2BFPA

Leishmania major pteridine reductase 1 in complex with nadp and tetrahydrobiopterin
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
283
structure length
267
Chain Sequence
VPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRNGDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Leishmania Major Pteridine Reductase Complexes Reveal the Active Site Features Important for Ligand Binding and to Guide Inhibitor Design
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 98
structure length 267
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2004-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bfpA00
1XG5A 5GY7A 3GDGA 1X7HA 1ZUD1 3DZHA 5BSGA 1A72A 1B8UA 4PG5A 2G0TA 5IZ4A 1FK8A 4R5HA 4CM3A 5GMOA 1G0OA 1D4FA 2GN9A 1DDOA 5LDHA 2DUWA 3JD3A 4CJXA 1ADGA 2GUGA 4CMKA 4DPKA 1P9LA 2EGGA 3KM0A 4NH4A 5F21A 4CM5A 2B35A 1LC0A 3K96A 1LDGA 4GWGA 4ROSA 1VC2A 1YS4A 3TF5A 3UH1A 4MP3A 1KY4A 3RC9A 4U5QA 3PHJA 2JD1A 3EHEA 3U0BA 2VT3A 5A03A 1T4DA 3D5QA 2GO1A 3VTZA 5KCZA 2VHXA 1P33A 2D8AA 1HZZA 1AXEA 4RQUA 3RCBA 5JFOA 1XKQA 3ROMA 4TRMA 5EL0A 2EHDA 2EKQA 1J49A 3GK3A 1NFQA 3DBLA 3DZJA 5I7SA 2R00C 3M1AA 3TSCA 3L4BC 3DONA 3OEYA 4FJ2A 4BKQA 1EEHA 1H6AA 5COQA 3V2GA 2O7QA 3HADA 4XGKA 4Z3DA 4P8RA 3JQFA 1NWHA 3C7DB 4E3ZA 3FNEA 5C5IA 4LGVA 2VNAA 2W90A 3B1JA 3SC4A 1E1MA 4WOJA 4ZJUA 3GVHA 2NQTA 5IN4A 4YPOA 3WGQA 2C29D 2HAEA 3HFSA 4OSOA 3COSA 3ZU5A 3DAPA 2D1YA 1YRLA 2Q3EA 5KIAA 1ZVMA 4HADA 1E3WA 4IS2A 3DBRA 4LRSB 1P1FA 4U6QA 5T8KA 2XF8A 2VYNA 1ORRA 1WP4A 1U3UA 4PLVA 1UZLA 4D42A 5A04A 5ER6A 3ZH2A 4RVSA 2AG5A 3D4NA 3I6QA 3JYOA 3FPCA 4J4BA 2FRDA 1DEHA 4U0KA 4W99A 2QYTA 4CM4A 2YFHA 1HDGO 4UVDA 4W82A 3RUDA 1UXGA 1DRUA 1HLDA 4Y9DA 4Y6RA 3CZMA 3F1LA 4H15A 1KVUA 1DC5A 2DTXA 5ILGA 3RUIA 1AN9A 4NHEA 3WLFA 4WGGA 3GVPA 2ZJ1A 4FFRA 2PGLA 2HCTA 4GVXA 3ZCXA 4IDAA 1F17A 2HMWA 3D3WB 3BMNA 2DLDA 4M1QA 3VZSA 2IRWA 4OKNA 4WEQA 1B2LA 1J6UA 1VJ1A 3DXFA 3NEPX 2Z1NA 4TZTA 3DOCA 5CG1A 4NBVA 4E0BA 3GGGA 2UYYA 3LLSA 1LA2A 5H82A 5JY1A 5K6AC 2Y1EA 3SBOA 1MG0A 2NQ8A 4Y67A 4WCFB 1H2HA 3DBHB 4O59O 1PWXA 2C54A 4YYZA 3BYZA 3DHNA 3JD1A 5IJZA 3PZRA 5KKCA 1KYQA 2A9FA 5C7LO 1HL3A 3RROA 1SEVA 1EDOA 1K89A 4AJPA 1TVEA 2A92A 1PZEA 4CLHA 1BXZA 4GKVA 3TRIA 4EGFA 1PGPA 3HN7A 3DC2A 1MP0A 2XXBA 1QYCA 3JQ7A 3DL2A 5U9CA 3I83A 8LDHA 2ZJ0A 3GQVA 3PJGA 4CM9D 1NPDA 1MGOA 2QRJA 3JQ7B 4R3WA 1KVSA 4ND2A 4NMHA 3ADPA 4R9RA 2J5KA 2ZIZA 5I7EA 3TPCA 1EE9A 2YV1A 3B20A 3JQ8B 1HE3A 3C1OA 3CEAA 2I5PO 4JK3A 3RKRA 3ZI0A 1DBVO 1B26A 5KKAA 2H9IA 2WTBA 3H4VA 2EWMA 4J16A 3WGGA 3LZ6A 2VHYA 1UDCA 1P1JA 1X13A 2R2GA 4GAEA 3RBVA 4ND1A 1LLUA 2OUIA 1U3WA 2F00A 1GL3A 3AFMA 3AUAA 1SOVA 2VZ9A 3KOUA 2W8ZA 4R9SA 4DPLA 1R4MA 2Q1SA 1QV6A 3B1FA 3IKVA 1T26A 3PHHA 1GZ4A 4LISA 2OBNA 2CDCA 5ICSA 1N92A 2B0JA 4DQUA 3I4FA 3TFQA 1CQIA 1HZJA 