA 1L7AA 1JIQA 1S4MA 1FS4A 2DTDA 1E1CA 1FFXA 3GT0A 4QRDA 4QHSA 4IDAA 4JUCA 1J0EA 2X6QA 4X41A 1IHOA 3DMTA 4ZVLA 2OORA 4JHXA 3W8DA 3ZPXA 2WWTA 3DEYX 1X8KA 4YXFA 3C5HA 2FWIA 3UYLA 3AP1A 2YY6A 3WRXC 3VAAA 4BS9A 1TC2A 2C0QA 4YMLA 3A4NA 3INTA 3P0HA 4F04A 4B3TB 1XP8A 3QXCA 1W1UA 2HI0A 2P5YA 3F74A 3QX7A 2PMDA 4J0KA 3BWBA 2BTQA 3ER6A 4O8CA 4YB8A 5DRTA 4KLNA 4UBMA 4EFNA 1XSEA 1A5AB 2O50A 5A5DA 4HB0A 3UJ3X 2J46A 4JBXA 4KEAA 2EZUA 2W98A 4KH0A 4LXQA 1B6TA 1NW6A 1OWPA 2EP7A 2GK3A 1D8AA 2P1DA 3HB9A 3PC4A 4NATA 5DNAA 3TK1A 3K1JA 3IR7A 4EL5A 3O8BA 3FDXA 5T4EA 4Y6PA 3L0BA 3KU1A 1S2LA 4DABA 3C7CB 3TEFA 1J33A 1V11A 4BATA 2FN3A 4Q4JB 2I91A 3AEKA 3ZDDA 1E3MA 4CCAA 2ATVA 2FXIA 2XBLA 1XHLA 1ZITA 1P0FA 1RU3A 1YQDA 2JB9A 2Q5FA 3BE4A 3DM5A 3L04A 4GSLA 5EXDA 1EK1A 2UUBB 4HO1X 3HVIA 1R64A 4FGKA 2CHVA 3IEXA 3WR5A 5MFZA 1NNI1 3TDMA 3PCXA 3UJPA 4TLDA 3H5NA 4ZYYA 5BPHA 1Y89A 3UWSA 3ZKAA 4DSUA 1LV8A 1VYTA 3ACCA 2I6SA 1DOHA 4GBED 1LDYA 5ELMA 5FCDA 5IUJC 2YASA 1F7UA 3GLIA 5SY9A 1C0IA 3CHYA 1HC7A 3KXLA 1U8UA 1I3NA 1NVGA 3KT3A 5ED0A 3K2QA 4R1LA 3U13A 2ANBA 4BFTA 2CV2A 1ZNXA 2JHGA 2X14A 3A6ZA 4M8SA 3I0MA 4BRWA 4ZVTA 3RYIB 3LK7A 2QYHA 3M82A 4AG6A 3OF5A 2LNDA 1T6BY 1V5GA 1WCXA 4INJA 4Q37A 1JQKA 2JCBA 1R16A 2ZJ5A 5FBQB 2HJVA 5A5FA 3MT0A 3NAMA 5LJLA 2RGCA 2AXPA 4Q9KA 4RIIA 4XXHA 3B89A 4X7BA 1OYOA 5E6RB 3SZLA 4J03A 2C8LA 2DAPA 2P7IA 2Q49A 4LRQA 1S01A 1NLUA 1L4MA 1ZFNA 4EHKA 2E85A 2PGAA 4TL7A 1YA4A 3K1YA 4C20A 1JJAA 1EJ6A 4P3YA 5LN1A 5EWJB 3ZCTA 1H0KA 3VZDA 2YFYA 4TX1A 4RM2A 4ZAVA 4C3OB 2Q4RA 5IU6A 3CKMA 5IM5A 1FDUA 4A36A 2JANA 3VO2A 5LL6P 4DVJA 4X20B 1ZUHA 3FKJA 1AKWA 4MGZR 2X6RA 4BX0A 1N0HA 1CZRA 2VPYA 4I55A 1DV1A 1XUOA 3DUFB 2FPGA 3GAAA 3H9BA 4TWIA 1Y63A 4PCAA 1NM5C 4JYCA 5B1IA 3ZWKA 5BQFA 2IYWA 1B0AA 4NX2A 1PBTA 4NIMA 3TR6A 4MUEA 3WL3A 4B2PA 1Y82A 5IT5A 3RUFA 4G5QA 5AKIA 4DTIA 5BWLA 1UQTA 2C99A 2EWWA 5L7WA 3AUXA 3GJTA 2EDCA 1Y42X 3G2QA 4IF4A 3GF4A 4ISCA 3DHEA 4Y6RA 2AQ8A 5JHHB 1W47A 3WX0A 3ZIUA 2HC9A 3IXMA 3NR2A 4OHXA 4YJGB 1JEJA 2BFFB 2Q3FA 2PBZA 3GEMA 3TX6A 2J6BA 4CLRB 2PRJA 3GA0A 3LCJA 3ONDA 5DULA 5DWQA 4PXYA 2JGDA 4TQ9A 1FUUA 1WY5A 1ZIOA 4Q18A 4WFQA 1E9EA 4RESA 5AVOA 4AULA 4F6RA 2QPTA 5AW8A 