2BFMA

Leishmania major pteridine reductase 1 in complex with nadp and trimethoprim
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
283
structure length
266
Chain Sequence
b'VPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRGDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structures of Leishmania Major Pteridine Reductase Complexes Reveal the Active Site Features Important for Ligand Binding and to Guide Inhibitor Design
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 99
structure length 266
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bfmA00
5BSFA 1KVSA 4RVSA 5KVVA 3AK4A 4K6CA 1D8AA 1DB3A 1DJNA 1CDOA 3MOIA 3Q1LA 4IJUA 2BI7A 4RVDA 4DLAA 4IINA 3QVSA 1QV7A 1HYHA 2G5CA 3L6OO 4XKJA 3OQ1A 2GN9A 2FR0A 3I9OA 3ST7A 2J8ZA 5CFZA 1GYPA 3MTGA 3QV1A 2UDPA 3D64A 3WDSA 4DBVO 4DRYA 4HP8A 4CMGA 1U3VA 3OSUA 2NLOA 4Q3AA 3RC1A 3V1UA 1V0JA 1KS9A 1W73A 4WK6A 4II3A 1K0UA 3TQHA 3WOHA 5TLSA 4DC1A 4GWKA 5CDGA 3IKTA 4DQUA 4L4RA 1QR6A 3ZNQA 5JXWA 2H1SA 1IULA 4NBVA 4DQXA 1LDYA 4F46A 3K96A 3JCZA 5ILGA 2D4AA 5A5FA 3RFXA 1MGOA 4BO6A 3QWHA 2IXBA 5JY1A 5EMHA 2ET6A 4U5QA 2IE0A 1AXEA 3ASUA 1PZHA 3RUCA 1ISJA 3H9UA 4CUJA 3OA0A 5B4TA 1HYGA 5ER9A 2X5KO 2I3GA 4EGFA 1MB4A 4ZQHA 1ZEJA 4BUCA 5J23A 4IM7A 5KJFA 2C07A 3BTOA 3ETEA 1JU9A 1QKIA 2YW9A 2AQ8A 3RJ5A 3OFSA 2IZ0A 5T8KA 2QQ5A 4A73A 2X8LA 1SEVA 2IRWA 3CH6A 2HK9A 1Z74A 4TKMA 1LU9A 1N7HA 1S6YA 3ROMA 2FPIA 2I6TA 4YJHB 4NU6A 1G0NA 1SOWA 2RAFA 2D1YA 1ZXBA 4E30A 2AEFA 1BXGB 3GFGA 3KXDA 4FW8A 3OECA 4IXTA 4NJMB 4YJHA 3OIDA 4CMJA 1BXGA 4NJMA 2P4HX 4E5MA 4D0SA 1LC3A 5FEUA 3CXRA 3D7LA 3S2IA 1OMOA 3ZWCA 3QQPA 2AMFA 1T24A 3E9NA 3RFTA 3HN2A 5BNFA 3HDHA 3KEQA 2BGMA 2UUPA 2DT5A 3PJDA 3F3SA 5C7LO 2P5UA 4B7CA 2WD7B 2F1KA 5KOIA 1B14A 3C1TA 4F6LA 2Q4BA 4RF4A 4KUHA 2WD7A 2FPPA 3JYNA 4J1TA 1B8VA 1GYQA 5COBA 3F4BA 1H6BA 4PRKA 1U5CA 4E5PA 4BMNA 1LRKA 1E7MA 3LF2A 4UREA 5FYDA 4EUHA 3H9QA 2H63A 3BMQB 3JQ8B 4E2YA 5BSEA 3EY4A 3BMQA 3DBRA 3DBLB 5H82A 4AJPA 1GU7A 3Q6IA 4P38A 3KLMX 3VTZA 1V9LA 1HZZA 1PJCA 1OC2A 3BTSA 2DKNA 5AXDA 3EAGA 4MP8A 1J4AA 1T2FA 1A27A 3R3SA 1QYWA 5TNXA 1B0AA 4YAEA 3N58A 4BNXA 3C7CB 5ENDA 2Q46A 2B4TO 2IZZA 1BVUA 2IYOA 3GVIA 2BGLA 5FI3A 4PFJA 3I52A 3ZWBA 3EMKA 4B3HA 1EBUA 5CHEA 4RF3A 3H6KA 4DMMA 3PIDA 1AE1A 1PL6A 3PZRA 4KUGA 1OZAA 1LLCA 3MWDB 4MIEA 3NTRA 3UH1A 4Q39A 3AU8A 4J0FA 4L74A 5ITWA 1MC4A 3INGA 3F5SA 3ONDA 2GYYA 1F06A 1C0KA 1Z45A 3RAJA 4O5OA 4CJXA 4NZ9A 2YFQA 2PV7A 5MDHA 4KDEA 1SBYA 2ZYGA 3H7AA 1RWBA 4Q3CA 2PGDA 2ZYAA 4TWRA 2EWMA 5ITVA 1PJLA 3EHEA 5L95A 1PQPA 4FJ1A 2PKQO 2JFHA 2PWZA 3NT4A 4I9UA 5IG2A 5EINA 1HXHA 2B36A 2AEMA 4N5NA 4NPCA 2YJZA 1WDMA 4WLEA 1BG6A 1ZKMA 3SEFA 1LQUA 4ZGWA 3OHSX 1JWBB 1TA4A 3HUDA 2WYUA 3OJ0A 1ZO8A 1QP8A 4XYGA 4E0BA 1UXJA 5HWSA 4MVJA 3ZI0A 3DTYA 2IEDA 1K6XA 3U9LA 4R9RA 3UGKA 4Y8VA 4NQZA 2X0RA 2ZKLA 3TSCA 2W2KB 1BSVA 3UCFA 1HSZA 2W8ZA 4RVFA 3U09A 1DBVO 3HE3A 3VC7A 3VZQA 2W2KA 4H15A 2FN7A 1Z7EA 1KERA 5JO0A 4PLYA 5B12A 4YAKA 1LC0A 3OJEA 4BNFA 3PJEA 3RCBA 5IN4A 1P3DA 2VN8A 3BMOB 5ADHA 5ICSA 1HLDA 2NM0A 4XZ3A 2XXJA 3BMOA 1U3TA 2X0JA 4IZHA 4ZN6A 4NFYA 1WDLA 1HF3A 3QW2A 1B2LA 3E82A 1BDBA 3BXXA 3C1OA 4GLOA 3PWSA 4TRJA 4DA9A 3GVXA 4NBUA 1M66A 3VH1A 1O9BA 4PLGA 4M89A 2NTNA 3ROKA 1YL7A 7ADHA 3BIOA 1Q0HA 3ANLA 3BA1A 3AI1A 4IQ8A 4FN4A 4LCEA 2C2XA 4TKLA 2X1HA 3IOYA 4U6QA 5KVSA 1QYVA 1IHYA 3ZU5A 2Y05A 4IQGA 1ENPA 4IJVA 3DL2A 3R6DA 3AY6A 5DBIA 4EZBA 3HADA 1DIRA 4JGBA 3AOGA 2A4KA 1HE4A 3ENNA 1TEHA 2O7SA 3ICPA 3SJ7A 2DBVO 5A9TA 2JCYA 2JD1A 4UUNA 1LDNA 3CUKA 4BNTA 1QSGA 1J5PA 4PLWA 1GR0A 2JFGA 2O23A 3O38A 3S2FA 1YBVA 1UXGA 4YXFA 4CLOB 5B37A 1E3SA 4JJIA 4RF5A 4O63O 2RCYA 2O2SA 3WJAA 4UUMA 4CQLA 1XCBA 5HA5A 3SC6A 1R0LA 4D43A 4CLOA 2NVWA 4EEZA 2C5AA 4C7JA 4WLUA 3SVTA 4N54A 3QA9A 3SJUA 3PHGA 3LC1O 1K3TA 1KEUA 1YO6A 1HE3A 1ZJYA 4U6SA 3ZHYA 3TRIA 3P5SA 3S55A 3RBVA 1M6HA 4B79A 2GGSA 4M55A 4OKNA 3ZWVA 4C7KA 4BGUA 5DDIP 3DHNA 4B3IA 2YQ4A 2JHFA 1NHGA 4RPKA 4RQTA 4U8GA 2C59A 3W4KA 2PGJA 3IUPA 5A9SA 3GMSA 3GGOA 1N1EA 4URFA 5CG2A 4L4XA 2QRKA 3VPSA 4O1MA 4FOSA 1I5RA 4A27A 4CUKA 3B6ZA 3KB6A 2DVMA 3JD1A 4J91A 2B37A 3PYXA 4CMKA 4EBFA 5DCWA 3PGJA 4FFPA 3M1LA 1GQ2A 1IE3A 3ZHXA 5THQA 2EW8A 4CMIB 5DOZA 2GLXA 2I65A 1E3JA 1I0ZA 3GHHA 4CMIA 2QW8A 1MV8A 3MCVA 5A5EA 3VAZA 2OGUA 4O0LA 2P9CA 4J16A 1LJ8A 4BMSA 3KHUA 4L9RA 3MEQA 3WYBA 4UEJA 2DPHA 4BNNA 2VHXA 4OKIA 1GDHA 2FSVA 4OOEA 6LDHA 1B3BA 1MP0A 2D3TA 1PWXA 2I76A 3D3EA 3MOGA 3COSA 3S1LA 4Z0PA 2POQX 2W2LD 3M1AA 5I8ZA 3I3OA 3WGQA 4RO0A 1C0IA 2DM6A 2O3JA 3WX0A 4QEDA 1I2ZA 1GCUA 3AW9A 2GZ3A 4J90A 1B3RA 4YB8A 3Q9UA 3KSUA 1NPYA 1ID1A 2BMAA 3DONA 3H9EO 1EE2A 4R54A 1A4UA 1K6IA 1LDMA 3OF2A 1T4BA 1XU9A 4FIZA 1PWZA 4ALMA 2BKAA 2HMSA 2FPGA 4CMAA 3HDYA 5A1TA 1ZZEA 5KCZA 1E7QA 3O4RA 1I2CA 1NPTO 3I9NA 2O48X 2ZB4A 3EC7A 3WGYA 4DREA 2FP4A 4M87A 3AWDA 4D79A 2YUTA 4B8ZA 1U7TA 3VKUA 4JLWA 3GNSA 4PIVA 5EJ2A 1KVUA 3LDHA 1R4NB 2Y1OA 2VT2A 3HWRA 2NSDA 4L76A 2NVUB 1I3MA 1H6CA 1ISFA 1LBEA 1Y9AA 3FHLA 3LYLA 2ZTVA 2NVUA 4GX1A 1GTMA 5COAA 2B5VA 3RKRA 2HO5A 5JW6A 3NT5A 1P1KA 4NFHA 1DC6A 5FI5A 