2BFMA

Leishmania major pteridine reductase 1 in complex with nadp and trimethoprim
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
283
structure length
266
Chain Sequence
VPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRGDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structures of Leishmania Major Pteridine Reductase Complexes Reveal the Active Site Features Important for Ligand Binding and to Guide Inhibitor Design
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 99
structure length 266
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bfmA00
1AGNA 1UDBA 2C5EA 4PN3A 2I9PA 5JCJD 2DTDA 1XEAA 3IKVA 3AUUA 2PH3A 2VYVD 2DBRA 2ZB7A 3H8VA 4Z0TA 3KV3O 1HDYA 3IDSA 1X7GA 4RL6A 2DBVO 4S3MA 5G4KB 1MXFA 2PD3A 4J90A 4N5LA 4O6VA 5CDGA 1E6UA 4TRRA 5KCZA 2EP7A 2VWHA 2CDCA 3ZWCA 2O4CA 3P19A 3BTUA 2H1SA 2IEDA 3WR5A 3KRTA 4IDCA 4FGWA 4Q9NA 3WJAA 1K6XA 3Q6IA 4FFPA 3INTA 3ZU5A 3ICPA 2E37A 4BHTA 2P9CA 3K8ZA 2D0IA 4CM1A 2AQ8A 3AJRA 4XYLA 4XJSA 1S6YA 1HSZA 1PL8A 1HT0A 4IMPA 2P4QA 2Y1EA 5LCXA 2DFDA 3BMNA 3DMTC 3ZWMA 4EZBA 2BFPA 1I2BA 1AUPA 2O3SA 1I2CA 4BB5A 1GDHA 4W7IA 4DC0A 1JWAB 2PGDA 3ONEA 2D1YA 1KETA 5MDHA 1NVTA 1P44A 3OM9A 4GGOA 3RUDA 5F5NA 2WDZA 1BG6A 5TJHA 3JYNA 4WUVA 4I5FA 4GAEA 1NFFA 3F1LA 2J5RA 3D0OA 2V6FA 2EKPA 4P8RA 3OA2A 3JD0A 3QWFA 1W0CA 3IUSA 2PV7A 4BKQA 3GG9A 4JK3A 3GQVA 1JWBB 1DC6A 1ML3A 5TLSA 1EK6A 3GHYA 3PYXA 3PZRA 4RCVA 4AJPA 2ZB4A 4OQYA 3I4CA 3IQDB 1PGJA 4NQZA 5C5IA 2V7PA 3U4HA 1PL7A 4YTEA 3NT2A 5C3MA 1E1KA 1GY8A 3JYOA 4CLRB 4IXTA 4L9RA 2ZJ0A 1MFPA 1IPEA 3D1LA 5IJZA 2HMVA 5CG2A 4MO2A 4DQVA 3NYWA 1VJ0A 3ZWBA 3V2HA 1I3MA 2JFGA 3VPGA 3ZWPA 2HCTA 3GDOA 1N7HA 3JQ7B 3TL3A 1I32A 3HQ4O 4KQWA 1SB8A 3JQAD 1Y8RB 5T8KA 3SX2A 3RASA 3MOGA 2B0JA 4E2ZA 5GZ1A 3ZU4A 3O38A 4R5MA 5IAAA 4ZVVA 2Q50A 1N8KA 3HFGA 4ZQFA 2O2SA 4PGFA 2WM3A 2Q2VA 4WE3A 4LN1A 4XYGA 3UOGA 3ZWNA 5JXWA 1B3RA 2CD9A 3EMKA 3WNVA 3R6DA 1HKUA 3TPCA 4J16A 3V2UA 4D0RA 1YBAA 4U8GA 3OETA 2HMSA 4YAIA 4BKUA 2C5AA 3PK0A 4CM4B 3KSUA 4AJJA 1Q2XA 1TEHA 4GWKA 4D44A 4BGIA 1LDGA 1UXIA 2NLOA 3TWOA 4BNFA 4E13A 4AFNA 5A05A 4BNVA 5A4DA 3UVEA 1A9ZA 1Q0HA 3VTZA 4HWKA 3RD5A 4NBRA 3I9LA 1JAXA 4ZJUA 4BIIA 3RUCA 2O4UX 1HDGO 4IPTA 1E7SA 3RBXA 1YJQA 5JS6A 4FQ8A 1O8CA 1QMGA 4TKMA 3HWRA 4R1SA 2C29D 3BHJA 2OXIA 1IHXA 2FN7A 3C8MA 3INGA 4R3WA 5EJ2A 4DREA 4DWVA 1Y8QA 3ADOA 1P9LA 5ITVA 4WKGA 2H6EA 2AG5A 3LC2O 1XSEA 3GEGA 4CUKA 4NFHA 1BW9B 3OIDA 5COQA 4CQLA 4FB5A 2X9VA 2JAPA 2HO5A 4YPOA 2D5AA 4BNNA 4UAGA 1B16A 2XXJA 4FOOA 1VI2A 1I5RA 1XQ1A 3L77A 4B8ZA 3PPIA 2Q1TA 1QKIA 4CLDA 2VRCA 3NEPX 4MKRA 1YVEI 2GYYA 3ENNA 1ZNQO 3E6AA 1P1KA 2RCYA 2X0JA 3PWKA 4DYVA 1P33A 4MVJA 4GX0A 3GUCA 4BKPA 1AHIA 1ZJZA 3ANLA 3PI7A 4UUPA 2QIOA 5JY6A 1Y9EA 3GMSA 3PJFA 3X2EA 4UEJA 3EUWA 4LCJA 5TGDA 1DC4A 3QW2A 2EKLA 1PX0A 3NT5A 1E7YA 2QZ9A 5HS4A 1F8GA 4ALMA 1M75A 2P5YA 2RHRA 1IL0A 4CL8A 2NUAA 3AUSA 2HJSA 1BRMA 2X9GA 2JCXA 3PJGA 5I9LA 4J0FA 3RUFA 3FNHA 3ZV4A 5FEUA 2HKIA 1UAYA 2GASA 1T4BA 3L9XA 5ICSA 1PJBA 5B4TA 1D1SA 3PQEA 3FTPA 4ND5A 4EYEA 1V9LA 2YQ4A 5DDIP 3LC7O 3ZCXA 3G49A 3WYBA 4DMMA 3KETA 3EVTA 1LXCA 3CE6A 2GN6A 3PHJA 4G81A 4BNTA 2QHXA 3FI9A 4D3SA 4WLEA 1ENYA 4N54A 3LVFO 1NHWA 2IZ0A 4NG5A 3VKUA 3VH1A 4XEHA 1P1IA 3OFSA 4LISA 2X0IA 2X4GA 4YT5A 1LRJA 4TRNA 5BSGA 4YA6A 2NTVA 3F47A 4NFYA 2FR0A 2OHXA 3JCZA 1TXGA 1WAMA 4BV9A 4CUJA 4J6FA 2IXBA 1FXSA 2Y1CA 3KUXA 3T7CA 3EHEA 3AY7A 4DLBA 5JAZA 5A02A 4WASA 3NGLA 4ONEA 1YDWA 4WECA 4INAA 3EK2A 1MX3A 2D4AA 2B36A 3DBRA 3I1JA 3OIGA 3JQBC 4E31A 4RDIA 4E5KA 3GG2A 2DT5A 5AQ1A 2FWMX 3I23A 3WIDA 1T2EA 2HQ1A 3VZRA 1SOWA 2IODA 4FR5A 4OSPA 1C0PA 1MA0A 2C0CA 3BYZA 3FWNA 1LDMA 4YJHB 4PLFA 4JBGA 1F0YA 1T2AA 4AVYA 4KOAA 1NNUA 2Y99A 4B3HA 4RPHA 4D7AA 4JIGA 3OP4A 4ALNA 4R1NA 1DB3A 4BV8A 3DZJA 3V5NA 4EEXA 4DQUA 4GKBA 1YO6A 5FFFA 2PD6A 1HE3A 1P0CA 3O26A 5IXYA 1T2CA 2WSBA 2XXBA 1LRLA 3WBFA 4CLRA 1VM6A 4DUPA 3IKTA 2YV1A 1GV0A 1LQUA 2BI7A 1DAPA 4HKTA 3JD1A 3QWBA 3OSUA 3QVWA 3MEQA 2OMEA 3H9QA 1KVSA 1NPTO 2VHYA 2IXAA 2ZCVA 3WG9A 3V1YA 4CMGA 2QX7A 3C7DB 1KC1A 4EJ6A 4J1QA 3JQ7A 4AJ4A 5JW6A 3QWIA 4NR0A 3RQSA 4IQGA 1Y8RA 1Z75A 4AJIA 3SJ7A 2EW2A 2VHWA 4MVJG 1CEQA 4E30A 4A27A 4TKLA 4P22A 2FMUA 4OJNA 4DXHA 4M8SA 3OQ6A 4CQMD 1WW8A 2X9NA 4GX1A 2GZ3A 3WX0A 1P1HA 4IZIA 3HFSA 3FBTA 3EZYA 1HZJA 4B3JA 2UUOA 4P4NA 5DBGA 1IUKA 1LC0A 2JD1A 5KVQA 4BO2A 2B5WA 5T57A 3R3JA 9LDTA 2JD2A 1LJ8A 5K6AA 5IDQA 2C2XA 5JNLA 1V3UA 3OMLA 3F1KA 4CM9D 1X7HA 2D5CA 4YWJA 1I30A 4QFCA 3FNEA 4TWRA 4B7XA 4J3FA 1DJNA 3GR6A 4Y6RA 3A9WA 1WMBA 3MJSA 2RHCA 4WLVA 5DBIA 5AYVA 1G0NA 3AUAA 3G17A 3P7MA 2D8AA 3D3WB 3IP1A 1YWGO 1E3IA 4R5HA 1DIBA 1V3VA 2NU7A 3RVDA 3PHHA 4J43A 4YJFB 4FIZA 4BNZA 4BNWA 2G82A 5A9TA 1ZK2A 3NRCA 4PG5A 2OOSA 3OQBA 2GR9A 3EDMA 4LGVA 1ADBA 3G0OA 1TT5B 1QXSA 1UXGA 4J91A 4RGBA 2NU8A 2J3KA 3OEWA 3AOEA 1KEUA 2NADA 4I5GA 1P1FA 3AFNA 1BVRA 1TT7A 1J0XO 4N18A 2CDAA 3WMXA 3H3JA 1N1GA 1WMAA 4P4LA 3UCXA 2VWQA 1F17A 4R1UA 3RC9A 2HLPA 4MVJE 4W6ZA 5CEEA 1ORRA 3VPSA 3VPXA 4IQ0A 3D5TA 2NV6A 5GMOA 5JC8A 2JFHA 4RVUA 3HNPA 4BQRA 4MVJH 1GCOA 2W8ZA 1KVUA 