5EJ6A 4UTNA 4WXMA 4N6GA 3UANA 1PQUA 2CV1A 3HP4A 1K4KA 1BRMA 1O9HA 2VEOA 1LS6A 1NW9B 5AVQA 3CZMA 3BH6A 5IASA 4J9VA 1ZK0A 4J29A 3OZ7A 3COVA 4J9UE 1N5KA 1YFLA 5LQKA 4R1QA 1UBCA 1WTCA 1QTNA 4EKEA 5F35A 1C4OA 1U3FA 2IDZA 4HVAA 1GKLA 3WL6A 2BZSA 1KQPA 2FSHA 4K86A 3SQNA 3ZDXB 5LIPA 2ZJOA 1WPRA 2PL9A 1K2WA 2Q4TA 3DG9A 4U1RA 1PE0A 3AW9A 3C3WA 1ZVJA 2KM1A 1YJBA 3DWIA 3ENVA 3EPLA 1JHUA 2HSZA 4NHEA 1QLHA 4J07A 3QTBA 4PYQA 4AUEA 2BZ0A 1YT5A 1SC3A 5HF6A 4YRNA 3IIJA 4PGAA 3DDNA 2W2MA 4TL8A 4QOHA 4WINA 2ZUDA 4QYMA 4DIOA 3LWNA 2E7ZA 3RRFA 1E3EA 3GZTB 1HO3A 2J4FA 3K30A 1F8FA 3QPVA 3N6VA 3OO1A 3HBFA 2FJ0A 2EBUA 2O2HA 3TQSA 3IUSA 4H59A 1U6KA 2QYTA 2Z2XA 2RAUA 1VTKA 2JJ1D 1OKKA 1NJFA 2VPIA 4IIHA 2OUIA 1QWSA 1C81A 3GI1A 2D74A 4X61A 3A8TA 4GGMX 4XCVA 2LPMA 3HV2A 3ZJYA 3DAOA 3PTZA 1LGYA 4GPBA 4ZEOA 2O8CA 3NXSA 4DIDA 1ITZA 4JR1A 3E61A 2JGIA 3K2EA 4OFWA 3WQSB 4DTCA 3ZE6A 3K96A 5CDUA 3BMCB 2HIAA 4FQ8A 1DKLA 5HF5A 1ETHA 4BFCA 3EZYA 2WVAA 3MAGA 4NCXA 3M33A 1AJEA 4TXJA 3AIOA 3D8SA 4IXMA 4R1SA 3G17A 1WD7A 2XQIA 2W6MA 3OOHA 4YUZA 1DUSA 3I6ZA 4ZAWA 4C2TA 4H6XA 3EGVA 2R2GA 3W5VA 4AZ3B 2SKDA 1H0RA 3O9MA 4BRSA 5I7SA 5JY1A 5EWMA 1SOMA 2XE7A 2IXBA 4H6WA 3TRJA 1V5IA 4Z0NA 3F7MA 3OIDA 4NEGA 4TQAA 1NW5A 1RYMA 1Z29A 4BQQA 2R6HA 4D0RA 2IEBA 3KVNA 4KXMA 5J4LA 1OA1A 4XQGA 4EPWA 4A8JC 1P1BA 4HATA 5CFZA 4CEHA 1I4TD 2IXTA 3EFOB 1FFEA 3JD3A 5EIFA 2GZAA 2YRWA 3EXIA 3U3ZA 5A4FS 4ZQBA 1BOFA 2WTBA 5DNCA 2TRSB 4LRXA 1U02A 3HJBA 2ZW9A 3RWMB 2DTEA 1MB2A 2EARA 4HOYA 1L5ZA 3N59A 1HF3A 1HG0A 5CT4A 4QVIA 4H4CA 2PSJA 4JC4A 1DFGA 2ZWIA 2ZCVA 3GUYA 3JQ8A 4XWOA 3G88A 2CDCA 1NE2A 3P9KA 3RKUA 3P9QA 4TGLA 5KOJA 1XIVA 1LDEA 1W581 2D59A 3R9XA 4AN1A 1YR1A 3A27A 1ABBA 3BWVA 5IJ0A 4D0NA 4LZAA 4PYKA 3TM5A 1EK6A 1C3VA 1CS0B 1GT91 4N3NA 1P17A 1YB6A 1G42A 1RLOA 3HSYA 1O77A 3WJ1A 3JXEA 1IULA 2E1PA 4E5YA 1DKMA 1NURA 3TL6A 4F3KA 2R6AA 2CY0A 2HCBA 3NKFA 1G1MA 2GZSA 3D0KA 3SKVA 1NPYA 4U5QA 2R4QA 3GHYA 4ARVA 3COJA 1RLIA 2OD7A 4AJOA 1WKCA 3WKCA 5F4BA 5FULA 2PH5A 1S96A 5DMXA 5IZ4A 2JIBA 1AGRA 3DBLB 4FXOA 4YA6A 1Z6ZA 3OIYA 4WLNA 3WZMA 2OCXA 1PNVA 2G3YA 2YC2C 3L1UA 3OJ0A 1AO0A 3C6XA 3EFBA 5IBRA 3SE0A 5KOYA 1M9NA 2BF7A 5KNBH 2OZVA 3GA7A 2WJ6A 