2Q45A 3LLVA 3IL2A 1B3BA 4NG5A 2EJWA 2PZMA 4ITUA 3SLKA 2B4RO 4D0RA 3GMSA 3JQAA 4DLAA 3QVTA 2FHSA 4H3VA 4TVOA 2YW9A 5A9SB 2WD8A 2I3GA 2Y0CA 1AHHA 3FNHA 4I5DA 4KWHA 4QEDA 4LRTB 1I8TA 1RKXA 5C7OO 5CPBA 3IJPA 3WWZA 2WEKA 1NYTA 4ND5A 1ZMOA 1PR9A 1PZFA 2A94A 4PLPA 1H9BA 1NQ5A 3OBBA 5EINA 3L07A 1LSOA 3OP4A 3PK0A 4ZQHA 1MXFA 2VRCA 4BL5A 3TQHA 5B37A 4ZQBA 4J2OA 3E18A 2R6JA 3V1TC 3BXXA 1W0CA 2VCYA 4OH1A 1OC4A 4IDCA 2AQIA 3S55A 1PJQA 2PZJA 4R68A 4IXTA 2AW5A 2PH3A 1P31A 4MIOA 3DOJA 1EUCA 5IAAA 3RFTA 4PLFA 4DA9A 4C7KA 4YT5A 1D7OA 4BNYA 3O8QB 2ZQYA 1FMCA 1HSOA 4RVFA 1ONPA 2O23A 5DF1A 4B3HA 3JQ9C 2AMFA 4ZHSA 6LDHA 3KSZO 1CQJA 1L7DA 4RZIA 2CDAA 3B1KA 4QO8A 2EERA 1C0LA 1Q7BA 2CF5A 4PZDA 3C7CB 5A06A 1Q1NA 2I67A 2B83A 2YJZA 4OXKA 5T8KC 1V0JA 2Q4BA 4P4GA 4DIOA 1RWBA 1LDBA 2VTDA 3PGJA 3OIDA 4Q9NA 2J8ZA 3KO8A 5L45A 3GA0A 4IJUA 3FTNA 3CIFA 3OQ1A 3H65A 1P77A 2D3TA 1K2WA 2B36A 4J7XA 4E30A 1BTOA 2VWGA 5TJ9A 2BMAA 3WQQA 1C1DB 3RD5A 1DAOA 5AXBA 3JD2A 3KLPX 3H9GA 3AY7A 2Q4EA 4UEJA 3CPSA 4FOOA 3AU8A 3WTCA 5JY6A 2VYVA 5G4LA 1GQQA 3C24A 3O4RA 1JW9B 5A02A 3MTJA 3KYDA 4CQMD 2OP1A 4XQEA 1FXSA 2X9VA 4ZVVA 1AE1A 1Y8RA 1OAAA 3NDJA 3BMCB 4CLRA 4K6FA 1OBFO 4NK4A 3CE6A 4IQ8A 3GEDA 3M1LA 1M6WA 2FOIA 1TT5B 1DJNA 2I65A 3TZQA 4AJ2A 4IQ0A 5BQFA 1L7EA 4IJVA 3ZW9A 5LCXA 1ZFNA 4K6CA 2DBVO 1QR6A 4YJGB 3VTFA 4DXHA 4Q3CA 2NU8A 3VPXA 3GG9A 2X5JO 3E6AA 1EBUA 4CMHA 3BHIA 5ILOA 4FSHA 5JAIA 1FDVA 3DBVO 2QYSA 3ZWWA 5JCJD 3NYWA 2NACA 5THQA 3ZZNA 3VZRA 3INRA 2YV3A 1KETA 1F06A 1Z7BA 2SCUA 4M8SA 4YACA 3GRPA 1CF2O 1Y7TA 2GN8A 3VAZA 5L51A 5T64A 2C82A 3BAZA 1PJSA 4YJHA 3VZPA 3A14A 4E5YA 5HBRA 1C1XA 3BMOB 4W9NC 1ZXBA 4ZRNA 3SJ7A 3GEGA 3I9MA 5F1PA 3WSWA 1JA9A 3NJ8A 1HF3A 1I5RA 1R15A 4Z0PA 4I8XA 3Q6IA 1U8FO 3FTPA 5FEUA 2GSDA 1C0IA 3HN2A 3RUHA 3KXDA 5JSFA 2DBQA 3QA9A 4YBZA 3TZHA 4UREA 1H5QA 1TXGA 2HSDA 4KDEA 4IQGA 3T7EA 5FWNA 4MJLA 4NJMB 3DDNA 2G1UA 3NT2A 3ZNPA 3N74A 2Q49A 1KERA 1PJ2A 1FDUA 3GFGA 4IGFA 4R3NA 4GGOA 3KZVA 4CR6A 4L76A 4GX2A 1ZEJA 3BTOA 3OSUA 4M87A 5IN5A 2YHIA 4DTIA 4AVYA 2DPHA 3L77A 1YH3A 5L95A 4CODB 3OA0A 3ZWAA 1V8BA 4PLYA 3IC5A 2HUNA 1LLQA 3RWBA 4LMPA 1LLCA 2UVDA 1H6BA 3HNPA 3L0DA 4IDBA 3WFIA 1LC3A 5DCUA 3R6DA 4QTZA 3RAJA 3CKYA 2LDXA 3QWAA 2X0NA 4GX0A 2OORA 3BMQB 4IIVA 1GADO 2FR1A 4TRRA 4DMLA 3GY0A 2ZTMA 4PGFA 4CMGA 4DQXA 4GX1A 3UUWA 1YDWA 2WD7A 4UULA 2P9EA 2JFHA 3G49A 3FSRA 1YQDA 4J9VA 1DIBA 2BFAA 5JPIA 3DFZA 4YVFA 3WYBA 2ZKLA 3WIDA 1SB8A 3KLMX 1R12A 5FFFA 1Y1PA 2DTEA 3KSDO 3ZWPA 3LC2O 4MP6A 4LVUA 1P3DA 1YL5A 3ENKA 4DWVA 3ABIA 1SOWA 2FSSA 3RBZA 5KTKA 2HK7A 3AUUA 4J1TA 4EZBA 3QY9A 4YJDA 3ZWNA 3INGA 1HYEA 1X0XA 3P7MA 1E3LA 3PTZA 4KWIA 3A1NA 3TZCA 5JC1A 4GX5A 2D59A 1ULUA 4RF4A 3MJEA 4Q3EA 4B79A 3GT0A 3KVOA 1GEEA 2H5LA 3JQAD 2Y93A 4YJFA 1NPYA 5JAQA 4UUPA 4XIJA 4OIMA 4PRLA 4I1IA 2FY8A 4W4TA 