5LDHA 3EGOA 2AQHA 5I9NA 1DAOA 2EF1A 1GZ3A 3FI9A 1NM5A 4IDDA 4W4TA 4R01A 4XGNA 1VPDA 4H16A 4OOFA 1WNTA 1NX6A 1HL3A 1VL0A 2RH4A 3GR6A 4BGVA 1GV0A 4BO0A 4N5LA 3P19A 4CM1A 4NFSA 5EIOA 3CKYA 4D0RA 1SEPA 3GUYA 3ANNA 5AQ1A 3FF4A 1MX3A 2EERA 1OAAA 1YOVB 2ZATA 3AI2A 5T57A 1QLJA 4QTZA 1YDWA 1QG6A 3CEAA 1U7HA 1YOVA 4KQWA 4PLCA 3WGTA 4R9SA 1YE3A 1ZSNA 5TGDA 1BRMA 2QZZA 2AW5A 4LCJA 1LSUA 1UP7A 4CL3A 5EESA 1WZIA 2VNAA 3M2PA 3RUFA 4J0EA 2PD6A 2HQ1A 3B20A 2EGGA 3RUEA 4LW8A 4QO8A 1E7YA 3NGXA 2DBZA 1CYDA 4IDAA 3DEYX 2HRZA 1CEQA 1E3WA 3JQ7B 5GMOA 5JMPA 5CDSA 3KLPX 2G82A 4TSKA 3UCEA 3JQ7A 5L45A 5C7IO 4OQZA 1ADBA 3V2HA 2W98A 4KTTE 4JX8A 4BNGA 3L6DA 4YJFB 1B15A 2AEJA 3OETA 3IKVA 5DF1A 5AXCA 1B8UA 4WJZA 4CLHA 4J43A 4YJFA 4D46A 1WP4A 1E0DA 1TB4A 3D5TA 2R00A 4BO1A 2DTEA 2PZKA 3N7UA 1VC2A 4OH1A 4HKTA 2WEKA 1FDWA 3G49A 2NACA 1BVRA 2I5PO 4GVXA 4IDCA 5ER6A 1E1NA 1V35A 4IDGA 5F5LA 4XCVA 4AICA 2NU7A 3L4SO 5I8WA 2O50A 4RLSA 3L9XA 3DWFA 3ORFA 5TF4A 3PQFA 2PR2A 4IBOA 1EVIA 1O95A 2VOJA 1XWFA 4DVJA 3IP3A 4IUYA 3U49A 1LUAA 1ZK3A 5CAEA 4A03A 2WSBA 1WZEA 1LXCA 1JAYA 1DFIA 4FS3A 3WTCA 4E2WA 3CE6A 3UW3A 1M6WA 5TRTA 3CPSA 4BOYA 1PZGA 1C14A 3AI3A 4JJFA 2DBQA 4FSHA 1Y81A 2X6TA 2Q4EA 4BKOA 5TS3A 4GGPA 2JD0A 3RVDA 2YDYA 3UICA 2J3KA 4ND3A 5KJCA 3ZW9A 5I9LA 1D1TA 2PH5A 1ULSA 4P4LA 4TZTA 2X9NA 1EFLA 5A3VA 4FB5A 3DB2A 5L9AA 2XXBA 1YDEA 4IZIA 4RL6A 4FJ0A 4PZDA 1VRWA 3A06A 2Y0EA 4YAGA 4YT5A 1KBZA 2X86A 3BHJA 4KDFA 2YV2A 3RROA 2Z1NA 2UV8A 3WICA 1EQ2A 1VJTA 3FNFA 2FHSA 4R3NA 4Y67A 4ZVVA 5TJ9A 5I7FA 2P68A 3TZKA 3ZHBA 4MDHA 4RZIA 1E1MA 3WFJA 4A10A 5B4UA 5LCXA 4P22A 1O6ZA 3GGGA 3IDSA 4CM7A 5G0SA 4E4YA 5DBFA 4X54A 3TF5A 4FR5A 4S3MA 3WMWA 4QQRA 1TVEA 4BIIA 3H5NA 1A7KA 1RM0A 1NQAO 1X0XA 4MKRA 4OHUA 2C20A 4CM3A 5A03A 4AL4A 2Y68A 3ENKA 3WSWA 1GL3A 4TQGA 1OOEA 3FNGA 4YRBA 1DHRA 4WKGA 3HB5X 1PS8A 1PR3A 4R16A 3TOXA 3ICCA 1M2WA 1IPFA 4JN6B 4J7CA 4ESOA 4J9UE 4HFRA 8ADHA 1N2SA 2X5OA 4JBGA 2ZJ1A 1ISGA 2Z5LA 5JLAA 5G0UA 4WCDA 3VZSA 2ZTUA 1DC3A 2BELA 3ZWXA 5JYEA 2CDAA 3JQGB 3QSGA 4EUEA 4JK3A 4LVUA 3JQAD 4E6PA 4A5OA 1X0VA 3I6IA 4PRLA 2AE2A 5G4KB 4GX5A 5BNIA 1F14A 4CMBA 1U4SA 3AUAA 3LK7A 5G4KA 4Y6SA 2OBNA 4RPJA 1RM4A 4WEOA 3S8MA 4YWJA 3KSDO 4KWHA 2X0NA 1FF9A 3V1YA 4FFMA 1PL7A 3ZWMA 1A4IA 3ITDA 3E18A 1VM6A 4ND2A 3VVBA 2OOSA 4E13A 4IGEA 3BHMA 1C3VA 3S2EA 2DQ4A 4HY3A 3INRA 3VDQA 4DLLA 1AXGA 5IF3A 1NHWA 1C1XB 1T2EA 1ZK1A 3ZHZA 3I9LA 3HB4X 4J6FA 1C1XA 3WS7A 1MFPA 4FD3A 3FBGA 4CR6A 4I08A 3RUAA 3LT0A 1VL8A 2AE1A 3WQSB 3TFOA 1WWKA 3QP9A 2NQTA 1EVYA 5L4LA 4YVFA 1H2HA 4GSLA 1GZ4A 2VNSA 1JKFA 3ON5A 4RF2A 4R68A 4BNKA 4CMCA 5JCJD 3KV3O 1C1DB 3JQFA 3C3XA 1YB5A 1BXZA 1C1DA 3I83A 3OA2A 5U1PA 3CMCO 3I5MA 1HDCA 4JP3A 1Y8QB 1SB8A 4K28A 2CSUA 3WBBA 3VZPA 1RYDA 3C7DB 4FGWA 1Y8QA 4F6CA 1D4FA 4YR9A 3ZCXA 1E3LA 3BTVA 1GUFA 1SMKA 3IC5A 1PGJA 2VHYA 3GG9A 2XPCA 3GN1A 3V5NA 3X2EA 4E2XA 2VTEA 1IL0A 1UR5A 1UDBA 2GF2A 2J6IA 2OP0A 1X15A 3GVCA 4BNJA 1YWGO 4W7IA 1E5LA 3ZV4A 5ENVA 1R6DA 2ZIZA 4UULA 4CMEC 2IZ1A 3BTUA 2GDZA 5IFLA 1BMDA 2OO5A 1LLDA 4B4WA 3G17A 2CNBA 3WNQA 4R3WA 3D1LA 3GHYA 3LU1A 3TZQA 2HRBA 3VH2A 3U4CA 4ZHSA 3V1TC 3K2EA 3OJLA 4OGWA 5L7TA 4XWYA 2GZ1A 3KYBA 1IUKA 3PDUA 4MVJE 4IIUA 1EQUA 4XQCA 1FDVA 4LK3A 2VUSA 1TT5B 4P4GA 3ZV6A 3ADOA 1YQGA 3DC2A 3K73O 1TT5A 2PD3A 4F3YA 2P9EA 2V6MA 5B1YA 1HE2A 2CDCA 3H5AA 4GH5A 1NBOA 2BFAA 1DPGA 4G2NA 4XQEA 5JE8A 5T64A 1E92A 3NJ4A 4M8SA 3KYCB 4EITA 3PK0A 1W4ZA 1J6UA 1WXDA 4MVJG 3KYCA 4YRAA 4TROA 4RZHA 4UVIA 4CR8A 4M49A 1N5DA 4BVAA 4CV3A 4J49A 1LI4A 3OQ6A 2OXIA 3LLVA 1FJHA 4M86A 9LDTA 3UHAA 3PHJA 3WJ7A 1OI7A 3K8ZA 1WW8A 1BTOA 1KEVA 2CZCA 5BSHA 3HNPA 5KIAA 3NJ8A 2VYNA 4I5FA 2HMUA 4LSWA 1LLUA 1A72A 3KOUA 4QECA 1F12A 4CM8B 4CQMD 3WBFA 5I7SA 2RHCA 3ADPA 3PRJA 1V3VA 2O3RA 5DN9A 3QHAA 4CM8A 3NRCA 3LC2O 4MVJH 1U3WA 2WD8A 3DBRB 5A04A 1C0PA 1H6DA 2GN6A 3AFMA 1UUFA 5JO9A 4NBRA 4XR4A 4DXHA 3NTQA 2Y1DA 1DIGA 2QHXA 3EVTA 4TMFA 4HFMA 5KWEA 2AQKA 1BHSA 3A4VA 2H9IA 1YQDA 2WE8A 2G17A 4YQYA 1T1SA 2FOIA 4ZRMA 4E2ZA 5JCXA 4MKXA 1AHHA 3GRPA 3DOJA 1XR3A 1DEHA 4IDEA 4FFOA 4DPMA 2ZB7A 3L07A 3AUSA 1LX6A 3UXYA 1CRWG 1I3LA 1KY5A 4Z0HO 3SC4A 3DMYA 1P77A 2HDHA 3RKUA 1T1RA 5AOVA 3LQFA 4ND5A 3MWEB 4OM8A 1Q7BA 4C4OA 4CMHA 3VTFA 3NT2A 2VZ8A 3R0IA 3RC9A 4TVOA 4CLXA 3IJPA 1HT0A 3F6YA 5G0VA 1E7RA 2WYWA 2HAEA 1T25A 3FNHA 2AG8A 4PZCA 1EFKA 5K6AA 4K1LA 4B7XA 4UVHA 1TT7A 1R0KA 5DCUA 3NGLA 1G0OA 3KSZO 5L7YA 4UVGA 2BHLA 1S7CA 1TXGA 2PFGA 3H5RA 4R1UA 5GZ6A 5IJZA 4F45A 1NFQA 1PZFA 3B1FA 1E3EA 3S2GA 2CF5A 1JVSA 1U4OA 4XA8A 3T4EA 1U9JA 1XGKA 4O59O 1ZH8A 5JBIA 3IMFA 1PJTA 3MJSA 4DIOA 3KBOA 1DXYA 2JAPA 4GGOA 2X5JO 4DWVA 3OMLA 3DZJA 3G1TA 2C2YA 3E5MA 2OMEA 3KUXA 5EQDA 1HDYA 2DFVA 4RCVA 2J5QA 1O89A 1NAIA 5CPFA 3RC2A 3I4CA 1PTJA 2W4QA 4TVBA 3E6AA 3T7CA 3JYLA 4TRNA 4GMFA 4ZQEA 1VE9A 3CMMA 3KM0A 2FR1A 4R41A 5TX7A 2WWRA 5KNLA 3K92A 4CV0A 4CMEA 1PQUA 3UKOA 3E9QA 1U2GA 3OICA 1KYQA 4GKVA 4XIYA 1NPDA 1A9YA 2A94A 3OBBA 1BWSA 3WYCA 5FWNA 3WMXA 2VYVD 4XYLA 4CLEA 1FK8A 1EVJA 1WMBA 2P5YA 1HDOA 1ISHA 3PJFA 4WOJA 2DUUA 1V3UA 1ZXLA 4K26A 4AVYA 3F9IA 1QYCA 