2BFDB

Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
341
structure length
332
Chain Sequence
AHFEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
total genus 129
structure length 332
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bfdB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bfdB01
5HJEA 1OZHA 3EXHA 3EXIB 3DV0B 5EJAA 2BFBB 4JUAA 5DGTA 1YI1A 5I4IA 2EZ9A 2JGDB 1N0HA 5HGXA 3IAEA 1QPBA 1X7XA 4JD5A 2VBFA 2JLAA 5I5GA 1OLXA 2IEAA 2OZLB 3JU3A 5HYVA 3ZHVA 5EJ9A 2G28A 3LPLA 3ZHRA 1YNOA 3DUFB 3ZHSA 4KXXA 1WCIA 3EXFB 1MCZA 4C7XA 1YD7A 4JUCA 4K9LA 2C3UA 4K9NA 4MPPA 4K9KA 1X7XB 3AHIA 3M6LA 2Y0PA 2UZ1A 2WVHA 4KXVA 1W85B 5EJMA 3DV0A 2C3PA 1V1MA 1YBHA 1YHZA 4GM4A 3DVAA 5EJ7A 1PO7A 4JUDX 1UM9A 2BEUB 2C3YA 1UPAA 3E9YA 2VK4A 4JU9A 5K3SA 5EJ5A 2QTCA 3EA4A 2BFCB 1W88B 1X7WB 2BFFB 1IK6A 4WBXC 1TKAA 1PVDA 3HWWA 1OZGA 1V11B 1RP7A 1OLSB 3OOYA 1V5EA 2R8OA 1TKBA 4KGDA 2EZTA 4MPJA 1TRKA 2UZAA 5I5EA 1V1RB 2BEVB 2FWNA 1Q6ZA 2EZ8A 3ZHQA 5DGDA 5EXDA 2Q27A 2BEUA 2DJIA 1V1RA 2BEVA 1X7ZA 4Q9DA 4RJKA 3DVAB 1UPCA 3F6EX 2O1SA 2PGOA 5ESDA 3AHGA 4GM0A 1W85A 2UZ1B 5EJ6A 4D5GA 2JI6A 3MOSA 5HHTA 1TKCA 1UMDB 4C7VA 3M49A 1PYDA 1X7WA 1YHYA 1OLUB 1V5GA 1X80A 1YI0A 2AG0A 1V16A 2BFCA 2BFFA 2X7JA 2O1XA 1NI4A 3ZHUA 5EJ4A 1PI3A 2BFEA 1UM9B 1OZFA 2G67A 2JI9A 2JI7A 1V1MB 2V3WA 3FLMA 1Z8NA 2IHUA 5DEIA 5EXEA 1DTWA 2VBGA 5EJ8A 2OZLA 2BEWB 3LQ1A 4K9MA 1NGSA 2WVAA 3HWX1 2JIBA 2PDAA 1POWA 1V5FA 4FEEA 3AHHA 2JGDA 2YICA 5C4IA 2IHVA 5FEMA 2XT9A 3ZHTA 1DTWB 3EXFA 1Y9DA 3EXG1 3DUFA 4GP9A 4MQ5A 1JSCA 2FN3A 4K9OA 3D7KA 3LQ4A 2BFEB 1OVMA 4RJIA 4XEUA 4KXYA 3EXG2 1V16B 3KOMA 1GPUA 2AG1A 1OLXB 1QS0B 3RIMA 1ITZA 1AY0A 3L84A 1R9JA 2PANA 3EXEA 3AHFA 3M34A 1UMCA 3M7IA 2BEWA 2Q5LA 3AHEA 3IAFA 4FEGA 4ZP1A 3AI7A 2BFBA 2IHTA 1X7YB 2BFDB 3HYLA 1T9CA 2Q28A 3EXHB 3EXIA 4JU8A 2Q29A 4QELA 1BFDA 1UMBB 1NI4B 2R5NA 1QGDA 3UPTA 1T9BA 2Q5OA 1B0PA 5AHKA 1X80B 1OLUA 2BP7A 1KEKA 4GG1A 2VK8A 1UMDA 2VJYA 2JI8A 1POXA 3EXHC 5IMSA 4COKA 2R8PA 3OE1A 4K9QA 4MPRA 1UPBA 1U5BA 1ZPDA 2NXWA 4RJJA 3LQ2A 2J9FA 2W93A 4D5EA 3AHDA 5K6TA 1X7ZB 4KXWA 1W88A 2C3OA 2EZUA 4KXUA 4K9PA 4QQ8A 3EY9A 5K6RA 1UMBA 2WVGA 2C3MA 1T9DA 2VK1A 3FZNA 3F6BX 3FSJX 4JUFA 4QPZA 2J9FB 2E6KA 5I51A 1X7YA 1U5BB 2BFDA 2C31A 2EZ4A 1L8AA 1OLSA 2JLCA 2Q5JA 1V11A 2YIDA 2XTAA 1UMCB 3AHJA 5ERXA 5K2OA 3EYAA 1T9AA 4GPEA 2XT6A 2QTAA 2BP7B 3EXEB 1QS0A 4GM1A 2Q5QA 3AHCA 3UK1A 2VBIA 4JUBA 5ERYA 1WCIB 2PGNA 2C42A 4MZXA 2G25A
chains in the Genus database with same CATH superfamily
2WAYA 2XF8A 1NLZA 3DBLB 3IKJA 4QGFA 3FKSD 3UXYA 4H7FA 3WGVA 3KZOA 4ZHQA 1ZJWA 2OM6A 1OXXK 2BVNA 1E3WB 4H1TA 2BBSA 3OZIA 3U40A 2P4EA 2YVAA 3R3UA 2BHRA 2BKEA 4D0NA 1MOPA 3OICA 4K3VA 4RSGA 4DUGD 1XOIA 1RLTA 1XD2A 2EC5A 1NVVR 3NVDA 4RCZA 2CCGA 3LPLA 1Z12A 2QF7A 2W2OA 3OPVA 2A0FA 2C4TA 2ZSDA 4LJKA 1UWLA 3OE7A 4FU0A 1G6OA 3GG2A 1XEWY 3K8ZA 4OATA 2QTFA 5AKHA 1KPHA 3ZH9B 2VNHA 3UOWA 2XEDA 5IDWA 3E27A 1UJ6A 1KJ8A 3MNFA 3AM4A 4RNCA 1DCKA 1N7HA 3Q0TA 4X1OA 5EXPA 4G6ZA 4J1SA 4TS1A 3GMSA 1VG8A 4Q1AA 1BW9A 4N39A 3DBLA 4EW3A 2BDUA 1N8SA 2JLRA 1NBIA 1A7AA 1ULBA 1EUQA 4S04A 4YIHA 3VU3A 1H6CA 4YMSA 3SVTA 5F73A 2JS7A 5G53C 3ASZA 3W3AH 2HM7A 3JPWA 1SOUA 1HXHA 3GJ3A 1ZLYA 3B36A 1TGVA 3VPBA 1YZVA 1FBNA 4LHEA 1KOJA 2JLBA 3R75A 3VDQA 4C22A 2HTFA 5C81A 4Q9DA 2DY1A 1QGAA 4RIFA 5DE3A 5TEWA 5BR1A 1X9HA 3EG9B 3TMKA 5HKAA 1NRIA 2AMVA 3LYHA 3O31A 1EFRA 1N6PA 4MWCA 3KSAC 2C9OA 1GKKA 3NNSA 1NOKA 4LXGA 1HYHA 1NP7A 1RZUA 5K8IA 2I2WA 1C9DB 2RHHA 4X8HA 5U4XA 4E33A 3V33A 2B0JA 3EEFA 1KZHA 2BZ1A 5K0GA 1SOWA 2H85A 2Y2UA 5CD1A 1OSNA 2VTEA 3P2YA 1WUTA 4M6WB 2AJTA 2I8CA 2P9BA 1WX1A 1NJ6A 2I71A 1A5ZA 3HCEA 3V4ZA 3BJZA 4D26A 1K1EA 3E05A 5TQ2B 1C3OA 4HYYA 3ZXUB 3ZY2A 3ZKWB 4BATA 5JWRA 2BKUA 3ILHA 5EUBA 1TUGA 3BL5A 1JEEA 3EUAA 4JELA 4NBSA 2K5UA 3OJOA 8MHTA 5FWYA 1OXKB 1Y3CE 3TECE 3QOFA 2WMDA 1DTEA 3STVA 4DIDA 4GOJA 3ZNQA 1GPMA 1BVYF 3DMRA 4YLGA 3FRIA 2ZLBA 4IM7A 1YIAA 2XVZA 1CETA 2Q8PA 3AR3A 4HS9A 4Q12A 1HH4A 4LJ8A 2Y1KA 1U0OC 3PICA 1OOEA 2VK8A 4OV6B 4BNHA 4DQDA 3P0JA 1ODFA 3B53X 4DLUA 3ZDXB 4MS3B 4GKAA 5KB3A 1SZJG 2HDNB 4V0ME 4FZVA 2BFMA 2AI1A 5AJVB 2CXRA 1F5NA 1XCMA 2EDCA 3ORSA 4NBTA 2ZUFA 5K6RA 1MABB 2D2FA 5J58A 1ZVMA 1TT5B 2CBGA 5G0VA 1WMBA 2XPCA 4QARA 3OQIA 4K9OA 3HHPA 3BWCA 5FV4A 3ICQB 1EEHA 2Z2KA 4XTRA 2X4LA 5LMCA 4MQMA 2J0EA 3D81A 3LVRE 3II6X 4H6XA 1BHQ1 1D2MA 4R1OA 3CLUD 2RAPA 2GN1A 2PKCA 3KT6A 2WOJA 1VB5A 5KYVA 2B20A 4R5HA 2GPWA 3SE7A 2MSCB 3TGWA 1WPGA 5E9JA 2PSEA 1RBYA 2BR5A 1V3UA 1A95A 4QECA 1GR0A 2ZJFA 1WNTA 2J9YB 5BV8A 4WZZA 1ZAKA 5FPQA 3D4PA 1A77A 1QVVA 1Z75A 2H1CA 3VU9B 3S81A 3H11A 3BGVA 3VHRA 5GINE 4DRYA 1ZH2A 1WCIA 1KU6A 1HDOA 4ZV7A 3B82A 4DQXA 1U0BB 4RENA 4YCCA 1PYOA 1KZ7B 4IL5A 3LUHA 5FF9A 3RS0A 3A6KA 1C7QA 5JJBA 5EMMA 4FCTA 1K8RA 4ESVA 1ZKMA 1NASA 4IIJA 1IBCA 4XQEA 1BVUA 5C1BA 1E20A 3H75A 2OL4A 1L7XA 2C8LA 2Q9UA 4C0WA 3H3XA 5I7SA 3OOEA 1NURA 1MBZA 1EQAA 2JB9A 2V7VA 3HHEA 3JALA 3MTAA 1JA9A 4JQOA 5HCUA 3RYIB 3S1AA 4QQRA 4P7FA 1M1XB 1V4NA 2DQ4A 3A1TA 4KACA 3RI3A 3V97A 