2BFHA

Crystal structure of basic fibroblast growth factor at 1.6 angstroms resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
128
structure length
128
Chain Sequence
DPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BASIC FIBROBLAST GROWTH FACTOR
publication title Crystal structure of basic fibroblast growth factor at 1.6 A resolution.
pubmed rcsb
source organism Homo sapiens
molecule tags Growth factor
total genus 26
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1993-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2bfhA00
3BAHA 3HALA 3SNVA 4EFPA 3RTIB 3NBEA 1SR4A 1WD4A 4OWLA 5D63A 1AF9A 3TC2A 3FJCA 4ZFYB 1Q1UA 3F62B 3FJHA 3Q7YA 5HPZA 3BAQA 3UD9A 2UUSA 4XFSA 4IHZA 2E4MA 4I96A 4EKXB 3CU1B 3O4CA 4A7KA 4KEKA 1F31A 1ITBA 3OJ2A 3NBNA 5DSSB 1HWMB 3OGGA 1JT4A 1WD3A 1HWPB 4L4IA 3WO4A 4EB2B 3Q7WA 3N0KA 3RMYA 4ISQA 4G9NA 4ZLBB 1IOBA 3A07A 4JQ0A 3POKA 1BARA 3AH4A 1L2HA 2MLLB 1DLLA 4F83A 2D20A 4I4PA 1XYFA 5I1BA 3RMXA 1XG6A 3O5WB 1S0DA 4AN7B 3CRIA 1KNMA 3FJ9A 3ILAA 4I4YA 4IZEA 1HWNB 2DS0A 4X3AA 1BFCA 1RY7A 1DFCA 4LO0C 3Q7XA 3LTQA 4G6MA 4J2XA 1V6VA 1TP0A 3BAVA 3ZXDA 3VT2A 3IAGC 1A8DA 3CA4A 4LO2C 2HZ9A 3B9UA 1PZZA 1BA7A 5FZZA 1DQGA 3N7KA 1S0FA 4JP0A 2Q3NB 2ZQNA 4JRAA 4JKQA 3BAOA 4DCKC 1HIBA 1MC9A 1NZKA 3P53A 2GZBA 2DRYA 4QD2B 4TLPA 4KEIA 1RZOB 1CE7B 2MIBA 3MALA 4I4VA 2GO2A 2J3PA 3S8KA 4GOVA 3RSJA 2AQZA 1S0EA 4R6UB 5BVPI 3MPPG 2FFVA 4KEJA 5JLVA 3OJVA 4LO8B 4ENDA 2D1ZA 3VUOA 1M2TB 2ZQOA 3FUQA 2F2FA 4IY8A 3UDAA 3OBTA 3WINA 3CA1A 4YOLA 1JLYA 3FFZA 9ILBA 3V0BA 2FDBM 1G82A 2Y9WC 1AVUA 3ZC8A 1FN0A 4KC3A 1RMLA 2ZR1B 3BADA 5GAQA 1OQLB 1YTOA 5F8YA 1IRAX 3O4OA 4I2SA 5DZUA 1ONKB 4P0JA 1YBIA 2VU9A 5BXSA 4I4UA 4LO3C 2HW9A 4J2SA 4X37A 1JT7A 3IM5A 1IRPA 5D62A 4OWKA 1I1BA 1J0SA 4QD2C 2BFHA 3CRHA 3O4AA 2KI4A 4ZFUB 4LO3A 2LIEA 3C9ZA 4J2YA 41BIA 1IJTA 1JTCA 2X2SA 3O49A 4D8HA 4ZGRB 1ISVA 3VEQA 1BLDA 3HBWA 1WBCA 4ZFWB 1M16A 4I4XA 1JQZA 3PG0A 4I7IA 4I4RA 1V6UA 1ISXA 1TIEA 2QYIB 3AZWA 4GP3A 2Y9XE 1TTUA 4H9WA 3BA7A 3FJBA 3I2XA 2VXRA 3T8SA 5EG6C 3OJMA 1E0OA 3FJFA 3CQAA 4GOYA 3CA5A 3RTJB 1V6XA 4II0A 3P6IA 2LIQA 3UJ4A 4QBVA 5BXRA 3HN1A 4XKIA 1FMZA 3AJ5A 5EHAA 3V79C 1YXWA 4F34A 3CA0A 1R8OA 1BFBA 3BRDA 2HWMA 5F8SA 4EFQA 5G00A 4CJMA 3UJ0A 4D0TA 1ILR1 4OEGA 4QKSA 2BEAA 3ZC9A 2YUGA 1Q04A 1EYLA 1JY0A 4P0LA 1MD6A 3VT0A 5BP5C 1BLAA 1HWOB 3V0AB 3OBRA 2QN4A 1FV2A 3WO2A 2KKIA 1IHKA 2HWAA 1I1EA 1V6WA 3FJJA 1QQKA 4LO0A 2RG9B 3UD7A 2D23A 1HCEA 2Z48A 1T4QA 4IZXA 1R8NA 6I1BA 3WMUA 2R9KB 3D7WB 3IM7A 4LO2A 2F8XC 2K8RA 21BIA 4HA2A 1JLXA 3QYDA 3BAGA 2X2TA 4I1EA 1S0LA 1PUUB 5BQUC 3O4BA 4LO1C 4D0ZA 4QBCA 3FGMA 1Z2VA 1QXMA 2RSTA 4Q9GA 4I4SA 4ZBVB 4P0KA 3CRGA 5BQUA 1FGAA 1PUMB 1Z0HA 3ZXGA 4HR6C 2FO1A 4IYBA 3AKFA 2VLCA 1UPSA 2M49A 4DENA 3CA3A 1TWMA 2ET2A 4G1RA 4ZOTA 5FZUA 3BA5A 3H6RB 2VUAA 3BX1C 2D44A 2NM1A 3BRGC 3S8JA 4IY9A 5EC5A 2RQ9A 1N4KA 1WBAA 3QR5A 2NP0A 4QKRA 31BIA 4Q9PA 3I2AA 3FJDA 5F90A 2D7RA 5D61A 4X39A 4Z9WB 2VSAA 3AZVA 1QQLA 5BXPA 3BAUA 1HCDA 2Q9XA 1FQ9A 1D0HA 1G9DA 4X38A 4OW4A 1ABRB 2D24A 1AXMA 3FJAA 1VCLA 3KMVA 4A7YA 2MC2A 1CVSA 2XOAA 3H6QA 4I0YA 1JT3A 3HOMA 4USPA 1AVAC 2WRYA 3A21A 3EF2A 3FJEA 3O4DA 4OEFA 3AKIA 2VXTI 4PC4A 4FGFA 1DJSB 4JAWA 4I8MA 1DIWA 4LO7B 2DREA 3H6SE 1SR4C 2D7IA 1FWUA 1ISWA 2P23A 1ISYA 4IONA 4I4QA 4OEEA 2Z49A 2L5XA 1ISZA 4I3NA 1II4A 4AN6A 3O3QA 4I1BA 3AKHA 1S0BA 2E4MC 2Y9FA 3IM6A 3AH2A 2Y9GA 4GAIA 3H6RA 3PUBA 4JPZA 1T9FA 2ESUA 4GAFA 2WBCA 3VSFA 4JKXB 4WBCA 4FVVA 3VSZA 1G9AA 1YF8B 3O44A 3BRFA 1FWVA 4A7ZA 1IT0A 4ZKTB 3NBCA 1DFQA 1BASA 3AKGA 3NJ5A 2IHOA 1DZCA 3UD8A 1S0GA 5DUYA 5FNWA 3LLPA 3VWCA 1TFMB 3I29B 4QO3A 2KLLA 1RG8A 4G6JA 3V0BB 1S0CA 1TWEA 3FJ8A 3K1XA 2KI6B 1SZ6B 1DZDA 3R4UA 5DVHA 2DRZA 5BP5A 1FV3A 1FMMS 1W3GA 4LO7C 1AVXB 8I1BA 5JMCA 3WMVA 4I37A 5BOWA 4KBBA 4EEEB 1BFFA 3P6JA 3IIRA 4USOA 2IWTB 1K5VA 4L4HA 