2UAGA 1WAMA 4BNWA 3PDJA 3AUTA 4Q3EA 3RWBA 4IDBA 4WASA 3NX4A 4L75A 1MC5A 1UP6A 3MJVA 4MVJI 3VPFA 3X2FA 4D3FA 4M54A 1WLYA 2RBEA 5CDUA 3FR7A 4DBZA 2QRJA 3ZWOA 3WR5A 3NUGA 4GWGA 1J0XO 5COQA 1EE9A 1AGNA 3F1KA 4RV9A 3WSVA 1LRLA 4PVDA 2ZQZA 4HV4A 1I2BA 4GL4A 4NR0A 3UOGA 4QX6A 4BB6A 4WLVA 3P2YA 3O8QB 2CVOA 4KP7A 1VKNA 1JLLA 3EK2A 3P2OA 1DC4A 4BKRA 3HZZA 3QWIA 3O8QA 4IXWA 4L73A 1O8CA 3DZKA 1JKJA 4HUJA 2DFDA 1JWAB 2VZ0A 3GNQA 3ASVA 2YZ7A 3FTNA 4CQLB 1P1HA 3PGXA 4AJ2A 1ADCA 5IXSA 1UXKA 3PYMA 4W99A 1PJSA 3GRKA 3D5QA 5B4VA 4Z9FA 2JFFA 4R1SA 1YJ8A 1U3UA 4BQRA 4FFRA 4KZPA 3W8EA 1P33A 3E03A 2YY7A 4OXNA 3PQEA 3C1AA 4XDYA 3VPXA 3PHHA 5KVQA 3PIIA 5TT0A 3RUHA 4ID9A 1IPEA 1RYEA 2I66A 3V8BA 3H2SA 4D44A 1ZW1A 5A9SB 1D1SA 3PEFA 1UZLA 1FXSA 1PX0A 4JBHA 4DIFA 5L4SA 4BKQA 4ALLA 2IEBA 3ZH2A 1LDBA 1AHIA 4ROSA 5F21A 1DJQA 3Q9NA 2DTXA 2X0IA 4WCFC 1H93A 2R00C 4XYMA 5CEJA 3F1LA 4PG6A 4FQ8A 1X7HA 4XD2A 3TL2A 3K2BA 3TL3A 2C7VA 3GZNB 5JS6A 1GQQA 1K5HA 4K9DA 2J5RA 3KTDA 2SCUA 1LTHR 1QORA 1XLTA 3GZNA 4LGVA 4OAQA 1KEPA 3GNTA 4HXYA 1ONPA 4AJNA 4D7AA 3WYEA 1L1FA 4NJOA 2NTJA 1SB9A 5AXAA 4B4OA 4GBJA 1DHTA 2A35A 3AM4A 3Q3CA 2B4RO 1ENZA 2F00A 4UVEA 3EZYA 4FJ2A 4ND1A 4Z3DA 2I3AA 6ADHA 2EEZA 3ULKA 1E1KA 3AY3A 5F3RA 3VPHA 3E5RA 1ZK2A 3TOZA 3PLRA 1HLPA 3QWFA 2QIOA 3TWOA 3Q11A 4ZRNA 2EJWA 3RBZA 2OUIA 1GPDG 1UAGA 1PU2A 1P1FA 1F8GA 2DPGA 2O2YA 3GDFA 4II2A 2LDBA 1VJ1A 3U62A 3PZBA 3FWNA 1P1JA 4RPLA 4JP2A 1ADGA 5FFFA 3TZ6A 1X14A 4NBTA 2D2IA 4A2CA 5TQVA 2TMDA 3ZU2A 3GLQA 3HQ4O 1RPNA 1PGQA 4DIBA 1W6UA 4R69A 1AUPA 4DYVA 3JYOA 2A9FA 4YJGA 1FDTA 2Z1MA 3G3EA 4N18A 1GV1A 3FPLA 3IS3A 4WLNA 5C37A 1SPXA 5G0TA 5U9CA 4MIOA 4QSMA 2PD4A 3BZUA 1UJMA 4YJDA 4ONEA 4G5HA 4J1NA 1QRRA 2DUWA 2X23A 4EJ6A 1UH5A 3GVHA 3W1VA 4BO8A 2C29D 2C5EA 5IZCC 3NEPX 1M76A 2P2SA 2AQIA 1Q2XA 3FRJA 4B4UA 5A05A 4Y9DA 4I9HA 4LMPA 2O7QA 3H65A 8LDHA 2EG9A 4EJ0A 2XOXA 1DRVA 3ZU3A 2JL1A 4YEDA 2VRCA 1EUDA 3ZZNA 2G76A 4KTVE 5I7EA 5HBRA 3FNEA 3ONEA 2GN4A 1ONNA 2C0CA 1B7GO 1NFFA 4TZKA 4CV2A 2CY0A 3DFUA 3GH3A 1L7EA 2NWQA 2X58A 1DIAA 4NMHA 2J3JA 2HJSA 4Z0TA 3U4HA 1AN9A 2R6JA 2HJRA 1Y6JA 3IUSA 3RSHA 5EN4A 5F5NA 2E6UX 3LT2A 2ZTMA 3WGHA 1EBFA 3FWZA 2B83A 3D0OA 3K6JA 1ZFNA 4OYRA 3RASA 3O03A 4UVDA 3VH4A 3AU9A 4CM9A 1KC3A 4NBWA 4ALNA 1KVTA 4R4JA 3HG7A 1WVGA 2VT3A 2O3UA 2B4QA 3ROPA 4XB1A 3WGZA 4IS3A 3N74A 4UEKA 2D8AA 3WIEA 2Q3EA 1V6AA 2CF6A 3PHLA 1UDAA 3LVFO 3VHRA 1T26A 2Y66A 4QO7A 1B8PA 4DMLA 2B35A 1P9LA 4BNLA 3HN7A 3ZWYA 2YV3A 1VLLA 4IJWA 1E3WB 3PJGA 4I9NA 5TT1A 4J4BA 1XQ6A 4D45A 2HMVA 1X7GA 4KUEA 2P4QA 3PXXA 2D0IA 3CTMA 3AOEA 3SXPA 4QXMA 5BSGA 4OQYA 1YXMA 2PGLA 3FCOA 2IXAA 4HNHA 1MXFA 4PLVA 4HFJA 4I8XA 4WCFB 2VHWA 3RI3A 3SLKA 3RU9A 3JQCA 4LRTB 4AJ1A 1R15A 4WCFA 2H5LA 3JQFC 2I67A 3KZVA 4RLHA 3GG2A 1KVRA 4YPOA 2E4AA 4Q3DA 1GUYA 3VVCA 2Q50A 4ZQFA 2W90A 2GZ2A 1YQXA 1XYGA 2PLAA 1YH3A 1N8KA 3U0BA 4PLPA 3PFWO 4E5NA 3DTTA 3NDIA 4R5MA 4QUKA 2WYVA 4XB2A 1H0KA 2C82A 4XJSA 4BNYA 1D7OA 1YJQA 4GMGA 4P4NA 3SX2A 3E48A 1F17A 3O26A 4CPDA 3DDNA 3U3XA 5C3MA 2B5WA 2HCTA 2J3IA 4YDRA 2X22A 1X1TA 1UDCA 1V3TA 5TC4A 3UF0A 4OXYA 2AXQA 4HBGA 1R16A 2NNLD 4DC0A 2G0TA 2Y0CA 3EDMA 3RIHA 2ZQYA 3JD2A 1DIBA 1SAYA 2GR9A 2Y1FA 2Y1CA 5A02A 5KVCA 1X7DA 4AFNA 3G0OA 4BKUA 2HSDA 3KRTA 3KYDB 2GCGA 4JQCA 1ZCJA 1ZK4A 2XF8A 5K9ZA 1RJWA 3JD4A 3KYDA 2GNAA 4CL8A 2QYSA 2YHUA 4KMSA 3DR3A 4YYZA 3VPGA 3AFNA 4DGSA 1LQTA 3DHEA 3MZ0A 1E3IA 2OBYA 3OP4A 3FSRA 4RJTA 1DIHA 3WWZA 3ZN2A 3CINA 3JQ9A 4AJJA 4I5DA 3TDKA 4U0KA 1DOHA 4Z6KA 4R1TA 3M6IA 5IDXA 4GVLA 4NHEA 5IZCA 3PTZA 1Y5RA 1U1IA 1PZEA 1A5ZA 2HK7A 3IJRA 5JAQA 1XDWA 5JDCC 1KVQA 4RGBA 4TRRA 1EDZA 1NVGA 1OFGA 2VUTA 3P7MA 3E9MA 3I9MA 4UEOA 5JDIC 3K5PA 3QRWA 1LSJA 1XSEA 3FN4A 3C85A 4FOOA 4IMRA 1M67A 5DOVA 4L0QA 3GF4A 3PFFA 2CDBA 4ALJA 5IXYA 4BHTA 4EYEA 4WEQA 4YACA 1DDOA 4BV9A 1QYXA 3I23A 5F1OA 1CF2O 3I9JA 4GX2A 3UN1A 2QG4A 3GDOA 4W9NC 4O6VA 1ENYA 1JVBA 3MJCA 4J4HA 5EL0A 4DUPA 2PZJA 2ZTLA 4PLTA 1VSUA 3L4BC 1NYTA 1MG5A 3IQDB 4EJMA 1NQOA 1ZSYA 4CM4B 3NAQA 3EYWA 1SC6A 1WMAA 2OZPA 3F46A 4S1VA 4CM4A 1PJ4A 3SBOA 1XEAA 2P91A 4N7RA 3ZV3A 2OFPA 5H83A 3BYZA 4I1IA 4MO2A 1I3NA 2DBRA 1NVMB 1E6UA 4E21A 4NK5A 1ENOA 4PLFA 4Y98A 4W6ZA 4XQ9A 1GAEO 3STHA 2FR8A 3ZW8A 5IDWA 1QMGA 3NKLA 3WB9A 1DC5A 2I9PA 4D3DA 4GPD1 1U8XX 2BH9A 4IPTA 2WTBA 2X9GA 3WLFA 1TLTA 2EV9A 2QX7A 5K6AC 2CVQA 4AJHA 1VSVA 1IOLA 2ZJ0A 3GUCA 4D42A 1O5IA 4G81A 1OBFO 2V6BA 1R12A 4OMUA 1E1LA 3AM5A 3LSYA 1EUCA 3A28A 1DAPA 1H6AA 1R0SA 1SO8A 3L6EA 4I5EA 3GEDA 3D4NA 1CQIA 5CDYA 3QE3A 1PS0A 2Y99A 3M2TA 5ES3A 1LSSA 1P1IA 4NH4A 2ILTA 2YYYA 4TRMA 1YB4A 5FF9A 1VKOA 5I7VA 3DOCA 4R51A 3R3JA 1M75A 3O9ZA 3QVOA 5IAAA 1YONA 1I3KA 1BW9B 4J7XA 4MVJM 2GPTA 2VUUA 3GOHA 5EERA 4MVJF 3V2UA 1G1AA 1BW9A 5TSDA 1KEWA 2OL4A 3A9WA 5A9RA 1DRUA 5BR7A 3C24A 2OORA 1DO8A 4NU5A 3BAZA 2HMTA 4XIJA 2BLLA 4HNGA 1KETA 2EGHA 2YFHA 1JA9A 2QZ9A 2A92A 5MGBA 1R37A 4WE3A 3PPIA 1CQJA 1ONOA 1GADO 1HDZA 1XG5A 5KKCA 2GASA 3VH3A 4CUZA 1P45A 1N92A 4KWIA 4RVHA 1U2DA 1X1EA 2O3TA 3FD8A 4QFCA 1KIFA 3GEMA 1ORRA 5IN5A 5DULA 5JSFA 5GY7A 3JQ6A 4CQMB 3MJTA 1H94A 