5IT4A 1FFYA 3NNNA 2YXBA 4MSUA 5I5EA 4QKQA 1VP9A 5J1SB 1MPXA 4YJFB 4DJAA 1O8CA 3NBMA 1HRDA 1JJFA 3N3AC 2FETA 4JYZA 2WJYA 4HZGA 1XAGA 1W85A 5AXAA 1A5BB 1TO6A 2CW5A 4D8WA 1C5KA 5TEVA 5AVUA 5KX5B 1ZK2A 2DPLA 1TM2A 1ZIOA 3E70C 5DF1A 3PE6A 3CEPB 2X8BA 4E30A 3QK7A 2CWWA 3H04A 4GZ6A 2VYFA 2P4UA 2CL5A 5JCOC 5K0TA 3FYHA 4OBBA 4WHMA 4QBHA 1TEHA 2Z8YM 3PDIB 5KNBA 3L5OA 5MFPA 3O8OA 2BEWB 2NOAA 1JBEA 3AVVA 1D7AA 1IM2A 4CV2A 4XM0A 1GPH1 1POWA 4GE3A 2PSDA 3QTLA 1F2VA 2GEDA 3B3QA 4B9AA 3R5TA 1F7UA 2WTBA 3MCVA 4UU7A 3L49A 4DCGA 5CVCA 3A1EA 2IEZA 1NMYA 3FH0A 4HZIA 1I2ZA 4PCUA 4ZI2A 2Z9DA 4YRKA 1C9YA 5ALRA 1V9SA 1P3DA 2F59A 1BMTA 1LF5A 3CLVA 3EISA 3B5IA 3EVNA 4HDCA 4ZI7F 1GUYA 1X87A 3E6AA 2PZMA 4PXYA 2B8NA 3BQMB 3GFFA 721PA 2TMGA 3D2CA 5J9FA 1K6XA 3UOAB 1ML3A 1J21A 3AB7A 3DNMA 3GEHA 4L7VA 5KAPA 2XRFA 3AF3A 3JSXA 7MDHA 1Z35A 2H9IA 2H1WA 2QD5A 2XOEA 5LP1A 3WJ7A 5IT9A 3QUSA 1I7PA 1NUTA 1JHOA 2W93A 4OXKA 3JWIA 1SC6A 4G67A 4XDHA 1FFXA 4QJIA 2C3OA 2JZCA 1J8FA 1ZJJA 3U9LA 1ZN8A 2X77A 3CRW1 5HRUA 5KSOA 1B3BA 3OBIA 1T8TA 1VKJA 1QVWA 1E5XA 2HNKA 4QPZA 1I1HA 2C8VA 1U2RA 1RAEA 3UB3A 4Y1RA 2NV6A 1ICIA 2R97A 2J9ZB 2ZUTA 1P0QA 4PV7A 2SBTA 3EZXA 3FCAA 3R5FA 2FWBA 3T9BA 1AU9A 2HU2A 2P2GA 3FIJA 5DW3A 3WAGA 1QIGA 3VHXA 5EWMA 2FPPB 1QJ4A 4LFCB 5K0CA 4YAJA 4B17A 1PL7A 4XWTA 3L3BA 2IWHA 1TCUA 1ZGAA 3GPDG 4UOQA 4BWGA 2I5PO 1RYDA 4DNXA 1D6JA 1TF2A 2V7QD 1SCBA 2QE7A 4L3WA 3GHHA 2PH5A 3QMPA 1N77A 4MV5A 1PSZA 1SUFA 1Z4KA 4MRSA 4KN9S 3C5CA 1I7SB 4C4SA 4P4NA 5T4BA 1OT3A 3JXEA 1ZD5A 1U1DA 2OXIA 4ZCIA 4NPHA 2NUTB 2EFJA 4UBKA 2F2TA 4A6DA 3GUZA 3THWB 1UFRA 1VPVA 1KMCA 1CJUC 3RSLA 2QENA 2QQEA 4AQDA 5JQGB 3O73A 5KOJB 3GFRA 4X92A 4GKJB 3F3SA 1PO7A 4L8LA 2ORWA 2Z5GA 3U0VA 4F5YA 4BY9E 3PQ6A 1CRWG 1X6VA 1G0NA 2R4TA 3WTBA 5IJ9B 3U3RA 3TCNA 1YBMA 2C2KA 2X42A 4LNHA 3G9XA 1YQGA 4PANA 4U02A 3B7PA 1NUAA 3RM3A 1XVTA 5IVKA 1XKXA 3O4FA 3REQA 1JVBA 2R84A 3RE1A 4FFBA 4O02B 1ZJZA 1JMYA 3MIZA 4YJ3A 4J3NA 3UJHA 3C43A 1XNQB 1RTKA 4Q4LA 1EFTA 4S0ZA 2YY7A 3AEUA 2DTDA 1G7TA 2RH8A 1Z6TA 1T2NA 2X5OA 2H2DA 4J75A 1B42A 1ORDA 5KI6A 5MGBA 4YT8A 2V55B 2DBQA 3HFJA 4CMIA 1TMGE 1BGWA 2CNWA 4RV4A 1CXZA 4EJ0A 2TRSB 3W3ZB 1E62A 4AU1A 2HQBA 1XMQB 3DOOA 4NI5A 3R0JA 3H7AA 4DMHA 1RTTA 4GW3A 3TIVA 2EWVA 1VJ0A 1KOFA 5DWVA 5EP2A 3ZCQA 4D9EA 1DCTA 2NQ2C 1B6SA 2YRWA 1PNTA 1J7JA 2V3VA 4J9UE 4M8LA 4A10A 1QO0D 1ZEJA 3WMGA 5JDCA 1UH5A 2OD7A 3AESB 1VM6A 2REXB 4R7TA 1E59A 5JO9A 3KKNA 2EP7A 4D3YA 1RKBA 1NIPA 3DYBA 3LHKA 4PS0A 4YRRA 5DCWA 3GEPA 1N2CB 2AH5A 2OMEA 4PQFA 1P0PA 2O14A 5KYKA 1W34A 3DTYA 2WIBA 4NICA 3UWMA 5JMWA 5M7EA 1SCDA 4FDUA 4PQGA 2YN2A 2HK6A 3QHPA 4F1KA 3DS8A 3SU8A 1N78A 1ANKA 3PKIA 5D00A 2HSDA 4BGIA 5C46F 4G4SP 2A9JA 2PKRA 2ZEJA 5LWHA 1G1MA 1KY4A 3E2MA 5K0SA 4QVIA 1LK7A 2XGJA 4RK5A 1IXKA 3H5OA 1CUJA 2H4JA 3EXHC 4BVFA 4CG3A 2ZCJA 1GYPA 4NCHA 2ZYHA 4KMSA 4W7HA 3ZBTA 3PNVA 3UUWA 1KI1A 4G5XA 4IDAA 4OO3A 1EDDA 1MG0A 4R16A 1SG9A 1JI3A 1U2TA 1W96A 4KX3A 3TNYA 5FWXB 2RHGB 4MW6A 5BSUA 2WVGA 2XF2A 3QPWA 2ZWMA 3P9PA 5FTMA 2PUBA 1YFZA 4YFYA 1LDNA 3O84A 1G20E 1VLHA 4CBVA 2FF7A 1RLIA 2JVKA 5LD2C 5E4JA 5HJ5A 4IVPA 1FJHA 1BN6A 1K9SA 4B5LA 1KO5A 4B7CA 4E5DA 5IJWA 1J9EA 5KTOA 1VZ3A 4A5SA 1Z6PA 1I80A 4RIEA 4Q4HA 4REQA 4EG7A 4B2YA 1APBA 4ZAZA 1QIMA 3U39A 4JJ6A 3DV0B 4F84A 2E4WA 4W8OA 1G5IA 3RTDA 3UV6A 4EHHA 4RABA 5CFMA 1DAOA 4J0KA 4PG4A 3WK5A 1BVHA 3A9SA 3L4BC 1ONOA 4MNTA 4QUHA 1P61B 4BKPA 5M2QA 2YIVX 3NALA 1EFHA 4HPXB 1PJSA 4YIKA 3KLOA 4ND5A 3PZBA 3O3MB 3FGZA 4TKLA 1CIPA 4KIUA 2H59A 2WD9A 1O7JA 4XJTA 3ZYCA 4B6QA 4D4KA 1MRSA 4C7OB 3K8QA 5A3SA 1L5FA 4CLOA 3V8BA 2IYNA 4MRAA 2P30A 1Z0IA 5HQTA 4A1OA 3H9EO 1BHSA 3N2IA 3HDJA 3LLSA 4C14A 2LIPA 3KLBA 5B1EA 4KLRA 1SZDA 1PTJC 2BFCB 2VQ3A 1JUDA 3LCRA 3RTCA 1KYXA 4L2IB 4MEAA 5E3JA 4X0EA 2O8DA 3T3MB 3OLXA 1V47A 1V8OA 2H52A 1J33A 1GL6A 3KQTA 1EE1A 1JSZA 2QMQA 3FVQA 2QVZX 1CQIA 2KM1A 3PIRA 4OH1A 2NZUG 3MB8A 5BN4A 3NFYA 3PBKA 2AFVA 4YRFA 1I3MA 1KJJA 2FKAA 2DJIA 5CHYA 4Z53A 4JYBA 3I6BA 2G17A 3HGMA 1BJTA 3OOJA 2GM4A 4RPJA 3HY6A 2FR1A 1OX6A 3DV9A 3M3HA 3V32A 2UZ1B 3IE0A 4KO2S 5E1OA 1TAGA 3GYGA 5CA1A 1DBWA 1F2TA 3VDXA 3T3EA 2X7JA 4IICA 4Z4QA 1RPZA 4W63A 1VXOA 5IF9A 3QF4A 4EG0A 2R1UA 4I8XA 2OO3A 4CZ2A 4HOYA 3HVHA 3EQ9A 5LLDA 4ZK2A 2JIBA 2PDAA 2AC7A 2XOXA 1QQ7A 4P1ZA 1U9IC 1LLDA 4Q02A 1M2GA 3SBDA 1JI0A 4DKJA 1QU2A 2Z1DA 4UBLA 1JSCA 3PQ7A 1DRUA 1L8QA 4AJKA 3DTVB 1E1YA 1XPJA 4L50A 1Z8FA 2VHXA 4EYKA 1GPUA 1PSWA 2HA7A 2P2CA 3ZGZA 1XRPA 3CX4A 5JWHA 3C1UA 5GOTA 2A0KA 2IS6A 3D6FA 1Y1KE 1E2QA 2OLKA 2B5OA 2QI9F 3GB9A 4G2NA 4XYEA 5P21A 2GZDA 4CMCA 2IBMA 3RLFA 3U7QB 5HQ3B 1JDBC 3H5TA 5TGDA 3W5VA 2GEFA 2OHIA 3JZFA 5CCXA 2LIVA 4AL4A 4PSKA 1JDTA 4KEAA 4QX6A 4OXNA 2BTOA 5LR6A 4XWAA 2DHCA 1EP9A 1VCMA 4KQJA 3ACDA 1L5HA 4CLXA 1AOXA 4G1MB 4BNNA 4ZK6A 5FX2A 1FX0B 3D3QA 1TQ4A 3IBCA 4MKZA 2XEXA 1FU7A 3STTA 4MQ6A 5GONF 3UK6A 3X1JA 1YKGA 3GLGB 3CR3C 4KLZA 3R41A 3NJRA 4YRSA 3JAMA 2QJRA 5AIBA 4H17A 1NBOA 1L0BA 3GT3A 4U7WA 1WS6A 1V8ZA 1A8PA 2H31A 4W8HA 3NP9A 3F96A 4Q6WA 5I3CA 3O90A 4A92A 3N7UA 4S1TA 