2WIJA 4HUQA 4J2OA 4G81A 4K03A 1V48A 1ZH6A 4KI0A 3K94A 3FOZA 4KK4A 5CJPA 3LP6A 2C04A 5L7TA 2MINA 4LA4A 5JW6A 4R9SA 2BM0A 2YRFA 2IYYA 2VNJA 4N3GA 2OHIA 2WTMA 5CT6A 721PA 4CT5A 1DB3A 2OQ2A 1LQTA 3ISVA 4NG5A 3TSAA 1W25A 1PKEA 3O8LA 2YN2A 1R0WA 3TVYA 4B7UA 1E2IA 4ZCQA 2W9XA 4DARA 1BMFD 1V4NA 2B3DA 2ZYRA 1MOPA 2O1WA 3PRJA 3U3RA 3V7YA 3BMXA 1E5TA 1SBYA 2HQSA 4YMHA 3WGZA 5JNVA 5KNDA 1I4EB 1I51A 2LCIA 3O7WA 3JRWA 4II3A 3GDOA 5E2IA 4MRRA 2BEUB 8ABPA 2G88A 2P6NA 2KLHA 3R7DA 2MR5A 2R8ZA 3CCFA 1HYBA 2ZVDA 2ZJ7A 3IBYA 4PG5A 1GIAA 4UTOA 2H4WA 3FHLA 4UE2A 1CY8A 2P1RA 1PZXA 3A14A 2IZ7A 3CH6A 4HWRA 1RWVA 1IPEA 4CM7A 1FOEB 1D09A 4Q7KA 2P67A 4OV6B 3WGNA 2C83A 3TH5A 1QHNA 3KLNA 4I81A 3Q4GA 4L9SA 2AV6A 3M2TA 2NIPA 4MLPA 5LA6F 2GA8A 2NPFA 3CSDA 2RC6A 4AC9A 3VOAA 4DJTA 1V35A 3F5DA 2DBRA 4AFNA 3PGXA 3DOEA 4I4IA 1SHZA 1TIPA 3FGZA 4TQGA 5B7GA 1LDNA 1VSVA 2CXTA 2O2IA 4RL4A 1WF6A 1D4FA 4MQ5A 3I9JA 4XUCA 4EATA 5IANA 1CP3A 2Y92A 1GA1A 3BGWA 3IVRA 2PT9A 4M0PA 3SIRA 4L50A 1AS0A 5T3UA 7GPBA 1UMCB 4RCVA 2FK7A 3VKUA 3OIVA 1U2GA 1ULBA 1W9MA 2ODBA 3PLNA 1JLRA 4ZI7F 4OHVA 5A6VA 2FUG6 2WE7A 3EAQA 2PGJA 3KWLA 2VHJA 5D5QA 4HSEA 5I01A 2V3VA 3HYNA 4K87A 5HIIA 1JPUA 3ZD8A 5AW7A 4B9AA 2Y1FA 1IBRA 1E1NA 1P7YA 3IUEA 1O2DA 3OM9A 1M72A 2IS1A 3FFBA 2V1XA 3IALA 3ZWVA 4QUJA 1F4LA 2XTMA 3E7FA 5AI6A 3HJTA 3FPCA 4EG7A 5BNTA 1I5EA 5DM0A 1UOPA 1TT5B 5KJFA 1FUIA 1M7GA 4Q4JA 5AQEA 4WKBA 1ZA1A 5D7NA 3Q9UA 4D3DA 4RGBA 3OJXA 4MV6A 1XL1A 4OYHA 3U7FB 1PJZA 1F0NA 2NVWA 2F6RA 4N7JA 5HTKA 3OQVA 3RS8A 1T5SA 3DPIA 1QBKC 3SBOA 4MW9A 3WGUA 1VZ2A 1Q77A 5ICFA 1PR6A 2GPBA 1JFRA 3D54D 4C0SA 2Q5JA 4JOCA 2ACKA 3U9LA 2ZYVX 4XWAA 1K7EB 3MS2A 1S2OA 3O4GA 3MWDB 3EAFA 4FUQA 3VDNB 3JYQA 1GA6A 5H4GA 2I9PA 4TS9A 2X9NA 3HCBA 4BNXA 2Q0XA 3QPUA 5JASA 4TS1A 1NUAA 1ZMTA 1YZLA 1AS2A 2PKYX 3KSUA 3F7OA 3W7BA 2QL6A 2VPXA 2YFKA 3HJRA 3VH3A 5C1OA 1SUWA 3TSWA 3RYIA 1M3SA 4GYJA 1YH3A 4U02A 4NECA 4MA0A 3ONNA 4I9GA 1HE1C 1MV5A 3ROMA 1SCBA 1P0QA 2W6ID 1C50A 5EJ5A 1ZG3A 2YXNA 4JLKA 2D2FA 3KTFA 2FP3A 2TMYA 4RCZA 5TQ2B 1MZPA 3IMEA 2DCUA 2O06A 1Z34A 1IY1A 2JNWA 2P41A 3MS7A 2EL7A 1EXWA 3NOXA 4J16A 1V8DA 1OLXB 2EWVA 4OAQA 5CH5A 1SOUA 5E6RA 2GEKA 3VVLA 1XTBA 3FFWA 