4EFRA 2NYYA 3A22A 1TOOA 3ZX7A 2BEBA 3NBDA 2I1BA 1XZZA 3PMEA 4LO1A 2NTDA 3N7LA 4Q91A 1YYNA 2FGFA 5FNXA 3HMYA 3BB2A 1AFCA 2ERMA 3WA1A 1NUNA 2K4AB 5E24E 2KH2A 3HSMA 4QALA 1G9BA 4J23B 2F2FC 2FFUA 1P63A 3BTAA 3N7JA 5FZYA 3WINC 5BXTA 1HKNA 1EVTA 5B2HA 3CA6A 4H04A 4ZA3B 4G9MA 3BA4A 3FUOA 1Q03A 1IILA 2NZ9A 3R4SA 1EPWA 2NVHA 4I4OA 3V0AA 4DEPA 3JRRA 2VSEA 4P6AA 1G9CA 1JT5A 4J2KA 1K5UA 3FJIA 4GP0A 4HJJA 1EV2A 2P39A 4XFTA 3CAHA 4QC4A 1AVWB 2AAIB 3FJKA 3JUTA 3PHZA 7I1BA 1XHBA 2K43A 3F1RA 4IQPA 4OWJA 1W3AA 2D22A 1Z4SA 3W9TA 3VT1A 4I6IA 3N7MA 3WO3A 3E8LC 2D43A 3OGFA 5F8WA 1PWAA 4ISRA 1W3FA 3AH1A 1GGPB 3AJ6A 1PC8B 3A23A 4OUJA 1BFGA 2AXMA 2AFGA 4XFUA 1DQOA 4Z8SB
chains in the Genus database with same CATH superfamily
3BAHA 3HALA 3SNVA 4EFPA 3RTIB 3NBEA 1SR4A 1WD4A 4OWLA 5D63A 1AF9A 3TC2A 3FJCA 4ZFYB 1Q1UA 3F62B 3FJHA 3Q7YA 4UY4A 3BAQA 5HPZA 3UD9A 2UUSA 4XFSA 4IHZA 2E4MA 4I96A 4EKXB 3CU1B 3O4CA 4A7KA 4KEKA 1F31A 1ITBA 3OJ2A 3NBNA 5DSSB 1HWMB 3OGGA 1JT4A 1WD3A 1HWPB 4L4IA 3WO4A 4EB2B 3Q7WA 3N0KA 3RMYA 4ISQA 4G9NA 4ZLBB 1IOBA 3A07A 4JQ0A 3POKA 1BARA 3AH4A 1L2HA 2MLLB 1DLLA 4F83A 2D20A 4I4PA 1XYFA 5I1BA 3RMXA 1XG6A 3O5WB 1S0DA 4AN7B 3CRIA 1KNMA 3FJ9A 3ILAA 4I4YA 4IZEA 1HWNB 2DS0A 4X3AA 1BFCA 1RY7A 4MZHA 1DFCA 4LO0C 3Q7XA 3LTQA 4G6MA 4J2XA 1V6VA 1TP0A 3BAVA 3ZXDA 3VT2A 3IAGC 1A8DA 3CA4A 4LO2C 2HZ9A 3B9UA 1PZZA 1BA7A 5FZZA 1DQGA 3N7KA 1S0FA 4JP0A 2Q3NB 2ZQNA 4JRAA 4JKQA 3BAOA 4DCKC 1HIBA 1MC9A 1NZKA 3P53A 2GZBA 2DRYA 4QD2B 4TLPA 4KEIA 1RZOB 1CE7B 2MIBA 3MALA 4I4VA 2GO2A 2J3PA 3S8KA 4GOVA 3RSJA 2AQZA 1S0EA 4R6UB 5BVPI 3MPPG 2FFVA 4KEJA 5JLVA 3OJVA 4LO8B 4ENDA 2D1ZA 3VUOA 1M2TB 2ZQOA 3FUQA 2F2FA 4IY8A 3UDAA 3OBTA 3WINA 3CA1A 4YOLA 1JLYA 3FFZA 9ILBA 3V0BA 2FDBM 1G82A 2Y9WC 1AVUA 3ZC8A 1FN0A 4KC3A 1RMLA 2ZR1B 3BADA 5GAQA 1OQLB 1YTOA 5F8YA 1IRAX 3O4OA 4I2SA 5DZUA 1ONKB 4P0JA 1YBIA 2VU9A 5BXSA 4I4UA 4LO3C 2HW9A 4J2SA 4X37A 1JT7A 3IM5A 1IRPA 5D62A 4OWKA 1I1BA 1J0SA 4QD2C 2BFHA 3CRHA 3O4AA 2KI4A 4ZFUB 4LO3A 2LIEA 3C9ZA 4J2YA 41BIA 1IJTA 1JTCA 2X2SA 3O49A 4D8HA 4ZGRB 1ISVA 3VEQA 1BLDA 3HBWA 1WBCA 4ZFWB 1M16A 4I4XA 1JQZA 3PG0A 4I7IA 4I4RA 1V6UA 1ISXA 1TIEA 2QYIB 3AZWA 4GP3A 2Y9XE 1TTUA 4H9WA 3BA7A 3FJBA 3I2XA 2VXRA 3T8SA 5EG6C 3OJMA 1E0OA 3FJFA 3CQAA 4GOYA 3CA5A 3RTJB 1V6XA 4II0A 3P6IA 2LIQA 3UJ4A 4QBVA 5BXRA 3HN1A 4XKIA 1FMZA 3AJ5A 5EHAA 4H75A 3V79C 1YXWA 2NS2A 4F34A 3CA0A 1R8OA 1BFBA 3BRDA 2HWMA 5F8SA 4EFQA 5G00A 4CJMA 3UJ0A 4D0TA 1ILR1 4OEGA 4QKSA 2BEAA 3ZC9A 2YUGA 1Q04A 1EYLA 1JY0A 4P0LA 1MD6A 3VT0A 5BP5C 1BLAA 1HWOB 3V0AB 3OBRA 2QN4A 1FV2A 3WO2A 2KKIA 1IHKA 2HWAA 1I1EA 1V6WA 3FJJA 1QQKA 4LO0A 2RG9B 3UD7A 2D23A 1HCEA 2Z48A 1T4QA 4IZXA 1R8NA 6I1BA 3WMUA 2R9KB 3D7WB 3IM7A 4LO2A 2F8XC 2K8RA 21BIA 4HA2A 1JLXA 3QYDA 3BAGA 2X2TA 4I1EA 1S0LA 1PUUB 5BQUC 3O4BA 4LO1C 4D0ZA 4QBCA 3FGMA 1Z2VA 1QXMA 2RSTA 4Q9GA 4I4SA 4ZBVB 4P0KA 3CRGA 5BQUA 1FGAA 1PUMB 1Z0HA 3ZXGA 4HR6C 2FO1A 4IYBA 3AKFA 2VLCA 1UPSA 2M49A 4DENA 3CA3A 1TWMA 2ET2A 4G1RA 4ZOTA 5FZUA 3BA5A 3H6RB 2VUAA 3BX1C 2D44A 2NM1A 3BRGC 3S8JA 4IY9A 5EC5A 2RQ9A 1N4KA 1WBAA 3QR5A 2NP0A 4QKRA 31BIA 4Q9PA 3I2AA 3FJDA 5F90A 2D7RA 5D61A 4X39A 4Z9WB 2VSAA 3AZVA 1QQLA 5BXPA 3BAUA 1HCDA 2Q9XA 1FQ9A 1D0HA 1G9DA 4X38A 4OW4A 1ABRB 2D24A 1AXMA 3FJAA 1VCLA 3KMVA 4A7YA 2MC2A 1CVSA 2XOAA 3H6QA 4I0YA 1JT3A 3HOMA 4USPA 1AVAC 2WRYA 3A21A 3EF2A 3FJEA 3O4DA 4OEFA 3AKIA 2VXTI 4PC4A 4FGFA 1DJSB 4JAWA 4I8MA 1DIWA 4LO7B 2DREA 3H6SE 1SR4C 2D7IA 1FWUA 1ISWA 2P23A 1ISYA 4IONA 4I4QA 4OEEA 2Z49A 2L5XA 1ISZA 4I3NA 1II4A 4AN6A 3O3QA 4I1BA 3AKHA 1S0BA 2E4MC 2Y9FA 3IM6A 3AH2A 2Y9GA 4GAIA 3H6RA 3PUBA 4JPZA 1T9FA 2ESUA 4GAFA 2WBCA 3VSFA 4JKXB 4WBCA 4FVVA 3VSZA 1G9AA 1YF8B 3O44A 3BRFA 1FWVA 4A7ZA 1IT0A 4ZKTB 3NBCA 1DFQA 1BASA 3AKGA 3NJ5A 2IHOA 1DZCA 3UD8A 1S0GA 5DUYA 5FNWA 4MZGB 3LLPA 3VWCA 1TFMB 3I29B 4QO3A 2KLLA 1RG8A 