1Y5MA 4YJFB 3WJAA 1U2DA 4RF3A 5C37A 1S6YA 4E2YA 2B69A 1D8AA 4XYLA 2H6EA 1P74A 3RASA 3LSYA 2EP5A 1BXGA 4BQPA 4J0EA 1XSEA 4WOKA 1ISMA 4B4VA 2P68A 3P2OA 1BSVA 3JQGB 4FGSA 1ENYA 3JYPA 2A4KA 3GN1A 4KMSA 3NKLA 1DFHA 4UUNA 4CLDA 4EEZA 3CXRA 1HXHA 2DBRA 5C7IO 3KYBA 4YXFA 1U7TA 1XQ6A 1I33A 1XEAA 4DMMA 3ICPA 3OJ0A 1NAHA 3GVCA 1T2CA 3RC7A 2FP4A 1J0XO 1DHTA 2P5YA 1E3WB 5L7YA 3DBLB 4YCAA 2PKQO 1NR7A 4ALNA 1ID1A 2B5WA 4ID9A 2VYND 4CMJA 1GQ2A 1DRWA 2YHUA 4WLNA 2UV8A 1PZGA 1ADFA 2W4QA 5H81A 3MJVA 3S8MA 3WS7A 5AXCA 3OQBA 4XDYA 1G1AA 1LSUA 2PTGA 3ONDA 4ALMA 4BKOA 1AGNA 1YOVA 2J3JA 2ZTLA 3PZBA 4Z9XA 1PIWA 2X0RA 1QP8A 1XQ1A 4IMPA 4TQGA 4LCJA 1PL6A 1V6AA 2AEJA 3IIEA 4CL3A 3FBTA 2C59A 2VT2A 1ZK2A 1ZXLA 1IHYA 4NFHA 5CFZA 4CL8A 5FF9A 3ZU3A 2E49A 3GGPA 1WVGA 1IOLA 3GZNB 4RCVA 3OA2A 5TC4A 3WBBA 1WDLA 4JQCA 2WSBA 3K30A 4M86A 1TT5A 3NDIA 5JAZA 5IDQA 4YQZA 2PZKA 4IJWA 3SXPA 1X14A 1QYWA 1JKIA 1LNQA 1TA4A 4Z0HO 5G0VA 4MKXA 4PG8A 3GPDG 1DB3A 5MDHA 2FZEA 1M76A 4IM7A 5AVOA 4E5PA 2VWQA 2HRZA 5HM8A 4HV4A 3HDJA 3EUWA 3WICA 2XAAA 1ISFA 4R1NA 4ESOA 4AL4A 4B8WA 1M6HA 1E3EA 4GWKA 3AUTA 4YQYA 3AOGA 3QP9A 1SEPA 4MKZA 4FR5A 4NI5A 3WGYA 1SBYA 3IS3A 3AOEA 1LTHR 2VZ0A 1BW9A 5A5EA 2PZLA 4YJHB 4H16A 2B4TO 1C1XB 2FMUA 3BMOA 1NNUA 1Q0QA 4WPGA 4J1SA 4B3IA 1B8VA 4CLOA 1NHGA 2X0JA 3FRJA 3WTBA 3ZNQA 1M67A 3DB2A 3FHLA 4FCCA 3F4LA 5DP2A 4RPKA 4PLGA 2QG4A 1ISIA 2E37A 5CEFA 2DC1A 1PX0A 1UP7A 1VI2A 2QQ5A 2Y0DA 4KQWA 4MVJG 4WEOA 4KP7A 4BMSA 5L4SA 4J1NA 1RPNA 2CMDA 4J90A 4U8GA 2PGDA 4PVCA 2YYYA 2BFOA 2VN8A 4XQ9A 2X5OA 2O4UX 1NQOA 1YBAA 2DBZA 1X7GA 4EYEA 1ISHA 1LX6A 1BGVA 1NVMB 2P4QA 1KC3A 2HU2A 2P4HX 4PLHA 4DYDA 3KYCB 3PFWO 2VQ3A 3DMYA 4KDFA 1LQTA 4YB8A 4ZA2A 4JP2A 3LYLA 4HBGA 3QWHA 1LI4A 3VKUA 3D5TA 3GNQA 2CY0A 1JN0A 3QRWA 5TS3A 4CM1A 1QSGA 1QORA 1PJCA 3DZIA 1E6WA 2Y1CA 4WLOA 4B7XA 4EJ0A 5TLSA 2W98A 2HK9A 2IYOA 2Y1FA 5I9NA 2QZZA 2NVWA 3H5NA 4ALKA 1E6EA 1ENOA 3W6ZA 3MOIA 4PZCA 5JDCC 3E1KA 2VWHA 1ISGA 3ZWYA 1N9GA 3H9QA 2A35A 1EUDA 2FR8A 1Q7GA 2X5KO 3MWDB 3HFGA 4F6CA 3AM5A 3V8BA 2IEDA 3F3SA 2PD4A 4RDHA 1GCUA 2QX7A 1XCBA 1P1RA 4CQMB 3OIFA 4BS9A 3QSGA 4BQRA 4GSLA 5JYEA 4NBTA 3GG2A 1R0SA 2O7SA 4Q3AA 1F12A 2FPPA 3ROPA 2PA3A 2ZTVA 3HQ4O 1LDMA 3U3XA 1T4BA 4NDNE 5JCXA 3WGOA 1N7HA 1B3RA 1GFSA 4MVJM 4RPGA 4B4OA 4WNIA 1Y9EA 2PWZA 5TJHA 4MVJA 4QX6A 1IL0A 3KV3O 5F1OA 4GI2A 3A28A 2FPIA 1P1HA 1PL7A 4JIGA 4EJMA 3V2HA 2C20A 4BNFA 3SLGA 5K6AA 3C85A 1DLIA 5EQFA 4BNGA 4OL9A 3NGLA 2NVUB 3OM9A 1E1LA 4BNJA 4CPDA 3RUFA 4D3SA 1YXMA 3FD8A 4HNGA 4WJZA 4L4SA 3VH2A 4KTTE 1PS0A 5G4KA 3ZWXA 1EK5A 1Y6JA 4HNHA 4FS3A 5DNAA 3AY6A 1PU2A 3EZYA 3GPIA 3IDSA 3IAHA 5KJ6A 3AI2A 1MC4A 1PZHA 5TF4A 3AFNA 1W4ZA 1WNTA 2OHXA 4FOSA 3UF0A 5L4LA 5H83A 2Y1GA 1JWAB 5F5LA 2V65A 4XYEA 2ZB3A 1CJCA 3H2ZA 4OQZA 1R4NA 4PLWA 4RO0A 4UVIA 4Y98A 3ZU2A 1SC6A 