2XA1A 2BUCA 4MW5A 5A6VA 2FN8A 2H8GA 3T15A 4C0BA 3SFTA 1GPAA 1VMKA 1Y1RA 2DPMA 1FYEA 1G42A 3I32A 4IIFA 4MYHA 3RRFA 1RRKA 4QJ4A 3K6SA 1REQA 1O6ZA 5KNCD 2IYLD 2OFOA 2QTTA 4HMPA 1GZHB 3OWHA 4OLAA 1M67A 5DWQA 2NAFA 3DLCA 2FPOA 3CZ5A 2Q6TA 3ICCA 4CTMA 4ZREA 1EM6A 1P18A 1XJ0A 2O8BB 3WGIA 4II2A 4CG0A 3WBJA 3W77A 3T8YA 4IVNA 4JP8A 3KHSA 3L7YA 4LKRA 2XHZA 3NHYA 4MW7A 4LZZA 4A8TA 3BWEA 3TLCA 2HBYA 2I6FA 3KKKA 4DB4A 4GVPA 4IUYA 4AS1A 5EZ5A 2IIPA 1TYBE 2FX2A 3N2YA 4TSRA 4CLRA 5KSZA 1DOHA 1X13A 2WV9A 2J3JA 3FUCA 3K6SB 4MMYB 1QDEA 2AJCA 3CJQA 3AINA 2HA3A 1WPQA 2X4GA 2WWIA 1COWA 1X8JA 2A0WA 2B98A 4BKUA 4MUIA 1DLJA 3NWBA 3OC6A 4C1BA 1RM5A 4F45A 4HUQA 2PD6A 5T8KC 4IFEA 1N5IA 2IVFA 4I1YA 1LDGA 4MUHA 2YY5A 4KGDA 2R8OA 5ELXA 5AKJA 1TEVA 3W6UA 2YRXA 4EX6A 3BXPA 1Z82A 4BO1A 2AYYA 3C4JA 5B7QA 1BIFA 2NZYA 3W4KA 1P2FA 2CSUA 3CONA 3RRJA 2P9JA 3UZUA 2Z4RA 5B30A 2QUKA 1G3MA 3DEHA 1P45A 5B12A 1CYEA 1C29B 1R4MB 3CPHA 1T5TA 3UT5A 1NYQA 2OBMA 3ZE2B 4F9GA 2IZ6A 1YNSA 2VRBA 3OZGA 3SK0A 2RGWA 5ESWA 4NH4A 4FKMA 2CGEA 1CPYA 2I4NA 5TNXA 3ZGYA 4MUBA 3WIEA 4JBYA 3SC3A 3KYDB 5BW8A 3O2QB 5BUZA 1ELOA 1EB9A 2BCJQ 4RKQA 3BCSA 1E3EA 1UP7A 1G55A 2FN3A 2O3RA 3BD6A 4U4AA 3IHWA 3HPRA 2C2GA 4CLEA 2B61A 1EVYA 5B6IA 4V38A 2BLNA 3I9MA 3HSYA 3JVEA 6NULA 2C82A 4UEWA 1W25A 2E85A 1RPAA 2GGSA 2CD7A 1H93A 2BDTA 3IBTA 4JXJA 3V4SA 1XDGA 3C3MA 1EUYA 4EHDA 3IA2A 4BOYA 4UDYX 3AKCA 3CUTA 3HA5A 4JVMA 3SR4A 2V4MA 2YXLA 3BGIA 3C8UA 3KQKA 1UT5A 5E6SB 1Z8DA 2OAGA 3BTOA 2FEKA 2Y1FA 3N5CA 4I1OA 4LX8A 1X80B 4YV7A 4QYIA 4KQ2A 3ONWA 4AF8A 5KCZA 4H6WA 4W5QA 2O2CA 2W6CX 1VXRA 4TKVB 3TW0A 4G5RA 1E7RA 2J07A 2NAPA 2IXGA 2Z9BA 3OFSA 2R751 4D02A 1D5CA 1N9KA 1W88A 3CTMA 1VL1A 5DRTA 3JQRA 3UKOA 4J6FA 2FSIA 2INGX 5A3JA 4PO8A 4R2HA 5BN4B 1NYRA 4UHDA 4GHWA 4X90A 2Y0BA 5HOEA 3T1YB 3UATA 4HQLA 1SXIA 4RVGA 1S3SA 3EEBA 5BV7A 1WCWA 4RGVA 3ZKAA 5EFZA 1CF2O 4TZ0A 1YZGA 1E2HA 4DR7B 4IO1A 4DMLA 4NSNA 2YMMA 1BH6A 4ZT4A 1V25A 3F6SA 3S3TA 1L1EA 5GIPE 3ICOA 1PT6A 2EVWX 5CEFA 3OTGA 5FTWA 5KVVA 3PF8A 4TKMA 1ISMA 1II8B 1QO0A 2CVFA 2JKZA 4ZCQA 4YHHB 1YKSA 3HKCA 2UYGA 3UA4A 3OC0A 4L15A 5CP8A 4P84A 4O4LA 1Q0HA 2V9CA 4J7CA 4L76A 3FM9A 3SFVA 4IIJF 4HLQB 2C8KA 2CLHB 3W9BA 2YS7A 3CVJA 4LECA 3DDUA 5KC8A 3B1JA 4K6OA 1I7QB 2O7SA 3E3OA 2JHFA 1E5TA 2MDTA 3DE6X 5HCNA 2OSBA 2FW1A 1U2DA 2CNWD 2QG4A 2YR0A 5TQ0B 2B36A 5EKSA 4KE6A 4B3XA 2ZYIA 4DY6A 3UMJA 3C7DB 4KAXA 3MSCA 4CWAA 3A37A 2E4ZA 4WXHA 2BFFB 1XCPA 4MWZA 1PSDA 2JATA 2O4UX 1GKIA 2OCLA 5TF4A 1UZNA 4N47A 2UU9B 1JR2A 1OJLA 2XI4A 3K9CA 4N5MA 4BN4A 3FBTA 4D4HA 5J23A 2NX2A 4UUAA 2QL7A 3CWCA 1YONA 3MILA 4W4TA 1T2VA 2FPRA 2N1BA 2OVBA 4UDNA 3ZQUA 4B5KA 2LUOA 4M99A 2JD0A 1CZKA 1KEPA 1RI4A 2PAAA 1QWOA 1KHTA 1Z15A 3MT8A 3ORQA 4KJZA 5ESXA 5LDHA 2A5YB 5TE9A 1G20B 5GV8A 4KITB 3IIMA 4JVOA 2QYHA 1BVRA 4H1WA 3C3KA 3QYJA 1TUBB 2IKSA 2ZBQA 4DUYB 2Z1MA 2HB6A 5TS3A 2Z6VA 4CEJB 4ZO7A 3OSZA 4JY7A 4ED9A 2V4UA 2WZQA 2IEYA 2PSHA 4K9DA 3RF7A 4YCDA 2K87A 1JEYB 2P3OA 3PQDA 5D5HA 2ONJA 2OVFA 1VE7A 1RYHA 3JWGA 4EENA 3LK6A 4HAXA 3IQFA 1UK9A 3D7KA 1NWCA 1WOYA 3AR5A 4LTMA 5DN9A 1B74A 3UUGA 3UH1A 1TZJA 3R8FA 1U80A 5DXFA 4KGZA 4GOND 2VF4X 2IUYA 4PYQA 3LO5A 1GGJA 1CJCA 5EHQA 1X7YB 3OCCA 3OBBA 4NBKA 3W2TA 4C3VA 2IHKA 3OY7A 2F1HA 5K0LA 1U65A 4ZYZA 4KGVA 1I7DA 3HBNA 2BFNA 2CK3D 2BGNA 1Y3AA 3VO9A 4MMXB 4QWMA 2ZS7A 2ZJ2A 4C30A 4NVRA 2CSXA 3TUJC 3LHFA 3O4JA 3WJAA 1Z29A 2GZAA 2XVXA 1A4UA 2PPLA 3CH6A 3DTTA 4KDFA 4NYIQ 2QD1A 2B6HA 4A5OA 3WLSA 1EP1B 3K1AA 1L4YA 3PTZA 5JSYA 5JD4A 1BGXT 4AJ2A 1RBQA 1E63A 4YAKA 1Q91A 1RE0A 2P78A 1ESMA 3OIVA 3PVSA 3ROZA 3REQB 3I1YA 3DE7X 4WZAB 3QLUC 5EHXA 2QAJA 3O4RA 2PSJA 1XIVA 3W8EA 2YWDA 1L7BA 1TJ3A 4C4YA 3LP6A 4BFLA 3KSBC 3HJFA 1MRNA 3ZI0A 1AV6A 1QANA 3NATA 4HQRA 1JA1A 4CM6A 3AXSA 1ZMTA 3N07A 1C9NA 4I19A 1RZRA 3RBXA 3ONFA 2ID9A 3N75A 3NTXA 4EMUA 2HT6A 3KQLA 3HLTA 1J07A 4LF8B 2HMTA 2WILA 3VRHA 4M9XA 1UC9A 2QP9X 3NAZA 1DDOA 3QU9A 3ZK8A 3R0XA 4MV9A 3U7EB 5U9CA 3LGAA 3QG5A 3EMKA 3R0QA 3KXDA 4Q7JB 4GPZA 4NEHB 1LBQA 4GXQA 5I01A 1Y3HA 1YCFA 2FPPA 5CEEA 1L8OA 3BMQB 2WP0A 2ZRJA 2YBDA 4FNGA 1S2MA 4PU0A 5REQA 4BLWA 5IZ4A 1Z73A 4CEIB 1UMKA 2CDNA 3AEKA 3F5SA 2PD3A 1CUYA 2BZSA 5IARA 4I55A 4JCCA 1GKYA 4KQCA 3I04M 5TPZA 4OJKA 4N6NA 4PRKA 4B6OA 4E2WA 5K5EA 1GLNA 3RIYA 1Z3IX 4LHXA 4I1PA 1ULAA 3YASA 4C05A 1Z4OA 4RHCA 2FWIA 4HN4B 2G1UA 4DJDC 1Z5GA 2HKIA 4LZPA 2G8LA 1E98A 1C3EA 4QQNA 4AIRA 5JSKA 2I2FA 3C8HA 3PFFA 1N6NA 3KVOA 2G9UA 1VYVA 2VQDA 5KU7A 5DI9A 1IBKB 1JKIA 2Q8NA 2FEOA 1RYFA 3A3OA 2D5AA 1A82A 4KUEA 5AVXA 5K8TA 4PX2A 1SO8A 4DIBA 3FMGA 1U5AA 5KYGA 2QRQA 4E3ZA 4E32A 5F4BA 3ZDZB 2QP4A 1R1DA 3E9CA 4FJ0A 1CIVA 1G18A 3NETA 4YK7A 2J87A 3AL2A 3WR5A 3WA7A 4HGOA 1E2LA 4JWTA 4KRFA 1WUHS 3COYA 2RGEA 3JQBC 2A1TS 4O8CA 1ZI8A 1HTBA 3C3PA 3IB6A 3MFQA 4D45A 3UPTA 5EMJA 3H17A 2C4MA 4ZA2A 1P74A 1EFVA 3GA7A 4BQNA 3AHHA 2CFIA 2WI8A 4IIBA 5D2CA 1W0JD 4PHCA 2D0DA 3PXDA 5TIIA 2Q3LA 3DQZA 1QRTA 1XZGA 4NBLA 3TQTA 1QGED 3NYQA 2WJ3A 3TXAA 1N2GA 1FK8A 3ND7A 1O57A 3TF5A 1FA9A 1V0JA 1BAPA 4FMBB 3R74A 5IDQA 2AKAB 1CC1S 