1QYVA 1R6DA 2OUIA 5A5EA 5JLAA 3CSDA 3O03A 4E6PA 4PLCA 4PLHA 1GUFA 4E4YA 2CFCA 3JYPA 1C3VA 4RV9A 7MDHA 3GNTA 1R0SA 2OGUA 1B2LA 1N5DA 5FI5A 1CQJA 2YDXA 3PXXA 4J9UE 4ZQGA 3DHNA 4DLLA 3B6ZA 1NWHA 4CV2A 1GU7A 1KVQA 3KBOA 4NBVA 2B83A 3TNLA 4A26A 3KVOA 5KTKA 3W8EA 3K96A 4CMEA 1DIHA 4J2HA 4OQZA 3WMWA 4AJEA 3KO8A 2Q99A 1YL7A 1G0OA 4XR9A 1V3TA 4Z3DA 1WZIA 2QYTA 4WEQA 4BB6A 4PRKA 5CDYA 4Z6KA 1E6WA 3IJRA 4HADA 3FPLA 4BO3A 3RROA 1Y1PA 2OORA 4RJTA 3GVXA 1ZKMA 5IN5A 2X22A 3I3OA 4FFLA 1QRRA 1EDOA 1A72A 4KDEA 3H9JA 2R00A 2NVUB 2PY6A 1EDZA 3K31A 2EHDA 1GTMA 3Q11A 1C14A 2J8ZA 1CF2O 1LLQA 4MJLA 2BGMA 1NM5A 4IMRA 4BGVA 3JTMA 5I7SA 7ADHA 5MGBA 1C1XB 1B0AA 4WCFB 4IINA 2O7QA 2Y05A 3C1AA 4IIUA 4ITUA 5ER9A 3L6DA 4NBTA 4RQUA 5DNAA 2XOXA 2P91A 3RSHA 3FR8A 2ILTA 1UP6A 4DBVO 1HSOA 3LT0A 4TVBA 3BMNB 1FK8A 5TQVA 1YKFA 1J49A 1B15A 4IJUA 1SC6A 3P2OA 1P77A 1QLJA 4UEKA 1QP8A 2X5JO 3AFMA 1Y5RA 4FFOA 5JBIA 5L7YA 3HDHA 3UUWA 1FDWA 1PU2A 4RZIA 3RJ5A 4XQ9A 3W1VA 3WFIA 2I5PO 3WJ7A 1WZEA 4L4RA 4YJHA 4DGSA 1LSJA 2DFVA 2DPGA 3TOZA 1I24A 4GVLA 5ES3A 3SC6A 3DMYA 5F1OA 5JFOA 1PQWA 3E9QA 1ZSNA 3HHPA 1V35A 1DBVO 1M6HA 5F3RA 5G0TA 3KYDB 1O6ZA 2GSDA 3DOJA 4XQCA 1K0UA 3JQ8A 5IZCA 2C20A 4NK4A 5JO9A 1O0SA 2BKAA 2VYND 2R2GA 4HBGA 1ZMOA 2V65A 2YFQA 4NPCA 3NDIA 4Y6SA 1Z73A 5C7IO 2P2SA 3TL2A 4BNKA 4DVJA 2O3JA 1LSSA 4BO4A 2Q1UA 3Q3CA 3CIFA 3FNFA 2RH8A 3B70A 3UF0A 1ZIDA 3U62A 5H82A 1EQUA 1PSDA 2A4KA 2NM0A 4R41A 3PYLA 3GVHA 4OYRA 4DIOA 3WGQA 2GCGA 1YQDA 1W4ZA 4IBOA 3GVIA 4TZTA 2CZCA 3ZV3A 1C0IA 4YYZA 3ZNQA 2YV3A 5L51A 2CDBA 3MTJA 4BVAA 1UXHA 2IRWA 1YJ8A 5DULA 3M2TA 4Q3AA 1DAOA 2EP5A 4J4HA 3MWDB 3OA0A 2NVBA 2X5OA 1M67A 2BGKA 1KEPA 2ZTUA 3VPHA 5DOVA 5I7VA 1N7GA 4ZRMA 2UV8A 1DFGA 4IS2A 4M1QA 4RVHA 2AEFA 3KOUA 1DEHA 3G79A 3GY0A 4ND1A 1EK5A 3AM3A 3ZWXA 2EXXA 2W2LD 1XHLA 1CQIA 3DAPA 4NZ9A 4Q3CA 3OQ1A 2PGLA 4XQEA 2FSSA 3WSWA 1Y6JA 1EQ2A 1BTOA 1H0KA 1L7EA 4BO6A 3WICA 2G5CA 2RH4A 3P2YA 4UVIA 5IG2A 1ZXLA 2Z95A 3QVTA 2IDZA 4BNMA 3JQCA 3AI3A 4J1NA 1MG0A 4YJFA 3NDRA 2VTEA 4E5PA 3DXFA 2G17A 1PJQA 1LDEA 3FF4A 3O8QB 1U3TA 4IZHA 3NUGA 1IYZA 2VNSA 2Q2WA 3PJDA 4EITA 3G3EA 4FGSA 3KEQA 5TS3A 1SNYA 1OBFO 1VPDA 4NU6A 4WOKA 3ZHXA 4YRBA 2NTNA 3AM4A 4M54A 3PQFA 1NAIA 2HAEA 3WXBA 1GL3A 3BIOA 3LT1A 4BO1A 5FWNA 3SLKA 2GUGA 1YH3A 2BI8A 2RIRA 2DQ4A 4Q3NA 3AI2A 2C07A 4H3VA 3WNQA 2GERA 3ZNOA 4C7KA 3FBGA 1HZZA 4MOWA 4DLAA 5DZSA 5ITWA 2VCYA 1MP0A 1W73A 3RBZA 3UFXA 2Y66A 1PEDA 3F4BA 5COBA 5LDHA 3EVNA 2OP0A 4B4VA 1E3EA 2VHZA 3VZSA 3GMDA 2Y0CA 5KJFA 4QX6A 4XQGA 1XCBA 1NVMB 1HE5A 5B4UA 3C7AA 2X23A 5G0SA 3K73O 3PTZA 3BTVA 1WDLA 3C1OA 3TJRA 4IIVA 2B35A 1HWYA 1ZVMA 4BO9A 2C7GA 1P0FA 1E3SA 1VKNA 3E18A 1CYDA 2P9GA 5I8WA 1ZMTA 1ULSA 4CV0A 5T6BA 4NJOA 1T1SA 4ALLA 1QV7A 3KYCA 4IM7A 3WTBA 3ZI0A 5AXDA 2YUTA 1ZK0A 3ITKA 4DL9A 3PGJA 1EUZA 1ISGA 2JAHA 3RWBA 4DMLA 1TB4A 3ZHYA 4ND3A 4CLXA 4YT8A 2VZ9A 1B26A 1SZJG 5TSDA 3GLQA 2NVUA 3CZRA 4IGEA 4J1TA 4E3ZA 3QVOA 1XGKA 4YJDA 2P5UA 2X1HA 5EPOA 1E7QA 1QLHA 3RAJA 3ZWVA 1C1XA 4IY1A 4PLZA 4RF3A 1NQOA 4WCFA 5C7LO 1ZH8A 2Q4EA 4M49A 3LDHA 2HMTA 2CVOA 1LRKA 3HE3A 3KEOA 2PH5A 3IOYA 5DOZA 4UUMA 2WWRA 3CINA 1EUCA 3JQ9C 4JN6B 4CR6A 5JYDA 2O48X 1UXJA 1U3VA 1TVEA 4GX2A 5KWEA 2DBZA 2FZEA 1R66A 3BHMA 4BMSA 3DBRB 4LRTB 3E9NA 2FY8A 2DBQA 2J5QA 3Q0EA 3DFZA 3IIEA 4BO5A 1RM4A 1P45A 4CJXA 1XIVA 2VUSA 2Z1MA 3BTSA 3PLRA 2I66A 1IB6A 1K2WA 3FD8A 1Q7GA 4CM3A 4P38A 3UGKA 1UH5A 1V6AA 1PZFA 2V6GA 2E82A 1GD1O 3QV1A 1OOEA 4TQGA 3DTYA 1I8TA 3G1UA 3KYDA 4ZA2A 2AE1A 4O5OA 3L4BC 4GSLA 1DFHA 4QTZA 4FW8A 2G76A 2QW8A 2JCVA 1MGOA 1VRWA 4J0EA 3I9NA 5TRTA 5ILGA 2EEZA 2F00A 4FFNA 3DWFA 3LT4A 1GFSA 3O9ZA 3V2GA 4OOFA 3LLSA 3V1TC 3JQAB 2NTJA 2BMAA 4WLNA 1KOLA 1U1IA 5EMHA 4BOYA 1KEVA 1MG5A 3CH6A 3K5PA 4H15A 3SEFA 3VH2A 4N5MA 3PYMA 1MB4A 2A9FA 1DRVA 1DXYA 3ZGYA 1M2WA 2YQ5A 3PFFA 4HX5A 3V1UA 1I33A 1U8XX 2O50A 6LDHA 4B8WA 4CV1A 1NWCA 4J2OA 3VHRA 1ONNA 3GPDG 1EZ4A 4FFMA 4U5QA 2GO1A 5IFLA 4XIYA 1YOVB 3WGOA 1XKQA 1N9GA 1SOVA 4UREA 3GA0A 1V8BA 4WJZA 4MP6A 2PKRA 2Y68A 3JQFC 5C7OO 2DAPA 3W6UA 1MFZA 4RPKA 4CR8A 4YAJA 3MZ0A 5JDCC 3WDSA 4CMIB 1PZHA 3ABIA 3DQPA 3PWZA 3K2BA 2GN8A 2C59A 1QYWA 4M87A 1FDTA 4IUYA 1C1DB 4O63O 1YRLA 1I3KA 2BH9A 3KTDA 4CMCA 2AW5A 4TVOA 1ULUA 3ITDA 4MKZA 3EGOA 5J23A 3O8QA 1A7KA 1EBUA 4FJ0A 4OGWA 1MLDA 1LLUA 4LCEA 4EGFA 3NX4A 3NT4A 3JSAA 3MJCA 1QR6A 3M1LA 4CL3A 4XB1A 4MVJM 3NTOA 5T64A 2UYYA 1Z7BA 3RCBA 2YJZA 2DPHA 3WWYA 4EUFA 1LEHA 2EJWA 2FPGA 4J7UA 3FR7A 5EN4A 3ASVA 3ON5A 1LDNA 1G6KA 3QVSA 4ND4A 3WGHA 1JKJA 1ZZEA 3DFUA 3TOXA 5B4VA 5T5QA 1O5IA 2Q1WA 3SXPA 4IJKA 1WDMA 1T4DA 4FPXA 2X7HA 4EJ0A 1YONA 3DZIA 3S2GA 3I5MA 5AVOA 3GT0A 9LDBA 1ZUD1 4PVDA 2PGJA 4XIJA 1KVRA 1XYGA 3DOOA 3ZH2A 3ZW9A 2Y0DA 1UDCA 4NJMB 4OXKA 1X1EA 2C7VA 3ZWYA 1UJMA 1IZ0A 2TMGA 4YR9A 1VL8A 1E7MA 4I5DA 1WNTA 4K28A 2EIHA 1RM3A 3WGIA 3HSKA 1KY5A 4S1VA 1U4OA 1GR0A 1E1MA 5JCJA 4YBZA 3OJFA 4AJNA 1IHYA 3AW9A 1H6CA 2V6BA 4ZD6A 3ZN2A 5CHEA 1KYQA 4RPLA 2HSDA 1M6WA 2AQIA 2VYVA 3B1KA 3I6QA 1DFIA 2YY7A 3H9UA 1DDOA 4DRYA 3WQRA 4EUHA 5HRUA 2FR1A 2ZK7A 4WGGA 2H5LA 4NHEA 1DPGA 1WDKA 