5A3JA 2CDBA 4E31A 2O4CA 3INTA 1KEUA 4PLTA 3GHYA 4YAEA 2NLOA 4I5FA 3AY3A 4N18A 5JYDA 3PWSA 3IUSA 5GZ6A 2B37A 4FC6A 3SX2A 3GGOA 1SNYA 1BVUA 4J7CA 1GEGA 2PR2A 1LSSA 2C5AA 1T1SA 3G1TA 3W8EA 3WSVA 3ZNOA 4F6LA 4KZPA 5DP1A 5JMPA 4XA8A 4NBUA 4RVHA 2UAGA 4WUVA 3GF4A 1UXJA 1E7SA 2PD3A 3L6DA 1Z74A 2XPCA 3FWNA 1O0SA 4DBZA 1ADBA 2PD6A 1EQ2A 2H1SA 5L9AA 4AJOA 3RKUA 2AXQA 3GC6A 3Q1LA 3VDQA 3LT1A 4L4RA 3ON5A 1UUFA 3DAGA 5EMHA 3NTQA 2VUUA 2E4AA 3L4BA 1NFRA 4ND4A 4AJLA 1IY8A 4JXKA 2GNAA 4BB6A 4MIEA 4EUHA 1JU9A 3JD0A 4LSMA 1XU9A 3CTMA 4OQYA 3VPGA 3M2PA 1IPFA 3LT2A 1Z6ZA 1A4UA 3OJOA 3PP8A 4W7HA 4R51A 2J3KA 1EUZA 1EVJA 3QVSA 3AWDA 4E2XA 1KS9A 5JDIC 1U5AA 3H2SA 3MJSA 3OJEA 2ZQZA 2WYUA 1KEWA 2DM6A 3GN2A 3DTYA 1Y5RA 5ER9A 1OFGA 3IP1A 3WGHA 3ZV4A 1KVQA 1HRDA 3ZDFA 3UFXA 1UAYA 2RAFA 1Y8QA 4WKGA 2PLAA 1LRKA 3PHIA 4OSPA 1E3SA 4M55A 3F5SA 1IB6A 1YO6A 3W4IA 1LDNA 1N1EA 4PRKA 1UZNA 4BO8A 4IIUA 1E7QA 2QIOA 4CM6A 5L7TA 4QFDA 4M49A 2NTNA 4R4JA 3ASUA 2O3TA 4AJIA 4YAJA 3TZ6A 1LRJA 4FBGA 4RGBA 2W2KA 2ZCUA 5C3MA 3WWYA 2OBYA 3PWKA 1YKFA 4DUPA 4AG3A 2BHLA 2UDPA 3DMTA 5TT0A 2BFMA 4FC7A 3ANNA 1TLTA 4RLHA 2JAHA 3GLQA 3OJFA 1JKJA 2OZPA 4M89A 3OETA 3WGZA 5MGBA 4GH5A 1A27A 1QXSA 3UCXA 3JQ8A 4BV9A 3N7UA 2C5EA 3D7LA 1UAGA 1WZEA 3UGKA 1QV7A 1SCUA 4E33A 3JV7A 1HE4A 5ITVA 5L53A 2AHRA 4WECA 4PLCA 5ES3A 3JQ9A 3LC7O 1YE3A 3DEYX 3BA1A 3E5RA 1B15A 1MUUA 1EMDA 2X22A 3DAFA 2GASA 3NAQA 2YFQA 4Q3DA 2O3QA 1UXKA 3MTGA 2JHFA 3R3SA 1NFFA 4GLOA 2NADA 1PEDA 1NQTA 4BNVA 1LEHA 4MIYA 1O5IA 5A9TA 3HB5X 1HEUA 2AQHA 2CSUA 4EDFA 1FF9A 3FN4A 4R1UA 2HMUA 4HFMA 4II3A 3QWBA 3EVNA 2EP7A 4BNUA 1K6JA 4S3MA 2V6FA 1CWUA 2C0CA 2WYWA 3D4PA 2ZYAA 2BI8A 1DLJA 2HJRA 3PI7A 1YWGO 4MINA 4FGWA 4YTEA 4LCEA 4J2HA 4RV9A 1Y81A 3S2GA 4MPDA 3SVTA 3I9JA 4G65A 3ULKA 4WCFC 1KBZA 5IG2A 4GGPA 3S2IA 3LT0A 4OAQA 2AQ8A 1IUKA 1E0DA 3PJEA 4TZKA 2OOSA 3RJ9A 1GTMA 4WE3A 5ADHA 2B4QA 4P4NA 1E7MA 5COBA 1I3MA 5T6BA 3O38A 1Z75A 3LK7A 5IDXA 1V3UA 4CM4B 2V6MA 4OXYA 2YQ5A 1QLJA 1Z73A 3PIIA 5FYDA 3VVBA 3WLEA 5EIOA 2X9NA 3DZBA 2FR0A 2POQX 3QJ5A 4OXNA 4TWRA 5DULA 2PGJA 2OO5A 2E82A 1CDOA 4HP8A 2PKQP 4RVGA 5AYVA 1EQUA 5AXDA 1H6CA 3NT4A 4ZQFA 1B7GO 2HMVA 1D1SA 4JNKA 3I9KA 6ADHA 3R3JA 1BVRA 3Q11A 4CQLB 1EZ4A 1I24A 5IXSA 3H6KA 1E6UA 2CUKA 3HUDA 4LSWA 3B6ZA 3EY4A 3LF2A 5U4QA 3VHRA 3WMXA 3WYEA 3ZHZA 3S2FA 1I3LA 5TRTA 4BO1A 3D3WA 1ZBQA 3ZN2A 2EG9A 1U8XX 4A26A 2Y67A 4ALJA 1TEHA 3AK4A 3BZUA 3ZWBA 4CMIB 4JJGA 4ZICA 2FSVA 1PJ3A 5KVVA 1A9ZA 3A06A 2AE2A 4DREA 3ZNNA 3U49A 4L8VA 5CAEA 3E5MA 1DC3A 1DIAA 2BELA 4BHTA 5L4NA 3WJ7A 3X2EA 1BDMA 3F46A 3PQEA 4IPTA 1A7KA 4ZQGA 4EJ6A 1YJ8A 4RPLA 3WB9A 3TJRA 1HETA 3ZWMA 5CDUA 3BMNB 3E82A 3JCZA 1JKFA 4NPCA 1R0LA 3ROKA 1G0NA 3DZFA 1XU7A 4TRNA 4DIFA 3PYMA 2J3IA 5DOVA 1CIVA 2EW8A 3I23A 2WJPA 5A9RA 4XZ3A 3EMKA 2YV2A 3A4VA 3H3JA 1QYDA 