3P97A 1H8ED 3DZGA 2DPGA 3C3BA 2HW8A 5E6RA 5EIBC 3EXIA 4JU8A 1NQUA 1KFCB 2JAPA 4I3FA 3RSQA 3PEWA 3IVGA 3DULA 1H22A 2ZI6A 3OFJA 2FN9A 3I05A 2O0KA 2R86A 5AM3A 4NYMQ 3M5WA 3NHZA 3ZW8A 2CFRA 4EARA 1TA0A 3IJEB 4I50B 4IQ0A 5EFOA 3O1IC 2I3ZA 1SBNE 3TX6A 1LA2A 1QPZA 2OCYC 1E0SA 3MSXA 3L1UA 4ISCA 4Q3KA 1II9A 3VVMA 1ODLA 2B94A 2VDQB 2OCAA 4UEJA 4RA9B 4O5AA 1GPWB 3HZZA 4FQ8A 1E6LA 5LA6B 3FSJX 4CLHA 5ALJA 1YS9A 3AR2A 4JODA 4E03A 4GI2A 4RLFA 4RZQA 1HZZA 1SWVA 1XELA 1SHLA 3HVUA 3NH9A 4BQRA 1EUCA 2QM3A 3CUUA 4E7PA 3SX4A 1V7ZA 1DE0A 2W7TA 2WPDD 1JR3E 1YJAA 1JMVA 1LK5A 4MV3A 5A04A 2CF5A 4KUGA 5KJCA 3LLVA 1JFRA 5HWSA 2IUTA 3TRJA 3MD0A 4H3HB 1I3CA 4IIJB 1AN9A 5AW9A 5LC1A 4PG8A 1VCHA 4EVQA 4ZWNA 2ZRLA 4YPFA 2VBFA 4EDFA 4B8ZA 3IILA 4YUXA 1H85A 1C1DA 1T5OA 4OL0A 4NAHA 1Y7LA 3IHTA 4KSBA 5MFZA 4P3NA 1PVVA 2FQYA 1SUSA 2I66A 1HDCA 2BGLA 2O0JA 4J91A 1XDWA 2RGUA 1XZAA 2ZAOA 3RVPA 4FQ7A 4IYJA 1JKJA 1GGHA 3ZHZA 4OP3A 3G0HA 1CRQA 1CYDA 1PK7A 3OPNA 2GK4A 3FDIA 4GNKA 3W79A 2ONCA 4MQ4A 5C8YF 3W8NA 4JU9A 1PL8A 2GHIA 4O3FA 4XASA 2ZJ5A 3IT3A 3O0DA 5JMTA 1IULA 1YB4A 2HA0A 2O9JA 3N6VA 1NIJA 3SF0A 2ZJ8A 1V5EA 1O2DA 2CLLB 3FN4A 4Q3OA 2J3HA 4MUFA 3OT4A 2LWIA 3KV3O 2GAAA 1E1QA 2FFBA 3VSEA 2GLXA 1P62B 4MI9A 4D99A 5I9IA 1H2XA 4JLNA 10MHA 3JD3A 3NT4A 3WYAA 1KMNA 1XZNA 3AVYA 1HC7A 4JP2A 2OUKA 4R3WA 2V7PA 5DO9A 4MS3A 5ALZA 4C4AA 1Z0SA 2HO5A 4AICA 1V4VA 3OKPA 1QH0A 2XDWA 1JTVA 1U8CB 4OGFA 3WDMA 3ZWQA 4F6RA 4LRYA 3SS9X 4AXBA 1RYBA 1R8SA 1AZWA 3IJPA 4XJSA 1G17A 1Z6QA 2OD9A 1P72A 2WJVA 3NKLA 2FDRA 3T1VA 3HEAA 4WK2B 3V46A 1OQAA 4UNPA 5B3JA 2YV5A 2FW7A 4P4SA 4ZIRA 1T2AA 1E3MA 2HMYB 3QY9A 1C3OB 3R20A 3ZCXA 3I8OA 2AIRA 3DLAA 5CT5A 4G89A 2WIFA 4AJEA 4MQ5A 4D4IA 5A9SB 1NN0A 5JBNA 1OJ7A 1TUBA 1AGNA 3FKSA 2MSNA 3O74A 4NX2A 5KNCH 2IL1A 1JPJA 2Y9MB 3KQSA 4IXNA 4LQDA 3SDSA 4X7MA 4M6WA 5SV2A 1N5DA 1U1EA 4MQBA 5A0TA 5LQUA 1S7GA 2MTBA 3IAAA 3FUTA 4UTRA 4BBJA 1SUWA 1Y1PA 4IKPA 4E2FA 1HFKA 1SHTX 3FNFA 4FOPA 1ULUA 3M9XA 3IO5A 4J90A 5EE9A 3WISA 4C6TB 5JCZA 3EG9A 4M2LA 1M6HA 4QBFA 3IEMA 5T67A 4ZZ0A 3C5VA 3FB4A 3HN2A 3GR6A 1QKJA 4YUWA 4M0MA 1Q20A 1WV1A 3DHVA 1YBFA 2GAFA 3WQSB 4BVEA 1PS0A 3UJAA 1WMDA 1IZ9A 1JLHA 2FUKA 1LFAA 2IPMA 2J9FB 2OOKA 5TQ0A 2C7RA 3EY4A 4EF5A 2E4YA 2B7LA 4BEJA 1QAMA 2H29A 3QH4A 4UQOA 5TGZA 4PF1A 5D5QA 4ZEXA 2VDVE 2XWJI 3FDFA 5JSHA 1R15A 4HZUA 4I55F 3RYFA 4EG5A 5JPCA 2V65A 1XTZA 2D3TA 3HU3A 3ZWWA 1Z74A 4WLOA 3PUXA 2A6PA 5AJXA 1N4DA 1SVIA 2DTXA 3I39X 4P34A 5E9WA 3LUJA 4Z4EA 4TQAA 4PHTA 3OEWA 3UMRA 1XRSB 4EUHA 1JBQA 4PVCA 2Z6QA 1XXLA 2LV8A 3GUYA 3RC7A 3R3XA 2WF5A 2I6SA 3IQWA 2IGTA 4MGEA 2IE8A 3S6JA 4WERA 2GXQA 4RBNA 3B85A 1RQ7A 4U2GA 4KSCA 4EEKA 4D4MA 2XUIA 4L5JA 4DLPA 1E3WA 3HL0A 4D25A 4LVOA 2VPZA 3F73A 2VAPA 3R7WA 4IDEA 1M2OA 5IM4F 3AL0C 1M0SA 1K3FA 2OHHA 3P4YA 1H1LB 4CCAA 3FJ1A 4XX1A 3GPCA 1W88B 2Q5CA 1VJTA 1EWKA 4GZ5A 5KKCA 4DC0A 1KDOA 2FN7A 4I0WB 5FPPA 3HYTA 3WMXA 2G5GX 5AIAA 5BOVA 2DLCX 1GSIA 1N0UA 1IHOA 4TXJA 4AF6A 2WF9A 2IDZA 1MO4A 4RK7A 1C30B 3HZOA 1V1RA 2OFXA 3D8BA 4G81A 4XARA 1O9BA 1CS0A 1XRMA 4D3XA 5DIZA 3WKAA 4WOKA 1A5TA 4KQXA 4NP6A 3FKJA 6REQA 3S2SA 4PRLA 3LX4A 3AVQA 1M8KA 4ZN6A 1WUKS 5LYJF 3D0RA 4HATA 4JYMA 4IF6A 4ZDKA 5HZGA 5J2UF 1XUOA 2VP0A 1SHKA 1Z5ZA 2IYSA 1GKUB 3AWIA 3GVXA 4OHRA 4GPIB 5AVQA 4FSDA 1MC4A 5BV1A 4RDCA 3KTFA 2VBGA 5HUHA 1T3HA 5YASA 1NMZA 1PL6A 1JHZA 4P7KA 2WF8A 3AFIA 1JEOA 1IAQA 2XDAA 2X8LA 4FEEA 4PQEA 4NARA 4H60A 4BNXA 2HOQA 4WLNA 2GN0A 3JR7A 4JJ8A 2PUGA 3AUXA 3BRQA 4CF3A 1G9SA 2UYYA 1QTQA 5AM0A 1RWQA 3TOVA 4G2TA 2COUA 3ZHCA 1BGVA 2WBLC 3OTWA 3Q6MA 2R6R1 2QQFA 2AG1A 3AWDA 4I8DA 1VSUA 1H4TA 4F6LA 5KJFA 1M9NA 4V2UA 1FQKA 1LBHA 4B6FA 3UJNA 2XZLA 1PZHA 1QMGA 1L5ZA 3U3KA 1NG1A 2E4VA 2DUMA 1J2RA 2P91A 1UPUA 3DZ8A 3L8YA 2OBNA 2GBFA 1OA1A 2QRPA 1TYAE 4C87A 4EJFA 3SLGA 3EASA 1P17A 5DDIP 3Q9LA 3MT0A 2VYCA 3GD7A 1ZK4A 1HYGA 2HZBA 3EVDA 4V1CB 4ENRA 4PYOA 1X1RA 3IDZA 4FFSA 4A8JA 5CFLA 1P29A 3KQPA 1UANA 2N46A 1Q0LA 1GPYA 4V3BA 4EBFA 4BNFA 2IQ5A 3L79A 1HNWB 2AA3A 2A59A 2VXCA 3L7MA 4UULA 1WKBA 2ZVJA 1XTBA 2X0JA 4MS4A 3UC5A 5E0KB 1AZLA 4I8IA 4ECEA 1O6FA 2PT6A 4A8JB 1N8KA 2GD0A 4MLCA 5IJ0A 4NULA 5LSAA 3NNDA 3CX7A 3T1NA 4H18A 1Q1BA 2EKDA 4MR8B 3LT0A 4QOFA 3AKZA 3KKZA 1SH7A 3PTLA 3ZOZA 4DJJA 2HMAA 4H08A 5GPBA 1QE5A 1XTSA 1L7MA 1SURA 4YALA 3E7DA 1DRWA 2JD1A 3GZNB 4FMDB 4G84A 4HDKB 1M54A 5IEJA 2V7GA 3QKUA 2J08A 4HMOA 5DNAA 5FTJA 3LO8A 2YV1A 3BD7A 1OVGA 3CSUA 4MIKA 2F9MA 1D2HA 1SN7A 3FMOB 3K09A 4JOBA 4DDHA 3HVKA 4GEKA 4P58A 2MR6A 3QBTA 4I1IA 1W9MA 3LGXA 3N2GA 1RQPA 5ICCA 3AYXB 3H19A 4XTCS 3ADKA 2HJGA 3FNEA 4D8TA 2F3RA 2FSSA 5FXMA 1M2NA 2ZPAA 2GETA 1RPNA 1Y98A 4LI0A 2I1VB 3A4TA 2W6OA 1PT9A 4J0JA 1IXYA 4CIDA 2AXEA 1J24A 2AR7A 5H59A 5ALSA 1YVDA 3W5HA 5TX7A 5T57A 2XUGA 3I5XA 4LFBB 4J3JA 3HQ4O 5F23A 1MTOA 2ZI9A 1OI2A 2Q1XA 4ZVRA 5K3BA 1D7OA 1D2NA 3HCRA 1IVNA 3AOEC 4TM8A 4DQ0A 1IHUA 1DKPA 4IDBA 5AKXA 1S2DA 1BX1A 1FX0A 1YVRA 2G4CA 3LKZA 4FX5A 2HIMA 3QBVA 3I09A 3GIWA 2YHBA 4Y6LA 1V1RB 3B6JA 3G82C 3VOTA 3ZJ4A 4WH0A 2PR7A 2VHCA 2JIZD 4MS1B 2NTEA 