4PZDA 4D3FA 3AI1A 4FJ2A 1SEPA 2OL4A 2Q49A 1X14A 1ARZA 1NYTA 1Z74A 2D3TA 4U6SA 4YCAA 4XR4A 4L74A 4JBHA 1B8VA 1DC3A 1YBVA 1KVTA 3H7AA 1ZFNA 4ID9A 4J4BA 5BNTA 4PLPA 1ONPA 2VQ3A 4Q3DA 1L7DA 1NVGA 3M6IA 2VOEA 4Z9XA 1U3UA 3W8FA 3I52A 5ENVA 2PKQP 2YW9A 1PTJA 2ET6A 3F5SA 2Y93A 2ZTVA 1DHRA 1FDVA 1NR7A 3RJ9A 3E1KA 4YAEA 4R16A 5JAQA 4NU5A 4Z0HO 5KNLA 1A9YA 2NSDA 3K30A 4OXYA 2H63A 4J4TA 3W4IA 1Q1NA 4EW6A 3O4RA 3OJLA 3CZMA 2W4QA 4BUCA 4M55A 4W4TA 3D5QA 1PJ3A 4QSMA 1ID1A 3IJPA 5L4NA 1FMCA 1Q7BA 2B4TO 2P68A 5DP2A 3ZDFA 1BGVA 3GRKA 1HXHA 3E03A 3Q9UA 1ENZA 2Y1GA 4D45A 4N5NA 3IC5A 1DRWA 2A35A 5F21A 1HYGA 2YDYA 1YDEA 4LVCA 3QWHA 3ZW8A 1YL6A 4Q3EA 3RU7A 2BHLA 4EJMA 2O23A 4RF2A 4CM5A 1DHTA 2VT3A 3JQ8B 3QVXA 2QG4A 3BTOA 3H65A 1JU9A 2YV2A 2BFMA 4N7RA 4LSWA 3W4KA 2JKVA 1AE1A 4WK6A 2GRAA 1EVJA 2FOIA 4B4OA 4RVSA 2D59A 1F14A 4PG4A 5BSEA 3QRWA 4XCVA 1DOHA 4F6CA 4RVDA 4FS3A 5A03A 3JQAA 5CDSA 1X1TA 5JY1A 2WYVA 1YL5A 4RVGA 2VUTA 3W8DA 3WGGA 2FR8A 1K6IA 3H5AA 1GEEA 3SJUA 4CQMB 4PG8A 3H9EO 1GUZA 3OECA 3I9OA 3QP9A 4HNHA 1W6UA 1CRWG 3KLMX 3PEFA 5L4SA 5GZ3A 3DMTA 1DC5A 3CUKA 4JP2A 3RUHA 1YB5A 1ZCJA 2OP1A 2CMDA 3E9MA 5KVCA 5I7FA 1YOVA 3U49A 1T25A 2DC1A 3JQDA 3S8MA 4XRGA 3U9LA 2B37A 3QIVA 3D4PA 4E0BA 2X5KO 3MWEB 3OHSX 1K89A 5CPFA 3IL2A 3VH3A 3RUEA 4OO3A 3MTGA 2LDBA 2ZCUA 4YXFA 1H93A 2O3UA 4CMKA 1NFQA 2DUUA 3BA1A 4CMIA 2GNAA 4J9VA 4XDZA 4W7HA 3U09A 3ORFA 1X15A 3FCOA 1GZ4A 4RO0A 1ZBQA 4A2CA 4F46A 5G4LA 4LSMA 2LDXA 3QQPA 1C1DA 1EE2A 1LUAA 1R4MA 2Z5LA 3QWAA 5KKCA 1RPNA 4K26A 4Z9YA 1GYPA 2E48A 1S7CA 3RU9A 1SPXA 2I6TA 3E82A 3ZHZA 2FHSA 5B12A 4WEOA 1RYEA 2Y67A 3DZFA 3GN2A 4GMGA 3PIIA 1PS8A 3A06A 4IXWA 3V8BA 4A73A 3A1NA 4D0SA 4XD2A 3VC7A 3PDJA 1U5AA 4KZPA 5JDIC 4J7XA 1HDXA 1JTVA 2NQ8A 4I1IA 2EV9A 1DRUA 2CSUA 1KEWA 3T7EA 3TSCA 4IJVA 1GCUA 1KBZA 1UR5A 4DQXA 4WNCA 3ETDA 3PGXA 3ZV6A 1HL3A 3DONA 4MINA 1UP4A 1WVGA 5BNIA 3I83A 4UVHA 4U6QA 3VTFA 3H6KA 4QXMA 3DZGA 2Y1DA 4L4XA 5T67A 4H7PA 3LYLA 1D4FA 1Z82A 1NQAO 4CLOB 5U4QA 3GDGA 5F1KA 4TRMA 3OJEA 1GYRA 4DIFA 1LI4A 5A3VA 3WWZA 2Q2QA 4PG6A 2ZQZA 2X6TA 3JD2A 4XX0A 3BZUA 4NJMA 1T2DA 5ADHA 3JQFA 1LQTA 2PD4A 4Y6PA 4GLLA 4ZHSA 1B8UA 2CF5A 5JDCA 3HDJA 4D41A 4OSOA 1X0VA 5BNFA 1F8FA 1O95A 5FF9A 4W9NC 4NNJA 2I76A 3WB9A 2P4HX 3WOHA 3EZLA 3E5RA 1YBMA 4OOEA 2JL1A 4R4JA 1H6BA 5CPBA 2WYWA 3GUYA 3C85A 3ROPA 1KY4A 4WOJA 3OH8A 5I7EA 1RM0A 3KYCB 3PJEA 2VZ8A 3UKOA 3I9MA 5JMWA 1A7AA 4C4OA 4KDFA 2PK3A 2XF8A 3CXRA 3EC7A 3F46A 1GPJA 1PR3A 1OC2A 5L3ZA 1PJCA 5IDWA 2QRKA 4OKIA 1JLLA 2X0NA 4XGKA 5C37A 3FPCA 3MOIA 4R9RA 2NU6A 3RC2A 2VNAA 1MXHA 1Q7CA 4ESOA 6ADHA 2A92A 1E0DA 1VSVA 5HBRA 4MIYA 4GWGA 3LQFA 4Y67A 4GKVA 1HF3A 3JQEA 1EUDA 2J3JA 2ZTMA 1I36A 3L6OO 4E2YA 3LF1A 4E2XA 1N1EA 1ADGA 1O9BA 4AG3A 2EGHA 2PFGA 3VVBA 1LLCA 1W8DA 4NBUA 1ISJA 1R37A 3SBOA 1WPQA 2AG8A 3GZ4A 3NJ4A 4NMHA 3GGGA 3HUDA 3AUTA 2JHFA 3GNSA 4E33A 4FC6A 1DO8A 3C24A 4BNIA 1JA9A 2GZ2A 1PJ2A 4OL9A 4QO8A 3TZ6A 5A5FA 3ZU3A 3FTNA 4BGUA 2E4AA 2Q3EA 2ZKLA 1B3BA 2QZZA 1XA0A 2POQX 2B69A 1UP7A 3MJ4A 4HFRA 3ASUA 1T2FA 3N74A 1I2ZA 1PIWA 1TI7A 2ZB3A 3BMOA 3P5SA 1OMOA 1YQXA 4PLYA 4F3YA 1U2GA 4L73A 1P1JA 4NI5A 5TC4A 1GUYA 1YS4A 3Q1LA 3NJ8A 1L1FA 2EERA 4BNHA 5L95A 4BO0A 1LDBA 4LRSB 1NFRA 3NTQA 1VC2A 2AEJA 4U7WA 4O59O 1C0KA 2HK7A 4CQMA 5JPIA 1GZ6A 2PWZA 2YHUA 5B37A 1QORA 5KJ1A 5K9ZA 1Q0QA 2BELA 3PLNA 3LZ6A 5AXCA 5KKAA 2VOJA 1VE9A 3H5NA 4HV4A 3H9GA 3GVPA 3S2IA 1YB1A 2CY0A 4XJTA 4B7CA 1JKFA 1HE4A 1E3LA 1VKOA 3JQBA 4CM9A 5JAIA 1N9GB 5ENDA 4HY3A 4E5NA 2YYYA 5EQFA 5JYEA 5L53A 1T24A 3ZWOA 3VZPA 3W6ZA 3WBBA 2YHIB 1FJHA 3T4EA 4B3IA 1PS0A 4JQCA 3RKUA 1E3JA 5ER6A 4JNKA 3COSA 4BS9A 3GZNA 4DPMA 3PDUA 4IDAA 1ADCA 2A94A 1HYHA 3A4VA 2NWQA 2HJRA 4LMPA 3H2SA 3LSYA 3JQGA 3GDFA 4G65A 4E5YA 1WP4A 1PGPA 4KUGA 4CODB 1E1NA 1VL0A 2FPPA 1PGOA 4XKJA 4ALKA 5CEFA 2EWMA 4CR7A 1CERA 4XDYA 4YT4A 3L6EA 2I3AA 3UCFA 4ZGWA 2VUUA 2B5VA 1BXGA 3UICA 1U7TA 2EGGA 1KC3A 4E32A 1Y81A 3DL2A 4OHUA 1DJQA 1Z45A 5A9RA 4K6CA 5IDXA 5HA5A 1OFGA 4NFSA 3OJ0A 4A7PA 1XR3A 2SCUA 2HUNA 4E12A 4Y9DA 4YJGB 2C82A 4PIVA 3QLJA 2Q46A 3U3XA 2GGSA 1E92A 3IAHA 3ZWWA 2PZMA 2OBNA 1ISHA 4CLOA 1QSGA 4YB8A 3QY9A 3DR3A 4E21A 3QHAA 1JQBA 1RJWA 5CAEA 1VJTA 2G0TA 3UXYA 3A14A 5I9MA 4ZN6A 3GNQA 1U7HA 3L07A 4TZKA 4A10A 1QYDA 1YE3A 2WD7A 4WLFA 5CFZA 3Q2IA 3VDQA 4R01A 1E77A 3KZVA 3A28A 1AHHA 2DLDA 4D43A 4ROSA 2ZB8A 3AM5A 3F3SA 4KMSA 1ZSVA 1NTOA 2VRCD 1H6AA 5I9NA 1ZEMA 3NGXA 4XYMA 2HDHA 3TZKA 5GY7A 4CMAA 3U4CA 4MVJD 3MJTA 1PWXA 1PZEA 4ND2A 3DTTA 3GPIA 1V0JA 4A5OA 3M2PA 3DO5A 2R6JA 2EW8A 4OMUA 4ALJA 3HG7A 3S2FA 3KB6A 2J3IA 4F6LA 5A1TA 2PTGA 1A27A 3DB2A 4KP7A 5IDYA 3U0BA 2Y0EA 1GQQA 2OBYA 3TFQA 1WXDA 4IDDA 3TDKA 5DCWA 1AXEA 1XG5A 1F06A 3GGPA 5DF1A 1LBEA 3HJAA 4JROA 4KUHA 1FDSA 5ILOA 3TN7A 3KXDA 1U9JA 3TRIA 1YB4A 3RUIA 2B4RO 3QE3A 2QRLA 1R16A 4BO8A 3F9IA 1U4SA 2UAGA 5H81A 4GL4A 1DIRA 1DIGA 4YVFA 4OKNA 3OBBA 4JBIA 1EMDA 4CPDA 2D2IA 1E7RA 2XAAA 2DTXA 2DU8A 1I0ZA 5JC1A 3MJEA 2JHGA 2PR2A 1EVZA 4PLTA 4W9NA 5TX7A 2VT2A 1JDJA 2WE8A 2RAFA 4MVJP 1EE9A 2PZJA 4KTVE 2P9EA 8ADHA 4Z0PA 2VYNA 4DC1A 3GF4A 1J4AA 