3VH1A 4AJ1A 4K28A 2CVQA 1SZJG 4RQTA 2H63A 2HJSA 3CUKA 2OFPA 4FQ8A 1HLPA 1TI7A 1YB4A 3L9XA 4QSMA 4IMRA 1ZK4A 1I2BA 4GVLA 3VPFA 1E7RA 1FDWA 2GPTA 1WPQA 2OGUA 4IS3A 4FDAA 3DO5A 3MCVA 5DBGA 4HXYA 4O0LA 5CP8A 3DTTA 1WXDA 1DC4A 4DC1A 3NRCA 3KEQA 4XRRA 5I8WA 1F8GA 4I5EA 1EDZA 3EGOA 3JQGA 4TSKA 3NJ4A 3HDYA 1A9YA 3I52A 4EW6A 2YHIB 1GPJA 1N2SA 4P22A 1ONOA 4BNLA 5CDSA 3U09A 3U4IA 1HWYA 1ZK3A 4HFNA 4K9DA 2HO5A 1M2WA 3H9EO 3DZGA 4O1MA 2VOEA 2HMSA 2ZYGA 4J7UA 4HUJA 3JQBC 4R1SA 1UR5A 4PN3A 1NVGA 3DOOA 4EBFA 5KVSA 1DIGA 3EDMA 3V5NA 1F14A 1NASA 2ZCVA 2OL4A 4OKIA 3WNVA 2E48A 2Y0EA 1E5LA 2JCVA 4EUEA 3PYLA 2HKIA 3H9JA 1I0ZA 2DQ4A 4FJ0A 4YRBA 1TB4A 3GVXA 3RBXA 1PJBA 1U5CA 1E3IA 1PJTA 3F6YA 3RUCA 1YDEA 1YBVA 3ZV3A 1QYVA 3QVOA 4L74A 1E7YA 1T2EA 2P9CA 3WGIA 2Z1MA 1R66A 1OI7A 2JFFA 4IJKA 3G79A 1I3KA 3ZWOA 4H7PA 1RM0A 1A7AA 1W8DA 2O3RA 1DIHA 1ZIDA 1ONNA 1DXYA 3C1TA 4TMFA 1QKIA 3HHPA 4MO2A 1XHLA 3DBHA 3HDHA 3WBFA 2D2IA 3L6OO 2W2KB 2GGSA 2ZK7A 4BVAA 3RUEA 5DOZA 4RJTA 3PVZA 4E32A 3IUPA 4E5NA 1H0KA 3VC7A 4R69A 4YJGA 2BGMA 3MJCA 2W2LD 4BNMA 4BNHA 3KTDA 1U4OA 1WWKA 4YRDA 5T57A 1EE2A 4YRAA 3K6JA 3ZHBA 3ITKA 3G1UA 4J4HA 4DQVA 3QHAA 5BSEA 1O8CA 1GV0A 1I32A 2NVUA 3ZGYA 4Z6KA 3L4SO 4DPMA 3N58A 2OMEA 2Q99A 1AUPA 3C7AA 3G3EA 4BO0A 5TIIA 1XLTA 3AU9A 5F1KA 4JLWA 1Z45A 4PG6A 1PR3A 2PV7A 3C3XA 3ZWVA 1FDTA 2WYVA 4JBHA 1VKNA 2VNSA 4D41A 4MVJI 5EPOA 4D44A 2GYYA 4KQXA 5HA5A 4QT0A 3HJAA 4IZIA 1FDSA 4FD3A 5KVCA 2IZ0A 1ENZA 2O2YA 4CV2A 4Z0TA 3WQRA 4WK6A 1UDAA 1DFGA 2HK8A 4ILKA 1R16A 1ZJZA 4BO4A 1VL0A 3L6EA 3NDRA 5CEJA 9LDTA 3I3OA 4HFJA 5DCWA 4CR8A 1YVEI 5EQDA 2WE7A 4A7PA 4YAIA 4JBGA 4JX8A 5IF3A 3Q2IA 1C0PA 3ONEA 4LN1A 4BNIA 3UW3A 4B7UA 2GR9A 3PJFA 4DLLA 3Q2KA 4MVJH 2O3UA 1CEQA 2WMDA 4WLEA 3IOYA 4JJFA 1E3JA 3GHHA 1B16A 3U9LA 4EEXA 1HTBA 2NNLD 4ND3A 2ILTA 4R5MA 5A05A 3F4BA 1E1NA 2EGHA 5HS6A 1MX3A 4F46A 4AJHA 1MXHA 3ORFA 4C4OA 4UAGA 4PIVA 2EKPA 4GPD1 2X0IA 2BD0A 5GZ1A 3AJRA 1SAYA 3OIGA 5JXWA 2JCYA 3OEWA 1RM5A 2G5CA 4A27A 4E2ZA 1GUZA 2X23A 4XGNA 3TN7A 5FI5A 3WQSB 2BFPA 5ITWA 2IYPA 1LXCA 1W6UA 5JO9A 3EK2A 4AJ4A 2PKRA 3JQCA 4A5OA 4IDDA 1ZSYA 4CM7A 5CPFA 2V6BA 1I2ZA 2X86A 4E12A 1VKOA 4G81A 5TQVA 4MKRA 2GN4A 2GLXA 3I4CA 1HDRA 1SPXA 1V9LA 3CINA 3PIDA 3JYNA 1OMOA 4I08A 2I66A 4I5GA 1ZW1A 4CMAA 1K3TA 1D1TA 3CZRA 3AM4A 3FF4A 5K0ZA 1GZ6A 2RH4A 3GAFA 4BKUA 3BMQA 2IZ1A 1ZKMA 2VOJA 1MLDA 1W73A 3JQAB 3BTSA 2DVMA 1P1IA 1RYEA 1C1DA 4UVEA 3CH6A 3LF1A 4FPXA 3K92A 5KNLA 4F3YA 2DAPA 3PQFA 1NX6A 4I9NA 4GMGA 5JDIA 3RVDA 3OH8A 2ZB8A 1F0YA 2F1KA 4R16A 3EW7A 2J5RA 1H2BA 3HE3A 5T67A 1GPDG 4QO7A 1NTOA 2ZYDA 3ZW8A 2QW8A 1C3VA 4AJEA 7MDHA 4NJMA 1PSDA 2JL1A 2EKLA 1Y9AA 4PG4A 1U28A 4OHUA 4UUMA 1LJ8A 4D0SA 3PHLA 4ZGWA 2PK3A 2BI7A 4DC0A 5HS4A 2YDXA 2Q1UA 2UUOA 3HZZA 4DGSA 4XYGA 3EVTA 3GR6A 2PH5A 2J5QA 4GLLA 5JLAA 4CQLA 