4CQMA 2J3HA 2EP7A 2NU9A 2WM3A 4ALIA 1I10A 4YTEA 2PA3A 3DZIA 2PKQP 4EUFA 2O4UX 1PEDA 3TNLA 1GQYA 3HHPA 4PG5A 2GSDA 1GY8A 5DP1A 4BV8A 3PP8A 2OHXA 1MUUA 2NU6A 2BGKA 1QLHA 1T2CA 4NI5A 3RBXA 1ZK0A 5JDCA 2PZLA 2NTVA 3A1NA 3AY7A 5ICMA 4PLHA 1GPJA 4EEXA 2QYTA 3FBTA 3LC7O 3UFXA 1YS4A 3WGGA 1BXKA 1I32A 5JDIA 1F0YA 3AJRA 5DNAA 1XELA 5DCYA 4FC6A 1Y1PA 3H3JA 4LRSB 5JAMA 1V8BA 2DTDA 1VL6A 4BO3A 2GRAA 4EDFA 1UZNA 1UXHA 4J4TA 2YDXA 3LT4A 3WGIA 4RPGA 3H2ZA 4BGEA 2RH8A 3NV9A 4XGKA 4JIGA 4FPXA 2X7HA 5ILOA 2PK3A 1CERA 4MP6A 4NK4A 4W9NA 4Y6RA 4B4VA 1Y7TA 4IJKA 4BNHA 1GD1O 2WDZA 3VOSA 5A4DA 5G4LA 3UAGA 3L4BA 1PR9A 2VCYA 3GQVA 2HU2A 3RQSA 9LDBA 3ZNPA 2TMGA 1R66A 2O3SA 2UVDA 1FDSA 5DT9A 4Q3BA 1H2BA 3AM3A 4NNJA 2Y67A 2Q49A 2IDZA 3ZU4A 5JAZA 1F8FA 1GUZA 3W6ZA 3GN2A 4IY1A 3DAPA 4XRRA 3GZ4A 3W6UA 3DZHA 2Q99A 3JQ8A 2FSSA 5AYVA 1NASA 3RU7A 1ZBQA 2HMWA 4GQAA 4FDAA 3DBLA 3NTOA 4WOKA 2EKPA 2Q2QA 1Q1NA 2FY8A 3RUDA 4BNIA 1P0FA 3OJOA 1HDXA 1N1GA 1T4DA 5U4QA 1IY8A 5HM8A 4PG7A 4E5KA 4E32A 1EDOA 4Q9NA 2BD0A 5L7WA 2Y1EA 2VYND 5KJEA 4IQ0A 3VDRA 4ZU3A 2Q2VA 1JDJA 3WXBA 3GT0A 3FPCA 1BGVA 1KOLA 4W7HA 4PGFA 2VYVA 1YL6A 3WG9A 4FFLA 3ZNOA 3B1KA 4Y6PA 4ZQGA 4YT2A 3WGOA 1OC4A 2BI8A 2H6EA 2EP5A 4L4SA 4L8VA 4JJGA 3QIVA 2Q1WA 4Z9YA 2RIRA 2E82A 2HLPA 2B0JA 3W8DA 2EIHA 4HX5A 2UYYA 4GX0A 1JQBA 3K30A 1JAXA 4H3VA 3ONFA 4H7PA 1X13A 1XU7A 4E3ZA 1NQ5A 4N5MA 5C5IA 4J9VA 3WTBA 1Q0LA 3K31A 3TFQA 3ZGYA 1DSSG 1ZNQO 1UP4A 4ITUA 4IMPA 3RFVA 2PTGA 1L7DA 3EW7A 1CWUA 5CEEA 3GC6A 2C7GA 4OSPA 4MIYA 3F4LA 1D3AA 1P74A 3L9WA 1B16A 3HSKA 4OJNA 3CSDA 4LVCA 4BS9A 5CPBA 2VTDA 2Y93A 3INTA 4XX0A 3LLSA 3QJ5A 4RDIA 4QT0A 4Q3NA 3DMTC 3FR8A 3DBHB 4OIMA 4GAEA 3I4FA 1R4MB 3Q2IA 1LA2A 3DBHA 4OSOA 5KTKA 2VQ3A 1R4MA 4BO9A 1PJ3A 1N7GA 4CM6A 1QV6A 4E5YA 5HS4A 4GKBA 3GGPA 1RKXA 2VWQA 3MJ4A 4R1NA 5CP8A 1ZSVA 3WIDA 4AJOA 4IS2A 1Z75A 1W0CA 3R1IA 1NVTA 5F1KA 5CG1A 2DC1A 1CJCA 4HWKA 4ZICA 1UXIA 1W8DA 4OXKA 4RVUA 5JNLA 1JTVA 3B1JA 1LEHA 2FMUA 4E31A 1ZMOA 2BFOA 2GERA 1TI7A 4E12A 2Q1SA 4BO4A 4A7PA 3GVPA 2ZK7A 3JD0A 4B7UA 3A14A 1J49A 3OIGA 3DZFA 4RVGA 3WNVA 4D3SA 2O4CA 5IZ4A 2B69A 4XGIA 1K6JA 4MVJD 4MKZA 5KJ6A 4GLLA 4YAJA 3BMCB 1A9ZA 4ND4A 2Q45A 1NQTA 3MTJA 3JYQA 3TZCA 2RHRA 1NXQA 1YBMA 1GFSA 1XQ1A 3BMCA 1ZIDA 1ARZA 2IODA 3T7EA 4J1SA 3I6QA 3JSAA 1GYRA 4PLZA 5JMWA 5C7OO 1HEUA 1HE5A 4I5GA 2FRDA 3NYWA 4JROA 2CUKA 4OO3A 2D5CA 3B70A 2NUAA 4DL9A 1KC1A 5KKAA 3JD3A 4OL9A 1DLIA 3GAZA 1IYZA 1LRJA 2Q1TA 2Q2WA 1NTOA 2Y0DA 3GFBA 2VWPA 4D41A 4LMRA 3G79A 3AOEC 4NIMA 5AXBA 4MOWA 2WMDA 5G2OA 5JPIA 5AVOA 2G1UA 5DBGA 3PI7A 2ZCVA 3ETGA 1XHLA 2W2LA 4U0JA 3W4IA 3PVZA 1U28A 4BB5A 1IZ0A 3DAGA 3DO5A 3H3FA 1LNQA 4BMVA 2X4GA 5DZSA 5JC1A 4JNKA 3WQRA 1Z82A 1MA0A 5BT9A 2IYPA 3GPIA 2XAAA 2YHIB 1O94A 1I24A 2D5AA 2J5KA 3PWKA 3VKVA 4XYBA 2YHIA 1ML3A 2E49A 3UUWA 1DLJA 4WECA 1HZJA 1PS9A 3ANMA 1JW9B 3OIFA 5K0ZA 2NV6A 4LSMA 4U7WA 4RPHA 4RORA 1MFZA 1U8FO 2PNFA 4JCOA 3UVEA 3V2GA 4BQPA 1Q7CA 5G0WA 3U5TA 1UZMA 1XKQA 4BGIA 3E8XA 1IZ9A 3GDGA 4UUOA 2V6GA 1BDMA 1NWHA 3U4DA 4MINA 3F5QA 1E7SA 5L40A 1K2WA 5LDGA 1NWCA 2AHRA 2YV1A 2FZEA 1JN0A 2VWHA 1CETA 4IIVA 3PWZA 4AJEA 1JKIA 4J2OA 1E6EA 1MXHA 3QY9A 1PJQA 4YJGB 3CZMA 1ZJZA 2R2GA 3C7AA 2NADA 3H9JA 3OEYA 4XQGA 3JTMA 3IAHA 4BL5A 5I9MA 3T4XA 3EUWA 3Q2KA 3IL2A 2BF7A 1ISIA 2GO1A 1PSDA 3DMTA 2VOEA 3D4PA 5HTOA 1HKUA 2WE7A 2BFPA 1C0LA 2EHDA 3JQ9C 4HADA 2P9GA 2NU8A 4MVJP 4DPLA 3GA0A 4J2HA 3HFGA 4GI2A 4FBGA 4YCAA 3JYPA 1PGPA 3NDRA 5F1PA 3TN7A 2LDXA 1Z6ZA 2ZCUA 2V65A 4JXKA 4AJLA 2JAHA 1PL8A 5EPOA 3H4VA 2Z95A 3KEOA 3NDJA 1IHXA 4XJTA 4ZD6A 3TPCA 3LT1A 1YBAA 3ZDFA 1NNUA 4DQVA 1E6WA 1XA0A 3QWBA 3QVXA 1E5QA 3ZWAA 5JYDA 4MPDA 2GN8A 2PH3A 3WQQA 3ZNNA 3U4IA 3H8VA 3DAFA 1LDEA 4FFNA 3TJRA 4E33A 3BHIA 3LZ6A 2JCVA 7MDHA 5DP2A 1I8TA 1WDKA 4UAGA 5KJ1A 2C54A 5CDTA 2PKRA 3JQBC 3DXFA 5T6BA 1WPQA 2JHGA 4JBIA 1EZ4A 1R4NA 1EUZA 4WNCA 1ISMA 4XR9A 1MG0A 1RM5A 2EW2A 3QVWA 4K6FA 1I30A 4YBZA 4IDFA 1Z73A 3G1UA 1NR7A 2CD9A 4CR7A 2FZWA 2FWMX 1HDGO 3I9KA 1YB1A 4PVCA 3KO8A 4RQUA 2Y1GA 5EQFA 1EK5A 5GZ1A 4R5HA 3ROQA 3ZV5A 5A3JA 2YQ5A 3PLNA 3PQDA 1EVZA 1HYEA 2DAPA 3OJFA 4AJIA 1P0CA 4G65A 5L53A 4WNIA 3I1JA 2X9VA 2GUGA 3GPDG 4J3FA 3HJAA 5CEFA 3W4JA 1O0SA 2NQ8A 1VJ0A 1ZUD1 5THKA 3RJ9A 3RD5A 3ZWPA 1PGOA 2JCXA 2V7PA 1HTBA 3GEGA 3GMDA 3WWYA 1Z7BA 3MJEA 2VRBA 1YKFA 2VRCD 1H9AA 2JJYA 3DZGA 4HFNA 1SCUA 2PY6A 4YA6A 4ZQBA 4PG4A 4W82A 4CLDA 4YT4A 4XEHA 5TIIA 1H5QA 1B26A 2ZYDA 2DLDA 5HS6A 1GEEA 4EI2A 4FC7A 2JD2A 1SOVA 2EJVA 1LDGA 4WPGA 4EW6A 4ZJUA 5L51A 4AJKA 4YQZA 4P8RA 4BO7A 1E77A 3HFSA 1PIWA 4FCCA 1FMCA 2AG5A 5IDYA 4CM9D 4WGGA 4BNMA 2CFCA 3QLJA 4XDZA 3OEWA 1GEGA 4PZEA 3IP1A 5LC1A 1NP3A 2CMDA 4BNUA 4DLBA 1DFHA 4INAA 4KQXA 2EKLA 3EZLA 4LISA 5A06A 1A7AA 4NDNE 2QRLA 2JKVA 1CIVA 1MLDA 4DTIA 1ZEMA 5BNTA 3ITKA 1K89A 2NVBA 3TZHA 5IDQA 5JAIA 3CIFA 3DQPA 2BRUA 4NG5A 1FDUA 3FTPA 4ILKA 4MP3A 4CLRB 1EK6A 1HETA 2PZMA 2UUOA 1Y5MA 1NAHA 3F47A 4CODB 4CLRA 4KOAA 3KVOA 1E7WA 4ZA2A 4LN1A 3OH8A 3GY0A 1Q7GA 3JQAB 4BO5A 2DU8A 1SNYA 1ZMTA 2E37A 3JQAA 4QFDA 1DRWA 5TJHA 2AA3A 1EEHA 3LF1A 4DYDA 4UUPA 1PJBA 4WLFA 