1PEDA 1TQDA 5TRTA 4S24A 4D3ZA 5J2TA 4TS9A 1GNQA 3K3PA 3IAUA 1M6NA 2FLKA 2JLSA 1F0KA 4BE4A 5IH7A 4MVCA 1E7WA 4KR0A 2XZDA 2UDPA 3K9LA 1C8VB 5M34A 4NECA 1X42A 1XD8A 5BRNA 4AQYB 2VJMA 3IEUA 3JQFA 4O5OA 4WOCA 2XITA 2L18A 2QLNA 2WK1A 4B40A 1EP3B 1W8IA 1OZFA 3EIHA 4NEGA 4MW1A 3U81A 1P60A 1WZCA 2G9VA 4OYLA 1W2HA 3MLAA 3MVEA 1OW3B 2HX1A 2O2XA 2P90A 3CT4A 3DP7A 1PKXA 3FA2A 4ER5A 4K0RA 5LQAA 3BDIA 2WPNA 3KELA 3C6YA 5JS8A 2DWOA 4MH0R 3KXIA 1GIAA 4GGPA 1N3IA 3FCXA 2WHYA 2DPHA 1Z5WA 1JT9A 1BDMA 3QF4B 3RG8A 4MEBA 4KIFA 1SRQA 1SUCA 1R4AA 3U7RA 5H3HA 5ILQA 2WD7A 2I1WA 3SYMA 4AZ3A 4K8RB 2IU4A 3B6EA 3V4FA 2R00C 2PRZA 3C7KA 1R64A 2JFQA 1SVSA 3PYLA 4K5QA 5ENDA 4CTKA 4D81A 1CR6A 4PC7A 2ETXA 5ALHA 1BWPA 5A06A 2IBSA 3THXB 3JASB 3RW9A 2RKWA 1T9KA 3R5KA 4HXYA 1XTQA 1Y7HA 2JPDA 4HRYA 4UMFA 4KMRA 4CF7A 4CQMB 5AVZA 1U0HC 1EK6A 2JGEA 4UHJA 4C78A 2YN0A 1ZIYA 1YFLA 2H06A 4URVR 1YB5A 3HUUA 4HDSA 2P2LA 2BTQB 3QXSA 3GI1A 3GJ8A 2DAPA 4R69A 1PNOA 1WSDA 2R8ZA 2H17A 3NWPA 1X7ZB 1KBQA 1XZFA 1C2TA 1KAEA 2G9ZA 3WQBA 5KSPA 4BXOA 3MYYA 2QX4A 1C4OA 5HE8A 4ND1A 3T3NA 3TNFA 5JG7A 2C92A 1HE5A 3IP6A 1UBGA 4EKNB 4NCBA 3WWZA 1FRVA 2XVYA 1F4PA 2Q1SA 3ZY3A 5HKLA 2WHXA 1XA0A 3WFJA 3ZGVA 2CL7X 2YCLA 3ZZTA 1P5FA 2QTGA 1NQVA 5FPSA 4DQLA 3CCBA 2XMRA 4JR0A 1CZOA 2BW0A 2GZSA 2H7CA 3EFOA 1FP7A 1U98A 3BS4A 3C6XA 2NV0A 4AY3A 4DCVA 4G0YA 3LS2A 2C00A 4TT3D 1OYOA 2CLCX 2QE7D 4HRVA 3UHPA 2OLEA 3RUEA 1DTSA 4JENA 2VDWA 2Y93A 3R9XA 4MJLA 2IDMA 4TRRA 1KAGA 2WQ6A 4N5LA 3CHYA 1K98A 3LP8A 1NQ5A 3DUFB 4BO7A 2PZGA 3IQGX 2I78A 2JEYA 1TQ2A 3LC1O 2PUEA 3BSFA 1X7XB 2QXTA 5FTLA 3LY8A 1THTA 3WFIA 4CMHA 4Q48A 3OHMA 3DYIA 2EEPA 3F6YA 2NU8B 3PI7A 2ZE6A 1NVBA 5JE8A 4D9JA 2HLDA 2R5WA 2PYZA 4QGGA 2IOFA 2JZOA 1J8VA 2ORVA 4DBLE 1GFIA 4W1PA 5FWXA 2X2EA 4IJWA 3I2GA 3BWXA 3ICWA 3LYAA 1RP7A 3R44A 1H6BA 4HADA 4KBGA 4NJEA 4AK9A 1Z2EA 4DCSA 1PD0A 2RJNA 3A26A 1G5TA 5B3KA 2YIMA 3FRHA 4YAUA 3VFDA 3KL2A 2O2YA 1TD9A 3RUPA 1XZJA 1WUYA 4FNOA 5GOZA 4C5CA 1QX3A 5HE9A 4BJ6A 3I0MA 3AXTA 4P93A 5IFKA 3AEYA 3HKBB 3S8YA 1D6SA 1DBQA 4HP8A 4ARSA 1U8UA 2PKWA 1MXFA 1P7PA 5E2BA 4BNLA 2QL5A 1QYDA 5C51B 3JVVA 4G5SA 2QUZA 5GONB 2OAQ1 2NN3C 2ZATA 2G76A 2EIXA 1RD4A 3DH0A 3LBFA 4Z1MA 4BC1A 1PTJA 3WHIA 1SAYA 3JQAD 5FA5A 1THMA 1WUJS 5B1DA 2OZPA 4P3OA 3K2IA 3IMCA 4LWOA 5CD9A 2FZ4A 2FWPA 3FYSA 1CUCA 3JRNA 4ZCTA 4M21A 3IRVA 1N3LA 3MQFA 1OI7A 1X19A 1H23A 1SVNA 1J9ZA 4EA8A 1DCFA 5JQWA 1ENOA 1P80A 3K9NA 1UKAA 1GHTA 1OLXB 1CK4A 2IELA 3COWA 3L84A 4PNZA 1MC1A 4BNVA 4L9SA 1TM7E 5KNBD 1U6KA 1RWVA 1P31A 3QE9Y 4IXTA 3D6AA 1S7CA 3ZWBA 4DJFC 1GU7A 1G16A 1M1NA 1RAIA 1N2CE 2QBYB 1C0EA 5AW1A 2Q29A 3LP5A 1WXFA 2FSPA 2EFCB 3O8LA 4AUEA 1KOLA 5E95A 1YA4A 3QVLA 3TDKA 4EOGA 2HHHB 4RXTA 1JB9A 2N1MA 5CCEA 3IRUA 3ZVNA 1ZHFA 2PZJA 4ND6A 3FVWA 4ZZIA 2ZYSA 1MORA 4CHTA 3IVRA 2DUNA 4ZYYA 5IJ9A 3NM5A 3KJIA 2HMWA 3L4BA 3PU6A 1TU4A 5F76A 2ZCUA 1KI6B 2FUCA 4CPDA 1NMEA 2O7QA 2DEUA 3LRTA 4C4ZA 2J46A 3AVOA 1DJOA 5J2UB 4DXHA 4MPTA 5DM2A 4YREA 1NR7A 4OCZA 4OH7A 5HS6A 3DG9A 1N7JA 3QX7A 4NK4A 4W1QA 3A11A 3SR3A 3GEMA 4U00A 1CVRA 1G6KA 1YDMA 1YR8A 4O4LF 4IUCS 2R5FA 3EXIB 1KPGA 2Y67A 4OUDB 1C50A 3DKRA 2Y6UA 3ESZA 3TPFA 4B74A 4D6XA 4MUNA 1IUNA 1WAMA 3AUAA 4WPGA 5AVWA 1MC5A 4OBEA 2JEZA 2CNLA 1NBHA 3P45A 4G4IA 3ROQA 1MAAA 1VBMA 2YW2A 3N76A 4PIMA 1ABEA 3KZVA 4JA2A 4UAVA 4DYHA 4F1JA 3P4UA 1VG0B 5EVJA 4IX1A 2OV2A 3LOPA 5EXTA 4H1VA 3EJWA 2C3UA 2Q2QA 3CE6A 4HCJA 2CMGA 4NENA 4QGBA 4A0QA 1AURA 1U3CA 3EBPA 4R9RA 4R6WA 3ZIAD 1NV9A 1JPUA 3RTGA 1QNFA 4JC5A 1X92A 3NOVA 3O2JA 4C01A 621PA 1NMXA 1IL0A 3KJNA 4GOXA 5DK4A 1DL5A 4Y2VA 9LDBA 4W8GA 5CXXA 3M0EA 3W6NA 4V1CI 2Q7XA 4KTTE 1F6DA 5F7JA 1FFXB 4ZXFA 2WFLB 3BGOS 1QOPB 2Y68A 4JWKA 2MSKA 4Q01A 5CGQB 1QFSA 1SCNE 1Z2AA 2WUGA 5AKEA 5FD8A 2OCXA 3WFZA 1AX9A 1S02A 3PQ5A 4NCXA 2AZMA 4QOJA 1AHPA 4UDXX 3RC8A 1NPTO 3QU5A 1SKAA 2GBIA 3EAGA 3JYOA 1TTPB 4TX1A 5LYYA 1M74A 1WP4A 3AEQB 4Q16A 1XEAA 4U7FA 5DCLA 3W7BA 4U6NA 2GPTA 1SHUX 4CEHA 4GM0A 1IMOA 1BS9A 3G2IA 5DISB 4LPKA 3V4VB 1UOQA 4BUJA 1NJGA 2H1HA 1HZJA 1WVIA 2GRJA 4ZP1A 2JLYA 1RRVA 4CIYA 2PJUA 2PYDA 4BPBA 3PT5A 1SBTA 3AIMA 4Y8VA 3FPKA 5IUJC 4G26A 1B4DA 2X8WA 3GNQA 4OAOA 2Q49A 1E1CB 4H16A 1INLA 4E4TA 4EH1A 2O4CA 2FJPA 5FR2A 4BKRA 4DCMA 4UU1A 2ZM5A 1Z5NA 1WNFA 5THXA 1AGPA 3KV1A 5FLKA 1TRHA 3TH5A 2I3DA 3BIOA 3TQSA 3CVWA 4FW8A 8ABPA 1FNSA 1XYVA 4JI1B 3LRPA 4QEDA 1UDCA 5JXGA 1CDEA 4HEHA 2R48A 3RROA 3Q98A 5HDQA 4FXPA 4BN0A 3QLEA 2E3JA 1TZ2A 1P3Y1 3L0SA 3TAXA 1SU6A 5C34B 4AJNA 3DFKA 2B99A 2XNJA 1YBVA 1VRVA 1GPKA 1FYWA 1U0FA 5CYGA 1UEIA 1WABA 4YBRA 5JSZA 2MSLA 3GXBA 3O1JC 4I46A 4WIAA 5AJTA 4NYJR 3RU9A 3UM9A 3NMUF 3PFHA 4EJSA 3A1FA 4P7BA 2XZOA 1S3GA 2AX3A 3U3OA 2RBEA 2VCYA 4V03A 1LPBB 5FO1A 4RIGA 3HCAA 3VNBA 2CKMA 4BO4A 3QNUA 3ZX5A 4WCFA 1ESEA 1E61A 4ID3A 3VKUA 1RMTA 2H48A 3MTJA 4UUBA 1ZMRA 4A7PA 4MI3A 1NKSA 3CJRA 1COWD 2EQAA 2QD2A 1Z4QA 5ELMA 2ZUEA 4WFQA 2ZT7A 4HX9A 3T61A 3EYAA 3B8EA 3U9TA 3G9UA 5KDOA 4MR9B 2ZWAA 5EPUA 4TVBA 3MJDA 4M0DA 1GNSA 3FETA 5K45A 4QGHA 3N2GB 1KI3A 5C7LO 1EK2A 2DX7A 1RS0A 2I8LA 