4Q3BA 1DC6A 4B7CA 3H7AA 9LDBA 3KYCA 4MVJE 4UEOA 4D79A 4XKJA 1BRMA 2C2XA 3PHGA 1X1EA 1X7DA 2V7PA 3R0IA 3QE3A 2Y1DA 5G0SA 3UXYA 1IULA 4JJIA 2JD0A 2RHCA 3K8ZA 1G6KA 5B4VA 3K5PA 4GMFA 1GY8A 4NZ9A 5A1TA 1JVSA 2TMDA 3IQDB 3FPLA 3QWFA 3PJDA 5KVQA 4AICA 3ST7A 4WLVA 1GYRA 3JQ6A 4UEKA 5CDGA 3H9UA 2FWMX 3DR3A 1QMGA 1ZK0A 4R01A 2BKAA 5TSDA 3HB4X 4NK5A 5ENDA 3IKTA 4AJNA 3BHMA 2NU6A 2JHGA 4PVDA 3X2FA 1YB5A 5IDYA 1U9JA 5EN4A 1PQPA 4N5LA 1ZNQO 4CLXA 4BIIA 2NTVA 2NVBA 4CUKA 3FNGA 5TNXA 3VOSA 4DVJA 1HE5A 3JYLA 3IP3A 2WWRA 1WDMA 2NSDA 1K0UA 1CETA 3VH4A 3H3FA 4NJOA 1IHXA 1EK6A 2Z95A 1XWFA 3PXXA 2OXIA 3RFVA 1C14A 3QVXA 1ZJYA 1I30A 3GRKA 3VPSA 1PL8A 1LU9A 4BOYA 4KUHA 1P44A 2P5UA 1ADCA 1Q7CA 4BNXA 2CZCA 2I6TA 4ZRMA 2CF6A 4N7RA 2EEZA 3GH3A 1H93A 1YQXA 4IXWA 7ADHA 2NU9A 1VJ0A 2QHXA 1LLDA 4R41A 2D4AA 1EBFA 3TFOA 1Z82A 4DL9A 1VE9A 1K5HA 1V3VA 2BLLA 2FPGA 1TT7A 3UICA 3OICA 2C2YA 2NU7A 3GDOA 1PGOA 4P4LA 1N9GB 2Q2WA 4ZQEA 1D3AA 3OF2A 4D45A 1IPEA 1YONA 1LUAA 4EI2A 4E21A 1GYPA 1T1RA 3E03A 2C7VA 4DLBA 4EITA 1O9BA 2VTEA 3Q0EA 1SO8A 3SC6A 4Z9YA 2Q1TA 2V6GA 4W6ZA 1VL8A 1KY5A 2G76A 5GZ3A 3STHA 4Z3KA 4DYVA 5B4TA 1YJQA 4TROA 3PYXA 1NXQA 2O48X 4NIMA 4WLFA 3E8XA 2Y05A 3E9NA 2ZB7A 4CV1A 5L7WA 1WDKA 1JVBA 1E7WA 1HDCA 2AE1A 2Y68A 4XRGA 1KEPA 1HYHA 1VJTA 1HDOA 3W6UA 2AEMA 1O95A 1UH5A 2CVOA 4WCFA 2HQ1A 2UUPA 3UHAA 1BDBA 1KEVA 3GZ4A 3GVIA 5A5FA 1WZIA 3GUCA 1PJLA 1QG6A 2ZATA 2X1HA 3G0OA 4RPHA 1GUYA 1YOVB 4QUKA 5B4UA 2LDBA 4GKBA 3SEFA 3T7CA 1X15A 4OOEA 2ZB4A 5J23A 3BIOA 1PS8A 2RBEA 3AM3A 1J5PA 1IZ9A 1DFIA 5JS6A 3EYWA 1YBMA 3RI3A 4L4XA 2VUTA 4QQRA 3ITDA 4RZHA 4TKMA 2GCGA 3JYQA 3GOHA 3AI3A 4INAA 1BHSA 4R54A 4N54A 3FR8A 3U5TA 3BMCA 4CLRB 2YDYA 3A9WA 3C1AA 4XB2A 3SJUA 2P9GA 4PLZA 5AOVA 4BO6A 3IMFA 4KTVE 1XDWA 4J0FA 2JCXA 4MDHA 4YEDA 5ICMA 2C7GA 3PDJA 3PPIA 1U3TA 2X4GA 5EESA 1X1TA 3DMTC 2P91A 1IYZA 3AOEC 4NU6A 4N5NA 3AUSA 4LMRA 2WDZA 3DWFA 5DT9A 3D4OA 3JQFC 2I99A 2J6IA 2BH9A 1PJ4A 3O26A 1PGQA 2Q2QA 3HSKA 3Q9UA 4JCOA 4XCVA 2I9PA 5JC8A 5T5QA 1VPDA 1MA0A 2VRBA 1P1KA 4OOFA 4A03A 3TWOA 4BNWA 3U4CA 4CLEA 1AHIA 5KJCA 4XGIA 3ZWCA 2GF2A 4RF2A 5BNIA 2Z5LA 2AQKA 1UDBA 2DFDA 4XX0A 3D3EA 4YR9A 2O2SA 2QRLA 1I10A 3HG7A 4FW8A 2DKNA 1U1IA 2RHRA 4O5OA 1T2DA 5CG2A 3NUGA 3GMDA 3ZU4A 4IUYA 5U1PA 1O94A 1F8FA 1XR3A 3VVCA 4BMVA 3ZV6A 1UP4A 4J6FA 1UXIA 2XXJA 1ZO8A 4NBWA 1JQBA 5F3RA 4J49A 3AW9A 2VWPA 2JJYA 4GL4A 3ETEA 4E4YA 5DCYA 1EVZA 2EIHA 4IGEA 3V2UA 2NUAA 1PQWA 1XYGA 4X54A 3ADOA 3RC1A 2JAPA 3QLJA 1ZSNA 4A73A 3TL2A 5KOIA 2D5AA 1KIFA 3O03A 5IZCC 3JTMA 3LT4A 3FCOA 2GD1O 1QYXA 3P19A 4I9HA 2EW2A 3WNQA 5IZCA 4BGUA 1XIVA 2AA3A 3WFJA 3UVEA 3RSHA 3V1UA 4PCVA 1O89A 1WW8A 2TMGA 2CD9A 4BV8A 1R4MB 3M2TA 1Z7EA 3GDFA 1YL7A 3H5RA 3NTRA 4E5MA 2ET6A 5DN9A 1CYDA 3DQPA 4W7IA 1RM3A 3E9QA 2Y1OA 4B4UA 3K73O 1J4AA 3LU1A 1H6DA 3PGXA 