2QN2A 3NHRA 4KQEA 5EGSA 3EDMA 3WFJA 1NVEA 4ZVQA 4P0PB 1E1KA 2XVZA 2BEVB 2Q8NA 3ETCA 3IR6A 4KBYA 4KIFA 4RDIA 4XVCA 3IJPA 5BN5B 3C43A 4F4UA 1BD4A 4PE5B 5EWJA 2BM8A 3SIWA 1EWKA 4I4TB 2I7VA 1AO3A 1V16B 4X20A 2I6UA 3KOZA 2CJYA 3R6LA 4B4DA 2H5JA 1JA0A 1T5HX 2FMIA 2EWMA 2FEAA 3DUFA 4I4NA 4O63O 1TK3A 1WSAA 2A8YA 3D0RA 2R6ZA 1ADJA 4GI3A 3MTQA 4H7FA 4JJ6A 1YXMA 4Y2JA 3BKWA 3GEHA 3RUPA 1XYVA 3NHPA 4F7DA 1VJ0A 3RRBA 1R6VA 2J3QA 4H7HA 5CNKA 1NKVA 1O6ZA 4BKRA 1I3KA 1CUBA 2KBEA 2V6JA 2VDPB 3M3DA 3SQMA 2CVHA 3WSWA 2VHWA 4URUR 3C3BA 2FZVA 4AAYA 1XRNA 2R6JA 3AX6A 3RTGA 4BMNA 1NUQA 1K63A 5I5EA 3KB1A 3GAMA 1XWIA 1R8QA 3KLOA 3O0TA 3ROXA 3VZPA 2BFFA 4C0WA 1U1DA 2CVQA 3RU9A 4CLRA 3STXA 2QB5A 2AOTA 1DPGA 4AY4A 3LBYA 2QY6A 3E58A 2ZM5A 3FWHA 1QRDA 1NPDA 2C5LA 3GOHA 2FOIA 2BTEA 4LXXA 1KS2A 4Z4HA 2PUHA 2Q4EA 1UZNA 1EDDA 2H2HA 3HR8A 4R2IA 1V8OA 1YL6A 1XROA 2IE0A 4PCLA 3ADDA 2FPXA 1TO2E 4H2DA 5K5EA 4RW0A 4D6PA 5CDYA 2Y1DA 3BWDD 3ZE1B 5F98A 1H85A 4MEAA 3TVDA 3HBMA 2CVOA 2OFXA 2YR0A 5EPEA 1YZQA 2YHUA 2Q41A 5GJCA 4BQNA 4ZEVA 5B55A 1CY1A 1ZL0A 2I2CA 2FJPA 4HEHA 3FRIA 1V47A 2YJ3A 4ENUA 4ZTUB 1WG8A 2QMOA 1U99A 1AM4D 4K8RB 2P1ZA 4RANA 3ESZA 1Q7GA 2A0YA 5D86A 4YP1A 2ZRQA 4D3FA 2QTHA 3OQ1A 3Q7PA 4RHTA 4Y0NA 2PUTA 5DTQA 4ARIA 5A03A 5G4LA 1KZ9A 3NP9A 1UOEA 1Q6YA 2C2GA 1TKAA 3IAS6 1R0LA 1XNHA 4FC6A 4RA9B 4Y9UA 2WWIA 4KFCA 1MRSA 4KPFC 3FMOB 2Q7OE 2G4LA 4OJTA 4C88A 5AM3A 1Y7PA 4JYBA 4YMGA 2YZNA 3REGA 1J2RA 5BR4A 1DLJA 2VATA 4O5OA 1QH0A 1DJPA 4EI7A 5JCXA 3ROEA 3G6WA 1XTVA 5MN4A 5BSTA 3TI7A 5AWFC 2I4MA 3P0FA 3WGHA 5DHSA 3RIMA 3KDPA 4UBLA 3R6DA 3BMCA 4UNQA 3D9QX 3HRIA 3MGKA 4LK2A 4ZQIA 4C78A 3GLGE 3DE7X 1KDOA 2EG5A 1UBOS 3JAKB 3K0HA 3F4LA 3JRNA 4U2GA 4XQCA 5AJTA 1EDOA 3LX8A 3C6QA 2OA0A 1MB9A 1QRUA 1KOLA 4YIHA 4NZYA 2QRGA 3GR6A 2COEA 4FYVA 4HRAA 4QZVA 5HDQA 3GQVA 2DC1A 2CMHA 4AZ3A 3A6LA 1XNGA 4PZPA 3EDQA 5J9FA 2OD2A 4I3GA 5A9RA 2KHZA 4NJMB 2PJZA 2Z8YA 3L0IB 4WQMA 3RS0A 3BZBA 1BE1A 4Q1CA 1WX1A 1CJMA 1AG9A 4II2A 3VDQA 5C8ZA 4EKYA 3TJRA 2C92A 3O75A 2FGJA 3KT8A 1Z3IX 3TIGA 1CDEA 4IDCA 3U40A 3ZYCA 5LP6B 2H85A 4QHYA 1TL7C 4D98A 3EFOA 4UW9A 3KU4A 4Q1BA 2EJBA 2W2KB 2P8SA 3ABSB 1PHPA 4HDOB 5NULA 5IYZF 4CMIA 