4G97A 4GXRA 1QE0A 3IB3A 3FAKA 4ARBA 5JS1A 2II6A 1CUEA 1TX4B 1FDVA 4JL5A 3TLXA 3B1FA 3OE7D 1HDEA 4MKHA 4DUGA 4FMCB 2OBFA 2H2IA 3AO0B 4P35A 4MAAA 1WXEA 3TNLA 2NP7A 3GELA 3MWDB 6PFKA 4JKIA 1Z36A 2UXBB 3GRUA 2D59A 3PE4A 5ALNA 4C0KA 4OLFA 1T91A 3SJBA 1OFUX 3B3FA 5DK6A 2FGKA 4XEHA 2ZXFA 3EWAA 3RHTA 1OPXA 4W5HA 3SBEA 1LS6A 4RKFA 1TT5A 3LUCA 5K03A 1Y3FE 3IJ5A 3SYKA 2XV1A 3DFFA 4G3XA 1Y4UA 2VEDA 1GGMA 1UOOA 5AXDA 2V4ZA 5A03A 2RHJA 1ODJA 4XWWA 3WC4A 2YZ7A 2CEAA 4KE7A 2FWNA 4PC6A 5AKYA 1GNPA 5BT9A 1RXVA 3KR1A 3I5UA 2HQSA 3ECSA 2R2AA 3P2IA 1V71A 2IUSA 4QQKA 2GF9A 4MO2A 4MMZB 2F43A 4QAQA 1ESZA 3KEGA 2DF8A 5LP6B 4WCDA 4LTNA 1R6BX 2O0HA 1YL6A 1N1EA 3IAM1 2M1ZA 2QROA 2NZVG 3KT3A 3P9IA 3UV3A 2EKBA 1U1CA 5THKA 1M2FA 2AK2A 2W2QA 2I2XB 3WGOA 4KO1S 4LJ7A 1DHTA 1I1OA 3D43A 4UOEA 3AERB 3B9QA 1YR9A 4J7UA 4NZYA 3IBFA 4JXKA 3U44B 5EQFA 1D1SA 5EE3A 2Q4DA 2OGSA 2QDXA 2Y0EA 3D4IA 1P0MA 4YRTA 1I0IA 2ZSAA 1CWUA 2B1IA 3A6HA 1OVMA 2GDJA 1JSXA 2VPQA 3K8OE 3NANA 3I6QA 5JJ5A 1L9XA 3PFWO 2WWTA 1ZIDA 1ZUWA 3EWSA 3O3OB 4HEJA 1GZ7A 3ZUPA 1ZNYA 1JEJA 4AKIA 3RANA 1CSEE 3LIPA 1DKNA 3CKLA 1T9CA 1KI7A 3N05A 3AH8A 2EGHA 2G04A 3UB4A 3H4IA 2G0AA 5LQRA 4Q1CA 2XECA 2WB4A 2AOWA 2ID4A 1MA0A 1YC2A 2YWRA 1GV0A 1TZBA 2SHKA 1Y8QA 4IIYA 1X1TA 3DMHA 4ZU3A 1IY0A 3RFCA 3T4XA 3OIFA 4KFSA 5TB5A 2V1XA 1OMOA 4M1KA 3PTAA 3SOZA 2ZPUA 3VR4H 3ONNA 4JOCA 3IVMA 3IJRA 3PJDA 4NBUA 4WA7A 2BMVA 3OH8A 4E5UA 1OE0A 4GM1A 1Y8QB 2Q5HA 3MJ4A 5BV2P 1V3QE 5LBTA 2HU7A 3AHJA 4K8OA 4B82A 4NE7A 4UTVA 5JRJA 2H1VA 2IU3A 3K0BA 2CT8A 4N0PA 1W44A 2C1EA 4XX0A 4HVTA 2DOKA 2NZWA 4BX0A 2IDJA 2E5LB 2EBFX 4LDRA 2IIQA 3DOHA 2HJHA 5D5PA 4B76A 3TTVA 1R5BA 3QJGA 4PBTA 4KR2A 4CM5A 4N3NA 1RHQA 1R66A 2PGLA 3I23A 4B3FX 2VDOB 5JIBA 4JI2B 4PZDA 4JD5A 1RXCA 5CM9C 1AQUA 4X54A 3LX5A 4YMWA 1EA5A 2V5AA 3WNQA 1FP6A 1SC3A 4ZT5A 4JDUA 3VDMA 4Y2PA 3WADA 4Z1OA 2I76A 3RBAA 3DZCA 1E4VA 1G21A 3PUKA 3PHIA 3JV7A 1SKBA 5DGCA 4CE6A 1DXYA 2TMKA 3RSSA 1FVFA 2COKA 1NW3A 4L27A 3IAS6 3OMXA 4Y2HA 3TTWA 1FDUA 2RBGA 5AVKA 5CFNA 1R0BA 3QE3A 1QR2A 1XDSA 4ZOLB 1KE1A 5KTTA 3BXFA 1IHDA 4R0NA 4JUDX 1P1IA 3TLAA 3TO5A 4FEAA 4CKEA 1VE6A 2VSFA 5LZ8A 4ZT6A 1JJAA 5SYAA 5LP6A 5KZMB 3QKIA 2A57A 5BSKA 1OBOA 1I1NA 1VGVA 4U63A 4ALJA 3D4OA 3VTZA 1BA3A 1SZCA 3HBJA 2RGBA 2GT1A 3PFKA 2R47A 3VISA 3W6ZA 1W36B 3GJYA 3GZJA 2WJAA 5CHEA 4EGCB 5LXTA 2XVAA 4EELA 5A7FA 4D97A 5FOQA 1I2AA 3SHQA 1AM4D 1HYEA 4EABA 2Q2OA 1Z6YA 2R6DA 3MLBA 1MN6A 1SBHA 5J4LA 2QS9A 8ATCA 3VU8A 3LBYA 3WLEA 4RHFA 5BSFA 1QCDA 3PVZA 2BGMA 4E08A 5PNTA 2OQ2A 4ZQHA 4MCIA 2G80A 4R1SA 3Q8LA 3T9CA 1PQYA 3I58A 3TLGB 5KJ6A 4CLRB 2FEWB 2Q0SA 1Z68A 4ABTA 1P75A 3R0ZA 4R2WA 1GL9B 3DO8A 3GCDA 1BKYA 5KTSA 2MMCA 1A69A 2OK8A 3A4YA 2WICA 4JJ4A 4Q21A 2F3TA 5BQ5A 3U26A 2E87A 2X5KO 1L5QA 4Z51A 1FXWA 4RJIA 2NXCA 4BWYA 1L4BA 1NPDA 3DJYA 3HL4A 3OETA 4CODB 2DR3A 1MC8A 4X24A 3LOUA 1CRLA 1QOZA 1R6DA 2BUBA 3AKYA 3FFXA 2NNLD 5GJWC 4XWOA 1DS6A 4AJ1A 3B6IA 1WA5A 3DPIA 4IDGA 1F14A 2YFQA 3KYCA 3P9KA 3I1JA 4H3KB 5FQOA 1E6UA 1PJZA 2UVQA 3C8MA 3EGVA 3AT1A 5DYYA 1O3YA 3W5AA 3BCRA 5CEJA 1SVKA 1NBMA 2E0IA 3ZD8A 1W36C 3MM4A 1AHNA 1CY7A 1YZNA 4FN4A 3QIAA 1ORHA 3DAGA 4AECA 4DS3A 1ULHA 4Y1GA 3PA8A 2I33A 4IFTA 1NOJA 4BLPA 2PFSA 2A8YA 3LL4A 5JXIA 3PCRB 4GI1A 3GRAA 2YH2A 3IDOA 3QNMA 1QC5B 3L7NA 4I1VA 2C96A 4I5FA 4R2JA 2DCUA 2OESA 2UYCA 1GRVA 3GG9A 1PDWA 1U5BB 2CJFA 2NYRA 1ZLXA 3V8RA 4BMCA 1E7SA 2DFPA 1Y7IA 1XTKA 2GWRA 2Q50A 3BL6A 3DEJA 1UBRS 1YUBA 3M5PA 4AZ0B 4EO7A 3FUXA 3HXTA 1V9CA 2JBHA 4EITA 5F64A 1Y5MA 4TWBA 4ENSA 3LWZA 2ZS9A 4XIYA 3S2IA 1QB8A 2HYDA 2ZITA 3DTVD 5CG1A 1LZLA 1ZW1A 3WMEA 2YUIA 3U6BA 1N34B 4EW6A 1R8XA 3EVGA 4K88A 4F3RA 3CPSA 3T5DA 3ZLJA 3GEDA 1T36B 2WSSD 1J22A 2VCHA 1CQPA 1EFCA 2OGTA 3Q11A 4OHZA 1VKNA 4C5BA 3VKGA 3I76A 2GERA 3F8WA 4W9NA 2XCLA 3NTUA 2VHVA 4V0KA 5FJIA 5IVHA 4X94A 1VFPA 3KE9A 2DB3A 4HYEA 4KHPB 5ED0A 3IESA 1YSCA 2DQZA 2H7XA 5FUVA 1PV2A 1F6WA 2P6UA 4LV5B 3GAZA 4ND3A 4INPA 4KXNA 1NBWB 4RA9A 2WNHA 4U8HA 3W2FA 3TGLA 1A7UA 5F51A 1ZIXA 4I4CA 4NU5A 4TLDA 3AYZB 2AWOA 3HP1A 3ZY4A 3D0OA 3KVVA 4NCNA 4R8MA 2YV3A 2I0FA 4BDTA 1QDLB 3VVCA 1ACMA 3DB1A 1QMPA 2BPOA 3MYRA 2Q27A 3P0FA 4EA9A 4Q9AA 4A0GA 1NX6A 4OJYA 2OZKA 1SB9A 4FOTA 3VH4A 3VR3D 2WM8A 3MIIA 5KHLB 2P7HA 2XE7A 2XKJE 2ZAMA 4KODA 1C41A 4E07A 3O26A 4RZIA 2W58A 2HF2A 3V2HA 1JEAA 1ZHHA 4BEVA 4OI0A 1VYTA 1FLVA 1WXHA 4P3PA 4E5VA 4U2BA 4DR6B 3JQ8B 1T1GA 3AONB 4LE1A 5H4GA 3IPYA 1NGSA 3VUFA 3PQ4A 3T5AA 2FLVA 5FPHA 3D54D 1LTQA 4BIMA 4RTSA 4E15A 4XYLA 3KT0A 4JLMA 1JA0A 2HSGA 1DPFA 3DBHB 2XUHA 3A6JA 3TXYA 2RAFA 2FQWA 2C4NA 4LHSA 1NJFA 2XOKD 3O9ZA 5FLEX 1WIWA 1BZYA 4YNBA 5DOVA 2VP5A 1XROA 5KVCA 1PLKA 3RK4A 1ZITA 1XAHA 4MYDA 1AO0A 3LKVA 1E66A 1DZIA 2JRCA 3DMGA 4KPYA 2ARKA 3A4IA 2B7CA 3O93A 3IT1A 1UMDA 2I2BA 3VVLA 1KAHA 1FOEB 2ZYDA 1YJ5A 1M0EA 1TLLA 3OZVA 4KV9A 4JBIA 3LT5A 3NRJA 2HPAA 4UD6A 3A3YA 2UZIR 4DCTA 1LNQA 4EW2A 1Z13A 1E1NA 4W5RA 1EIWA 2E4UA 4KWIA 3VYVA 1C7FA 5CLGA 4DMCA 3QEMA 5HDBB 4CI9A 4E13A 4E14A 2WU3A 3JRWA 2E5WA 3A2MA 3UVEA 4AJHA 1ECCA 2RC5A 2ZIXB 4BKMA 