2AMFA 1J6UA 4II2A 4XZ3A 1F12A 3JD3A 3PP8A 5B1YA 1N92A 4D42A 4CLHA 2IEBA 1H2BA 3DHYA 3UW3A 5K6AC 1D3AA 1E5QA 4RDHA 4CUZA 3HDYA 4FC7A 2PZKA 1XWFA 4XGIA 2Q4BA 3WS7A 1HETA 1OC4A 3PHIA 5CG1A 8LDHA 5A3JA 4OH1A 5DBFA 4K1LA 5IZ4A 1KERA 5L9AA 3L0DA 1LDYA 2DKNA 5U9CA 4I8XA 3NKLA 1A4UA 3WGTA 2O3QA 4D79A 1A71A 4AJOA 1ZK4A 4EUEA 1OI7A 1QV6A 2PKQO 3ST7A 1NBOA 5TT1A 1QYCA 4OM8A 5BQFA 4URFA 3RFTA 4QQRA 2Z1NA 1IULA 2I65A 4HXYA 1ADFA 1IOLA 4TSKA 3GH3A 4ZQBA 4W82A 2B4QA 3KSZO 1O89A 4L4SA 3AOEC 2W2LA 5F1PA 1ISFA 3CPSA 1R4NB 3STHA 4MP8A 1LX6A 1SMKA 2YHIA 1NHGA 4XA8A 1G1AA 1DLIA 1U5CA 5L45A 2DTEA 3CKYA 5CP8A 1MC5A 1U8FO 3ULKA 2VTDA 3UH1A 4G5HA 3F5QA 2GDZA 1KIFA 4CM8B 1IZ9A 1R4MB 1RWBA 2G1UA 1PGQA 3IP3A 4FD3A 4PZCA 4HFMA 1SAYA 5AOVA 2BFAA 1X13A 2BGLA 2E6UX 3ONFA 5G0VA 2Q45A 1AXGA 1CETA 3WTCA 2BF7A 1P31A 3GVCA 2QYSA 1NR1A 5L40A 2OZPA 1GV1A 1CWUA 3LU1A 3D4NA 1GZ3A 2GN9A 3I9KA 3DAFA 3B20A 2W2KA 4QO7A 3DC2A 4CMEC 1GQYA 3W4JA 4O0LA 4DBZA 2IZZA 3C1TA 4YJGA 4XYBA 4B79A 3QA9A 1D1TA 1FDUA 3BAZA 5FYDA 5LDGA 1QG6A 4IS3A 2FPIA 4Y8VA 2JD0A 5EESA 2AHRA 2FRDA 2YFHA 3F6YA 4PCVA 1GPDG 4GGPA 5COAA 2ZATA 3PQDA 4QECA 1ZEJA 1ZK1A 2AEMA 3H5RA 4D46A 3H4VA 3EAGA 1E5LA 3LF2A 4U0KA 2R00C 1YQGA 4JP3A 5TNXA 1B8PA 1LTHR 2FSVA 1D8AA 4L75A 4F45A 1CIVA 1KS9A 4QUKA 4GH5A 2VHXA 3ROQA 4ZQHA 3DAGA 3ZNPA 4NDNE 5TF4A 1NPDA 2RBEA 3FWZA 4JCOA 4XYEA 1BVUA 1HDRA 2W90A 3Q2KA 4IGFA 1JAYA 3RKRA 2VHVA 3GAZA 2JCYA 5EINA 3DHEA 3PHGA 4ZQEA 4FSHA 1E3WB 2VWPA 1PJ4A 1WLYA 4A0SA 3PRJA 4I9NA 4R3NA 1BDMA 2J6IA 1TA4A 3HDQA 5AXBA 1EEHA 2IYOA 1NQTA 4GQAA 4PG7A 5JO0A 5CDTA 4ZU3A 3GGOA 1BWSA 5TIIA 2TMDA 2VZ0A 3BMQA 3NAQA 1LSUA 3S2EA 2CF6A 3ZWAA 2BFOA 4HFNA 1K6JA 4WLUA 1RM5A 4QEDA 1CDOA 1QYXA 4MKXA 3VOSA 3F4LA 3HZZA 4EBFA 3H2ZA 2QQ5A 3DBLB 3QSGA 3RFXA 5BSFA 5BSHA 4PVCA 4ALIA 1Y7TA 2VN8A 2YZ7A 4PZEA 2BRUA 4B7UA 3UAGA 1PQUA 4XWYA 4AL4A 3N7UA 4LMRA 1UAGA 5IZCC 1NQ5A 2WTBA 3IMFA 1N2SA 1GADO 5F5LA 3TQHA 4CV3A 4UVEA 1EVIA 1Z7EA 5G4KA 3WGZA 2X58A 3Q9NA 4I9HA 2ZIZA 1E6EA 4EI2A 1PS9A 4FJ1A 3GK3A 4YT2A 2O3TA 5KIAA 1XU7A 2W98A 3GEMA 4EDFA 4II3A 3N58A 4XB2A 4MDHA 3U4DA 3RC7A 3WGYA 4MIEA 3HN2A 2OO5A 1M76A 1H6DA 4RZHA 4Z3KA 5JMPA 4HP8A 3ANMA 4JGBA 4JJFA 3HADA 4LK3A 1XLTA 1E7WA 4GMFA 3NDJA 1P3DA 3OEYA 3PIDA 4YACA 3C7CB 1GAEO 4ILKA 2EJVA 4L76A 1AN9A 1SB9A 1H2HA 3UHAA 1P1RA 5JSFA 1IE3A 5JE8A 1HDCA 4IDGA 4FOSA 4NK5A 3VPFA 4BNLA 1Q0LA 2FP4A 3DBHB 4YQZA 4IJWA 4RF5A 1ENPA 3RI3A 1OAAA 3BHIA 3BMOB 1Y5MA 3ETEA 3VH4A 2C54A 3UN1A 2ZTLA 3R1IA 3X2FA 4AJHA 4DPKA 1HEUA 1HLPA 5FI3A 4YDRA 1UDAA 4CMHA 3WIEA 2GF2A 4CM7A 2I99A 1XQ6A 1EVYA 2NACA 5HS6A 4BMVA 2WMDA 3I6IA 1PR9A 3WFJA 5JCXA 2GPTA 1ONOA 1SCUA 4BNYA 1HDOA 3JQ9A 4R1TA 4E2WA 4H16A 2EKQA 3K6JA 3KYBA 2AQHA 4UUOA 2GZ1A 4BKRA 4PRLA 1MV8A 1R4NA 4BMNA 3I9JA 3R3SA 2JJYA 1PGNA 3NV9A 5GZ6A 5HTOA 3D4OA 1MUUA 4FN4A 2GD1O 1NPYA 3VVCA 2ZYAA 1UZLA 1XELA 4TMFA 3QJ5A 3CMMA 3OJOA 5G2OA 4AJ1A 3TFOA 1LU9A 2O3RA 4CM8A 2IYPA 1SBYA 3GZNB 3LC1O 1UXKA 4G2NA 4HNGA 3M1AA 2ZJ1A 4HUJA 4MP3A 3ADPA 3JQGB 1T1RA 3L4BA 4NBWA 1RKXA 2HK8A 1EFLA 3OICA 1U28A 4CM4A 1XU9A 3BMCB 3KSDO 1BXGB 4L0QA 4MPDA 1GQ2A 2UUPA 4DYDA 1MC4A 4PLWA 4EEZA 4GLOA 1ZSYA 2PLAA 1EFKA 1LC3A 4ZICA 1OZAA 4RPGA 1U2DA 2DUWA 5LC1A 4AJ2A 1PL6A 2O2YA 4AJKA 4D3DA 4LVUA 3GC6A 3ANNA 3PHLA 2AXQA 4RORA 3ROMA 3JQ6A 1CJCA 3DZBA 3CTMA 2AQKA 4KQXA 3K92A 1LA2A 3PWSA 3FNGA 2J5KA 1BW9A 3DZHA 2X8LA 3HB4X 4J49A 4OIMA 3ZZNA 1PZGA 2Y1FA 1DIAA 1T26A 3EYWA 4PLGA 4X54A 3RFVA 5KJCA 5L7WA 4UVGA 1PQPA 3TF5A 3RBVA 5JAMA 3DOCA 1J5PA 3WLEA 4JJIA 2V6MA 3D64A 2HMWA 3MCVA 1R12A 3LK7A 4WCFC 3AY6A 3DDNA 2HK9A 2WD7B 2XPCA 4Q39A 1E3WA 3JV7A 1ZXBA 3JYQA 5A9SB 1BSVA 4K9DA 4CM6A 2H9IA 5DN9A 1PWZA 1HDZA 1HYEA 4ZRNA 5DCYA 1K3TA 1NAHA 1Z6ZA 3ROKA 3FRJA 2F1KA 1ENOA 2CUKA 2WE7A 1HLDA 1A4IA 1ZO8A 1C0LA 2ZYGA 4KWHA 3U4IA 3PVZA 2GLXA 2FZWA 2JFFA 1SEVA 2X86A 4WNIA 3S1LA 4UUNA 2IZ1A 5DP1A 4WLOA 1GEGA 3GFBA 4PFJA 2DVMA 4UEOA 2HU2A 4TRJA 5THQA 4CMJA 3DBLA 3FN4A 5G0UA 1UUFA 1IY8A 2GN4A 5EQDA 1VLLA 2EG9A 3WYCA 4I08A 4Z9FA 3EY4A 5I8ZA 4CLEA 2UDPA 1BXKA 1JKIA 3IS3A 5CDUA 4QFDA 2I3GA 3RIHA 4GX5A 3KM0A 5DCUA 4A03A 4RF4A 1JVBA 3AY3A 5HM8A 3L4SO 4NIMA 2NQTA 1I3LA 2CVZA 4J7CA 5DT9A 4K6FA 3DZKA 2UVDA 3KLPX 4BKOA 4RVFA 3EW7A 1TLTA 2VWGA 2X0RA 4R54A 4GVXA 3AOGA 4FBGA 4UVDA 3HN7A 1K5HA 3RUAA 3ZHBA 5T8KC 3T4XA 2DM6A 3S55A 5KOIA 1Y9AA 1YXMA 4YAKA 5H83A 3ETGA 1EBFA 4U0JA 3SC4A 4DIBA 4GI2A 4YAGA 1H5QA 1VL6A 1I3NA 2WD8A 1UZNA 1H9AA 5AXAA 3CMCO 4WPGA 3B1FA 4KWIA 3GN1A 3VKVA 3D7LA 2E49A 1D7OA 1I01A 2NNLD 4IDEA 1FF9A 2NU9A 3LLVA 4PLVA 4UULA 4B4WA 4BO7A 1GYQA 1BHSA 1R0KA 3DBHA 3FSRA 3GRPA 4YEDA 1BXZA 2ZYDA 3ENKA 3DBVO 5L4LA 5G0WA 2WYUA 2HRBA 4DTIA 1B14A 2O7SA 1ZK3A 3GFGA 3OIFA 4IDFA 1JW9B 4FFRA 3ONDA 3C3XA 3SVTA 4I9UA 5IF3A 1PJTA 3FHLA 4DA9A 1JN0A 3TZHA 3D3EA 3IUPA 3JYLA 2Y1OA 1ZJYA 3E48A 1E1LA 4RLSA 3VDRA 4YQYA 2I67A 4RQTA 4GBJA 4TROA 1A5ZA 2PA3A 4LW8A 2PNFA 3AWDA 1LSOA 2PZLA 1PJSA 5HWSA 4KUEA 3WQSB 1VSUA 2CNBA 4KTTE 4J1SA 3PFWO 1R0LA 4I5EA 4E5MA 3U5TA 1JVSA 5BR7A 5K0ZA 1IPFA 4XRRA 3TZQA 2C2YA 2NVWA 4BNXA 1NX6A 2OFPA 3AU8A 3K9QO 