1CRWG 3VKVA 3EZLA 4OO3A 4XR4A 4CMEC 2HDHA 2J3HA 3GEMA 4NQZA 4DRYA 2IXBA 3BTUA 3RUAA 3KUXA 3PQDA 3WDSA 4PFJA 3FBGA 1ARZA 1RM4A 2QZ9A 1V3TA 4IDEA 4U6SA 3HDQA 1VL6A 1MB4A 2JD2A 3TL3A 1LDEA 4OMUA 5I7FA 4O63O 3PLNA 4XWYA 1IE3A 5AQ1A 3AI1A 1UZMA 1A4IA 4GBJA 4YT8A 4Z9FA 1LQUA 1EVIA 1DHRA 1NR1A 1XGKA 2CVZA 4XDZA 4BGEA 1EFLA 1N8KA 1L1FA 1U4SA 4ZN6A 3PWZA 5JE8A 3MJ4A 3WYCA 1PGJA 5KJ1A 1GR0A 3UCEA 4I9UA 3QW2A 4OM8A 3D0OA 5TT1A 3VZQA 3W8FA 3VH3A 4XEHA 4DBVO 3WX0A 4LVCA 2VHVA 3DHEA 3T4XA 1HYGA 4UVGA 5KJFA 4OGWA 1FJHA 3RFXA 3PLRA 4BKRA 1I36A 2GN6A 3K2EA 1U3VA 3E9MA 4XYMA 4A0SA 4BO7A 1RYDA 5A4DA 1GZ3A 5JW6A 2BGKA 1GD1O 2VHZA 3MJTA 5IDWA 1OC2A 4CMBA 4E6PA 3H5AA 1DAPA 1IZ0A 4Q39A 4MVJP 3NTOA 4S1VA 3OHSX 4J1QA 1OZAA 1DRVA 1GCOA 1XA0A 1C0KA 1X0VA 1M75A 1BWSA 1NPTO 2JKVA 4BO5A 4BMNA 4IDGA 4J91A 4FFMA 5G0UA 1WLYA 4E5KA 2B5VA 4QXMA 3Q9NA 4YAKA 1N7GA 3U4DA 3DFUA 3HWRA 4LW8A 1M66A 3O8QA 2RCYA 1ZK1A 4FFOA 3GAZA 4U7WA 1YGYA 3TOZA 4Y6PA 2HRBA 3ANLA 3UN1A 4AJKA 4RF5A 4G5HA 4D3FA 5KJEA 4EUFA 1E77A 4O6VA 1DO8A 2NV6A 1NVTA 5K9ZA 3OECA 4J3FA 5HRUA 3UOGA 1ML3A 4KUEA 1BMDA 1ENPA 2DU8A 3W4JA 2AEFA 1PS9A 1ISJA 1HE2A 4JROA 4RDIA 2G17A 5F5NA 1BG6A 4DIBA 4XJTA 1JTVA 3OMLA 4L75A 1R6DA 3GZNA 4Q3NA 5CEEA 2IEBA 4ALLA 1DPGA 1R4NB 5IXYA 2GZ1A 4E2WA 4WASA 5L3ZA 4QFCA 5DDIP 3EC7A 1NBOA 5I8ZA 4NFSA 3F1KA 3WR5A 3P5SA 4XR9A 4OJNA 5DBFA 1E1KA 1HDYA 4L0QA 4C7JA 3JQDA 4YDRA 1EVYA 1MV8A 4BO3A 4B8ZA 1RJWA 4D7AA 5JDCA 5THKA 4IINA 2RH8A 2JFGA 1GV1A 1LDYA 4WLUA 2NWQA 4TVBA 3KB6A 3FI9A 3PFFA 3S2EA 2WD7B 1U2GA 4B3JA 3B70A 2NM0A 3PDUA 2GRAA 1HKUA 2GZ3A 1Y8RB 3L9WA 4BNZA 4D46A 1MC5A 2O3JA 5AXAA 4URFA 4BO2A 1R0KA 1N1GA 1LSJA 2EF1A 4XIYA 1YL6A 2DFVA 4TRJA 1ZZEA 1DJQA 2FZWA 1UJMA 3P2YA 4UVHA 3JQBA 5G0TA 3KBOA 5BSFA 2IXAA 3U4HA 3IJRA 4BNKA 3VDRA 1E5QA 5B12A 5ENVA 1JAYA 4XQGA 1LRLA 1QRRA 3ZHYA 2YZ7A 5JAMA 1YQGA 3QVWA 1AXGA 2GZ2A 1VM6A 4KOAA 5BNFA 3GUYA 3LVFO 4BB5A 3ETDA 4BGVA 4JP3A 1BW9B 5JO0A 1T2FA 3WXBA 1K6XA 1YB1A 4YA6A 3TZKA 4ZD6A 1DIRA 2Q2VA 3M6IA 4WCDA 2HLPA 1DOHA 5A3VA 3KSUA 4MVJF 3I9OA 1NWCA 4FIZA 2Y99A 3EAGA 3RQSA 3I9NA 1T2AA 4Y8VA 5G0WA 1P45A 1MG5A 3O9ZA 4CR7A 3ROQA 1A5ZA 4BNTA 2Q46A 2GERA 2WE8A 1Q0LA 5CHEA 3F5QA 3MZ0A 5I9LA 1BXGB 1SB9A 1VSVA 1GU7A 2YQ4A 3KRTA 4NU5A 3TDKA 4FB5A 1PQUA 3FNFA 4CQMA 4BNNA 1I01A 3FWZA 3MEQA 5JBIA 3V1YA 3JQEA 3WOHA 1GYQA 1N5DA 3ZHXA 1UXHA 1PWZA 4RLSA 3RC2A 5CDTA 1PTJA 2R00A 1ZSVA 4GQAA 4A10A 2W2LA 3QWIA 2Q50A 5LDGA 1KVRA 4IBOA 4IDFA 2DTDA 1NP3A 2O3SA 3WG9A 3UCFA 3F47A 3QIVA 4B4WA 3K2BA 1OOEA 4FN4A 4YT4A 2RIRA 3C8MA 2DT5A 4J9UE 3RU7A 3S1LA 4LK3A 1A71A 2GDZA 4CUZA 1NM5A 4XQCA 4JN6B 3GNTA 2PFGA 3CMCO 1ULSA 1Y8QB 4FFLA 1NQAO 1GUFA 3OQ6A 5G2OA 1JLLA 2PNFA 3KYDB 4G2NA 3K9QO 4R1TA 1R37A 3KHUA 1KVTA 5JNLA 4RPJA 1LBEA 3Q3CA 1MFPA 2QRKA 1PGNA 4ZU3A 4BUCA 4CM9A 4KUGA 1HDXA 