3BAFA 2AFIE 4BTVA 4EEZA 3Q8WA 3UB2A 1W76A 2Z57A 4ER7A 4ERXA 4NMWA 4QYWA 4C7BA 1Y5RA 5KQRA 1E79D 2R8RA 2XRYA 3HVRA 2IYPA 3GEGA 3Q5EA 3EEYA 3WO1A 4YCLA 3TN7A 2X8JA 2PVPA 4GYKA 4HTFB 5B37A 1QG4A 1PHRA 1K7XB 1B2LA 3DDSA 2J5BA 2QIOA 1IBMB 2IEAA 2XCUA 3EYWA 1EPUA 4IWYA 3ROEA 1KQFA 4G36A 1T4CA 3NBAA 4GXNA 5TJHA 2GFQA 4F3NA 2Q2VA 1DAMA 3PP8A 3KOXA 1MAVA 2W22A 2WYHA 3EXFB 3BJIC 4OXXA 3FWHA 3VC7A 4B34A 2A9KA 2QPLA 4NS4A 2L19A 4YB8A 4RCVA 4YRLA 2C95A 1H0KA 2LW7A 4KI7A 1LFDB 4FINA 3TI7A 4P98A 5BVHB 4OGGA 4M0UA 1RWOA 2RHWA 2QVXX 4IFIA 3JTMA 5EOVA 1Y8RB 2QTCA 3EDCA 2IY9A 2PTHA 2YDXA 4MV7A 1SIWA 4QU8A 2L69A 1YDWA 4WZBB 2I55A 4LNAA 3ZS8A 4F9EA 3LHSA 1ZOIA 2B0CA 3H9CA 1MJFA 1OV6A 3KJZA 3UTCA 1SXJB 3JYQA 1ZM2A 3SBOA 2XQGA 3IQEA 3L7JA 3DFMA 1B15A 2KLHA 3ZDQA 3ZJYA 1KL7A 1ECBA 3ZE9A 3HDVA 4HQFA 5CT6A 4H3SA 3JRXA 3SNHA 1PFQA 4CUJA 1LI4A 4DQUA 2HNAA 3QWBA 1AUQA 4KWCA 4BNZA 4X6UA 1G9XA 3IQHX 2DR0A 4O08A 3OHPA 4Q3EA 4F60A 4JP5A 3RYHB 2ASEA 3V3KA 5BV0A 3HI6A 3TNJA 5A0VA 4BNDA 1FTQA 4NJMA 5FWNA 3A9RA 2P6RA 3AFGA 2DGDA 2ORYA 1IJBA 1PR3A 2DVMA 2I3AA 1Q1NA 3QG1A 1TECE 4MYSA 4RM2A 3ZV4A 4AO6A 1A2OA 1O54A 1Q2UA 1QYVA 1SC4A 2VHUA 3QTTA 1X14A 3I9NA 4RDIA 3FTEA 3SZLA 3WHPA 2X3YA 1RXWA 1M7BA 1O96B 3EZ6A 1WE2A 3F90A 3KIPA 4MUKA 3OQ6A 3DUFA 4KK3A 5EEGA 1PLLA 3AIKA 4OHBA 2Y6VA 1M72A 4H1UA 2GA9A 2Z8YA 4ZAFA 2JK0A 2ZYGA 1E4EB 2ILTA 2P6NA 3QYFA 4YA6A 1V95A 4YDHB 3PFGA 5DV9A 1TC2A 1EYZA 3D7RA 4TROA 3RC9A 1QRRA 4YYZA 4HH1A 2JANA 3MAAC 4X63A 3Q0EA 2PEYA 4WLFA 2WT9A 4JLWA 5GMOA 2OCGA 3SBXA 2A1TR 4OU5A 3AY0A 3I01A 2WAXA 3K0AB 4HQ0A 1QHFA 3VPCA 3GYBA 2QR3A 4KNVA 1GT91 1POXA 3L7KA 4X1KA 3V8QA 5K3DA 3PPIA 2Q6KA 1W5TA 3P52A 1K7FB 4NMXB 1ZPDA 3DLBA 1ZW6A 2FMHA 4R7GA 4FYKA 4KG7A 2PT5A 1N25A 3TQFA 3LPCA 3RU7A 3LUGA 2ON6A 4JC4A 4LXYA 5HMLA 5THQA 4Q4CA 1ZR4A 5I7UA 4TQ9A 2C3MA 3MLEA 2FSGA 4UFNA 5ES3A 1ULTA 1ZOOA 1URPA 2V6MA 4IZOA 4CKXA 2BTQA 1HO3A 2IS4A 3NRCA 1X8KA 3VR6H 2GZ1A 1WBBA 2G7ZA 3KETA 2FX5A 5HFNA 1UADA 2J0UA 3NGMA 4YWHA 1V45E 3SM9A 2PZLA 4JFAA 1Q0PA 1Y42X 3WO0A 1AGRA 1RFLA 5BYBA 3QXXA 3VAYA 3OA0A 3ZVMA 1Y6FA 3GGOA 5EMLA 2ZVQX 4IDCA 2P9ZA 4QULA 2I7VA 4E6PA 1P2SA 1ICEA 3CXRA 3ONDA 3LLCA 4MVJF 4P92A 1GTSA 3TPZA 3W78A 1UBEA 2QPTA 4UM9D 1AKEA 1DUVG 1KA9H 2QAGA 2R9VA 2VJPA 3FD8A 3OFKA 3P9QA 4LCJA 4RF2A 3ZJVA 4GX5A 3JQAA 4ER6A 4XFKA 5JC8A 4L28A 3S99A 3TCXB 2ZRKA 4YXWD 4KXVA 2Y71A 1WJGA 3GFOA 5FL7D 2FW0A 3IPRA 1WSWA 5DBEX 4Q7QA 3Q85A 2J0UB 4IQ8A 2WA1A 1LTHR 1CJMA 1CHDA 2HEGA 4D4JA 3RJTA 3I9FA 1KSFX 4QJ5A 4LC0A 3A0UA 3O1HB 4EF4A 7YASA 3HUDA 4G85A 4GEGA 1H4SA 1DRKA 3MCTA 1T2FA 1VHLA 4TKVA 4FR0A 1GCAA 4BZPA 1I32A 1Z28A 2O8NA 1TKBA 2WFLA 3D3NA 3KPUA 3ZC3A 1KP3A 3G02A 2PLRA 4REOA 4RV9A 4ZPXA 2IXFA 5E6SA 1D1PA 1F8FA 5ULLA 4LOJA 2G06A 3EXAA 1OAOC 2DTEA 3BTUA 1UWVA 2HLDD 2ZSFA 4G0XA 2RCYA 4PZEA 4WDRA 1QKIA 1XBTA 1XHFA 2QM7A 3AR6A 3E5HA 3JSAA 4F85A 1GKLA 3VOAA 3QYPA 1H2YA 3QBDA 3NT5A 4LWZA 2GCEA 4O25A 4PWZA 5ALKA 3RYIA 2GN4A 1O77A 1QG0A 1YQ9A 5F33A 5CB4F 2CZGA 2AJBA 1W35A 3R9KA 3R7SA 3MJRA 2IPAB 5FHQA 2YYSA 3KRTA 4FBMA 2D54A 2IHUA 2ECOA 4K9SA 4R68A 1J1ZA 5BN5B 4C08A 3RAFC 1W49A 3DZJA 4DA8A 1VZ2A 4V0MA 5DYIA 3WLQA 3MWEA 2HRDA 4E4RA 1XMIA 4EPYA 1QG6A 3DOIA 3OESA 2XT9A 5AW8A 5KBYA 2BKVA 1BDJA 2A9RA 5LVAA 1XRJA 3A14A 4UPEA 1E9FA 1ZYUA 5BNFA 3S70A 2WTUA 2ZZNA 3O3CA 3HA2A 3B5JA 4LQCA 1JEQB 1HEIA 4QOGA 4WA8A 4MP8A 4YP1A 2IV2X 4ZFNA 3PQ8A 4RHYA 5A5GA 2CV0A 2DBRA 5HBRA 3RABA 1G2PA 3B1KA 4MW9A 2X5NA 1JDSA 3L7OA 1G7CA 4GX1A 1M6EX 1U3VA 2B25A 1XAJA 1Q3KA 2VNIA 1BFDA 2R6ZA 2CYBA 3QKSA 3STUA 1T15A 4BNDB 5LQJA 1OLUA 1TYCA 8GPBA 4JL6A 1J25A 1J9GA 1M8JA 3AFMA 2KSQA 3D02A 1CR0A 1RQ2A 1Q95A 3AFNA 2PRKA 2ZJ3A 3IHKA 3OCZA 3OQIB 3W3AA 4INAA 1A9QA 4QIHA 3ZE7A 1JDPA 4L16A 5H7XA 4D5EA 1UXIA 1AA6A 4KXWA 4QASA 1KSHA 5LU9A 3VQTA 2GH1A 5DLEA 5ADWA 2IRWA 2EHJA 3E0XA 3ACBA 2CK3A 2GNOA 1AZTA 2Q5JA 3QVWA 4U9HS 3O8QB 4LHWA 1IPFA 2OMKA 5CFRA 4WZBA 1W59A 2GDZA 4GICA 1GUAA 2QTAA 3G0BA 4JXXA 5SY6A 3WRYA 4EVIA 2GXSA 3VOBA 1V48A 1QTRA 3O4IA 4IJQA 2ZK7A 5JSFA 3QLVA 3F6RA 2X3UA 2Y1LA 3UK0A 3C15C 5BVHA 3MGCA 4JLVA 4WD3A 1TFRA 3V2UA 4ZYXA 5FWYB 4DLNA 4G9GA 1JG7A 1MO5A 1D2RA 1OREA 2DWCA 4BVLA 1W87A 2C4VA 4V0QA 1FTGA 2I4TA 2D1SA 4C6RA 2WRZA 1J49A 3KQVA 1XQ9A 3OU2A 3HGTA 2GA8A 1P2BA 3N0RA 2PLFA 4K6MA 3RC3A 2PX6A 2JEOA 3N53A 4LHVA 5TC4A 1IPEA 1IBRA 1YGPA 1MB9A 2ETVA 1LB1B 1T24A 2VSOA 4WX2B 3S2ZA 4ZCSA 3PIIA 3WMRA 1L3CA 5IC5A 4RY2A 4U7HA 3PCTA 1L5NA 2NXJA 2BN4A 4ZT7A 2HD4A 3QPAA 3NB0A 4NHOA 5DP1A 3PI6A 5ALDA 1E2JA 4RHXA 2Z2XA 4Y2XA 3OD1A 2OKGA 2W6JA 3OHSX 5CR9A 1J39A 3D5QA 1CUIA 1C30A 2XDQB 2VHZA 1WU8A 1E4YA 4WUVA 1CR2A 2JBAB 3QVTA 1G8MA 2C0PA 2ZYAA 4MQFB 5A7GA 3KAJA 4A4DA 5ESDA 5H9VA 3MBIA 3SG0A 3UBMA 4AWAA 2VQEB 4AMZA 4XIGS 2JLVA 4BBPA 3LSYA 4Z9XA 1ZY2A 5AKLA 1UZMA 4BDSA 4KO3S 3LHIA 4RD0A 3L7AA 5LNK1 3ANSA 2I4MA 2CLKB 2I6XA 2PZEA 2X9GA 3NVAA 1X1EA 1XXHA 3RS2A 5DTEA 3HY4A 4TXNA 3NP7A 1GT6A 3PRJA 3WICA 4P3XA 4RX1A 4TXMA 2GS9A 3HO8A 4EB3A 4KR6A 4PN3A 5K2MA 5JD5A 4DA4A 3OIWA 5J40A 5F12A 5I7FA 2QL9A 1AK2A 