4JLWA 4R9SA 1VJ1A 3GEDA 5TT0A 3KHUA 2BLLA 2Q1SA 4FCCA 1BDBA 1I10A 1R15A 1X7DA 4W99A 4BNUA 1WWKA 4RLHA 3I4FA 3ZV5A 1HE2A 3JD4A 5TJ9A 4OAQA 1NASA 1PJLA 4BL5A 5ICMA 3INRA 3R0IA 1M66A 1LLDA 3LT2A 1SO8A 4JJGA 1DLJA 3HB5X 5KVVA 4AJLA 1BMDA 3BMCA 2J3HA 1YGYA 4M86A 5EIOA 1X0XA 1XDWA 1RYDA 5IN4A 3MJVA 1O94A 1ISIA 4YRDA 3VAZA 4MVJI 4C7JA 4QT0A 2WJPA 1LNQA 2CVQA 1P74A 3AU9A 2W2KB 3B1JA 1ISMA 3D3WA 2AE2A 5U1PA 1ZW1A 4JXKA 4WCDA 3WSVA 3ZNNA 2VRBA 1H9BA 4CMBA 4YRAA 1UZMA 2BD0A 3G1TA 3E5MA 4RPJA 5CEJA 5KVSA 1B7GO 3UCEA 2ZQYA 1NXQA 3WYEA 3BXXA 1Y8QB 1TT5A 5A06A 4L8VA 5THKA 3SLGA 3WLFA 3CEAA 3GHHA 4NH4A 4CQLB 3K2EA 4IDBA 5A04A 5L7TA 4XGNA 1U3WA 2HRZA 2IE0A 3E8XA 4GSKA 4Y98A 5IXSA 3WQQA 3ZU2A 4FDAA 4JX8A 2QRJA 4GPD1 4MIOA 4BNGA 4BGEA 3GAFA 4MVJF 5A9SA 4AICA 3GOHA 3RC1A 4M89A 2EF1A 1H94A 4R69A 3VZQA 4BQPA 4P4GA 5KJ6A 1NP3A 4OXNA 4BNJA 3DEYX 3PZBA 5EERA 3NTRA 1DSSG 4R51A 4IQ8A 3BMQB 2WEKA 3OF2A 4HFJA 4DPLA 1HTBA 3H3FA 5JDIA 2AA3A 3L9WA 2HMUA 5KJEA 3ICCA 4Q3BA 4R68A 4B4UA 5BT9A 3TZCA 1HRDA 5EL0A 4O1MA 3AK4A
chains in the Genus database with same CATH superfamily
3SD7A 1U1FA 5TMEA 4JI7B 1Z5GA 3EVDA 5D3ZA 2BKXA 2VSQA 1E9SA 1X1DA 1NP7A 5AK5A 4FU0A 3FGPA 4V39A 5GJVC 2IYRA 1POWA 4AKEA 5KZMB 2PH3A 1PCXA 3PD0A 1XEWX 2OECA 1N6RA 3Q5EA 1IBKB 1HDYA 1VYVA 1ZCZA 1X7GA 2JHCA 2PCJA 1CUJA 3IDSA 3ND7A 3X1ZA 2EFEB 4G0UA 4CIYA 4C7OA 5CDGA 2EHJA 1E6UA 2XUZA 1R9JA 2I62A 3OLZA 4TRRA 2WUGA 2VWHA 5LN1A 1U90A 2LP4Y 5IFKA 1MW8X 3K1YA 3FB1A 3U60B 2WJ6A 4CKEA 1B41A 4IDCA 4V2UA 3D4IA 4FNMA 1SZPA 1UZUA 2FZ5A 4DMFA 1X3LA 2FR8C 3IDOA 3DFMA 4D81A 3IELA 4F84A 5JR3A 3H4IA 3F6PA 3JR3A 2DH6A 3RVQA 2WPDA 1WHSB 3QLUA 2Z2JA 4HF7A 3WK6A 4C7MA 1GSHA 4MA0A 1PL8A 3PXAA 2CLFB 2WFMA 4WBSA 1HT0A 4I50B 5I4CA 2OWDA 4LRQA 3DMTC 4AECA 3QELA 2GFHA 4XWKA 1AUPA 3VNBA 2KM1A 1I2CA 1J70A 3C7KA 5NULA 1DO2A 4MW0A 4DC0A 1H4QA 4MUIA 2PGDA 2QSJA 3D0QA 3IESA 4LBWA 2W6CX 4FIDA 4C0XA 3OZSA 4DSTA 5DX8A 4AF7A 2IXEA 3OM9A 3AERB 3E58A 2A6PA 2NQ2C 2H06A 1HT3A 3C3JA 5K4HA 3PUVA 3UYKA 3KYJB 3L1UA 4WUVA 3UPUA 2ADFA 3E22A 1S1CA 5EI5A 1XX6A 4I5FA 3MJDA 1NFFA 5FOVA 3IFSA 1OSNA 1CUVA 4KSBA 3D0OA 5DTJA 2PZ8A 3UJ3X 1LPNA 2DWCA 1VIVA 3OA2A 3IUSA 4GDMA 1ABEA 1Y8AA 2P30A 5GONA 4BKQA 1E9CA 4RZUA 5KSPA 5IWAB 2RE8A 2JVKA 4URUR 1N32B 3RAGA 1NQUA 1EK6A 4M1OA 5IT4A 3GHYA 4S1WA 4YMVA 3PYXA 4O4JA 4R9UC 2B8TA 1TJ3A 1NRWA 1GITA 2ZB4A 3FFWA 4OQYA 1W2GA 3AF4A 3I4CA 5CXSA 3EBOA 2XNSA 5ALPA 4NQZA 4YJ2A 1FB5A 4H7EA 2WUDA 4QVGA 3FCSB 2RGGA 4DANA 5C5IA 5AVRA 5KU7A 1IMOA 3B5IA 4RTPA 2IYTA 2G9QA 4E7PA 2XEDA 4JH0A 2OBXA 3T3DA 3USZA 4YQEA 1MFPA 1NVKA 3ZHSA 3D1LA 2HMVA 4M83A 1CR0A 4I1VA 5CG2A 4HDKB 3B9BA 1XK7A 1T3SA 4UEWA 1YK1A 3OU2A 4BLVA 3AZOA 3H5VA 2QKYA 5AR1A 1SKUA 4A16A 1EJ6A 1W1UA 2MSEB 4Q47A 3GDOA 4P80A 1N7HA 1GRVA 2E4WA 2FWPA 2PPLA 1NVAA 3AR8A 4MS3B 4NCNA 3H7IA 2VH5R 3SC2B 4KQWA 3IILA 1CLEA 5T8KA 4C6TA 1J39A 1JIUA 3OQVA 1ZC4A 4FHEA 3MOGA 2B0JA 4JLDA 3TLYA 5CAEA 2W37A 1VPEA 3O38A 4EHKA 2YNMD 2V9ZA 2Q29A 1Z0ZA 4FYVA 4ZQFA 2VZEA 1C3LA 1O2DA 3C6YA 2REBA 4N49A 1USIA 2EKZA 4LN1A 3UOGA 1YDMA 2G88A 2H92A 4A8PA 5JQGF 1B3RA 1P1BA 2ZJ2A 4I1PA 3R41A 3TPCA 4EF4A 3SKVA 3WLTA 4RK0A 3K0AB 4HCJA 2NW6A 4CTMA 2XQFA 3DF9A 3HU5A 1VE5A 3K8OE 4KVGA 5M5BA 1DO0A 3G9TA 4HAZA 3LGSA 3MGGA 3CPJB 2M6LA 4AJJA 4Z9AA 4KQCA 4D44A 4DM3A 3AKYA 2CV1A 3NTUA 2P6PA 4BNFA 1YC5A 1DJOA 3PUZA 2R86A 5A05A 3DQZA 5A4DA 1A9ZA 2DWUA 3PF8A 4NCXA 4C3VA 3RC3A 3QKUA 2AT1A 3NC0C 1OXUA 4MO9A 3MWLA 3R7WA 1T2VA 2QJTA 5J5CA 1YVDA 3RUCA 4IPTA 5MN4A 1E7SA 1N8NA 3HV0A 1HI9A 2PSFA 4FGZA 4LYAA 5CIWA 4LGYA 3RBXA 3T1NA 3MMSA 1RRGA 4PSKA 3VR5D 3SHTA 1IHXA 2FN7A 3C8MA 3INGA 3ILVA 4P3KA 5FUBA 2XB8A 1Y8QA 3ADOA 1P9LA 4OGKA 4RXMA 4EKEA 4UAJA 1K4KA 1N0WA 2G8NA 1E3QA 2AG5A 4U7PB 4OP3A 4UAUA 521PA 1XSEA 4EFMA 1BW9B 1RP1A 4FB5A 2PAFA 1M3SA 2RI1A 1QHIA 3GLGE 3TTXA 5HR5A 2BKLA 1PZNA 2JAPA 4YPOA 1G21E 3GLHA 3MJHA 4KITB 1JDZA 1XQ1A 2KJQA 3TLGB 3OIVA 2FF7A 3L77A 3UMSA 3SYTA 2ROQA 1AN0A 1QKIA 4CLDA 4MKRA 2FWRA 3LL4A 5KINB 1A8IA 3AW8A 1CT9A 4WBNA 2JATA 1P1KA 2X0JA 2AOVA 4DYVA 3ADDA 5IW8A 2SNIE 4KDRA 2QUIA 8AT1A 2JANA 4GX0A 3TIVA 3IOCA 1ZR4A 1ODKA 1P4HA 4OA8A 3TDMA 3ANLA 4G56A 3RS0A 2QIOA 2SECE 1SKBA 3LY8A 3A1EA 3LBIA 3PJFA 4ARBA 4FFWA 3ED5A 3C6QA 4MMYB 1QBKC 2A67A 1U1DA 3EUWA 1DC4A 5ITSA 1RYBA 3ZK8A 4JJEA 1E7YA 2QZ9A 3DBOB 2G72A 1CQJB 1FJ2A 1XP5A 4QYXA 4ZCMA 3HKCA 5EXDA 4EA9A 2P5YA 3QVKA 4RM2A 4CL8A 1S7GA 1T8RA 2HJSA 1IG3A 3OJCA 1Z5VA 2ODNA 2X9GA 3DUWA 2F3SA 4I4CA 1XWWA 3UPDA 3RUFA 3IBCA 3ZV4A 2CLHB 1R64A 1DTWA 4IHJA 1RYNA 1G5QA 3G9QA 4MS1B 4B7ZA 2R8OA 3L9XA 3R0JA 4RTLA 2V5UA 5K3FB 1Q22A 5ICSA 1EK2A 3AVUA 1KQFA 1VQ1A 5B4TA 5A4IS 2A5JA 5ALOA 4EYEA 2XDQA 4JOQA 3R4CA 3MHPA 3QKWA 1G2PA 5DDIP 2E5FA 3AF6A 1U63A 4OMFG 2CLEB 1GPYA 3LDFA 5IJ0B 4DMMA 3TMKA 3LUPA 4UE3S 2VUHB 4CDMA 3VSEA 3GLIB 4G0WA 3QLEA 2WW8A 2QTAA 3V4ZA 3KTAA 2RSLA 5FBHA 2XUOA 4BNTA 2QHXA 3QNWA 2AI3A 3OG9A 3PFGA 4U9HS 4N54A 4WLEA 4C5AA 2XYVA 3GFSA 3EPRA 4MGKR 1FQKA 1S3SA 4NG5A 3UK2A 4ZCTA 4XQ0A 3N8KA 5LUAA 1P1IA 3E1GA 1L5OA 2X0IA 1Z13A 3ZVKA 1U0GA 2A3NA 2A78A 2IUSA 