3LX4A 1YNOA 1SR8A 4GS5A 4INPA 1FB5A 5ITWA 2HHLA 1BS9A 2YUTA 1BDBA 1C1XB 2DYKA 1T35A 1DKQA 3CURA 3KOXA 3NWEA 3SYRA 2ZUTA 1X38A 3ZU3A 4HAYA 1L4HA 5CD1A 1WNTA 1E3QA 1WW2A 4MHTA 2F55A 1GPKA 5A71A 2YZ7A 4HLNA 2A35A 4TMVA 1J39A 3O82A 2JD2A 4BQRA 1NBMD 4C4OA 4E21A 2V6GA 3EXG2 2J5BA 4G0XA 5FEUA 1F6DA 5JFGA 4ESVA 3B3GA 2DXIA 3BH0A 3Q1KA 4CM4B 1UMDB 2XOKA 1KI4A 4ZVOA 1ZBDA 2R4UA 3GGGA 2OECA 3K92A 3KV3O 1H6AA 3KPVA 3LX5A 3BZUA 3CVJA 4QBGB 5DASA 3LPCA 4Y6QA 5ENVA 4XWGA 5KQMA 3Q8XB 1JKJA 3WV5A 5GINE 3THWB 5F7XA 1OYYA 2CVPA 1SVWA 1RRGA 4ZYXA 3FWNA 1Q14A 1JSLA 5LQCA 4GVXA 1BN6A 2QW1A 1YONA 1YR8A 2PQ2A 2Y4OA 4JT4A 4CRWB 2AFRA 3M89A 3DBLA 1RQLA 2E89A 4KDCA 5FFMA 3ZNPA 4F2WA 4ENWA 1EK5A 1W5AA 2AMVA 4GQIA 4IKEA 1L4GA 2FQYA 2IYAA 1OV6A 4G4JA 4JJGA 4WZ6A 3I9V1 1FVOA 1N33B 3UV3A 4OI4A 1F4PA 2QL9A 2CF6A 4RV4A 3RJMA 5L51A 5LQAA 5JJKA 1QORA 3TOXA 2HM7A 3M6WA 1W6RA 3RK4A 1R15A 5SV2A 2A5JA 4FHZA 2P91A 3LQRA 4WSOA 3TSOA 4FB4A 4LVCA 1VHTA 2P27A 2Y68A 3LVRE 3ZI4A 5JUWA 1N2GA 4DCTA 2V4UA 3HDVA 1PL0A 3TQHA 3KYDB 4B3RB 4FZVA 1CHDA 2CCKA 4OQPA 2ORWA 3SSMA 3T8YA 4CLOB 5CK5A 4ACBA 5C9ZA 3EH2A 1UXKA 4G0NA 3BD6A 1UMBA 5K45A 3N05A 1H2HA 3L0CA 2XUKA 4NI5A 3AZPA 1HNNA 1ZQ1A 2B35A 4LN1A 5ALXA 4UOZA 5KKCA 2VDVE 2VUIB 3I2JA 2QG4A 5CYFA 3H17A 2VT6A 3V4PB 2OXCA 1HT1E 5CA1B 1WB9A 3D8TA 5AJWA 3T54A 1WZEA 1JLMA 4ARUA 1CJSA 4C0JA 2WNSA 1P1HA 3ROKA 5CH3A 5KC9A 1R6XA 3KZ1E 4XPIB 4WZZA 1KY3A 3GBVA 3LBAA 4RJ2A 2RGBA 1V71A 5IARA 1PX2A 4MV5A 5JJIA 1G60A 2WHRA 4R51A 1J9GA 1SA0B 1YTLA 3ETDA 1OJ7A 2WAYA 3L05A 3TQFA 4R5MA 1ZEMA 5JPIA 5LNK6 2XRZA 3ZBPA 2PLAA 4LYEA 2QN8A 5HUQA 1CIPA 3CPSA 3GX1A 2G8LA 1A4IA 3MTDA 3BXFA 2CUKA 3EEFA 1XZIA 4L0QA 3U39A 4QYWA 5ES4B 4OMCA 4INAA 2ABWA 3U48A 3OQIB 4BLSA 4DSTA 4GX0A 2AXEA 2EP8A 5JWRA 3FW1A 3OA0A 2BRUC 5L53A 4WEOA 3G2IA 3WYAA 1EP9A 5TMPA 4ZCRA 4G4IA 4UREA 1RBMA 3EUFA 3GLHE 1D04A 3FAZA 4RFVA 1Z7EA 1L7EA 1E64A 1SKQA 2Z1NA 3GGDA 4JT9A 4OHRA 1L5LA 1JB9A 1Y4DE 2B7CA 2V6IA 1AB5A 3WISA 4F91B 1QPZA 5EJIA 5LOVA 4D82A 5LYYA 1OBCA 2ZAOA 4UOEA 1WOYA 1FFDA 5A4IS 2JJ2D 5KKNB 4MI9A 3TRDA 2H7CA 4BJ6A 4PHHA 4C2UA 1L4YA 5FV7A 3R9WA 1OBHA 1IWOA 2O07A 3QBJA 3B6KA 5D85A 2JFZA 4IMRA 1TT5A 2AC7A 4O4HA 