4H7IA 3WL5A 4IIXA 3PNYA 5EJEA 1P5JA 4LQ4A 4PICA 1DWPA 4F5ZA 2J0VA 4HI0E 1FTYA 1V7CA 1DI0A 4DJEC 3TRIA 1GYRA 3HP7A 2Z4SA 4X8OA 2DZDA 3RBZA 1OB2A 1E7YA 3MOGA 1XLUA 4PFSA 4WN3A 3B20A 4DLSA 3VMMA 3ZTWA 5GJCA 5JOQA 1CQZA 3IOCA 1WU7A 2PEZA 4IY1A 4JSYA 2IYRA 1Q3HA 3TL3A 4NMLA 3T6KA 3L0PA 3Q72A 2PO7A 1YWGO 2J5QA 3GLTA 4TRNA 3GCXA 4KR9A 1J1IA 3VSDA 1DAKA 2CFSA 1EX7A 1H42A 2ZAGA 3MBKA 3U7HB 5F9MA 4F38A 2XJ9A 4RSMA 1KYYA 3FFTA 1D09A 1Q5PA 3INYA 2XTNA 1H0RA 3P27A 1DP4A 2W2LA 3H8WA 2XW6A 3NHJA 5DGXA 5JMPA 2O8DB 1E1QD 5L3SB 2IPNA 2VT3A 2WSMA 3C3YA 4WNYA 3WP0A 5FYQA 4A6PA 2P40A 2FQ1A 1W5SA 4AT1A 5JCXA 2JFNA 2IK8A 4D46A 3GFTA 4J0EA 5J47A 3IP8A 2JLCA 1KRXA 4RMIA 1N2XA 1XQ1A 2C88A 4MVJH 3SYNA 4PHFA 3TJMA 2AXNA 3UTDA 2MOKA 4Q82A 3UJCA 1N5RA 3WIBA 3PJFA 2PGNA 2HRCA 1ODKA 4PO9A 4WXMA 1RJEA 5G02A 4LF9B 2AEJA 3D5TA 4UUOA 3OKFA 4PHHA 2OC4A 2PIAA 3OX4A 2RHLA 5BSRA 1UQRA 2GMWA 3QELA 5IG2A 3L4EA 1GU0A 1YS4A 4KMMA 1JHMA 1U9ZA 3EEIA 3GV0A 2EFYA 3NJ4A 4IHJB 4L95C 1UDRA 5FI3A 5I6DA 2ZBDA 1CDDA 1KTVA 1TYZA 2NXNA 3AP1A 4Q34A 4TLAA 4TKUB 1KS2A 1BU8A 4TTQA 2Y77A 4QGAA 2NSDA 3INGA 4M49A 3KR9A 3W8DA 1E9AA 2QR2A 1RHKA 3GQVA 2LVBA 3IEXA 1I36A 4L75A 4MWBA 3MGGA 1ZQ1A 4R1TA 3VZSA 5JD3A 2WAOA 5CUQA 1JTFA 4DPLA 1J5PA 3CR7A 3CMMA 4WVLA 4D41A 2CNOA 3GNLA 1L4HA 2PS0A 4JSTA 2OE2A 2PKQP 1VHJA 3KOZA 3OM8A 3OZUA 4R05A 2W11A 2HJWA 1Y3IA 3H1EA 5A3VA 3D6MA 3EIWA 4F6RB 3QA3E 4C1NA 1VBFA 3ZJUA 3GT7A 3ZGNA 3TJRA 4U3JA 1Q21A 3AK4A 1NVWQ 1OI3A 3IP5A 1JDZA 4PYIA 2FOXA 2DPXA 4M60A 2ICAA 3OCVA 4JVLA 3ISTA 3FJOA 3OLZA 1IOZA 4JT8A 4HB3A 4NK5A 4WT7A 2P1DA 4B7AA 2IWRA 1OIWA 3E22B 2NYAA 3FTDA 3G68A 5EKTA 4NV3A 1G4HA 1Z3CA 2JHAA 4YV0A 3B1WA 5F5LA 3R7BA 1ACJA 1N5MA 1SPBS 3CZRA 4O63O 1CUXA 3N0XA 4RJJA 4ZKEA 1ZCAA 3DONA 1XDBA 2A4KA 2H16A 3T94A 4H59A 2O5RA 1Q1GA 4KDRA 1MW8X 3KYCB 3VJRA 4YLEA 4A8PA 3AESA 2C9YA 2WWVD 4WV3A 1EWRA 2WVAA 1E1LA 4FQ5A 1MRZA 1ZUNB 2WWRA 5CXSA 3GARA 5B57C 3QUBA 1F4VA 3IQDB 4LHYA 4LN1A 2DWUA 1RR6A 4G37A 1LCIA 4GKKB 4C2BA 1CF9A 2E2WA 5K8CA 1D2AA 5EGSA 3DMYA 1QAOA 2CDAA 1M6WA 1R5NA 1DIAA 5JTUA 4N76A 3P0HA 4I4LA 1AA9A 2N47A 4LMPA 2QMYA 5IJ0B 4L0CA 3RUIA 3DF9A 3GH3A 4RZSA 1T4MA 2AB0A 3HYLA 1TJNA 1RMYA 4IX9A 2PUVA 2B78A 2VP4A 4QFCA 3VTKA 2VF2A 5EE1A 5KWEA 1IPHA 1B0PA 1PK9A 2WSLA 2F1IA 1YQUA 3CF4A 4PYRA 5G41A 1FPQA 1MX3A 1WXIA 3QX9A 3E9QA 4YJ3B 4JQSA 1NN3A 1XRNA 1T9HA 1HORA 3ETLA 3BD9A 2K2QB 2LPMA 5KS2A 1J8DA 1JXOA 3VPAA 3DPSA 4MA5A 5ER6A 5CAEA 1JG4A 3OI7A 4HUJA 1EJ6A 5FR1A 3PJEA 5G3ZA 3CX6A 5EVCA 3PNPA 4ZMRA 2C98A 4NZMA 2R7MA 5B55A 3CLKA 1EG2A 5HMMA 3F6BX 3VTAA 3RVRA 1R0CA 1MV5A 3OEED 3H65A 4CG1A 4D74A 3LPDA 1VG9B 2D2VA 2WJPA 3THWA 1AH2A 4IMJB 3FRJA 3JZIA 4OY3A 2B4TO 4MCAA 2M6SA 5EHNA 3R76A 2KYRA 2EFDB 4HNHA 4L1KA 3KTAA 3KTOA 4S2UA 1U6JA 1D1TA 3D3WB 1JHUA 1VOTA 2ODQA 2P11A 2WWYA 4M37A 4RTMA 2P4HX 3DHEA 2O57A 2A0UA 4N12A 2CDBA 1XR3A 4AIIA 3HE3A 5EKUA 1GFWA 3FHJA 4MGZR 1WM1A 2IXDA 1Z47A 5HBGA 4TVSA 1C80A 4HS4A 2NZ8A 4EHJA 2NUPB 5LZ7A 2DSNA 3AUKA 5IN4A 2ZT6A 3AETB 5BPHA 3IEVA 3GLSA 1Z34A 2K7ZA 3OMLA 2VZ9A 3QUTA 4J49A 3PKJA 4HQOA 4MQLA 1HFEL 3GJTA 3MUOA 4DSOA 5HUQA 2Z30A 4EFDA 2ZRQA 3GIDA 5EZ6B 1A4RA 4I1UA 4DSZA 4QT4A 1R6XA 3S29A 6REQB 4QDOA 1Z0KA 3TTTA 1U7WA 2YFKA 3HMQA 3V1TC 2MYTA 2BKAA 4NPAA 1D04A 4KL8S 4L8GA 1IONA 3EA4A 3F8TA 3X2FA 5B2FA 1IK6A 4JH0A 3FZQA 4HWTA 3IAS1 4LW8A 4BNGA 1UJ4A 4F71A 2XWBF 3ER9A 4Y9UA 1KS9A 1GRNA 4EPWA 3B13B 4RTRA 2DBVO 5D87A 2EZTA 2HWWA 1TPYA 4XWGA 3TEFA 5I47A 2JFGA 5IKOA 3SZOA 1FPMA 6YASA 2C58A 4W7SA 2QLFA 3HGQA 3QQPA 2C7GA 3K5HA 4ALMA 1Z4JA 5HKKD 1JQAA 2DR2A 1NMQA 1XP8A 3R7WB 3H4VA 5ARDA 1TQHA 1LPAB 1RC1A 1L4GA 2Y05A 3IBGA 3Q8KA 1T43A 4ZQFA 4C89A 1EKXA 1YCHA 2M9MA 3EJ6A 4XCQA 3ZNNA 4D56A 4GBGA 1U0RA 4TV9A 4EX7A 2AYZA 2O2HA 3SPXA 2FWMX 2JGRA 1KVSA 3PQ3A 4L0MA 4Z0PA 5LN1A 1PW5A 1UM9B 5CLIA 1IY2A 5KINB 1C7JA 1MJ5A 4OA8A 4NOJA 5K4AA 1UT8A 3ITKA 3HKEB 3OLWA 4FZJA 3ST7A 5EIWA 4Y2YA 3PFIA 4DILA 5JTTA 4Q4AB 5KTKA 4LAFA 3TUIC 3DF7A 1E1KA 2EP5A 3QVUA 3CX3A 3GRFA 5DJ5A 1ZD8A 4KPFC 4AQ7A 4EG8A 3LFUA 4B6RA 3MELA 1O58A 1WULS 2W2VA 3BFJA 3L4SO 1WQ1R 3TZLA 1V16B 3HR4A 4EMTA 3TBKA 3H9BA 2XQKA 1G8HA 3OX2A 5C53B 4FFVA 3DZKA 1TD1A 16PKA 1V3VA 5IK2A 1I0LA 4X1IA 3KSRA 2D5IA 4LGVA 1Y4AE 4WESB 5AJZA 1DFIA 4U2FA 4OHPA 3U7GA 1Z4MA 2YWEA 1QGDA 2WPDA 1DQPA 2VDKB 1ETUA 3L6BA 3OOHA 3MZ0A 3JAKB 5DNEA 1E6KA 4HYTA 5CURA 1C9EA 3G0CA 2OHVA 4KAFA 1VA5A 5GVRA 3UMVA 3NCHA 3CF4G 2Y3IA 3IVXA 3GUHA 1VG1A 3FXAA 3S1AB 1QFZA 4B3BA 1GOTA 2D0OB 1FNDA 2OXEA 3BTVA 3PR3A 3K1AB 4IMRA 4KXUA 3TSYA 3DO5A 3OSUA 5I7WA 3B1XA 1N32B 3UQZA 1HQCA 3WLHA 3ACCA 3B1ZA 2GPSA 1FDWA 2CJXA 1P77A 3V2GA 1N2SA 4PC1A 4WAUA 1E4EA 1IAVA 3FWPA 3CVYA 2PCLA 4YAWA 1D8AA 2OM2A 4UTOA 5ERYA 1ZXBA 2C42A 1F0YA 2PSFA 2XQVA 1NRJB 3HP4A 1CLEA 4LRTB 3D7SA 5EJAA 5IULC 4MGYR 2CXNA 3FB1A 4P0TA 3SEFA 5DHUA 1N0HA 1WMAA 3EMBA 5DI3A 3NKFA 3TEMA 3VR5D 1EI9A 2QTHA 1ZS9A 3TR5A 1NKTA 2ZUUA 4R9VA 1HF3A 3RF6A 2GZHA 4CXMA 3TB4A 3K9BA 4NFSA 2JG3A 1S5PA 4G5GA 3I61A 1KH3A 3LE8A 4WFKA 1OV4A 3L1IA 2HSZA 4AJOA 4ETIA 4ARCA 5EUMA