2GPSA 5AOAA 1TA0A 1VHDA 3HMQA 4YCMA 5BSGA 4JC4A 5IUJC 5CCBA 3COJA 4F56A 1D0IA 5FPQA 4DLTA 4QJ5A 2PZBA 1E4YA 2R65A 2UXCB 3JCZA 1XQXA 1WAMA 4BV9A 4NECA 2Z3ZA 4Y30A 2EBHX 4QBIA 2ZSDA 3NBQA 3N5KA 1AZWA 3AY7A 4GI7A 4XE5A 3LTNC 5JAZA 1NMYA 2PQMA 3DGEC 4ZYUA 4INAA 1S4QA 2ZRDA 2D4AA 3BB3A 4Q1BA 4E31A 5LP6A 3MXTA 3JQBC 4LHVA 4MJ7A 3WE7A 2J87A 3G2KA 1C4XA 2IWRA 5D5HA 5DEIA 4HAYA 4E5KA 2E21A 5B7GA 4LYEA 3I23A 3KEFA 1NBME 1T2EA 2HQ1A 2BDEA 2Z09A 2A86A 1SD5A 3PCTA 2C0CA 3BYZA 3ECAA 3V7FA 3QEBZ 1KQ3A 1OBOA 2VBFA 4LOIA 4LXQA 2BKVA 2NNWB 3BJIC 3HU2A 3OFVA 3OWHA 4L3WA 1WQ1R 2B8EA 2GJ9A 4KOAA 4B3HA 4WN3A 1B76A 1ZNXA 2YXEA 4JIGA 4S1NA 4ALNA 4R1NA 1DB3A 5DGDA 1EJ0A 5BPFA 5KYUB 3UQZA 2PD6A 1HE3A 3CKMA 5IXYA 2N75A 1QO9A 3DH0A 3FZQA 4F38A 4ATNA 2TECE 3SF0A 1WSBA 3QTBA 4DA6A 1XK6A 1ZVQA 3CONA 3QKSA 3NHBA 3HPQA 4QELA 4EVSA 1LQUA 2BI7A 1DAPA 3CVOA 3FOCA 4RJIA 3MJFA 2A5LA 3QVWA 4INOA 4NESA 5ALYA 4N7MA 1SH7A 2HXYA 1YUMA 4I4TA 4EMSA 4HXEB 4EJ6A 3FFAA 3PQCA 4NZPA 2WM9B 4X97A 2AD5A 4M21A 4AJ4A 1RQ7A 3PC8C 2AJBA 3PDCA 3QWIA 4YLGA 1ZH2A 5KMGA 3JVIA 3U7QB 4AJIA 5EPEA 3NQ41 1DJLA 2EW2A 2VHWA 4KIFA 5BY2A 1II8A 4DXHA 2XYPA 1LVUA 3G82C 3OQ6A 1UMKA 4W1PA 1PJRA 5H68A 5HTKA 4AQ7A 2ZULA 5B2FA 4AURA 1JEQB 1P1HA 4YRNA 5IULC 3OF3A 1EK0A 3EZYA 4QBTA 1HZJA 1YD7A 3AKDA 4R2JA 3S7ZA 1JBEA 4HQKA 4ENSA 2RG7A 3DFIA 4TYQA 3DDOA 4RCYA 1YQUA 3ZS9A 3LYAA 4I6GA 3W9SA 3TL6A 5T57A 4DV0B 4Q01A 9LDTA 4B45A 2GJ4A 2QX6A 4KXNA 4D9FA 1KZ4A 5LQCA 4K46A 4US2R 2HHJA 1G8GA 1UFVA 2D5CA 5GVSA 1I30A 4KQFA 1YIAA 4K40A 4QFCA 4RGQA 1CQIB 3IAAA 3RE1A 3FNEA 2I6GA 1K8ZB 4B7XA 2Q5HA 2F64A 1EUYA 2FK8A 2WM8A 3GR6A 1K8YB 1NIPA 2ZJFA 3CSSA 3IIMA 4UTPA 4WLVA 5B3LA 5KTYA 4J0HA 1G0NA 2QV7A 2J1LA 4RWEA 3D3WB 3IP1A 1YWGO 4JP8A 1V3VA 4PYKA 3N5CA 3SIWA 2F59A 4OLHA 3A6LA 1XXHE 2VF8A 5AI0A 4B32A 2Z5VA 1CJVC 3KZNA 4BNWA 4PBSA 2G82A 1Q83A 4G23A 4HB2A 3BSSA 2OBLA 3NRCA 1L4EA 1P4RA 4XVUA 2I4MA 4HL6A 2GR9A 4PNPA 1ADBA 4GT1A 3G0OA 3IKMB 3ZW7A 1MHPA 1BGWA 1K08A 1U7OA 1GU1A 4HWTA 3OEWA 5M04A 2NADA 3NJRA 2XNCA 1AUVA 1N2GA 5EC8A 4ZAZA 1E99A 1BVRA 1X8LA 4OHMA 1J0XO 4N18A 2CDAA 2GMWA 3WMXA 4V1CA 2WK1A 3H3JA 2P41A 4QU8A 4ZZIA 4C6RA 5D3QA 1C7JA 1PF7E 4FEAA 4R1UA 2HLPA 3RC9A 3EFBA 3UA3A 4O29A 3DT6A 2YJ5A 3EVCA 3TJMA 3NH6A 3GFQA 5BW6B 1RLJA 2IS4A 3WGLA 1GCOA 1Z9BA 2YUIA 3PPXA 2WY2D 3B48A 4AP9A 5A5EA 1X1CA 5CK4A 1GRRA 1DV2A 5F1YA 3WLJA 5P8WA 4YMLA 3JYPA 4OF4A 4RV9A 2BCGY 1R0SA 5BSRA 1L5YA 3DOEA 1LPSA 1W47A 3QXSA 2ZUBA 3NPAA 3SXUA 1CHDA 4OQLA 1JDBC 1BMQA 2GLUA 3KBOA 5CA1B 2BEJA 2IXTA 4O5AA 2B83A 4Y9UA 4AIRA 3I2JA 4EF5A 1E0SA 2WWWA 4BAZA 4ZO6A 3BERA 3D43A 3KVOA 1V1MA 3LFHA 4TTTS 4EIWA 1L7AA 3K96A 2J67A 4QTTB 5KTKA 1OH7A 3OLQA 4OFWA 4PCAA 1JP7A 2JJ8A 4AJEA 1V5WA 2F43B 3OQIB 1NVBA 2NZ2A 2CUNA 1WZIA 5I9SA 4WEQA 3PD7A 5E1OA 4GYWA 4Z6KA 4B81A 2EZTA 2H17A 1M5TA 3NM6B 3IJRA 2XGMA 3ROEA 4UE6A 5ESXA 2D3WA 1WXQA 1XZJA 1SU4A 4J0QA 2YW2A 4RJTA 3GVXA 2K7ZA 2FOLA 3GJ8A 3QI7A 3I3OA 3W2GA 4RMNA 4WHMA 3D6FA 4ZK6A 4MHTA 1QRRA 2QAIA 3BA6A 1KZ6A 3H9JA 3U4AA 5TB5A 4G4GA 1XEWY 2D1FA 3MTDA 3IQXA 2HLDA 4KLAA 4MJLA 4IMRA 4BGVA 2O8DB 1DOAA 5I7SA 2X15A 4Q66C 4RADA 1GZ5A 3E0QA 5FT9A 5MGBA 1B0AA 2ZAGA 3WZ2A 4F21A 3U1VA 2PMEA 2HWKA 1UODA 3KXPA 5JUWA 4IHQA 3HR8A 3WNZA 5E4TA 2WWFA 2XOXA 2CZGA 2P91A 3U80A 4BU0A 3R3YA 4AY5A 2VP4A 1S89A 1XB2A 4X66B 1J0BA 2HDOA 2VFAA 1J49A 1B15A 2IQ5A 4IJUA 5DLYA 3UG7A 4F3CA 3P2OA 5EA2A 1CLUA 4S2UA 1NNI1 4AKIA 1WMDA 4UEKA 3AFMA 3KIPA 1CS4C 2R96A 2RMKA 2W2OA 2WIBA 3HDHA 1IAVA 1Z0KA 2AFIA 4IP0A 4TLDA 5DASA 4RZIA 4PM4A 3RJ5A 4QOHA 3EUFA 4RZQA 1TGVA 4XQ9A 3USES 5ED4A 3W1VA 4DDTA 2EL7A 2GH1A 3RT9A 3WWCA 1ADYA 2XT6A 3NWEA 1USVA 2HNKA 2HWWA 2ZXEA 3BWMA 4TV9A 1IJFA 1DBWA 4DGSA 1AO0A 4FMCB 1VMEA 1Q12A 4RD1A 3SC6A 2HQBA 5F1OA 5LQUA 1GGFA 1JILA 3E9QA 3IALA 3LVRE 3CLUC 1V35A 1M72A 1M6HA 2ZS7A 4O1HA 4I4IA 5G0TA 3AESB 3KYDB 3WYAA 1ZONA 1JDSA 2CYAA 4AZSA 2FFHA 1W36D 1K0UA 1Q77A 3JQ8A 3ER8A 1YI1A 3ZDQA 4NK4A 2FPXA 3V46A 2JLWA 2BKAA 4HBGA 2R2GA 4BNDA 2XT9A 2JLUA 5EHQA 3GJXC 3E15A 3H0CA 3FOAA 4KN6A 2YFQA 3WOVA 2FGKA 3NDIA 4NSNA 3FYUB 2NUTA 1IDN1 3QF4A 3S5UA 4DVJA 2CLKB 2O07A 4JP5A 3OAAD 2C84A 4YCJA 2XGJA 5AM1A 2CJYA 3Q3CA 3CIFA 2X3UA 3FNFA 4ZGGA 5JCPA 1F4PA 2RH8A 4CT4B 1ZIDA 1V95A 3WA7A 2Q9AA 2PLNA 2IHZA 1SUSA 1CW2B 5SY4A 1B0ZA 2A4KA 2H57A 1VI6A 1XZCA 4EHBA 3GARA 1NBIA 5EG5A 1W4ZA 2UVPB 3ZV3A 1GO2A 5CGQB 5E1BA 2QRVA 5D84A 1G7TA 1IHPA 1J56A 2QGFA 1JAHA 1W5AA 1ZM9A 1YBFA 1GNLA 2O2XA 3MTJA 5T3UA 1JEDA 1YJ8A 4U2GA 3M2TA 2KX7A 4OI4A 1XYYA 1IEQA 4B6SA 4PNEA 5HF8A 5I7UA 2EX0A 2X5OA 4HGRA 2YS7A 1IEXA 2BEKA 3RSQA 3UCXA 2Z6QA 4FOTA 1N7GA 1I14A 3STYA 1H0HA 4C21A 5JYBA 1EXWA 4N9QA 1FS4A 3PNOA 2ZPTX 2RJ3A 4IS2A 2J9FA 2JA2A 2OG2A 3G79A 4ND1A 3AM3A 2EXXA 2W2LD 1LK5A 3PNQA 5JD6A 2HSGA 1JTEA 2QN8A 2VK8A 2ZUSA 3VHXB 2PGLA 2ZR0A 1MA3A 3A7DA 1Y6JA 3SQXA 1ECCA 3LWBA 4ZCQA 5EKUA 1MKYA 3NIBA 5HCIA 3P2YA 3A6GA 5IG2A 1RRCA 2QR3A 3R6TA 4FYPA 2XOKD 2Z95A 3DV2A 3I04A 3QVTA 1MEJA 4O3FA 1V48A 4XFDA 4YDHB 4CN8A 5CITA 3DW3X 5D87A 2ZVQX 2AV6A 1MG0A 5BXQC 3NDRA 2IHKA 2WIDA 1JXQA 1YZQA 2BZ0A 