4G6JA 3V0BB 1S0CA 1TWEA 3FJ8A 3K1XA 2KI6B 1SZ6B 1DZDA 3R4UA 5DVHA 2DRZA 5BP5A 1FV3A 1FMMS 1W3GA 4LO7C 1AVXB 8I1BA 5JMCA 3WMVA 4I37A 5BOWA 4KBBA 4EEEB 1BFFA 3P6JA 3IIRA 4USOA 2IWTB 1K5VA 4L4HA 4EFRA 2NYYA 3A22A 1TOOA 3ZX7A 2BEBA 3NBDA 2I1BA 1XZZA 3PMEA 4LO1A 2NTDA 3N7LA 4Q91A 1YYNA 2FGFA 5FNXA 3HMYA 3BB2A 1AFCA 2ERMA 3WA1A 1NUNA 2K4AB 5E24E 2KH2A 3HSMA 4QALA 1G9BA 4J23B 2F2FC 2FFUA 1P63A 3BTAA 3N7JA 5FZYA 3WINC 5BXTA 1HKNA 1EVTA 5B2HA 4MZFB 3CA6A 4H04A 4ZA3B 4G9MA 3BA4A 3FUOA 1Q03A 1IILA 2NZ9A 3R4SA 1EPWA 2NVHA 4I4OA 3V0AA 4DEPA 3JRRA 2VSEA 4P6AA 1G9CA 1JT5A 4J2KA 1K5UA 3FJIA 4GP0A 4HJJA 1EV2A 2P39A 4XFTA 3CAHA 4QC4A 1AVWB 2AAIB 3FJKA 3JUTA 3PHZA 7I1BA 1XHBA 2K43A 3F1RA 4IQPA 4OWJA 1W3AA 2D22A 1Z4SA 3W9TA 3VT1A 4I6IA 3N7MA 3WO3A 3E8LC 2D43A 3OGFA 5F8WA 1PWAA 4ISRA 1W3FA 3AH1A 1GGPB 3AJ6A 1PC8B 3A23A 4OUJA 1BFGA 2AXMA 2AFGA 4XFUA 1DQOA 4Z8SB
chains in the Genus database with same CATH topology
3BAHA 3HALA 3SNVA 4EFPA 3RTIB 3NBEA 1SR4A 1WD4A 4OWLA 5D63A 1AF9A 3TC2A 3FJCA 4ZFYB 1Q1UA 3F62B 3FJHA 3Q7YA 4UY4A 3BAQA 5HPZA 3UD9A 2UUSA 4XFSA 4IHZA 2E4MA 4I96A 4EKXB 3CU1B 3O4CA 4A7KA 4KEKA 1F31A 1ITBA 3OJ2A 3NBNA 5DSSB 1HWMB 3OGGA 1JT4A 1WD3A 1HWPB 4L4IA 3WO4A 4EB2B 3Q7WA 3N0KA 3RMYA 4ISQA 4G9NA 4ZLBB 1IOBA 3A07A 4JQ0A 3POKA 1BARA 3AH4A 1L2HA 2MLLB 1DLLA 4F83A 2D20A 4I4PA 1XYFA 5I1BA 3RMXA 1XG6A 3O5WB 1S0DA 4AN7B 3CRIA 1KNMA 3FJ9A 3ILAA 4I4YA 4IZEA 1HWNB 2DS0A 4X3AA 1BFCA 1RY7A 4MZHA 1DFCA 4LO0C 3Q7XA 3LTQA 4G6MA 4J2XA 1V6VA 1TP0A 3BAVA 3ZXDA 3VT2A 3IAGC 1A8DA 3CA4A 4LO2C 2HZ9A 3B9UA 1PZZA 1BA7A 5FZZA 1DQGA 3N7KA 1S0FA 4JP0A 2Q3NB 2ZQNA 4JRAA 4JKQA 3BAOA 4DCKC 1HIBA 1MC9A 1NZKA 3P53A 2GZBA 2DRYA 4QD2B 4TLPA 4KEIA 1RZOB 1CE7B 2MIBA 3MALA 4I4VA 2GO2A 2J3PA 3S8KA 4GOVA 3RSJA 2AQZA 1S0EA 4R6UB 5BVPI 3MPPG 2FFVA 4KEJA 5JLVA 3OJVA 4LO8B 4ENDA 2D1ZA 3VUOA 1M2TB 2ZQOA 3FUQA 2F2FA 4IY8A 3UDAA 3OBTA 3WINA 3CA1A 4YOLA 1JLYA 3FFZA 9ILBA 3V0BA 2FDBM 1G82A 2Y9WC 1AVUA 3ZC8A 1FN0A 4KC3A 1RMLA 2ZR1B 3BADA 5GAQA 1OQLB 1YTOA 5F8YA 1IRAX 3O4OA 4I2SA 5DZUA 1ONKB 4P0JA 1YBIA 2VU9A 5BXSA 4I4UA 4LO3C 2HW9A 4J2SA 4X37A 1JT7A 3IM5A 1IRPA 5D62A 4OWKA 1I1BA 1J0SA 4QD2C 2BFHA 3CRHA 3O4AA 2KI4A 4ZFUB 4LO3A 2LIEA 3C9ZA 4J2YA 41BIA 1IJTA 1JTCA 2X2SA 3O49A 4D8HA 4ZGRB 1ISVA 3VEQA 1BLDA 3HBWA 1WBCA 4ZFWB 1M16A 4I4XA 1JQZA 3PG0A 4I7IA 4I4RA 1V6UA 1ISXA 1TIEA 2QYIB 3AZWA 4GP3A 2Y9XE 1TTUA 4H9WA 3BA7A 3FJBA 3I2XA 2VXRA 3T8SA 5EG6C 3OJMA 1E0OA 3FJFA 3CQAA 4GOYA 3CA5A 3RTJB 1V6XA 4II0A 3P6IA 2LIQA 3UJ4A 4QBVA 5BXRA 3HN1A 4XKIA 1FMZA 3AJ5A 5EHAA 4H75A 3V79C 1YXWA 2NS2A 4F34A 3CA0A 1R8OA 1BFBA 3BRDA 2HWMA 5F8SA 4EFQA 5G00A 4CJMA 3UJ0A 4D0TA 1ILR1 4OEGA 4QKSA 2BEAA 3ZC9A 2YUGA 1Q04A 1EYLA 1JY0A 4P0LA 1MD6A 3VT0A 5BP5C 1BLAA 1HWOB 3V0AB 3OBRA 2QN4A 1FV2A 3WO2A 2KKIA 1IHKA 2HWAA 1I1EA 1V6WA 3FJJA 1QQKA 4LO0A 2RG9B 3UD7A 2D23A 1HCEA 2Z48A 1T4QA 4IZXA 1R8NA 6I1BA 3WMUA 2R9KB 3D7WB 3IM7A 4LO2A 2F8XC 2K8RA 21BIA 4HA2A 1JLXA 3QYDA 3BAGA 2X2TA 4I1EA 1S0LA 1PUUB 5BQUC 3O4BA 4LO1C 4D0ZA 4QBCA 3FGMA 1Z2VA 1QXMA 2RSTA 4Q9GA 4I4SA 4ZBVB 4P0KA 3CRGA 5BQUA 1FGAA 1PUMB 1Z0HA 3ZXGA 4HR6C 2FO1A 4IYBA 3AKFA 2VLCA 1UPSA 2M49A 4DENA 3CA3A 1TWMA 2ET2A 4G1RA 4ZOTA 5FZUA 3BA5A 3H6RB 2VUAA 3BX1C 2D44A 2NM1A 3BRGC 3S8JA 4IY9A 5EC5A 2RQ9A 1N4KA 1WBAA 3QR5A 2NP0A 4QKRA 31BIA 4Q9PA 3I2AA 3FJDA 5F90A 2D7RA 5D61A 4X39A 4Z9WB 2VSAA 3AZVA 1QQLA 5BXPA 3BAUA 1HCDA 2Q9XA 1FQ9A 1D0HA 1G9DA 4X38A 4OW4A 1ABRB 2D24A 1AXMA 3FJAA 1VCLA 3KMVA 4A7YA 2MC2A 1CVSA 2XOAA 3H6QA 4I0YA 1JT3A 3HOMA 4USPA 1AVAC 2WRYA 3A21A 3EF2A 3FJEA 3O4DA 4OEFA 3AKIA 2VXTI 4PC4A 4FGFA 1DJSB 4JAWA 4I8MA 1DIWA 4LO7B 2DREA 3H6SE 1SR4C 2D7IA 1FWUA 1ISWA 2P23A 1ISYA 4IONA 4I4QA 4OEEA 2Z49A 2L5XA 1ISZA 4I3NA 1II4A 4AN6A 3O3QA 4I1BA 3AKHA 1S0BA 2E4MC 2Y9FA 3IM6A 3AH2A 2Y9GA 4GAIA 3H6RA 3PUBA 4JPZA 1T9FA 2ESUA 4GAFA 2WBCA 