4J7UA 3HDQA 1VI2A 1I33A 2CVZA 5L3ZA 4A26A 3L0DA 3HDJA 5T8KC 1ZVMA 2VHZA 3DZBA 1YVEI 3D4OA 1HRDA 3C8MA 3JQEA 3JQDA 4CM5A 2ZB3A 3JV7A 5GZ3A 1Y9EA 3ABIA 3Q0EA 1PQWA 3ZWWA 1G6KA 4J1QA 1YL5A 1I01A 2GD1O 4RDHA 4B8WA 3CZRA 4FGSA 3E1KA 4GSKA 3VZRA 5JC8A 1NR1A 1QXSA 4BO2A 1XIVA 3SLGA 2WJPA 5T5QA 2I99A 3WLEA 2Q1UA 3PYLA 3UCXA 2E48A 3RUIA 5L4NA 2EXXA 3OM9A 1YGYA 4A0SA 4BNVA 4CV1A 4YRDA 2BFMA 2D59A 4YT8A 5HRUA 2EKQA 3ZWNA 1I36A 1T2AA 5T67A 3JQBA 1NFRA 1ULUA 2VZ9A 3GK3A 4B3JA 1RM3A 3AUUA 1PJ2A 4WUVA 3IIEA 1UAYA 1N9GB 1Q0QA 1SZJG 4M1QA 1HDRA 1IB6A 3K9QO 5JCJA 1N9GA 2VWGA 3D3WB 4YAIA 4Z3KA 1QYDA 1DFGA 3W8FA 2OP1A 1P31A 5JFOA 3QVTA 3KETA 1ADFA 3D3WA 3BMNB 1PGNA 5BQFA 3WFIA 1KY4A 1LLQA 2HUNA 3BMNA 3ETDA 4DPKA 1GCOA 4XRGA 3JQGA 4PG8A 2V6FA 3H9GA 3RC7A 1Y8RB 3OQBA 1YRLA 1GZ6A 1P44A 4AJ4A 1HWYA 3DOOA 1Y8RA 3GAFA 2HKIA 3PHIA 3DFZA 2HK8A 1P1RA 4AG3A 3EVNA 1EMDA 3DBVO 4IGFA 4XYEA 4BNZA 1U5AA 5JY6A 4PN3A 3L77A 3QWAA 2O3QA 1H9BA 5H81A 4ALKA 1LSOA 4Z9XA 2ZB8A 4MJLA 3DHYA 4WLOA 1HSOA 1T2DA 4BKPA 1A71A 4PCVA 2VHVA
chains in the Genus database with same CATH superfamily
1JDSA 2WJHA 4LNHA 4I46A 5IM4F 1Q74A 4DJEC 5IT9A 5FYQA 1DJNA 1EX1A 2XDWA 3AHDA 1BWQA 4IJUA 4ASUA 3ZE1B 4IINA 4FYVA 2A1IA 1HYHA 1JEDA 2G5TA 3ZD9A 3IELA 4DT1B 3LV8A 4RKRA 4EMUA 2GN9A 2CVHA 2W00A 1K8ZB 4LGYA 1KR2A 1Z6QA 2J8ZA 5G02A 1GYPA 3GRRA 5CFZA 5C9ZA 2HA5A 3LUCA 3HP1A 2J9XB 1EINA 1J7JA 1E1QD 3FPFA 4CU2A 2AH5A 1KTVA 1X7YA 5JARA 2ES4A 1OCEA 2AWNA 3D64A 4HP8A 3SF0A 1XZBA 4EA7A 4NZNA 1D03A 4DY4A 1AGPA 4U7FA 4UDNA 1LCIA 3PXBA 2O8NA 4HPWA 4B43A 1W19A 1W73A 3KJQA 1J06A 4II3A 3TQHA 5TLSA 4DC1A 1SVKA 3VZDA 1E9DA 4GWKA 4F8YA 4OB7A 4DQUA 4QGSA 2G0AA 3KZOA 3OZUA 5JXWA 4J0QA 2EAUA 2GAAA 1IULA 3ND5A 4E14A 3RVBA 5TVGA 4GXQA 3K96A 2FI1A 1TZJA 1CY1A 4P3YA 1CQJB 1J97A 4X1IA 3SBXA 2UVQA 1BHO1 2O7RA 4ZO8A 5B1EA 2JFOA 1AS0A 2HXGA 1MHPA 1D2GA 2IE0A 2JRCA 2L0XA 3ASUA 4U5QA 4OHVA 1PZHA 4URWR 1GGMA 1ISJA 1QQ5A 3H9UA 2JPDA 4O4HB 2V7QD 2C1ZA 3FNRA 4QYMA 1PNVA 4CUJA 3THXB 3GLIB 3PUHA 2BMFA 5ER9A 3K5IA 3Q3VA 4Y0NA 4GE3A 3ZD8A 4FEAA 4MS3B 4D56A 4C05A 4H18A 4K9PA 4YRTA 1ORHA 4JB8A 3TG8A 1EA7A 3EAQA 3DUFB 3UAXA 1K8XB 4MI6A 4IM7A 1SGWA 1X3SA 3ETEA 3IQIX 1T1GA 1SU8A 3EIOA 3II6X 1SWWA 2VP6A 2IZ0A 2R6R1 1T6NA 3EFEA 1RC0A 2FPIB 2HK9A 1G8YA 1LU9A 5J63A 3BKWA 3NOXA 3FOZA 1KBQA 4GIBA 3QLEA 3PENA 5J1SB 1FTYA 2D1YA 4EFNA 4ZT3A 4B75A 2BV3A 2JGFA 4FW8A 1SH7A 3F8TA 3GCGA 3OIDA 4ITRC 3DXYA 5AM3A 1FJGB 1BXGA 4NJMA 4TV9F 3GA7A 1LC3A 1TE2A 4B6FA 4ZYWA 3D7LA 1PO7A 5DT2A 2KWIA 1B6RA 3NLLA 4H7KA 3QQPA 3RFTA 3N3BC 1G38A 3HDHA 2AC7A 3WHKA 4ENQA 2J09A 4F1KA 1KR5A 3BD7A 2AJCA 2CK3A 2DT5A 4INOA 4KXUA 1JNYA 1N4AA 4B7CA 2PBRA 5AD1A 4ZHQF 1B14A 3CNQS 3HLYA 1EFHA 4P7FA 2BM0A 3AINA 3OZ7A 2X7JA 2CKMA 4QOGA 3ES9A 2WTAA 3KNZA 1P2BA 2DQSA 3BCUA 3RTGA 4CWAA 2C04A 2JW5A 1KXJA 2VF7A 1E79A 3L0OA 2O2IA 1Q1EA 3PRHA 1LS6A 4DLWA 4L3OA 5COBA 1XTBA 3KQVA 3O83A 3A6DA 2ZSUA 2IT1A 2LGJA 4L8GA 1KDRA 4PRKA 2C88A 3RDPA 3U9TA 3OC0A 2ZXEA 3EB9A 1OAOC 1LRKA 4E1VA 1BJTA 3N07A 3ET4A 4BTEA 3IEMA 2JIBA 3R3HA 1OVGA 5KQGA 5J43A 2VHUA 5FYDA 3AKDA 3PKZA 3BMQB 1DL5A 1WCXA 3LK6A 1FLAA 1RYNA 4DLZA 3EUEA 3EY4A 4CKZA 1AKYA 1EP3B 3DBRA 2YYZA 5EJ7A 1GU7A 2ON6A 4P4SA 5DX1A 3NH9A 3N9IA 4WA7A 4HAIA 3IDQA 3RT7A 1GCAA 4J3JA 5EMNA 3VTZA 2ECFA 2IX3A 3I58A 3TKYA 2XYGA 5H80A 1FS5A 1HZZA 3VR3A 4AURA 2CFTA 2O8DB 4RHFA 4H9GA 4MP8A 2NYAA 1DEKA 2ZBVA 1MQAA 2DUNA 4HNGA 1T2FA 4CTOA 4L3WA 2ZQ5A 4QC2A 2OGWA 2ZSJA 2XB9A 5TNXA 2XQIA 5FJIA 4AKSA 2J9FA 4CN8A 6YASA 1GFWA 4AS3A 4URYR 2Q46A 5EP3A 3TOVA 1E20A 3IP5A 4LHEA 3EASA 1JSXA 1C4KA 2GZAA 3C7KA 3Q7RA 4YDSA 5BP7A 4Z49A 4AY5A 1J0BA 2O1SA 5DM1A 1A9RA 4LOIA 4YC7A 1NULA 2GNOA 4B3HA 4ENTA 1KMHA 4RF3A 4DMMA 2IH4A 1AMNA 4P4UA 1U9CA 3PIDA 1WJGA 2Z09A 3PZRA 4KSCA 1LLCA 3WE7A 1XRQA 3MWDB 2OCLA 5E6UB 3R8CA 4PNZA 4DV5B 2RJNA 1HUQA 3NTRA 5FBQB 1ID8A 3CT6A 5B5SA 4JS0A 1MC4A 5AK5A 4B6SA 1U0NA 3IP7A 1JDBB 3ONDA 4AMZA 5LB4A 2BN4A 2GYYA 4NCHA 1E3TA 2A0WA 3OT4A 3RAJA 1Z45A 3JWJA 2Q8QA 3ZJTA 3DLBA 3FLAA 5CB0A 1ZU4A 2B78A 2PV7A 2YFQA 3I04A 1DUSA 3OOEA 3RIXA 5EIHA 3H7AA 3U44A 1E9VA 5BN5A 2WWYA 2FSVC 2IYUA 5ERYA 1Z35A 4ZDWA 1UKZA 2WM9B 1KL7A 1FP7A 1PJLA 1QRAA 1TQ6A 3DDCA 4KKVA 3ZX5A 1H8EA 2PWZA 4BPBA 4PTZA 1UADA 4GMXA 2X0EA 4DQLA 2JGJA 3FBWA 2ORWA 2AEMA 1G98A 2YJZA 3AEKB 3RTBA 4PO3X 1ZKMA 1LQUA 1RW4A 3AHJA 1JWBB 2REQA 1XQWA 2WYUA 1QP8A 4IJ6A 2WNIA 2JLQA 3LWBA 3IURA 2WWXA 3W05A 1ZDMA 3U9LA 2R7LA 3N7AA 2WM2A 4Y8VA 2WYOA 1DKLA 2D0PB 2X0RA 3TEJA 2PBFA 3Q5GA 1KJYA 3TSCA 3A2MA 2VDOB 3WLIA 1ZD5A 3UWOA 3EF0A 3VZQA 2W2KA 3ICWA 4MR8B 1PBNA 2QRMA 3CX6A 3M9LA 2G9VA 2YXPX 4QPNA 2PEZA 1KERA 1BO6A 1P61B 2MYTA 5JO0A 4F4HA 2R4TA 3GI1A 2XX3A 2QYOA 2VAVA 2GX6A 1V26A 2Z3ZA 5I9BA 4ZI7F 5CW2A 5IC4A 5IN4A 1P3DA 4MUJA 4C4PA 1FRZA 4DQ0A 3LBFA 4DMGA 3WK5A 4XZ3A 2J1LA 2XXJA 1FFCA 1GNQA 1I7PA 5HG0A 3A1EA 2PH1A 1U3TA 3BE8A 5ALRA 3KZNA 3BFKA 4CYMA 3JVIA 4JH0A 2QVCA 3R7DA 1EHCA 3RYHB 5LLDA 5HKOA 1TNDA 2JBAB 5DXAA 4Y1EA 3CO0S 4ZARA 2GEFA 5CA0A 1O0BA 3BXXA 3SBDA 3PWSA 4BQSA 1ZNXA 3AC0A 4NBUA 3DW1X 3C3JA 3O9VA 4UBIA 