3VO2A 5ADWA 3ZTTA 1PJQA 2Q5OA 5K0EA 1Q20A 4ZYYA 1SCQA 2M2IA 4GNRA 1IYZA 1VG1A 2VNSA 2O7NA 3PJDA 5AKXA 4P4TA 4DSAA 4JDPA 4C4TA 4I1SA 1CRZA 5JS2A 2AOWA 5LM3A 1TTTA 2Y4NA 2C2BA 1ZA2A 1SNYA 4XTCS 1VPDA 1XZ8A 3WLRA 3HJTA 3AXTA 4RA9B 2PJRA 4I9GA 3T5DA 1D2CA 4M54A 1NAIA 3R7FA 5KBYA 2J3LA 3SM3A 1F5NA 4IIGA 3K1AA 5ALDA 1BC5A 4WDQA 2GEFA 3IURA 2A58A 3LT1A 3UMCA 5BMVA 1GAWA 4Q9HA 1EIWA 3QBVA 4BO1A 2AUNA 4GXTA 5LQKA 1OAKA 2BGRA 3CVJA 3MWFA 4QRDA 1JIIA 4WXHA 1KZGB 2BI8A 2RIRA 2ONCA 4QTXA 4C30A 2O9JA 3ZUPA 4MWSA 3CSUA 8GPBA 3OCUA 1VG8A 3L8EA 1VA5A 2C07A 3ZGLA 1CF9A 4N9WA 1VKRA 1DBIA 1K5PA 2HA5A 4XSGA 5JNSA 2WYOA 5E8JA 5CVTA 1W73A 4L9SA 5F3DA 3RBZA 2Y66A 3GYBA 4EO9A 2FG7C 5COBA 2WG0A 1YRBA 1QZUA 3AYXB 1XROA 1EHYA 2VDLB 1KJJA 4GZLA 4HQ0A 4P35A 5CCEA 4XQGA 1XCBA 1NVMB 1OV6A 1XLTC 3GELA 1HE5A 2CFIA 3KV1A 3LY7A 3M1IA 3NV7A 3QBDA 5AM4A 3C7AA 2X23A 3G23A 4HUTA 1KXZA 3C1OA 3QUAA 3ANSA 4PZPA 5A4KA 1Q15A 1M2KA 2Z2YA 3PE6A 1ZVMA 3CJRA 4KPGA 1OFUX 4P4UA 1NU8A 1U7DA 4MA5A 4HTFB 1A5AB 1AZSC 4OL0A 4XTRA 1PR1A 4Y18A 4H1TA 2Z8YA 4YGXB 2A2ZA 5ALXA 2VJBA 4I6JA 4HZGA 3T94A 3OBIA 1RW4A 3GFRA 4FUQA 4FHFA 3WTBA 1TPZA 1ISSA 4PHCA 3OTIA 5B7NA 3JARB 2AOUA 1KSJA 1R9MA 1UPXA 2JIQA 1GTJ1 4DMLA 1NVDA 3NVDA 1RWPA 4YT8A 2VZ9A 3TIXB 5H4GA 1T35A 2QL6A 1X38A 1I7SB 3N8HA 3CLVA 3LRXA 3PQ3A 3ZTWA 3QMVA 5AJZA 1SUBA 5GM2A 3RAJA 3ZHVA 5KUTA 1JAIA 5I51A 3E7PA 1C1XA 3RJMA 2OWEA 2WVJA 4PLZA 4H77A 4WCFA 2ZSJA 2O8FB 1NUPA 1TYCA 1IZ7A 3FUWA 3MYYA 3OE7D 4Q0MA 2HBRA 4N47A 4EJSA 3BXOA 3DMNA 5BQ3A 3IQEA 1OLUA 1PP4A 5B30A 2V74B 3DLHA 1MIHA 4D9CA 1SVNA 3GFTA 1J1ZA 5TEVA 4B44A 5LYJF 1SJ9A 3EB9A 2WWRA 2A1UA 1EUCA 3CINA 3JQ9C 3C3CA 2KSQA 4OVKA 4CR6A 1UXJA 3B2EA 1TVEA 3KB1A 3RS8A 2DBZA 3L8YA 2IGTA 2QB5A 4RA6B 4MGHA 3GJTA 3GD5A 4C22A 5K8LA 4D6XA 1TRHA 1ZHOA 4R8LA 5IARA 3LQYA 3WA6A 5HOQA 3DBRB 3UGQA 4LRTB 1N2ZA 2VPYA 1M2OA 2Y9MB 4JC8A 1F2DA 2J5QA 2GKSA 1AMNA 1VRVA 3RVOA 4CJXA 1GGMA 2Z1MA 2V3VA 3SZOA 2FEWB 1Q7GA 2VSXA 4UEQA 4P38A 3ICEA 5JI3E 4ZXPA 5EEGA 1WDWB 1FSSA 3HK2A 2GBCA 5F4ZA 2DF8A 1V6AA 2IDJA 4LXHA 3ZS8A 2TYSB 2NO7A 4Z9BA 5JZOA 2BEVA 4NP6A 1H85A 3FLBA 1IRXA 3OO1A 5CT5A 4GZ5A 5FNVB 3SVZA 1QFJA 4GSLA 5JBNA 2FZVA 3PA8A 2G76A 2JCVA 1JSLA 1VRWA 4HLCA 4KWEA 4F7DA 4UOQA 5E7QA 4ZARA 3RFCA 3OKCA 2TRSB 1E6KA 3II6X 3LD9A 1KZ9A 3BXZA 2GHRA 5ILGA 4ZIRA 1P5JA 3NP9A 1YR1A 4JQYA 4OREX 5E1MA 5EQTA 2ZR9A 2P9FA 3U13A 3O9ZA 3LGXA 1V6SA 1EDDA 4HPWA 3V1TC 2NTEA 4GRIA 4QU5A 4PNHA 4BOYA 2BMAA 5BVGA 3H1AA 1H2RS 1KEVA 4H15A 3THXB 2F8SA 1CY7A 1AKRA 1DXYA 1P17A 3L49A 5B7QA 1M2WA 4QREA 3V1UA 2O7RA 5EUCA 3FSGA 1I33A 1C7IA 1U8XX 1UBFA 2H3HA 4KBFA 1OZFA 4E5UA 6LDHA 3THYA 4DV7B 4CV1A 3SNHA 3GLFE 3VHRA 2XTJA 4C89A 5DNYB 1ZOLA 4FFMA 3GBVA 1BX1A 3TAHA 2XZLA 2Y8EA 5F2EA 3WBKA 3WGOA 1Z15A 3WRWA 1N9GA 4BVBA 5FHRA 1M2FA 2IW1A 2C7OA 5C34B 3GA0A 4PFQA 2OHHA 2QM8A 4MP6A 4A2PA 2QVGA 1ZAKA 5T6MA 4X3CA 2PKRA 3JQFC 3IAM6 1DEKA 2H8KA 1U80A 3OEHA 2DAPA 5FUYA 3L7NA 1KY3A 2Q3DA 2DR2A 1C9KA 4MI6A 5EIFA 3MZ0A 4Q7MB 1RKBA 3DUFA 1SBQA 2DWPA 3WDSA 2P67A 4F2PA 3P9KA 5T7BA 2C7BA 3NHYA 2A9RA 2O0HA 5DYIA 5F76A 2FQ1A 2PS0A 2VHTA 4XI9A 1K3FA 3UK6A 1ZMBA 5F23A 4Q1DA 3EWAA 3OZCA 4BUZA 4O63O 3ZCTA 2MU1A 1NOJA 4D56A 5IJ9B 3HB9A 3CZ9A 2NO9A 4NU8X 3ZHTA 3ETLA 4HNAB 3IVAA 2O8CA 1S01A 3QMWA 2Q3FA 2QD5A 2K6GA 2WZCA 1RE0A 3K72B 1PYDA 3OZUA 5GPBA 2WB2A 3D2AA 4H31A 4OGWA 3JATA 2HX1A 3OFKA 3OURA 3QM1A 4JKYA 4OG2A 1P5RA 1ZR2A 3NT4A 1TAUA 3D1VA 1GP2A 4M9CA 4EKIA 4D0LB 4Q4AB 1Y1RA 2IKSA 4CL3A 1HA3A 5KTNA 1J8DA 4PRZA 3NTOA 2VQ6A 1L4FA 1F5SA 5YASA 1Z7BA 4BLUA 2YJZA 3I2IA 2JDIA 1G2QA 3WWYA 4O2BA 4EUFA 2UYGA 2WVHA 3FBWA 4MHSA 5ALNA 5EN4A 1G6KA 3EX7C 2EOAA 4KVZA 5DN6D 1ES9A 4Q7JB 3ZX5A 3TMAA 2EATA 1G291 10MHA 2BT4A 4JB3A 5T5QA 1YR7A 1SVSA 1QQTA 3SXPA 3A32A 2HXGA 5HKKD 3PFBA 4FPXA 1H5UA 4HGYA 5AW7A 3R3WA 2F8MA 3I5MA 4Z1OA 4EQ6A 5KYXB 2XKAA 1ZUD1 5K8VA 3BL6A 3PXBA 4FX5A 4XIJA 3ABQB 3M5PA 2QAGB 2MTBA 1XYGA 4LYFA 2G9UA 4XVRA 2Q2OA 3LUGA 4C76A 3CLRC 3GBPA 4LV6A 5B57C 5GOZA 2PSEA 3ZW9A 4F12A 2DX7A 1UEIA 3BFXA 2QTVB 3BGVA 1QK4A 3FMOB 2IBTA 3P0JA 3ZWYA 1UJMA 4HDAA 4P86A 2K7FA 2J41A 4R1PA 2PT9A 2FX2A 3IUJA 4W6QA 1QRUA 2F3QA 2CXNA 4CN9A 4YBZA 3OJFA 3EA0A 3ZDZB 1RRKA 3ENZA 1A5TA 2V6BA 3ZN2A 3KAQA 4IJ5A 1KYQA 4RPLA 5H5JA 1M6WA 2AQIA 3NXSA 3ITNA 1EESA 4CNQA 1CZHA 2C5FA 2ONZA 3ORYA 4WFJA 2F8LA 4TS4A 1IH8A 5KSYA 1ZQ9A 1C8BA 3VX3A 1CKEA 2AKAB 4DCTA 2PV0A 1GR1A 1BXRB 1XEXA 3MPOA 1RZRA 4A36A 3ZCPA 1X7YB 3LCMA 1NW7A 5H3HA 5K3DA 4RPCA 3D59A 1CTQA 1NYTA 1RLMA 2GEDA 2ZGVA 2R68A 3D9QX 1V71A 3CNNA 4U6SA 4XR4A 3F98A 3Q7PA 4L74A 4YCAA 4ZCLA 5HDQA 3R74A 2P7IA 1IY9A 3MPUA 2JFUA 2PA0A 4X3OA 2VP0A 1HORA 2ZRPA 4J4BA 2K2WA 1JLLB 1WA5A 4JOCA 3UUFA 2VQ3A 1O6GA 4IWNA 2CWWA 1H3FA 5LU8A 1U3UA 3H9CA 2XCQA 3I0NA 2HHAA 2KMLA 1R8JA 2FEKA 5ENVA 2WWHA 1GNTA 2XRYA 1PTJA 1F0NA 2RI6A 3EIHA 1G17A 3F5SA 2Y93A 3DAOA 2O1EA 1RYMA 2PE5A 5K3SA 1NR7A 4MYHA 2FUG1 4YAEA 4HQNA 5I9IA 1ORTA 1Z0UA 1EUDB 3ILXA 1QIKA 1ECLA 2FZKA 2QDXA 3L8MA 1PR5A 1U3CA 1KDZA 3Q6MA 2BN4A 2D5BA 4K9KA 2KB0A 3CH4B 4ACAA 4J4TA 3MD0A 5SYAA 3EGDB 4NZOA 2PUTA 