3VSFA 4JKXB 4WBCA 4FVVA 3VSZA 1G9AA 1YF8B 3O44A 3BRFA 1FWVA 4A7ZA 1IT0A 4ZKTB 3NBCA 1DFQA 1BASA 3AKGA 3NJ5A 2IHOA 1DZCA 3UD8A 1S0GA 5DUYA 5FNWA 4MZGB 3LLPA 3VWCA 1TFMB 3I29B 4QO3A 2KLLA 1RG8A 4G6JA 3V0BB 1S0CA 1TWEA 3FJ8A 3K1XA 2KI6B 1SZ6B 1DZDA 3R4UA 5DVHA 2DRZA 5BP5A 1FV3A 1FMMS 1W3GA 4LO7C 1AVXB 8I1BA 5JMCA 3WMVA 4I37A 5BOWA 4KBBA 4EEEB 1BFFA 3P6JA 3IIRA 4USOA 2IWTB 1K5VA 4L4HA 4EFRA 2NYYA 3A22A 1TOOA 3ZX7A 2BEBA 3NBDA 2I1BA 1XZZA 3PMEA 4LO1A 2NTDA 3N7LA 4Q91A 1YYNA 2FGFA 5FNXA 3HMYA 3BB2A 1AFCA 2ERMA 3WA1A 1NUNA 2K4AB 5E24E 2KH2A 3HSMA 4QALA 1G9BA 4J23B 2F2FC 2FFUA 1P63A 3BTAA 3N7JA 5FZYA 3WINC 5BXTA 1HKNA 1EVTA 5B2HA 4MZFB 3CA6A 4H04A 4ZA3B 4G9MA 3BA4A 3FUOA 1Q03A 1IILA 2NZ9A 3R4SA 1EPWA 2NVHA 4I4OA 3V0AA 4DEPA 3JRRA 2VSEA 4P6AA 1G9CA 1JT5A 4J2KA 1K5UA 3FJIA 4GP0A 4HJJA 1EV2A 2P39A 4XFTA 3CAHA 4QC4A 1AVWB 2AAIB 3FJKA 3JUTA 3PHZA 7I1BA 1XHBA 2K43A 3F1RA 4IQPA 4OWJA 1W3AA 2D22A 1Z4SA 3W9TA 3VT1A 4I6IA 3N7MA 3WO3A 3E8LC 2D43A 3OGFA 5F8WA 1PWAA 4ISRA 1W3FA 3AH1A 1GGPB 3AJ6A 1PC8B 3A23A 4OUJA 1BFGA 2AXMA 2AFGA 4XFUA 1DQOA 4Z8SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BAH A;  3HAL A;  3SNV A;  4EFP A;  3RTI B;  3NBE A;  1SR4 A;  1WD4 A;  4OWL A;  5D63 A;  1AF9 A;  3TC2 A;  3FJC A;  4ZFY B;  1Q1U A;  3F62 B;  3FJH A;  3Q7Y A;  5HPZ A;  3BAQ A;  3UD9 A;  2UUS A;  4XFS A;  4IHZ A;  2E4M A;  4I96 A;  4EKX B;  3CU1 B;  3O4C A;  4A7K A;  4KEK A;  1F31 A;  1ITB A;  3OJ2 A;  3NBN A;  5DSS B;  1HWM B;  3OGG A;  1JT4 A;  1WD3 A;  1HWP B;  4L4I A;  3WO4 A;  4EB2 B;  3Q7W A;  3N0K A;  3RMY A;  4ISQ A;  4G9N A;  4ZLB B;  1IOB A;  3A07 A;  4JQ0 A;  3POK A;  1BAR A;  3AH4 A;  1L2H A;  2MLL B;  1DLL A;  4F83 A;  2D20 A;  4I4P A;  1XYF A;  5I1B A;  3RMX A;  1XG6 A;  3O5W B;  1S0D A;  4AN7 B;  3CRI A;  1KNM A;  3FJ9 A;  3ILA A;  4I4Y A;  4IZE A;  1HWN B;  2DS0 A;  4X3A A;  1BFC A;  1RY7 A;  1DFC A;  4LO0 C;  3Q7X A;  3LTQ A;  4G6M A;  4J2X A;  1V6V A;  1TP0 A;  3BAV A;  3ZXD A;  3VT2 A;  3IAG C;  1A8D A;  3CA4 A;  4LO2 C;  2HZ9 A;  3B9U A;  1PZZ A;  1BA7 A;  5FZZ A;  1DQG A;  3N7K A;  1S0F A;  4JP0 A;  2Q3N B;  2ZQN A;  4JRA A;  4JKQ A;  3BAO A;  4DCK C;  1HIB A;  1MC9 A;  1NZK A;  3P53 A;  2GZB A;  2DRY A;  4QD2 B;  4TLP A;  4KEI A;  1RZO B;  1CE7 B;  2MIB A;  3MAL A;  4I4V A;  2GO2 A;  2J3P A;  3S8K A;  4GOV A;  3RSJ A;  2AQZ A;  1S0E A;  4R6U B;  5BVP I;  3MPP G;  2FFV A;  4KEJ A;  5JLV A;  3OJV A;  4LO8 B;  4END A;  2D1Z A;  3VUO A;  1M2T B;  2ZQO A;  3FUQ A;  2F2F A;  4IY8 A;  3UDA A;  3OBT A;  3WIN A;  3CA1 A;  4YOL A;  1JLY A;  3FFZ A;  9ILB A;  3V0B A;  2FDB M;  1G82 A;  2Y9W C;  1AVU A;  3ZC8 A;  1FN0 A;  4KC3 A;  1RML A;  2ZR1 B;  3BAD A;  5GAQ A;  1OQL B;  1YTO A;  5F8Y A;  1IRA X;  3O4O A;  4I2S A;  5DZU A;  1ONK B;  4P0J A;  1YBI A;  2VU9 A;  5BXS A;  4I4U A;  4LO3 C;  2HW9 A;  4J2S A;  4X37 A;  1JT7 A;  3IM5 A;  1IRP A;  5D62 A;  4OWK A;  1I1B A;  1J0S A;  4QD2 C;  2BFH A;  3CRH A;  3O4A A;  2KI4 A;  4ZFU B;  4LO3 A;  2LIE A;  3C9Z A;  4J2Y A;  41BI A;  1IJT A;  1JTC A;  2X2S A;  3O49 A;  4D8H A;  4ZGR B;  1ISV A;  3VEQ A;  1BLD A;  3HBW A;  1WBC A;  4ZFW B;  1M16 A;  4I4X A;  1JQZ A;  3PG0 A;  4I7I A;  4I4R A;  1V6U A;  1ISX A;  1TIE A;  2QYI B;  3AZW A;  4GP3 A;  2Y9X E;  1TTU A;  4H9W A;  3BA7 A;  3FJB A;  3I2X A;  2VXR A;  3T8S A;  5EG6 C;  3OJM A;  1E0O A;  3FJF A;  3CQA A;  4GOY A;  3CA5 A;  3RTJ B;  1V6X A;  4II0 A;  3P6I A;  2LIQ A;  3UJ4 A;  4QBV A;  5BXR A;  3HN1 A;  4XKI A;  1FMZ A;  3AJ5 A;  5EHA A;  3V79 C;  1YXW A;  4F34 A;  3CA0 A;  1R8O A;  1BFB A;  3BRD A;  2HWM A;  5F8S A;  4EFQ A;  5G00 A;  4CJM A;  3UJ0 A;  4D0T A;  1ILR 1;  4OEG A;  4QKS A;  2BEA A;  3ZC9 A;  2YUG A;  1Q04 A;  1EYL A;  1JY0 A;  4P0L A;  1MD6 A;  3VT0 A;  5BP5 C;  1BLA A;  1HWO B;  3V0A B;  3OBR A;  2QN4 