5CJJA 2XQKA 3G5UA 4RD6A 3Q88A 4M89A 5BUSA 2NZWA 2FKNA 3BIOA 3D7NA 3ANLA 3VXKA 2FCRA 3AI1A 1BKSB 2PRSA 3D7RA 3ZDAA 2FSGA 4QRDA 3LCJA 4U6QA 1IHYA 1V71A 1PW5A 1KK3A 4IQGA 2RI0A 3TZBA 1W4RA 4IJVA 1RS0A 3NIBA 3AY6A 1NM5C 3KB8A 4KGVA 3JWEA 3CV3A 4OAOA 3TQFA 4WESB 3HADA 4K6HA 1ACMA 3B7PA 4BBZA 5LB2A 3K94A 2R47A 4PSUA 4HAXA 4V24A 3DE2X 3ENNA 4DANA 4DHEA 1TEHA 5K8CA 3ICPA 2CE2X 4KC0A 4IIGA 3SJ7A 1M9NA 5A9TA 3UJPA 3I61A 2RHJA 2C3OA 1XROA 3EGIA 3CUKA 4NU8X 3ZZ1A 4FCVA 2ZKIA 3OIUA 1QSGA 3AEYA 1GR0A 3K2IA 2O23A 5IARA 1SHKA 2I1QA 5LPNA 1Y8ZA 2EW1A 4YXFA 4LHYA 4CLOB 3CG0A 3MGBA 1A2KC 1SY7A 4RF5A 1E8NA 2RCYA 5B37A 4CQLA 1D1PA 1XCBA 2A59A 2H4HA 4HZGA 5FKJA 4BEWA 4F72A 3ETHA 4F56A 1M8PA 3ILVA 2VJLA 5I7WA 1ZCBA 3NVDA 3RT9A 1OYVA 4GPZA 4IJMA 4M0MA 3QA9A 1K3TA 1KEUA 3KD2A 5IVDA 1P2FA 1ZJYA 4U6SA 3S55A 3G8DA 5GADl 4CI9A 3U3RA 3AFOA 3GLHA 2QUJA 3OO0A 4IR7A 1WD5A 3K7EA 5IK2D 4EY5A 2ANCA 1JS1X 2DRIA 3PUIA 4IIJA 4LZLA 4O4IA 3ZWVA 4C7KA 1PLKA 1DG1G 3HXLA 4N8EA 5DDIP 4BGUA 1FMFA 4G4JA 5EFOA 3GXOA 4G01B 4UAUA 4RPKA 3IIMA 2GAFA 2C59A 3W4KA 4Y30A 2Q4TA 2I4IA 3QG1A 4BRWA 3K70B 1RYMA 2PUBA 1F4VA 3RBAA 2GHRA 5TDHA 2H5EA 3IB3A 1GT6A 4URFA 3RAPR 1PQYA 3HCOA 3I2HA 4L4XA 2NPFA 2ZIFA 4A0QA 1JTFA 1GTRA 3ZE7A 1Q7RA 2P79A 1BS1A 2ZYUX 3N05A 4HWOA 4CUKA 3KB6A 4X24A 2W70A 5AIBA 3ML1A 5LMZA 1ZOLA 2YN2A 1AT1A 1NZDA 3X1XA 2QMOA 3ECCA 2ZYWX 4HJXA 2AZ4A 2VPPA 1NUAA 2J59A 2INGX 4KH1A 5THQA 3ZHXA 2XOKA 4I99A 3TLCA 5EPUA 1W49A 4NF2A 2ZRJA 3GLFE 1E3JA 3GHHA 1VKZA 2QW8A 2I62A 2F48A 4NH0A 1FRQA 3PFIA 1Z83A 1EWRA 3PNQA 5A5EA 5A4AA 2P9CA 1D04A 3MEQA 3K70D 2DPHA 4A8PA 5CMLA 3X1DA 4CEIA 2VHJA 2P67A 2BRUC 3D6JA 3FZNA 1GDHA 3LSTA 4MV0A 3DLIA 4OOEA 4XWOA 4QFMA 1XQYA 4Y1GA 3D8SA 1PWXA 5ECDA 2XA2A 1P7VA 3D3EA 3PT9A 4B3RB 4F38A 4PRYA 3T7KA 2CLSA 2ZGVA 3COSA 4LVOA 1T4CA 3OLQA 3QELB 3SN6A 3TW6A 1PD0A 2W2LD 1L7VC 2OSVA 3I3OA 4DCGA 3V9AA 4RO0A 3AGPA 4IRMA 4WV3A 4EPRA 4BXOA 2R97A 1HMYA 1GCUA 1A9XB 4YGYA 1QTNA 3A7DA 4J90A 3WRVA 3OCZA 3HVJA 2NIPA 3D8HA 1UBOS 3MAAC 3AGQA 4C29A 4NXNB 3KSUA 1X9IA 1ID1A 1O94D 4JLVA 1ZKDA 3QEKA 4MS4B 4NMLA 4ZEOA 5KYWA 3R9XB 1QTIA 2SKEA 1K6IA 1LDMA 2I3BA 3LKBA 1PAUA 3GWZA 1U0HC 3TS1A 1RRFA 5CB4A 1XU9A 3IVXA 3STUA 3MUFA 5KSZA 3KHTA 4JYBA 3FDZA 1RLUA 2Z43A 1YMUA 4G0XA 1BKYA 2GWRA 2BKAA 1QFSA 1LJUA 1SU7A 1N5OX 3BULA 3FX2A 4ZAGA 3PFNA 4K2HA 2PZAA 1AQIA 3SZMA 2VUIB 4EW3A 1BMTA 1KEZA 1IDN1 1UPTA 1Z6PA 5HDBB 5C18A 2ZRPA 2QTZA 2O48X 2ZB4A 1LBQA 1SD2A 3EC7A 4UATA 3RARA 3OF5A 3AWDA 1QFJA 4D79A 4B8ZA 1N5LA 2BR4A 1IBSA 1U7TA 4KLRA 1KFCB 4KMRA 3VKUA 4PIVA 2V3CC 4JELA 3Q87B 1XT6A 5HILA 4AWBA 1ZHHA 1FLVA 2VT2A 4NE7A 2X5NA 4LY9A 1VE5A 4KNWA 4KLAA 5KYVA 4HZIA 3L3BA 2IYTA 2HCFA 3A1UA 1SBNE 2P0AA 3LX8A 3DKIA 2O0JA 3EIWA 2NVUA 3LYLA 4IJ5A 5KYNA 5ICGA 3FUXA 5LDHA 1YB2A 3ZJ4A 3G02A 1GTG1 3PL1A 1DAOA 4NWIA 1GZ3A 4IILA 4RXUA 2SNIE 3PEWA 4WX2B 5I4CA 4W4TA 5C80A 3VKGA 3IVRA 3CUEF 1WNTA 1G20A 1VL0A 5ALJA 5CDHA 1RSZA 2HSEA 1B93A 4BGVA 3HCPA 1OLSB 3P19A 3S5UA 2Z2ZA 3OT5A 3WO0A 1KY2A 3CKYA 2PVPA 3PL5A 1ZI8A 3K6KA 3ZIUA 3LBHA 2JJ1D 5F52A 3V32A 4GOXA 3FKSD 3WZLA 2FSIA 2EERA 3K5HA 5T57A 4EG1A 3QE2A 3TLEA 2PS3A 2PX0A 2RK6A 3CEAA 3ODGA 2ODTX 1YRAA 3MMPA 4RIGA 1NP7A 4RIIA 2XKKA 3QVUA 3EJWA 3OC6A 3RTAA 1M34E 3L1VA 4LCJA 1U63A 2FZLA 1LSUA 1XP5A 2QTWB 4QUHA 3HSYA 3A2NA 2VNAA 2G7MC 1WX1A 4L28A 3B20A 3GBPA 3MCTA 5A7GA 2P5TB 3HXPA 4OBWA 3LP6A 3IT2A 2QVYX 3LUBA 1CYDA 3MT0A 3GELA 4RNCA 1CEQA 1E3WA 1OB2A 4JQYA 2XVMA 4TSKA 2RI6A 4P93A 3I6YA 3MRSA 4B5LA 5C7IO 1ADBA 4JB2A 5A4MS 4KTTE 5TPZA 3VISA 4BQFA 3ET5A 2QUZA 3TMYA 3OETA 4KOEC 5FOSA 3W2TA 2J3MA 1GZUA 4J43A 4GPBA 1CYEA 3P52A 1OGYA 1TB4A 2R79A 5LXTF 2W2PA 2WVGA 2FN9A 4MZXA 4UC0A 3N7UA 1ZRNA 3P4XA 1KZYC 2XWQA 3CM0A 3OPXA 3ZS9A 2ZVPX 4HYTA 3GP3A 2WEKA 1NV8A 1E4OA 1YBFA 2QD5A 2QN6A 3T9AA 4F2HA 4IV5A 3HCRA 1E1NA 5F5LA 3W06A 3U4GA 1MT0A 1K7XB 2VH1A 3P2EA 2QVLA 2F1JA 3IIKA 3PNSA 1FNNA 3ORFA 1UBKS 2IXFA 2PR2A 1O95A 4F96A 2GEJA 2VOJA 3E7XA 2BDTA 3G2QA 2IE8A 3IP3A 7MHTA 2BEWB 5CAEA 1YVDA 4YBRA 2Y1LA 1WZEA 4ZMBA 1LXCA 2VAPA 1QANA 3DEZA 4LYEA 5P21A 3TZEA 4Z4EA 2HHAA 4R2JA 3Q3IA 1XHEA 3UAVA 5GTDA 2H2DA 4FS3A 3WTCA 3SJBA 5H4GA 2GAJA 5IH3A 4E2WA 4PR0A 4I1RA 1QGOA 5BW5A 2CUZA 1UOQA 4RE5A 3ONVA 4RZ3A 4JJFA 4L3VA 2O2XA 3OFKA 1CJKC 4BKOA 1F60A 2K4MA 2HA2A 2IC5A 2JD0A 3RQIA 2YDYA 4WBXC 1Z0DA 5CLLA 3UICA 2J3KA 4I55B 4MB2A 4ND3A 4OFBA 2GCOA 1P7WA 5JQGB 5KJCA 2Y6UA 1D1TA 4KXMA 2OBXA 3HEAA 1JHQA 1N75A 4I50A 4J0DA 2WJ4A 4PYOA 2X9NA 2Y77A 1UBFA 3TTVA 4HGQA 1EG7A 4LMAA 4DV0B 2H5JA 1JMYA 2WU8A 5L9AA 4RL6A 2XE8A 3NOVA 4FJ0A 2Y0PA 3SSOA 2I2FA 1TCCA 2Y0EA 3E70C 4YAGA 3BHJA 2X86A 4TT3D 2O54A 2YV2A 5LVAA 2Z1NA 3KT0A 1NIPA 2I2DA 2DFLA 3WICA 1VJTA 3KOWA 2FHSA 4Y67A 3K1AA 2EQAA 3SFZA 2XLBA 3P5BA 3TZKA 4GXNA 4MDHA 4XPIA 4O4JA 4B2IA 3DYBA 1YB6A 3HB9A 2I8LA 4KW7A 1NQUA 5DW0A 1JJFA 4FONA 3PUXA 3ZKAA 1Z18A 1QHEA 4N03A 1MB2A 4E4YA 5IXJA 1DCKA 1E32A 1A9PA 2VXCA 4LWPA 2RB5A 3GCDA 5JEEA 3WMWA 1FFSA 1EX7A 2JDID 4BX0A 5EY5B 3H5NA 5HQ3B 2W4IA 3T94A 1A7KA 4O2RA 1TRKA 2OGSA 4IHJA 4X92A 1KI6B 1DQSA 1VL5A 4NJEB 2JGEA 