3W04A 1JW9B 1U04A 1M2VB 5FADA 1OZFA 1OD6A 2DLDA 2PX8A 3OFNA 5FWNA 1COZA 3LYUA 3TNLA 4AY2A 3MIIA 2C1ZA 1E62A 2QTZA 2IU6A 3EXEB 3Q5DA 2PAFA 4EHJA 1FC0A 4LZLA 3O4FA 3NHMA 4DV5B 5ALVA 5BOSB 4B3HA 3MWJA 4JK3A 2VG8A 2ZWMA 3KRTA 4JQOA 5AK5A 4TOIA 4UUBA 6REQB 3OHMA 2EBFX 2ZJ2A 2C9BA 2IYPA 4NEHB 2WOOA 3MWDA 3KYCB 4E6PA 4BUCA 2H06A 2XPCA 4J1NA 4NZZA 1ZH0A 3G2KA 4W82A 1HDCA 3P2IA 4K2HA 3TQQA 3T7JA 1NXQA 2D5LA 2R48A 2XOEA 3CRNA 1N9GA 1LDGA 2Q7XA 4GVPA 2I3AA 1PJAA 5E8RA 2XWJI 3ELWA 3PUJA 3ZHSA 5TQ2A 3A4VA 1R9JA 1ENYA 4FQ5A 1NN0A 2KB0A 2HV9A 4YWJA 3OLZA 1OLXA 3KAKA 1H0SA 3JR3A 2BISA 4OHBA 2JIZD 3HADA 4Z51A 2BYTA 2H1IA 4JVOA 4UTVA 5KSOA 1UDRA 1YB1A 2BEVA 2QNIA 1E6CA 2OQIA 3H5IA 3ZTWA 3KZKA 2C7BA 2YHSA 5B2EA 5JEDA 4Z4QA 2Q6OA 2O6LA 1U31A 4COKA 2WB2A 4E5MA 2OHFA 4MW4A 1SU4A 4FTWA 4L5JA 4I4TA 1PJTA 3JW8A 1V16A 4JMPA 2ZFUA 3A1NA 4K46A 1V3UA 3K0KA 1B15A 5HTOA 5CVUA 4Q3LA 3RFXA 1IB6A 4N7RA 1IZ0A 2PUJA 4Q1VA 4Y1EA 1BS1A 3H11B 4KMOA 3O26A 5CX1A 2FKNA 5U4XA 1NVBA 1XKLA 2ARKA 4GXQA 4P1ZA 5FH9A 1J1UA 1ULSA 1RJFA 3GDWA 3ENZA 2IHVA 3KC2A 4ZAXA 1DAEA 1K9SA 5I9IA 2DJIA 2YIJA 2V97A 3O4JA 1MFPA 2X4LA 2WRZA 1NXVA 1EWRA 3JASA 3HJHA 3K4PA 4S0ZA 3O21A 3ZHQA 4PC3A 3SQLA 1ZOLA 5CLGA 2O5CA 1WBDA 2YHAA 2VJBA 5BSFA 4CDNA 1G6Q1 3FLBA 4D4MA 3F9CA 2ZITA 1G3IA 4G1MB 3DE4X 1VZ3A 1YKFA 2GXUA 4RGYA 5EIAA 5CXQA 2FSVC 1X86B 1W87A 5JATA 1NVVQ 3I1YA 2HA7A 1WJGA 1M8PA 3GRZA 1XYYA 2O7SA 4AG5A 4B0PA 2GPJA 2HEGA 3GCXA 4URWR 5ESRA 1GG2A 3AXSA 3OD1A 4IPTA 1KK0A 4P33A 1R10A 2YHIB 3I2IA 2NU8B 4FZRA 4P83A 3R23A 3AM3A 3FPSA 4NBVA 4RNCA 4G8JA 1JIIA 2GCNA 4JODA 3WB0A 3JQEA 4BQFA 1XJ5A 2QVBA 4Y2GA 3S8YA 1JFLA 4GOOD 1W4LA 4B73A 2ZSBA 5IF3A 4I3HA 2FWBA 3VV3A 4FHGA 1WA5A 3NDPA 3W34A 2FP4B 3JPYA 5LU8A 3ZWAA 1E9CA 2VI5A 1VSTA 1DAIA 4K9NA 1H4SA 4EJSC 3FCAA 1V8FA 1LRKA 1JI3A 3K73O 3RD5A 2DR2A 2G67A 1E20A 4F4CA 3PXCX 3VR5A 1PBNA 1T9GS 2Z5LA 1Q74A 3A04A 2D1RA 4FNOA 4UE3S 3T0IA 3WYGA 1M5RA 5F1OA 1DG1G 1H93A 1Q1GA 1IXZA 1A8HA 4HH4A 3OJWA 1PU2A 4TPKA 1CERA 1HK7A 1NOKA 2HA6A 2WSLA 1GCAA 4FS3A 5I8WA 3UJBA 3LUFA 5P21A 3LDFA 4RA9A 1CRQA 1GARA 4XCXA 1DO2A 3HBJA 1DKUA 3BGIA 5CK4A 4BIIA 1BCRB 4CR8A 1L1FA 2BFMA 2ZCJA 2IYFA 3QVTA 1F6WA 1RAIA 