A;  1FV2 A;  3WO2 A;  2KKI A;  1IHK A;  2HWA A;  1I1E A;  1V6W A;  3FJJ A;  1QQK A;  4LO0 A;  2RG9 B;  3UD7 A;  2D23 A;  1HCE A;  2Z48 A;  1T4Q A;  4IZX A;  1R8N A;  6I1B A;  3WMU A;  2R9K B;  3D7W B;  3IM7 A;  4LO2 A;  2F8X C;  2K8R A;  21BI A;  4HA2 A;  1JLX A;  3QYD A;  3BAG A;  2X2T A;  4I1E A;  1S0L A;  1PUU B;  5BQU C;  3O4B A;  4LO1 C;  4D0Z A;  4QBC A;  3FGM A;  1Z2V A;  1QXM A;  2RST A;  4Q9G A;  4I4S A;  4ZBV B;  4P0K A;  3CRG A;  5BQU A;  1FGA A;  1PUM B;  1Z0H A;  3ZXG A;  4HR6 C;  2FO1 A;  4IYB A;  3AKF A;  2VLC A;  1UPS A;  2M49 A;  4DEN A;  3CA3 A;  1TWM A;  2ET2 A;  4G1R A;  4ZOT A;  5FZU A;  3BA5 A;  3H6R B;  2VUA A;  3BX1 C;  2D44 A;  2NM1 A;  3BRG C;  3S8J A;  4IY9 A;  5EC5 A;  2RQ9 A;  1N4K A;  1WBA A;  3QR5 A;  2NP0 A;  4QKR A;  31BI A;  4Q9P A;  3I2A A;  3FJD A;  5F90 A;  2D7R A;  5D61 A;  4X39 A;  4Z9W B;  2VSA A;  3AZV A;  1QQL A;  5BXP A;  3BAU A;  1HCD A;  2Q9X A;  1FQ9 A;  1D0H A;  1G9D A;  4X38 A;  4OW4 A;  1ABR B;  2D24 A;  1AXM A;  3FJA A;  1VCL A;  3KMV A;  4A7Y A;  2MC2 A;  1CVS A;  2XOA A;  3H6Q A;  4I0Y A;  1JT3 A;  3HOM A;  4USP A;  1AVA C;  2WRY A;  3A21 A;  3EF2 A;  3FJE A;  3O4D A;  4OEF A;  3AKI A;  2VXT I;  4PC4 A;  4FGF A;  1DJS B;  4JAW A;  4I8M A;  1DIW A;  4LO7 B;  2DRE A;  3H6S E;  1SR4 C;  2D7I A;  1FWU A;  1ISW A;  2P23 A;  1ISY A;  4ION A;  4I4Q A;  4OEE A;  2Z49 A;  2L5X A;  1ISZ A;  4I3N A;  1II4 A;  4AN6 A;  3O3Q A;  4I1B A;  3AKH A;  1S0B A;  2E4M C;  2Y9F A;  3IM6 A;  3AH2 A;  2Y9G A;  4GAI A;  3H6R A;  3PUB A;  4JPZ A;  1T9F A;  2ESU A;  4GAF A;  2WBC A;  3VSF A;  4JKX B;  4WBC A;  4FVV A;  3VSZ A;  1G9A A;  1YF8 B;  3O44 A;  3BRF A;  1FWV A;  4A7Z A;  1IT0 A;  4ZKT B;  3NBC A;  1DFQ A;  1BAS A;  3AKG A;  3NJ5 A;  2IHO A;  1DZC A;  3UD8 A;  1S0G A;  5DUY A;  5FNW A;  3LLP A;  3VWC A;  1TFM B;  3I29 B;  4QO3 A;  2KLL A;  1RG8 A;  4G6J A;  3V0B B;  1S0C A;  1TWE A;  3FJ8 A;  3K1X A;  2KI6 B;  1SZ6 B;  1DZD A;  3R4U A;  5DVH A;  2DRZ A;  5BP5 A;  1FV3 A;  1FMM S;  1W3G A;  4LO7 C;  1AVX B;  8I1B A;  5JMC A;  3WMV A;  4I37 A;  5BOW A;  4KBB A;  4EEE B;  1BFF A;  3P6J A;  3IIR A;  4USO A;  2IWT B;  1K5V A;  4L4H A;  4EFR A;  2NYY A;  3A22 A;  1TOO A;  3ZX7 A;  2BEB A;  3NBD A;  2I1B A;  1XZZ A;  3PME A;  4LO1 A;  2NTD A;  3N7L A;  4Q91 A;  1YYN A;  2FGF A;  5FNX A;  3HMY A;  3BB2 A;  1AFC A;  2ERM A;  3WA1 A;  1NUN A;  2K4A B;  5E24 E;  2KH2 A;  3HSM A;  4QAL A;  1G9B A;  4J23 B;  2F2F C;  2FFU A;  1P63 A;  3BTA A;  3N7J A;  5FZY A;  3WIN C;  5BXT A;  1HKN A;  1EVT A;  5B2H A;  3CA6 A;  4H04 A;  4ZA3 B;  4G9M A;  3BA4 A;  3FUO A;  1Q03 A;  1IIL A;  2NZ9 A;  3R4S A;  1EPW A;  2NVH A;  4I4O A;  3V0A A;  4DEP A;  3JRR A;  2VSE A;  4P6A A;  1G9C A;  1JT5 A;  4J2K A;  1K5U A;  3FJI A;  4GP0 A;  4HJJ A;  1EV2 A;  2P39 A;  4XFT A;  3CAH A;  4QC4 A;  1AVW B;  2AAI B;  3FJK A;  3JUT A;  3PHZ A;  7I1B A;  1XHB A;  2K43 A;  3F1R A;  4IQP A;  4OWJ A;  1W3A A;  2D22 A;  1Z4S A;  3W9T A;  3VT1 A;  4I6I A;  3N7M A;  3WO3 A;  3E8L C;  2D43 A;  3OGF A;  5F8W A;  1PWA A;  4ISR A;  1W3F A;  3AH1 A;  1GGP B;  3AJ6 A;  1PC8 B;  3A23 A;  4OUJ A;  1BFG A;  2AXM A;  2AFG A;  4XFU A;  1DQO A;  4Z8S B; 
#chains in the Genus database with same CATH topology