3BWYA 3RS9A 5JRJA 4AL4A 4XLZA 2Y68A 2LVBA 2OCXA 3HI4A 3LX5A 4TQGA 5DI3A 3VPCA 2WSSA 1MJGM 4JNCA 4WJKB 2DZDA 4UKDA 4C07A 2FUG1 2ST1A 3E15A 3K6SB 4BQOA 4GOKA 5DPMA 1S4QA 4Z0NA 2PS0A 3TOXA 2IYWA 1IPFA 5AJXA 3EX7C 4J7CA 3W6NA 3COJA 3FMIA 1XWWA 2CHEA 1ZG3A 3KPYA 2OBBA 4WHMA 1F20A 9MHTA 1QC5A 2Z5LA 4W5WA 2Q5JA 3QOXA 3TCKA 1UJ4A 1SC9A 2XMPA 4JXZA 4GRIA 1T5SA 3SM3A 2Z4TA 1NW6A 2KSQA 4A2PA 1YDMA 4JK3A 1JDTA 1EP1B 1GVHA 2Y9PB 3SD7A 3TLBA 3RSSA 4AT1A 1X0VA 3KQWA 4FBLA 7GPBA 4HGPA 1O9GA 3VZCA 4DCMA 3ND6A 1KDZA 2REOA 1IN6A 1YDHA 3LVBA 5MFPA 4F11A 3QF4B 1E1RA 4Y6SA 1DKQA 2VJOA 1DZIA 3CYFA 2WG0A 2NSYA 4GLFA 1XJ5A 2B9VA 4N0DA 1SJ9A 2R8PA 3ZWMA 1A4IA 1P4SA 3ITDA 3E18A 4V0LA 4PS1A 3SK0A 5EJGA 3LRTA 2OOSA 4NTZA 2H65A 2QJWA 3BHMA 1C3VA 3VNBA 5JI2E 3S2EA 5DE3A 3INRA 3B52X 3VDQA 5FUQA 4EKDA 3B1ZA 3KKMA 3Q3EA 5JI3E 1NHWA 1T2EA 1T3HA 1GSOA 2J3EA 4RD3A 3HB4X 4KFTA 2RKOA 3IDOA 5LYYA 2EFCB 1E9SA 4NESA 4DLUA 5KTSA 5EYPB 1N2ZA 3FBGA 3OCXA 1H05A 4JOSA 3LT0A 1BEEA 2I7VA 2NN3C 4CGYA 2I87A 2QW1A 3EULA 3E35A 1WWKA 5BMVB 4F60A 3F9CA 2MU1A 3R76A 3VO1A 4BEJA 2FF7A 4R8RA 4V3CA 3AVWA 2PMFA 1JKFA 1LH0A 1P9WA 1JFSA 4BNKA 3AF2A 3T3HA 3HJGA 3HVUA 2GQ0A 4IEEA 4MCHA 4EL5A 2QNRA 3UJNA 4GQBA 5D1HA 4OK3A 1YB5A 1JLRA 2JFPA 1C1DA 2ZR7A 2YWRA 3BS4A 1ZCAA 2A9VA 5U1PA 4AI6A 1DTSA 2CLLB 3HP4A 3OAAA 4JP3A 3T99A 1SB8A 3KKLA 4I1UA 4QGHA 5CT6A 1JV2B 1MEEA 1AZWA 4FD2A 1KGSA 4RZUA 1FW6A 2Z56A 3B78A 4FGWA 4JWKA 2LTAA 2IDKA 5FI0B 3ZCXA 1B1CA 3L7BA 2JI9A 1T5IA 1Y3IA 2CJFA 2QM0A 3UUGA 3LKZA 1UT5A 1RAHA 4JOQA 5BMOA 3V5NA 1H2WA 4D8XA 2O8EA 3AR3A 4QM7A 3OZGA 3FFWA 4M6WB 3DFIA 4UU0A 1IXZA 1G6HA 4J3NA 2ESRA 2R48A 3AVOA 3OY2A 5H59A 1IL0A 2GEKA 5AI9A 3T9BA 1M8GA 1ESDA 2CZQA 5AI5A 1UR5A 3DEFA 4CE6A 1UDBA 2IHTA 5IMSA 1W88A 1WQ3A 4L72A 4BNJA 4Y2YA 5JWHA 1E5LA 3ZV4A 2HLDA 2RONA 1JA1A 2ZIZA 5BYAA 3C8HA 4R83A 3AMVA 4UULA 3T7TA 3ICVA 1LLDA 4YNBA 1SOUA 3D1LA 2X0KA 4QQKA 1QWSA 4X71A 1S8AA 5L7TA 2X8JA 4QJBA 2GZ1A 3SS8A 1SD5A 4IYJA 3DZDA 4MCJA 2PUVA 3DDHA 4TVSA 5GJWC 1P5FA 2PQ0A 3ZXIA 5BWNA 2VKTA 2MINB 4HDCA 2DKOA 4YRJA 4PANA 5C8VA 1J9GA 3ADOA 1VPWA 3T5MA 1D9ZA 3DC2A 3RVSA 1VYHA 2JAXA 2NYVA 4F3YA 2P9EA 2Y8EA 1SUWA 4RZ2A 1TX4B 5ALUA 2CDCA 3PA6A 1NBOA 2BFAA 5HUJA 1KK1A 4XQEA 1JPNA 1W87A 3T3MB 3CF0A 5T64A 4YMTA 1JZSA 1YASA 3EXFA 3M4JA 4E08A 4FHFA 5IKPA 1NW8A 2BVNA 3W0LB 4EITA 2ZS8A 1DDIA 3IAUA 4O2BF 1IBRA 3FMOB 4TROA 4R0VA 4G8DA 4M49A 4KYTA 1N5DA 4BVAA 4CR8A 3UQYS 3GJZA 4Q82A 3F6CA 5IHXA 3G8CA 3IT0A 2H1FA 2BEUA 4FUTA 2X40A 1U0FA 4KLNA 4HMOA 4M86A 2D06A 2NZJA 2ZI6A 4MDYA 4MUIA 4TM8A 4KIUA 4DIMA 1EM8B 1WW8A 1CY6A 3HKEB 4EDHA 3F73A 3HA5A 4TTTS 2QRZA 3HNPA 5SV2A 1AKVA 1TVKB 1X7XB 1XU4A 2QMUA 5FHRA 4I5FA 3UMRA 4UFPA 2WG1A 4TL9A 1MAUA 2J32A 2H2IA 2JJ8A 1V1MB 2BUBA 5HTKA 3KOUA 4RIHA 3AIKA 3SHWA 1F12A 1SR8A 5HIKA 3I92A 4ANFA 4ADSG 5I7SA 3ADPA 3BAFA 4UM5A 3AP3A 4JLOA 4CM8A 3NRCA 4KQCA 4LNUB 1U9ZA 4M8IA 1K8QA 4NQRA 1XMQB 1EB9A 2WD8A 1UEXC 2C31A 1AKTA 3DBRB 4QU8A 3QTTA 4HTAA 2QAIA 4P4SB 3GFRA 1C0PA 5EXSA 4LZAA 5A04A 2PQ6A 1GUDA 1HBJA 1UUFA 3AFMA 1NZFA 2RAVA 2YMQA 1JJ7A 1XVAA 3OEHD 3QLVA 1YZUA 2FMXA 2XB4A 4NBRA 4X1YA 3ADDA 4DAOA 4IIDA 4N48A 2DQZA 5HOQA 3NTQA 4RMIA 4TTVA 2QHXA 1V5EA 3OU6A 1R9GA 4Q4AB 4UMEA 2G17A 3MOSA 4U5XA 4ZRMA 4RLQA 4ZO9A 4E2ZA 2ZYTX 4OLAA 3GRPA 5A6VA 3QMWA 4DEXA 4LC0A 8AT1A 4WD3A 4HT3B 3I28A 1GPWB 5E1DA 1X94A 2NO4A 3LPDA 4C9BA 1YVRA 1LX6A 3ZDYB 1I3LA 5DSZA 2JC3A 4BFTA 2JFYA 3DMYA 2BGWA 1Y6ZA 3CLVA 1YFZA 4ZC1A 3LZDA 4C7OA 3LQFA 1EFPA 4FDMA 3VKFA 3QPDA 2V4MA 3MWEB 3ESXA 5DM4A 5FWDA 1A5BB 4JLDA 4C4OA 4MW1A 2WJVA 4EI9A 2IL1A 2CCJA 3CO5A 1SCBA 1W76A 3LH5A 3NT2A 3RC9A 4DLYA 4TVOA 4CLXA 4G5OA 4DG5A 4EZEA 2GM9A 4E09A 5BQXA 1SBZA 2NAPA 3BORA 3IA7A 1OBCA 5BN3A 1OHHA 3F5DA 4PZCA 2AG8A 1JALA 1HT3A 5JG7A 1XLUA 3WWPA 1NMEA 1GOTA 4X7BA 3NC0C 4K1LA 4DCPA 5K6AA 3DW3X 4WH0A 4A6XA 5IM4A 2G9UA 2GB4A 1NI5A 3W79A 2ZJ2A 3PNMA 5A4FS 2Z5GA 1WUTA 3V7FA 5C1DA 4FYYA 2OT3B 1PZNA 2YCLA 1KZ4A 3JZAA 3VOBA 1G0OA 5KQPA 2FFRA 4H08A 4WZZA 2PFGA 1S3SA 2LE0A 3BIFA 4IGIA 3B1FA 1TU0A 2LV8A 4UJ5A 1PDOA 4JSYA 3N0RA 1U9JA 1XGKA 2JLCA 1R64A 4O59O 2WMNB 1ZH8A 2ZJ7A 5HRCA 5JBIA 3IMFA 1PJTA 4DIOA 4EHNA 1KJNA 1IPHA 1BGWA 3KBOA 3KSBC 3PC6A 4GGOA 3DZJA 3G1TA 4ZDJA 3CF4A 1PEKE 5EQDA 1QHXA 2IHUA 1HDYA 5CX1B 4M46A 4YXWD 4FWIB 1TW3A 3G2MA 3BUSA 4M83A 3E3NA 3GZJA 3UXHA 5CLFA 3EZ7A 3W5JA 2Z98A 1DO2A 1VE9A 3CMMA 3KM0A 5KNLA 1PT6A 2JB9A 1P39A 2X2OA 3CX4A 3K92A 1G3QA 5KAMA 5HHTA 1PQUA 3PEVA 1PVOA 1EXMA 1U8CB 1YD7A 4FEEA 1T9ZA 4OQFA 4RA9B 3UKOA 4KR7A 1KYQA 1QIJA 4XIYA 4ZQIA 1NPDA 1A9YA 1RQGA 1BWSA 4FEYA 2VYVD 5A7FA 2JGRA 2VAWA 2AN5A 2ZUFA 2FX5A 2P5YA 1ISHA 3NWPA 5AH0A 4ZKEA 4AF7A 5I3ZA 2DUUA 2PAAA 5LZ7A 4AVYA 4ZI3A 1QYCA 4EB3A 2AFRA 1WAMA 4LDNA 3MYRA 4PC6A 3O2NA 4BFCA 5B7NA 2VKQA 3ENWA 3BSYA 1JR3A 1KPGA 4NCNA 4DSZA 1RJGA 2RIPA 2HZ7A 4DV3B 1C8KA 2CLCX 2COKA 2ZRIA 1L7OA 2YY5A 3FWKA 4FZ3A 5AW5A 3X2FA 1WLYA 2RMKA 3IVCA 4MPRA 4F92B 5CM2Z 2A1UB 4OFXA 3ZWOA 3PU6A 4FFBA 3NUGA 1J0XO 1RYFA 3N6XA 4FYJA 1S3GA 1ULBA 2I6SA 2JCGA 3OFVA 1AGNA 4HWTA 4RV9A 2CMHA 3K15A 3Q4GA 4UXHA 