2UZAA 3A9WA 3ZCPA 1E2MA 1Z7GA 2POCA 3P0IA 1QUEA 1U7XA 2QGNA 4IICA 3SF0A 1PLKA 4EYGA 2F1OA 4OBXA 3AFGA 4LMBA 3PJGA 4N7BA 5K0GA 1TQ2A 1QCYA 4I1RA 4ZT2A 2NZ2A 2H1FA 1GRVA 3A70A 1S1MA 4KB5A 1DBSA 3ZWXA 1GV0A 3JAKA 3Q7IA 2QY9A 1XZHA 4C07A 4BE4A 3V1UA 2JC3A 4BVJA 1KWKA 1CUGA 1RYZA 1SBQA 2CDBA 3RM3A 4EW2A 1DJMA 2PR7A 2DP4E 1KY4A 3PDJA 4PNHA 4FFRA 1CS4C 1V6AA 1SKAA 3JSAA 4TTQA 3UKDA 5SY6A 3VTFA 1IL0A 4MKFA 4NJMA 5DM60 3ZVMA 5BR8B 1R27A 4PNPA 4XLLA 3CN9A 4LZNA 2AYXA 1BWPA 1YI8A 2BW0A 3A1EA 4LUCA 4IZ6A 5AI9A 4UNSA 1PO7A 1M67A 2JBWA 1VG8A 1A5TA 3DQZA 4FW9A 2OYCA 3WLIA 1N5MA 3WICA 3X1JA 3VJRA 3HXLA 1MH1A 4OJNA 1L1QA 2OBXA 2PQ0A 3AIKA 2Z30A 1E32A 2W2KA 1IVNA 1J9EA 5CYOA 2VNHA 2VYND 5IKPA 1N0UA 3ZJ5A 3F1LA 3DOUA 1FSFA 2PXHA 4BFXA 4F4DA 4P84A 1S02A 1E9BA 2ZYGA 3OZWA 4DR5B 4P0QB 1C1XA 3U17A 3PNBA 2LGJA 2G4VA 3E35A 3LIPA 2O2XA 3R0ZA 1MX3A 2G4CA 4K2AA 2G5PA 4NARA 2ECKA 1FMLA 2ZI7A 4EYQA 1AXRA 1W2HA 4TLBA 3IJRA 5AXAA 1EB8A 4IZOA 3ZBUA 2PZ8A 3WY9A 4CIXA 4ZEMA 4MV4A 5DLYA 4L5IA 5TB5A 2G9RA 4RSHA 5ILGA 1UMDA 4CM4A 2O8FA 4L27A 3W77A 4YN3A 1CUXA 1LRLA 1INLA 2NU6A 3IEIA 3ILYA 5FAKA 5ITSA 3DZBA 2VK1A 2GPSA 4P38A 4RUKA 1IMOA 3K31A 2PD3A 1N1DA 3F1KA 4BKOA 1UBNA 3KKPA 2W6PA 3AGQA 2I4NA 2BFEA 4PLTA 4K6FA 4Q0MA 1KDZA 4E4YA 4AP6A 1Z4IA 2EIXA 3GLVA 3ESBA 2UVDA 3TINA 1KKMA 4ZKEA 3HCDA 4N1AA 1W6UA 1N1MA 2XUJA 3KIPA 4XEUA 3RIYA 1CUUA 4CTKA 1P31A 4N5NA 1GYRA 4CQMD 1TJNA 4UD2A 2QRMA 3QMPA 4MQEB 3MG9A 5FO1A 1D03A 1ZOIA 3SIPA 1YHYA 2XX3A 3ND6A 3WLMA 4DKXA 4LYGA 1XQ1A 3AQ4A 3ZXSA 1M1NA 1ZOPA 4PYNA 4S1WA 4JUDX 1I32A 1G2QA 2C2KA 2R00C 2WJJA 3NFRA 4RD1A 4OSPA 3IE2A 2WUGA 4G65A 4OXKA 2G0NA 1EEHA 2AVDA 3G0BA 4JB8A 6CHYA 4BWYA 2R5NA 3SPXA 1B00A 1Y1RA 1XBTA 2GCGA 3QNUA 1Z37A 4Q3BA 4B9EA 1YQ9A 4ZA2A 4V1CB 3EZLA 4K40A 4ON9A 2WUFA 1YFKA 2VPWA 4QQKA 4WJLA 1T6XA 2XA1A 3KYDA 1FS5A 3N0XA 3WDMA 2GBIA 4DUPA 1GQQA 3TTTA 3HNRA 3BN3A 4EG6A 2V7PA 1T2DA 1NLFA 3NUGA 1X7DA 3MM4A 3RRNA 5I4CA 3UTDA 1N2CE 3ACBA 2XNJA 3PNVA 5FFFA 3H5AA 4KTVE 2GLUA 5AD1A 1CDOA 4JXXA 4DXAA 4XDGA 5DLPA 2PWYA 1NVTA 3ZH2A 3HJNA 4UHHA 5ESDA 1L7RA 5AVTA 4HDAA 2B83A 1NV9A 4MKHA 4CNBA 4P2BA 4MKZA 4Q3CA 5CA1A 2XMGA 1L7BA 1BHQ1 1PGPA 2JS7A 4RENA 