 3BAH A;  3HAL A;  3SNV A;  4EFP A;  3RTI B;  3NBE A;  1SR4 A;  1WD4 A;  4OWL A;  5D63 A;  1AF9 A;  3TC2 A;  3FJC A;  4ZFY B;  1Q1U A;  3F62 B;  3FJH A;  3Q7Y A;  4UY4 A;  3BAQ A;  5HPZ A;  3UD9 A;  2UUS A;  4XFS A;  4IHZ A;  2E4M A;  4I96 A;  4EKX B;  3CU1 B;  3O4C A;  4A7K A;  4KEK A;  1F31 A;  1ITB A;  3OJ2 A;  3NBN A;  5DSS B;  1HWM B;  3OGG A;  1JT4 A;  1WD3 A;  1HWP B;  4L4I A;  3WO4 A;  4EB2 B;  3Q7W A;  3N0K A;  3RMY A;  4ISQ A;  4G9N A;  4ZLB B;  1IOB A;  3A07 A;  4JQ0 A;  3POK A;  1BAR A;  3AH4 A;  1L2H A;  2MLL B;  1DLL A;  4F83 A;  2D20 A;  4I4P A;  1XYF A;  5I1B A;  3RMX A;  1XG6 A;  3O5W B;  1S0D A;  4AN7 B;  3CRI A;  1KNM A;  3FJ9 A;  3ILA A;  4I4Y A;  4IZE A;  1HWN B;  2DS0 A;  4X3A A;  1BFC A;  1RY7 A;  4MZH A;  1DFC A;  4LO0 C;  3Q7X A;  3LTQ A;  4G6M A;  4J2X A;  1V6V A;  1TP0 A;  3BAV A;  3ZXD A;  3VT2 A;  3IAG C;  1A8D A;  3CA4 A;  4LO2 C;  2HZ9 A;  3B9U A;  1PZZ A;  1BA7 A;  5FZZ A;  1DQG A;  3N7K A;  1S0F A;  4JP0 A;  2Q3N B;  2ZQN A;  4JRA A;  4JKQ A;  3BAO A;  4DCK C;  1HIB A;  1MC9 A;  1NZK A;  3P53 A;  2GZB A;  2DRY A;  4QD2 B;  4TLP A;  4KEI A;  1RZO B;  1CE7 B;  2MIB A;  3MAL A;  4I4V A;  2GO2 A;  2J3P A;  3S8K A;  4GOV A;  3RSJ A;  2AQZ A;  1S0E A;  4R6U B;  5BVP I;  3MPP G;  2FFV A;  4KEJ A;  5JLV A;  3OJV A;  4LO8 B;  4END A;  2D1Z A;  3VUO A;  1M2T B;  2ZQO A;  3FUQ A;  2F2F A;  4IY8 A;  3UDA A;  3OBT A;  3WIN A;  3CA1 A;  4YOL A;  1JLY A;  3FFZ A;  9ILB A;  3V0B A;  2FDB M;  1G82 A;  2Y9W C;  1AVU A;  3ZC8 A;  1FN0 A;  4KC3 A;  1RML A;  2ZR1 B;  3BAD A;  5GAQ A;  1OQL B;  1YTO A;  5F8Y A;  1IRA X;  3O4O A;  4I2S A;  5DZU A;  1ONK B;  4P0J A;  1YBI A;  2VU9 A;  5BXS A;  4I4U A;  4LO3 C;  2HW9 A;  4J2S A;  4X37 A;  1JT7 A;  3IM5 A;  1IRP A;  5D62 A;  4OWK A;  1I1B A;  1J0S A;  4QD2 C;  2BFH A;  3CRH A;  3O4A A;  2KI4 A;  4ZFU B;  4LO3 A;  2LIE A;  3C9Z A;  4J2Y A;  41BI A;  1IJT A;  1JTC A;  2X2S A;  3O49 A;  4D8H A;  4ZGR B;  1ISV A;  3VEQ A;  1BLD A;  3HBW A;  1WBC A;  4ZFW B;  1M16 A;  4I4X A;  1JQZ A;  3PG0 A;  4I7I A;  4I4R A;  1V6U A;  1ISX A;  1TIE A;  2QYI B;  3AZW A;  4GP3 A;  2Y9X E;  1TTU A;  4H9W A;  3BA7 A;  3FJB A;  3I2X A;  2VXR A;  3T8S A;  5EG6 C;  3OJM A;  1E0O A;  3FJF A;  3CQA A;  4GOY A;  3CA5 A;  3RTJ B;  1V6X A;  4II0 A;  3P6I A;  2LIQ A;  3UJ4 A;  4QBV A;  5BXR A;  3HN1 A;  4XKI A;  1FMZ A;  3AJ5 A;  5EHA A;  4H75 A;  3V79 C;  1YXW A;  2NS2 A;  4F34 A;  3CA0 A;  1R8O A;  1BFB A;  3BRD A;  2HWM A;  5F8S A;  4EFQ A;  5G00 A;  4CJM A;  3UJ0 A;  4D0T A;  1ILR 1;  4OEG A;  4QKS A;  2BEA A;  3ZC9 A;  2YUG A;  1Q04 A;  1EYL A;  1JY0 A;  4P0L A;  1MD6 A;  3VT0 A;  5BP5 C;  1BLA A;  1HWO B;  3V0A B;  3OBR A;  2QN4 A;  1FV2 A;  3WO2 A;  2KKI A;  1IHK A;  2HWA A;  1I1E A;  1V6W A;  3FJJ A;  1QQK A;  4LO0 A;  2RG9 B;  3UD7 A;  2D23 A;  1HCE A;  2Z48 A;  1T4Q A;  4IZX A;  1R8N A;  6I1B A;  3WMU A;  2R9K B;  3D7W B;  3IM7 A;  4LO2 A;  2F8X C;  2K8R A;  21BI A;  4HA2 A;  1JLX A;  3QYD A;  3BAG A;  2X2T A;  4I1E A;  1S0L A;  1PUU B;  5BQU C;  3O4B A;  4LO1 C;  4D0Z A;  4QBC A;  3FGM A;  1Z2V A;  1QXM A;  2RST A;  4Q9G A;  4I4S A;  4ZBV B;  4P0K A;  3CRG A;  5BQU A;  1FGA A;  1PUM B;  1Z0H A;  3ZXG A;  4HR6 C;  2FO1 A;  4IYB A;  3AKF A;  2VLC A;  1UPS A;  2M49 A;  4DEN A;  3CA3 A;  1TWM A;  2ET2 A;  4G1R A;  4ZOT A;  5FZU A;  3BA5 A;  3H6R B;  2VUA A;  3BX1 C;  2D44 A;  2NM1 A;  3BRG C;  3S8J A;  4IY9 A;  5EC5 A;  2RQ9 A;  1N4K A;  1WBA A;  3QR5 A;  2NP0 A;  4QKR A;  31BI A;  4Q9P A;  3I2A A;  3FJD A;  5F90 A;  2D7R A;  5D61 A;  4X39 A;  4Z9W B;  2VSA A;  3AZV A;  1QQL A;  5BXP A;  3BAU A;  1HCD A;  2Q9X A;  1FQ9 A;  1D0H A;  1G9D A;  4X38 A;  4OW4 A;  1ABR B;  2D24 A;  1AXM A;  3FJA A;  1VCL A;  3KMV A;  4A7Y A;  2MC2 A;  1CVS A;  2XOA A;  3H6Q A;  4I0Y A;  1JT3 A;  3HOM A;  4USP A;  1AVA C;  2WRY A;  3A21 A;  3EF2 A;  3FJE A;  3O4D A;  4OEF A;  3AKI A;  2VXT I;  4PC4 A;  4FGF A;  1DJS B;  4JAW A;  4I8M A;  1DIW A;  4LO7 B;  2DRE A;  3H6S E;  1SR4 C;  2D7I A;  1FWU A;  1ISW A;  2P23 A;  1ISY A;  4ION A;  4I4Q A;  4OEE A;  2Z49 A;  2L5X A;  1ISZ A;  4I3N A;  1II4 A;  4AN6 A;  3O3Q A;  4I1B A;  3AKH A;  1S0B A;  2E4M C;  2Y9F A;  3IM6 A;  3AH2 A;  2Y9G A;  4GAI A;  3H6R A;  3PUB A;  4JPZ A;  1T9F A;  2ESU A;  4GAF A;  2WBC A;  3VSF A;  4JKX B;  4WBC A;  4FVV A;  3VSZ A;  1G9A