5EE5B 4HV4A 2ORED 4NR0A 4H7DA 3RS7A 1UPFA 3B3GA 4BB6A 2ISSD 2LUOA 1A5SB 1M7BA 1UBMS 4NE9A 1VKNA 4TV9A 1JLLA 1KRXA 2J87A 2YZNA 1ZIYA 3QWIA 4F2PA 1OXVA 1Q15A 3TXAA 3NW9A 1JKJA 3HRIA 1I7QB 3KB2A 2HHHB 2X76A 2PLRA 2YZ7A 3TW8A 4CQLB 1P1HA 1NATA 5BY2A 1ADCA 1MOPA 5FOXA 5HF9A 2NZUG 5BV1A 1ZNWA 1SQFA 5A6SA 2PX6A 5I5EA 5IPFA 1YRHA 4ZO6A 1GRCA 2WA2A 4ZHQA 5AM2A 4WZBE 4LE1A 4OYLA 1YJ5A 3GRKA 5B4VA 1PT7A 3V42A 4NYIR 3WK9A 4Z9FA 3TNFA 2JFFA 3OLCX 1H2FA 3DDZX 4RWEA 1U3UA 4BQRA 4FFRA 2FZCA 2V7EA 2H1RA 3LUFA 3SM9A 1BWRA 3W8EA 4NRDA 1N2CA 1XQ9A 3PHCA 2LKCA 4KO1S 3UG7A 4IIJB 3PHHA 4D5GA 5BOSA 1AD2A 2IX9A 4ID9A 4QNRA 2GK3A 2CHVA 2I66A 1BD4A 1KZGB 4AWXA 4IIXA 4AXBA 3O93A 2LKDA 1PZMA 2BBWA 3WAKA 3WYGA 2J3QA 721PA 3PEFA 4NU0A 3GQBB 1MT3A 1UZLA 1NVVR 2PL9A 2ZIAA 4DIFA 1DWQA 3EVBA 3T34A 2Q6VA 3Q12A 2J0EA 3C3KA 4H6XA 4ROSA 5F21A 1RLIA 3Q9NA 2ACKA 1THZA 2PMCA 3IP8A 4R98A 4Y6LA 2R00C 4XYMA 4H60A 3NVKI 3F1LA 5CDFE 4LTDA 3G2KA 4PG6A 1ZW6A 2N47A 3PSHA 3QU9A 1SXJE 4X84A 2AMYA 3K2BA 3TL3A 3ZBPA 4FT2A 3O8CA 1XQVA 3O0TA 3MTDA 4AUEA 1K5HA 3UENA 5AHRA 3U7HB 1T8WA 4BRUA 3JZFA 3BDVA 1XLTA 3GZNA 1KEPA 3DDSA 3GNTA 5JECA 1ONPA 1RBMA 4WRRA 3U3OA 4AJNA 7YASA 4D7AA 5KYTA 2OC4A 3ABOB 3ED5A 4GECA 1KSJA 1DHTA 1UF9A 1E2NA 2A35A 3TAUA 4NZZA 4RH3A 2FDXA 5CH5A 3Q3CA 4G89A 4M7OA 4D98A 1J2EA 4EVQA 1GARA 1FA9A 1N7IA 1VHJA 2F00A 3KHKA 4ND1A 3L2OB 4C7MA 2EEZA 2ZRKA 5D3KA 1E1KA 3A3PA 1ZIOA 4LZNA 4OL0A 1Y6GA 4KHPB 2Z6QA 3OQOA 2ZRGA 3OZWA 2OKCA 5E3IA 1B41A 1MVNA 3FOAA 3MUEA 1MB0A 3R4VA 5FB3A 1IONA 2OVFA 4LDJA 1FEZA 1YZGA 4ZRNA 2FQQA 2EFYA 3PIRA 3RBZA 4G4GA 1U81A 1JYSA 1G60A 3D6NB 3ZQ4A 2EF0A 2H00A 2UZAA 2LDBA 3UB2A 1J70A 2G70A 2GJAA 3NYQA 3PZBA 5EWMB 1PUXA 5C8DA 1P1JA 4EO9A 4JP2A 3W3ZB 2BFEB 2GK6A 2A9OA 2HBQA 3DH0A 2C2KA 2D2IA 3TMKA 3OWHA 4H6PA 4MR9B 2VK1A 3COVA 1DT5A 1Z0JA 5JZ9A 1RPNA 5CB4B 1V16A 3VR4A 4DIBA 1AUPA 5JSKA 1DPFA 4R8SA 5KS2A 1EP2B 3NP9A 1G5QA 3ZDRA 4CIVA 2BPOA 1FDTA 4D1YA 2Z1MA 1VHWA 2FSUA 2HIHA 2QL9A 2YJ6A 1KMMA 2FZVA 3QUQA 4HH4A 3C45A 4N18A 4TMXA 4K9LA 5A5VA 3QFRA 4WLNA 1BU5A 1SPXA 2BY4A 1VSTA 1RYBA 1R7RA 1L4MA 4QSMA 5G0TA 4E2FA 2XHEA 1LBIA 3BZUA 1UJMA 3P2KA 4LX0A 4YJDA 3X0DA 4ONEA 1RI1A 2BHSA 2HY7A 3DPSA 4U8HA 3ZTWA 4N76A 1K97A 4GP7A 2JK0A 3TJZA 1P6QA 1RYHA 3W1VA 4BO8A 2C29D 1RZRA 2C5EA 3PDCA 2VDNB 2JJ2D 4EPYA 2G9NA 1J56A 1M76A 2P2SA 2WOJA 3GRUA 3FRJA 3C5WP 3OOJA 3B53X 1B8NA 4NXMB 4I9HA 1IH8A 4IL5A 4LMPA 4EFLA 1W5EA 3IAAA 2XOXA 5IULC 2BEJA 3BEDA 4ZI7A 3SEZA 4V1CA 3REOA 4OGGA 2NUPA 4Q9HA 1PYDA 2IS4A 1Z16A 2JVIA 5EJIA 4C21A 4G07A 2VRCA 4BUZA 1SVWA 4KTVE 4L1KA 5I7EA 2LBPA 3PDWA 3NYRA 5ES4B 3FDXA 3NU1A 1HFJA 1T3GA 2C0CA 3AEUB 3HHEA 2WB4A 3ANTA 4JYCA 4RZQA 1X2EA 1H2RS 3C6YA 1TA0A 3IOMA 4TZKA 4L4ZA 1HURA 4Q9LA 3RC3A 4UW9A 1SXQA 1CHNA 1DIAA 2ZI7A 3MT9A 3NM4A 2B6HA 1RWXA 4G26A 4NMHA 3D6FA 4Z0TA 2IH5A 3EPRA 1WCWA 3QENA 4KYVA 1A50B 3RREA 4OXXA 5F5NA 2E6UX 3FCAA 3FCXA 3KD3A 2ZTMA 4MLPA 1EFAA 1SZDA 2G1PA 2PV0A 1INLA 4I4TB 3D0OA 5C8YB 1TUIA 1ZFNA 4Q9JA 2ZE6A 4RKFA 4TTJA 3RV3A 3O03A 3NG1A 2D7DA 1JFVA 5FTWA 4BCDA 1KC3A 3CWQA 4G0QA 4XFKA 4NBWA 1CUJA 1TPYA 1G18A 1KVTA 1UFVA 3AXSA 4FMCF 3HG7A 4K3UA 4D3XA 2IXGA 5L6MB 1MA3A 3D0RA 3RVKA 3KG2A 2VT3A 2O3UA 2Q6OA 1CRZA 2IBMA 1VMIA 2B4QA 3E0QA 2BHRA 3ONWA 3ROPA 4MGHA 4UNQA 1BD3A 4OMFG 1F2UB 4QG7A 3SHTA 3I6BA 2CF6A 3A9CA 3KC2A 2XCUA 2YRFA 2M1ZA 3GXBA 3VHRA 4OQPA 2Y66A 4QO7A 1MW8X 1EFRA 3B2QA 1B8PA 2XTNA 4LJRA 4BNLA 1VIDA 1KMQA 4L4YA 1L5LA 2FEKA 2PO5A 2DCMA 4WINA 1JH8A 4B80A 1E3WB 3RF7A 4TTPA 4MHSA 4EVIA 3PJGA 5TT1A 4J4BA 3KS9A 1X7GA 4KUEA 3F0TA 1FVHA 1FNMA 1PEYA 2D0IA 2ZYRA 3R75A 3AOEA 4JITA 5FAKA 2XF2A 3EY9A 1JDNA 1RLTA 4OQYA 1F3LA 4QXMA 3HB0A 5AO9A 1Q22A 3B9QA 4BLWA 3T5PA 2B7LA 4LOHA 2J4DA 2AFHE 2DFPA 4DDTA 3HV0A 3RI3A 4WCFB 4ZVLA 3TLGA 1H0SA 4QGFA 4XFDA 5F98A 3JQCA 4LRTB 3UJ8A 4GYKA 2H5LA 5DX8A 3S27A 3WKBA 4PYJA 3FUCA 2A67A 4Y9TA 2GM4A 3C3BA 4D9BA 3I0NA 4YPOA 1ZD9A 2E4AA 2ZBUA 4MYUA 3R9WA 4B6QA 1T8RA 4TQAA 5JNRA 2W90A 4OD0A 1YQXA 5DRTA 1N36B 2PLAA 2GPJA 3CSSA 3NNNA 1FRNA 1THGA 1QS0A 3KKQA 4YJKA 5F4ZA 3U0BA 4PLPA 5CAEB 1AZSC 1N34B 3MWYW 2E5LB 4M4SA 3BB1A 1HRKA 3G5TA 1RYYA 1E69A 2A88A 3ZZUA 3MW8A 4E5NA 3DTTA 4R5MA 3P2MA 3GFOA 2RGYA 4QUKA 3F3MA 2C82A 3ZIAD 2HJ9A 3DG9A 3QEJA 4EWLA 1YJQA 4MGIR 1MNAA 1KE1A 3SX2A 3E48A 4WJLA 5KSYA 1N33B 3EPLA 5ITSA 4BLUA 3CQ9A 3L7MA 1X1TA 3L1UA 3WYAA 2XSZD 4D97A 5TC4A 1DZ3A 4OXYA 1L8LA 1EWKA 3ZVLA 3BICA 1YZ3A 2OXTA 1XHFA 2Z9BA 4K05A 2VJDA 5ANRB 2Y0CA 4I4LA 4I50B 1FFYA 2ZQYA 4TS4A 3JD2A 3LA6A 3NDPA 4Q9KA 3BWBA 1D6MA 3I12A 1SAYA 4YALA 2Q6TA 4AULA 1YQTA 5KVCA 1MCZA 4BWYA 1GNSA 4BN0A 3FZQA 2GCGA 3EYAA 4JQCA 5JSZA 3SJZA 3L84A 4U39A 4W1PA 1ZITA 3JD4A 4MQLA 2B5OA 2EDCA 4JR2A 4X91A 4KB5A 4C20A 1MAAA 1ZR2A 5KQSA 3K0CA 1VLZA 4JXXA 1GU1A 2BTQB 4AZ0B 3P20A 3QPCA 5BSUA 1TZMA 1K9SA 1RI5A 4O4JB 4Z2YA 3TTUA 4JI8B 1LQTA 1PLJA 3RFCA 3CEPB 4DZRA 3TBKA 1VYUA 4YRSA 4LF5B 1QNFA 1YHNA 1X7WB 4ZVKA 1M83A 3E9EA 1ONBA 1DKRA 3EH2A 3WWZA 3GEEA 1VFPA 4AJJA 1UC8A 3NRBA 2AI1A 5JATA 2OO3A 3R3WA 2OCYC 4U0KA 1F0PA 2CDRA 2RGUA 3MWGA 1XRRA 2XZDA 4P3NA 4MAMA