4XPIA 1A4XA 3TTUA 1YR3A 3V2IA 3PNLA 2A9PA 4IDFA 5EVJA 4OCZA 5MF6A 4I4LA 3TEMA 3DD1A 1KQFA 1Y5NA 1HE2A 3RLIA 3BILA 4GP9A 2QK4A 5LLDA 4JVMA 4UU0A 1SA0A 3E8SA 3WLNA 5BNFA 1VMEA 2BZGA 2H54A 1OWOA 3A1UA 1BWQA 3M6AA 4LQDA 4QREA 4WOBA 1BE8A 3HXTA 4ITVA 3RBZA 2QDKA 3QF7A 3I2HA 1IFXA 5FXMA 1FTSA 3V8BA 4KW7A 4HYEA 1FFYA 2LBPA 2E4WA 5A7GA 1TFUA 3NHKA 1C9YA 1EJBA 1X2BA 1S4QA 3C74A 3Q72A 3QGMA 2ORYA 4NV1A 4R6XA 2GILA 1HLFA 5CHEA 4D0LB 2B0JA 2NTVA 3ZDEA 2DPHA 3BA6A 3I61A 2GKGA 3HSSA 1SUIA 2KJQA 3I6YA 5AH0A 1NF8A 2W0MA 3GJ6A 5FT9A 4EPYA 1KI6B 5JFOA 5F1KA 4JBIA 4EYSA 3PICA 5FQNA 4IMPA 3WWDA 3IYLW 1CETA 4PVCA 1GZ3A 2BHTA 2Y0BA 4AJKA 3LW8A 1Y1TA 3DW1X 3EZNA 4OKNA 4B7XA 1O95A 3IPLA 2DWUA 2EQBA 1PX0A 5KYVA 5IT0A 1DMRA 5LB2A 4EWLA 1KC3A 3I45A 1XAGA 5EJ9A 1XA4A 2GERA 5CCBA 1TDJA 3NBAA 3AKYA 1NZDA 2NV0A 4KUHA 4OA5A 4EP1A 3J81k 1HYGA 1HE5A 3C8HA 2AN1A 3EXEA 2GT1A 3I42A 2IYRA 4E03A 1T36B 3KB2A 4NV3A 4TKVB 3LUJA 5BOSA 5JCZA 4MA5A 1G8JA 4ZT5A 6REQA 2VSNA 1NRIA 1NTOA 5L4LA 4E15A 3X44A 4AKGA 1PDWA 1BGWA 1Y33E 2P6OA 4CZ2A 1UADA 2O5VA 3KYCA 1RAAA 2Z4RA 3U44B 1YKGA 2CMGA 4QXMA 3W6ZA 1T29A 1HQCA 2P9EA 2CNLA 2DPGA 2DWQA 4H7IA 3S1SA 2QUAA 3RS4A 1H9BA 3K9GA 2ID9A 3QJYA 4O6VA 4YQYA 4B40A 5GVSA 4ROSA 5DGIA 4IUDS 3IQXA 3TBFA 4GMXA 3QG1A 4H4DA 4BX2A 4CKYA 4PHCA 4OI2A 5IKOA 2C96A 3ZS9A 2ECFA 1TM4E 2HHHB 2OILA 3CZRA 4D3SA 1T0JB 2I8AA 3JD2A 2PGNA 3R7AA 4W5HA 5E1BA 3VH2A 1RQPA 2IRWA 1NC1A 4QIHA 5PGMA 3RJTA 1HQKA 4C7JA 2HRRA 4P3KA 5L3RA 3S27A 3WLQA 3SEQA 1NY6A 4I4CA 4KRGA 3P1JA 3A6EA 521PA 3TW8B 5BW6B 4ZMBA 5JRJA 1LD3A 3VRHA 1HNWB 1EVYA 3KYJB 4Y7DA 1U7WA 1EHIA 5TVKA 1OCEA 3MTAA 4WNAB 3U7JA 2F3SA 1IUNA 3OZAA 4G5RA 1QOPB 2P0EA 3H11A 5HR5A 1Q0SA 4LWQA 4E33A 5H9VA 3NWOA 1YB2A 4KR2A 3A10A 1E6MA 2D0IA 3TLCA 4M76B 2IC5A 2V3CC 1D6MA 3SR0A 4LJLA 4EGCB 1TUGA 1YASA 2YBDA 3L82B 3GUCA 3L7CA 3W9YA 2R6GA 4MUGA 3T1QA 2I1LA 4M7PA 1X9HA 3HR4A 1YK1A 3X0DA 5I7WA 3Q3GE 1WB6A 1F3LA 3ZWDA 5GZ1A 3D7SA 3BB4A 4R16A 1CR1A 3LC0A 4R0MA 5EGNA 2I6QA 1MRNA 5F3DA 2LKCA 3RS3A 4QO8A 1G5QA 1GPUA 2GAFA 1W5EA 1CY2A 4MARA 1VPLA 3DXXA 1BFDA 3SZMA 3TQOA 1D1SA 3VTAA 3NDIA 2HJHA 3LHKA 4IJUA 3QWAA 4DDWA 3VR0A 5JPDA 5LWQA 2YV5A 4EA6A 3RHSA 5C52B