A;  1YF8 B;  3O44 A;  3BRF A;  1FWV A;  4A7Z A;  1IT0 A;  4ZKT B;  3NBC A;  1DFQ A;  1BAS A;  3AKG A;  3NJ5 A;  2IHO A;  1DZC A;  3UD8 A;  1S0G A;  5DUY A;  5FNW A;  4MZG B;  3LLP A;  3VWC A;  1TFM B;  3I29 B;  4QO3 A;  2KLL A;  1RG8 A;  4G6J A;  3V0B B;  1S0C A;  1TWE A;  3FJ8 A;  3K1X A;  2KI6 B;  1SZ6 B;  1DZD A;  3R4U A;  5DVH A;  2DRZ A;  5BP5 A;  1FV3 A;  1FMM S;  1W3G A;  4LO7 C;  1AVX B;  8I1B A;  5JMC A;  3WMV A;  4I37 A;  5BOW A;  4KBB A;  4EEE B;  1BFF A;  3P6J A;  3IIR A;  4USO A;  2IWT B;  1K5V A;  4L4H A;  4EFR A;  2NYY A;  3A22 A;  1TOO A;  3ZX7 A;  2BEB A;  3NBD A;  2I1B A;  1XZZ A;  3PME A;  4LO1 A;  2NTD A;  3N7L A;  4Q91 A;  1YYN A;  2FGF A;  5FNX A;  3HMY A;  3BB2 A;  1AFC A;  2ERM A;  3WA1 A;  1NUN A;  2K4A B;  5E24 E;  2KH2 A;  3HSM A;  4QAL A;  1G9B A;  4J23 B;  2F2F C;  2FFU A;  1P63 A;  3BTA A;  3N7J A;  5FZY A;  3WIN C;  5BXT A;  1HKN A;  1EVT A;  5B2H A;  4MZF B;  3CA6 A;  4H04 A;  4ZA3 B;  4G9M A;  3BA4 A;  3FUO A;  1Q03 A;  1IIL A;  2NZ9 A;  3R4S A;  1EPW A;  2NVH A;  4I4O A;  3V0A A;  4DEP A;  3JRR A;  2VSE A;  4P6A A;  1G9C A;  1JT5 A;  4J2K A;  1K5U A;  3FJI A;  4GP0 A;  4HJJ A;  1EV2 A;  2P39 A;  4XFT A;  3CAH A;  4QC4 A;  1AVW B;  2AAI B;  3FJK A;  3JUT A;  3PHZ A;  7I1B A;  1XHB A;  2K43 A;  3F1R A;  4IQP A;  4OWJ A;  1W3A A;  2D22 A;  1Z4S A;  3W9T A;  3VT1 A;  4I6I A;  3N7M A;  3WO3 A;  3E8L C;  2D43 A;  3OGF A;  5F8W A;  1PWA A;  4ISR A;  1W3F A;  3AH1 A;  1GGP B;  3AJ6 A;  1PC8 B;  3A23 A;  4OUJ A;  1BFG A;  2AXM A;  2AFG A;  4XFU A;  1DQO A;  4Z8S B; 
#chains in the Genus database with same CATH homology
 3BAH A;  3HAL A;  3SNV A;  4EFP A;  3RTI B;  3NBE A;  1SR4 A;  1WD4 A;  4OWL A;  5D63 A;  1AF9 A;  3TC2 A;  3FJC A;  4ZFY B;  1Q1U A;  3F62 B;  3FJH A;  3Q7Y A;  4UY4 A;  3BAQ A;  5HPZ A;  3UD9 A;  2UUS A;  4XFS A;  4IHZ A;  2E4M A;  4I96 A;  4EKX B;  3CU1 B;  3O4C A;  4A7K A;  4KEK A;  1F31 A;  1ITB A;  3OJ2 A;  3NBN A;  5DSS B;  1HWM B;  3OGG A;  1JT4 A;  1WD3 A;  1HWP B;  4L4I A;  3WO4 A;  4EB2 B;  3Q7W A;  3N0K A;  3RMY A;  4ISQ A;  4G9N A;  4ZLB B;  1IOB A;  3A07 A;  4JQ0 A;  3POK A;  1BAR A;  3AH4 A;  1L2H A;  2MLL B;  1DLL A;  4F83 A;  2D20 A;  4I4P A;  1XYF A;  5I1B A;  3RMX A;  1XG6 A;  3O5W B;  1S0D A;  4AN7 B;  3CRI A;  1KNM A;  3FJ9 A;  3ILA A;  4I4Y A;  4IZE A;  1HWN B;  2DS0 A;  4X3A A;  1BFC A;  1RY7 A;  4MZH A;  1DFC A;  4LO0 C;  3Q7X A;  3LTQ A;  4G6M A;  4J2X A;  1V6V A;  1TP0 A;  3BAV A;  3ZXD A;  3VT2 A;  3IAG C;  1A8D A;  3CA4 A;  4LO2 C;  2HZ9 A;  3B9U A;  1PZZ A;  1BA7 A;  5FZZ A;  1DQG A;  3N7K A;  1S0F A;  4JP0 A;  2Q3N B;  2ZQN A;  4JRA A;  4JKQ A;  3BAO A;  4DCK C;  1HIB A;  1MC9 A;  1NZK A;  3P53 A;  2GZB A;  2DRY A;  4QD2 B;  4TLP A;  4KEI A;  1RZO B;  1CE7 B;  2MIB A;  3MAL A;  4I4V A;  2GO2 A;  2J3P A;  3S8K A;  4GOV A;  3RSJ A;  2AQZ A;  1S0E A;  4R6U B;  5BVP I;  3MPP G;  2FFV A;  4KEJ A;  5JLV A;  3OJV A;  4LO8 B;  4END A;  2D1Z A;  3VUO A;  1M2T B;  2ZQO A;  3FUQ A;  2F2F A;  4IY8 A;  3UDA A;  3OBT A;  3WIN A;  3CA1 A;  4YOL A;  1JLY A;  3FFZ A;  9ILB A;  3V0B A;  2FDB M;  1G82 A;  2Y9W C;  1AVU A;  3ZC8 A;  1FN0 A;  4KC3 A;  1RML A;  2ZR1 B;  3BAD A;  5GAQ A;  1OQL B;  1YTO A;  5F8Y A;  1IRA X;  3O4O A;  4I2S A;  5DZU A;  1ONK B;  4P0J A;  1YBI A;  2VU9 A;  5BXS A;  4I4U A;  4LO3 C;  2HW9 A;  4J2S A;  4X37 A;  1JT7 A;  3IM5 A;  1IRP A;  5D62 A;  4OWK A;  1I1B A;  1J0S A;  4QD2 C;  2BFH A;  3CRH A;  3O4A A;  2KI4 A;  4ZFU B;  4LO3 A;  2LIE A;  3C9Z A;  4J2Y A;  41BI A;  1IJT A;  1JTC A;  2X2S A;  3O49 A;  4D8H A;  4ZGR B;  1ISV A;  3VEQ A;  1BLD A;  3HBW A;  1WBC A;  4ZFW B;  1M16 A;  4I4X A;  1JQZ A;  3PG0 A;  4I7I A;  4I4R A;  1V6U A;  1ISX A;  1TIE A;  2QYI B;  3AZW A;  4GP3 A;  2Y9X E;  1TTU A;  4H9W A;  3BA7 A;  3FJB