3Q5GA 3GUVA 1T3TA 1R6XA 4G89A 2LRHA 2A0FA 3AL2A 3UAVA 3UZUA 3KKNA 4YX9A 4PAGA 3R09A 5CFRA 4KODA 2A9PA 5C32A 1FMCA 3ZDAA 1YCDA 2ZSEA 1W25A 3N7AA 3GRKA 1WABA 3I2FA 2Q7XA 5JSUA 3QNMA 4OQPA 1G8HA 2JZCA 2XI4A 2ZRKA 1ZVJA 2ZBDA 3UBMA 1C1HA 4D45A 5IRCD 4J7AA 1WSAA 1DRWA 4U39A 5FBQB 7AT1A 2YDYA 2XF2A 4RQBA 1UOQA 1OXKB 3DPIA 1KPGA 2FFQA 1W8IA 2G8LA 1Y9ZA 2OV2A 1OROA 3FAKA 3QWHA 1TDJA 1KAMA 1XN1A 2HYDA 3PCXA 4H7IA 4Q3EA 5DTEA 3EPJA 1ZNWA 2IDKA 3TXYA 1DHTA 2ZJ4A 4DA7A 5AKIA 1GSIA 2QG4A 1OT5A 4TQAA 2PANA 3TMYA 1ESEA 2BFMA 2C5SA 3W4KA 3KQKA 4LJLA 5CLJA 3GQBB 3L7JA 4ARZA 4WZZA 5K0GA 1JA1A 2GRAA 4R98A 3RT1A 4EFDA 1DRJA 3BT7A 3TFWA 1NI4A 4W5JA 3RVBA 3K7EA 1YZ3A 2YBEA 4MRMB 3GBSA 2MYNA 1U8AA 1PYOA 4ON9A 4KBYA 3CUTA 1CIJA 1YE5A 4TS9A 5AHKA 1NDUA 1V11B 2I8CA 2P6OA 3EWSA 1RMYA 2YNMA 4HX2A 4RVGA 3W8DA 3WGGA 1NBAA 2QT1A 3VU3A 2X41A 4CQMB 1EKXA 4X0EA 4MARA 4IIJA 3OECA 2X8WA 4BVKA 4ZOLA 3QP9A 1XZEA 4HNHA 4KFRA 2QTCA 1L4MA 3KLMX 3ZY4A 1C7ZA 5BORA 3L0ZA 5DMHA 5GZ3A 1MO4A 1A95A 1Y6ZA 4YK7A 3CUKA 3CVUA 4XCXA 2O2CA 5FLEX 2HO4A 3TE7A 1U8UA 2VVTA 1GRNA 1YOVA 3BGSA 3S8MA 1Z4LA 2FG5A 3JQDA 3U49A 5AESA 5CX1A 2B37A 2D5IA 1MQSA 1PFUA 2F1OA 3O21A 5JEDA 1Z17A 5ERGB 4KK4A 2C3MA 2LDBA 3V80A 1CNEA 4TXLA 4CMKA 4MHOA 4G5GA 1YB6A 3C5HA 4FE4A 3DJFA 5DYGA 4DMKA 3E7WA 4CMIA 4CYMA 4ER7A 4MUMA 4YAFA 4D9GA 3AEXA 5CB4A 5JAPA 3ORFA 1KJNA 1X19A 1ODCA 2IP1A 3A05A 1QRAA 1GZ4A 2D7DA 1ZBQA 4E09A 5DI3B 2D5LA 1N3IA 1DBSA 2GVDC 5CM9C 5G4LA 5EMJA 1MH9A 3X1YA 1RIFA 2HC9A 5BN4A 5KKCA 2PHZA 1A97A 2Z5LA 2FPOA 1E20A 1GYPA 3H11A 4Z9YA 3SR3A 5AW8A 4Y1GA 5DCLA 5EFOA 3VR5A 3NNNA 3W6PA 4F11A 3E82A 2FHSA 1CG6A 2PH7A 1CR1A 3WGVA 4WEOA 5LMZA 4JWTA 4MULA 2AZ4A 5KDLA 3ICQB 2RHMA 1F8XA 3NYQA 1NXVA 2N1BA 2O52A 1U04A 1O8BA 4GKAA 3RR2A 3MILA 1JTVA 4I1IA 1O4WA 4K6OA 2DHEA 2OA0A 4DREA 1DT3A 3AUYA 3T7EA 1EFDN 1GUAA 1UR5A 1KBZA 3DXYA 4JSRA 4DQXA 2RHOA 1N6LA 2O06A 3C43A 5I9TA 2PUGA 1GGKA 3GXBA 5DK4A 2PL5A 1WVGA 1I1HA 2WT4A 2PMDA 2Y1LA 3I83A 3LQKA 1QOZA 3PQ5A 4KE9A 1O94D 2WV7A 5K0NA 3SY8A 5BWBA 1NUSA 1SXJB 1C2YA 1XNGA 1SQ5A 2COUA 2E5WA 2SKEA 5BW8A 1DKPA 4DR6B 3DZGA 2H7XA 3OX4A 1GNQA 2Y1DA 1M0WA 4LY9A 1UWCA 1W76A 1TA9A 1L5RA 1UADA 2HM7A 3BE6A 4GC5A 4H7PA 4HGOA 4JASB 1ZM2A 3W7BA 1Z82A 1NQAO 2B6NA 2YZGA 2GBPA 3VHLB 1ZI8A 3A9VA 3CX6A 3SSNA 4OXIA 2IEYA 4GOOD 3V4SA 4RIGA 4DIFA 2C57A 3IOBA 4NEHB 4QQNA 4MR9B 3V8QA 3WWZA 2G40A 2ZQZA 3JD2A 4FMBB 4RLFA 1U0OC 3ELUA 4NJMA 1T0BA 5ADHA 5H02A 1ZD5A 4PZAA 3PCRB 1U6IA 3HTXA 3Q3GE 2PD4A 4QOGA 1GDDA 3R24A 1B8UA 1M1NA 1ZKDA 3IKJA 3U6BA 3L1HA 3PENA 1TIBA 4OSOA 4BJ6A 4P3YA 1X0VA 1OYOA 2V45A 3DVAB 1F8FA 2B7LA 1XTIA 4IH1A 5FF9A 5BNFA 4ZT2A 2I76A 1JJVA 2C4NA 4BMXA 1KRHA 2HREA 2JL1A 3I2YX 3UTCA 3PB3A 1SY7A 3BJMA 3E2IA 1DCMA 5CPBA 4LY0A 1SUPA 2QMHA 2WYWA 3GUYA 4KKXB 3JAMA 2YWGA 5TMBA 1RBYA 4ND8A 1T9DA 3S4YA 2CXHA 4XH9B 1NZJA 4W8OA 4BJ3A 1JHXA 2VZ8A 3I9MA 4WKOA 4K86A 1VG9B 3M5DA 3F49S 5IH3A 4FM9A 3IMKA 2XF8A 1X92A 1NN0A 3EJWA 3F46A 4UMDA 4WFIA 4KU4A 4BQIA 1E0AA 4L27A 3L0IB 1KJ8A 1Z83A 2REQA 3NB0A 4GPZA 3WLNA 3X1WA 4BRWA 1OFUA 1SBCA 2GOYA 3K9GA 1GZUA 1E2MA 1A9RA 2QRKA 3BRWD 4OKIA 3QQ5A 1GCGA 3P2IA 4NULA 4F72A 3NPMA 3C6ZA 2O20A 2X0NA 3E3OA 1FSFA 3FPCA 4OXRA 1AGXA 3ASYA 4GSYA 1XUOA 2VNAA 2O2IA 4XUCA 4K3UA 2Y27A 5TXGA 4UNRA 4JA0A 1OAOA 6CHYA 1E0DA 1PFWA 5C52B 5ARCA 5I8PA 1XV5A 1G6OA 4GWGA 2E1PA 3VRHA 2HBZA 2RC5A 5TMDA 2BTQA 4XDHA 1UKZA 2GT1A 2V8OA 2ZTMA 3BXGA 3USCS 4KAJA 4RYDA 5BV8A 3GLVA 4OI1A 4CEJA 3OM1A 5LWHA 3LGAA 3SWWA 3QA3E 4JR0A 2JGAA 5HM6A 1P8AA 1ADGA 1N6KA 2QEQA 3C4QA 4M1EA 4AG3A 1CZOA 5JWHA 4RJKA 4A5SA 1MU0A 1ISJA 4PC2A 2XMSA 1E64A 1R37A 1OZGA 3FWYA 4J75A 2IIQA 1WPQA 2B8WA 3I30X 2XA9A 1IHUA 4JBWA 4W1QA 3GGGA 3ESZA 5AVWA 1NF2A 2ZI3A 3HABA 2IU3A 3Q1KA 4P2GA 1L5GB 5A7HA 3STTA 3TUIC 3K8QA 5MN6A 3K09A 1E69A 2JHFA 4WACA 4ABTA 1IN8A 4QDZA 2DSTA 1J2JA 3GJ7A 4BNIA 1WEHA 1FP4B 2VTBB 5ALLA 3ILHA 4QO8A 3DMGA 3R5KA 1GPKA 1UK7A 3LPMA 3QYFA 3U1BA 3FGOA 4KCGA 1YKSA 4TWAA 1AIPA 3ZU3A 3FTNA 3COZA 4BGUA 2E4AA 4DLZA 4ZI7F 4D25A 2ZKLA 4BX3A 1R9NA 4BLQA 4HAUA 4X7PA 2POQX 2YJNA 2B69A 1H2EA 2IYLD 4IJ6A 4DCMA 2I1LA 2HR1A 1OXXK 1T2FA 3TCKA 3ZUGA 4DABA 2FMHA 3FDZA 2O5RA 1T6NA 3ENQA 5IP5A 1WBDA 1JLSA 4EKYA 3HCPA 4EPVA 2WOOA 5TC4A 4PU0A 3HRHA 1K6EA 4KACA 1QAMA 1R2QA 2QQ0A 2LPMA 3KKPA 4BNHA 1KH1A 2EFHB 1NBMD 2QW0X 4BO0A 4LRSB 1DBRA 1NFRA 4DLKA 3SHWA 1XALA 4O59O 1C0KA 1SVLA 2ZDGA 4LBYA 1SBIA 3TSOA 5ALMA 5KJ1A 1EE1A 4PO3X 2QY9A 4DB2A 1Q0QA 3E5HA 5CH8A 4TLAA 5K6RA 3K9CA 1QCCA 2FRDC 1D6MA 3GFPA 1P5HA 2M6RA 3LZ6A 4JBNA 1JALA 3SFZA 3ZDYB 1VP9A 1X80A 3H5NA 2O0MA 1V43A 3G2LA 4TMKA 1YB1A 2W6QA 4EJFA 4B7CA 1ESDA 3QLVA 1F20A 2Y1WA 5LD2C 3BORA 2FOXA 3G0IA 1JEEA 1TCAA 4HY3A 2CHEA 4HB3A 2YYYA 5EIWA 1WCIB 2WTNA 3K05A 1EP2B 1MRZA 1X74A 3L8HA 4BY9E 1J0CA 3VZPA 3W6ZA 3E70C 2YHIB 3WBBA 4KL8S 5JNUA 1IG0A 1COWD 1GNPA 1HY3A 2NPIA 2CJWA 5B36A 1N36B 1B6RA 1AKWA 5JSQA 1VJ5A 1YTUA 5EJ4A 2QJRA 3GZNA 4DPMA 5I9BA 1ADCA 2A94A 3SYNA 3MGCA 4G41A 1Y82A 2GXQA 3D6HA 3DJYA 3GDFA 3UENA 2BBTA 3HGQA 3VR5H 1E4EA 1JSCA 1I1OA 1Q1GA 4CODB 1C3JA 3KTOA 3JVUA 4KGZA