A;  3I2X A;  2VXR A;  3T8S A;  5EG6 C;  3OJM A;  1E0O A;  3FJF A;  3CQA A;  4GOY A;  3CA5 A;  3RTJ B;  1V6X A;  4II0 A;  3P6I A;  2LIQ A;  3UJ4 A;  4QBV A;  5BXR A;  3HN1 A;  4XKI A;  1FMZ A;  3AJ5 A;  5EHA A;  4H75 A;  3V79 C;  1YXW A;  2NS2 A;  4F34 A;  3CA0 A;  1R8O A;  1BFB A;  3BRD A;  2HWM A;  5F8S A;  4EFQ A;  5G00 A;  4CJM A;  3UJ0 A;  4D0T A;  1ILR 1;  4OEG A;  4QKS A;  2BEA A;  3ZC9 A;  2YUG A;  1Q04 A;  1EYL A;  1JY0 A;  4P0L A;  1MD6 A;  3VT0 A;  5BP5 C;  1BLA A;  1HWO B;  3V0A B;  3OBR A;  2QN4 A;  1FV2 A;  3WO2 A;  2KKI A;  1IHK A;  2HWA A;  1I1E A;  1V6W A;  3FJJ A;  1QQK A;  4LO0 A;  2RG9 B;  3UD7 A;  2D23 A;  1HCE A;  2Z48 A;  1T4Q A;  4IZX A;  1R8N A;  6I1B A;  3WMU A;  2R9K B;  3D7W B;  3IM7 A;  4LO2 A;  2F8X C;  2K8R A;  21BI A;  4HA2 A;  1JLX A;  3QYD A;  3BAG A;  2X2T A;  4I1E A;  1S0L A;  1PUU B;  5BQU C;  3O4B A;  4LO1 C;  4D0Z A;  4QBC A;  3FGM A;  1Z2V A;  1QXM A;  2RST A;  4Q9G A;  4I4S A;  4ZBV B;  4P0K A;  3CRG A;  5BQU A;  1FGA A;  1PUM B;  1Z0H A;  3ZXG A;  4HR6 C;  2FO1 A;  4IYB A;  3AKF A;  2VLC A;  1UPS A;  2M49 A;  4DEN A;  3CA3 A;  1TWM A;  2ET2 A;  4G1R A;  4ZOT A;  5FZU A;  3BA5 A;  3H6R B;  2VUA A;  3BX1 C;  2D44 A;  2NM1 A;  3BRG C;  3S8J A;  4IY9 A;  5EC5 A;  2RQ9 A;  1N4K A;  1WBA A;  3QR5 A;  2NP0 A;  4QKR A;  31BI A;  4Q9P A;  3I2A A;  3FJD A;  5F90 A;  2D7R A;  5D61 A;  4X39 A;  4Z9W B;  2VSA A;  3AZV A;  1QQL A;  5BXP A;  3BAU A;  1HCD A;  2Q9X A;  1FQ9 A;  1D0H A;  1G9D A;  4X38 A;  4OW4 A;  1ABR B;  2D24 A;  1AXM A;  3FJA A;  1VCL A;  3KMV A;  4A7Y A;  2MC2 A;  1CVS A;  2XOA A;  3H6Q A;  4I0Y A;  1JT3 A;  3HOM A;  4USP A;  1AVA C;  2WRY A;  3A21 A;  3EF2 A;  3FJE A;  3O4D A;  4OEF A;  3AKI A;  2VXT I;  4PC4 A;  4FGF A;  1DJS B;  4JAW A;  4I8M A;  1DIW A;  4LO7 B;  2DRE A;  3H6S E;  1SR4 C;  2D7I A;  1FWU A;  1ISW A;  2P23 A;  1ISY A;  4ION A;  4I4Q A;  4OEE A;  2Z49 A;  2L5X A;  1ISZ A;  4I3N A;  1II4 A;  4AN6 A;  3O3Q A;  4I1B A;  3AKH A;  1S0B A;  2E4M C;  2Y9F A;  3IM6 A;  3AH2 A;  2Y9G A;  4GAI A;  3H6R A;  3PUB A;  4JPZ A;  1T9F A;  2ESU A;  4GAF A;  2WBC A;  3VSF A;  4JKX B;  4WBC A;  4FVV A;  3VSZ A;  1G9A A;  1YF8 B;  3O44 A;  3BRF A;  1FWV A;  4A7Z A;  1IT0 A;  4ZKT B;  3NBC A;  1DFQ A;  1BAS A;  3AKG A;  3NJ5 A;  2IHO A;  1DZC A;  3UD8 A;  1S0G A;  5DUY A;  5FNW A;  4MZG B;  3LLP A;  3VWC A;  1TFM B;  3I29 B;  4QO3 A;  2KLL A;  1RG8 A;  4G6J A;  3V0B B;  1S0C A;  1TWE A;  3FJ8 A;  3K1X A;  2KI6 B;  1SZ6 B;  1DZD A;  3R4U A;  5DVH A;  2DRZ A;  5BP5 A;  1FV3 A;  1FMM S;  1W3G A;  4LO7 C;  1AVX B;  8I1B A;  5JMC A;  3WMV A;  4I37 A;  5BOW A;  4KBB A;  4EEE B;  1BFF A;  3P6J A;  3IIR A;  4USO A;  2IWT B;  1K5V A;  4L4H A;  4EFR A;  2NYY A;  3A22 A;  1TOO A;  3ZX7 A;  2BEB A;  3NBD A;  2I1B A;  1XZZ A;  3PME A;  4LO1 A;  2NTD A;  3N7L A;  4Q91 A;  1YYN A;  2FGF A;  5FNX A;  3HMY A;  3BB2 A;  1AFC A;  2ERM A;  3WA1 A;  1NUN A;  2K4A B;  5E24 E;  2KH2 A;  3HSM A;  4QAL A;  1G9B A;  4J23 B;  2F2F C;  2FFU A;  1P63 A;  3BTA A;  3N7J A;  5FZY A;  3WIN C;  5BXT A;  1HKN A;  1EVT A;  5B2H A;  4MZF B;  3CA6 A;  4H04 A;  4ZA3 B;  4G9M A;  3BA4 A;  3FUO A;  1Q03 A;  1IIL A;  2NZ9 A;  3R4S A;  1EPW A;  2NVH A;  4I4O A;  3V0A A;  4DEP A;  3JRR A;  2VSE A;  4P6A A;  1G9C A;  1JT5 A;  4J2K A;  1K5U A;  3FJI A;  4GP0 A;  4HJJ A;  1EV2 A;  2P39 A;  4XFT A;  3CAH A;  4QC4 A;  1AVW B;  2AAI B;  3FJK A;  3JUT A;  3PHZ A;  7I1B A;  1XHB A;  2K43 A;  3F1R A;  4IQP A;  4OWJ A;  1W3A A;  2D22 A;  1Z4S A;  3W9T A;  3VT1 A;  4I6I A;  3N7M A;  3WO3 A;  3E8L C;  2D43 A;  3OGF A;  5F8W A;  1PWA A;  4ISR A;  1W3F A;  3AH1 A;  1GGP B;  3AJ6 A;  1PC8 B;  3A23 A;  4OUJ A;  1BFG A;  2AXM A;  2AFG A;  4XFU A;  1DQO A;  4Z8S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...