4L9RA 3I1JA 4RVUA 3FR7A 4F45A 3T4EA 5JCJA 4CMIA 2EV9A 1B8PA 2PY6A 2IODA 2VUSA 1NAIA 2G82A 5EJ2A 4D3DA 2BRUA 3GNSA 5A9SA 1VLLA 2YY7A 2VRCD 5JMWA 2DPGA 1V35A 2C07A 1E92A 2FN7A 5LC1A 4K26A 5DBIA 4J4TA 4BKPA 3MOGA 5BR7A 3ASVA 1HT0A 3KETA 4D43A 1HDZA 2X58A 3R1IA 3UKOA 3ICCA 4ALIA 2XOXA 4PZEA 3NT5A 4ONEA 3ZV5A 4YAGA 4IZHA 1T24A 2IDZA 1I3NA 1Q0HA 4XB1A 1JDJA 1P0CA 3WIEA 3QQPA 4MVJD 1CERA 4PG7A 3ANMA 2D0IA 4XD2A 5DZSA 2VYVD 2X6TA 1H94A 2ZTUA 4WNCA 3K31A 3DZKA 1H9AA 4TKLA 3MWEB 1T25A 1S7CA 5G4KB 2AG8A 5B1YA 2WM3A 2BGLA 3W1VA 4RVDA 1U7HA 3D64A 4CV3A 2O50A 4P38A 3D1LA 1KC1A 3DHYA 3RJ5A 4NNJA 5I7VA 4GSKA 4A2CA 5KWEA 3I5MA 1B0AA 4CM8A 1ZMTA 1GDHA 2I76A 3RU9A 1BXKA 4HKTA 3I9LA 2VZ8A 5EERA 1ZEMA 4JBIA 4N5MA 5I9MA 5FI3A 4CM8B 1EFKA 1ZCJA 2X8LA 4OYRA 2YUTA 1WMBA 2CNBA 1UP6A 4XYBA 4NBRA 3PRJA 5BNTA 4II2A 2CFCA 4NFYA 2X9GA 4U0JA 1K6IA 4AJJA 4Y6SA 1DSSG 1JWBB 4FFNA 4HX5A 5TGDA 5HWSA 3BHJA 3E48A 4JGBA 4UUOA 4K1LA 2OP0A 3H8VA 3RIHA 4CMCA 2HMTA 5IFLA 2EXXA 3ETGA 1ZH8A 1SMKA 4AFNA 3JSAA 3WMWA 2DUUA 4CV0A 3LDHA 5HTOA 1B14A 4FJ1A 3DBRB 4E13A 1MFZA 4FFPA 3TNLA 1NHWA 4NR0A 4MOWA 4IY1A 2NTJA 3LQFA 4CMEA 4L73A 1KOLA 5BSHA 2EJVA 2X7HA 3NX4A 1Q2XA 5BT9A 2Q1WA 2D5CA 3UAGA 3W4KA 2BF7A 2IZZA 4M54A 4BO9A 3ONFA 4BGIA 1GQYA 5L40A 3GFBA 1XELA 3OFSA 1O6ZA 1JAXA 3VPHA 3BTVA 4QECA 3NGXA 4W9NA 2Y66A 1GAEO 3G17A 4XJSA 3I6IA 4HFRA 3W8DA 1VRWA 3JD4A 3TOXA 2P2SA 3NV9A 5CDYA 3OJLA 3U62A 4MP8A 4YT2A 4RL6A 3KEOA 4CUJA 3ENNA 1HSZA 1WMAA 3LC1O 8ADHA 3CSDA 1QLHA 5COAA 1WAMA 4J43A 3CMMA 2I3AA 4RORA 3WGTA 2IE0A 2VHWA 1VSUA 5TX7A 4YWJA 3F9IA 4CLOB 1P0FA 3PEFA 4HWKA 2E6UX 1I2CA 4HY3A 3QV1A
chains in the Genus database with same CATH superfamily
2Q6VA 1XG5A 4HUQA 1J06A 2CLKB 5GY7A 1ZUD1 5BN1A 2PCJA 4WNYA 1UBOS 3U7QA 1FJGB 3P2JA 3IPLA 4YP1A 2QAGA 4C05A 1BQ4A 5GMOA 1D4FA 2JA1A 4B3FX 3WNZA 3JD3A 4CJXA 5DNEA 1EUCB 2QROA 4CMKA 2C3OA 2OR3A 1ZPDA 3C7KA 2ZYWX 1GRRA 4NYIR 3PC3A 2DT8A 4CM5A 1M0WA 3PV0A 1OBOA 3O4IA 1R9GA 1QHNA 2ZRBA 2RJ3A 3DV0B 3H75A 3R6TA 5CB4B 2QT0A 3BREA 1VHLA 3EXIA 2LCQA 4QNNA 3R7WA 4MP3A 4Q9KA 1KY4A 2E6KA 3TI9A 2J33A 5GJVC 1UC5B 2EG5A 4OP2A 4WFIA 1JDBB 5LP6B 4Q7JB 1NVEA 3D5QA 4F7WA 1G18A 3SQXA 4PCLA 2B34A 3LZCA 1USVA 2BMWA 2VHXA 4KREA 2D8AA 1HZZA 1TEZA 1XKQA 3EEIA 3ZWQA 2YNMC 4TRMA 4UPVA 3ROMA 2BVNA 1FYEA 2II6A 1NSYA 2JZCA 2K87A 1GRCA 5DXAA 4YUVA 5BRNA 3M1AA 3HEAA 2DR3A 5G41A 3TSCA 1F7UA 1N57A 3OEYA 3ACDA 2XTAA 5BSMA 5I7HA 2O7QA 4FZRA 3VVMA 4XGKA 4Z3DA 4AUNA 4P8RA 5JNSA 3C7DB 4Q1FA 3FNEA 4B7ZA 4V0RA 2X6QA 2YASA 4U7JA 3W78A 3HRIA 2JGAA 2PL1A 3H84A 3HB1A 3K4QA 4BMOB 5JZOA 2C00A 3RLIA 3SC4A 2JLXA 3KQMA 1TTPB 4IFIA 1GG5A 1R64A 3CNOA 3EZ6A 3GVHA 4LC0A 2E4ZA 1Q77A 5A7FA 2NW6A 3U7HB 5KX5B 1OU4A 4MYTA 2XUZA 3NYRA 4RHFA 5IVPA 1B41A 4G85A 4MRVA 2Q3EA 1I2MA 2RGGA 2FWPA 5JJBA 2C58A 2I7DA 5YASA 4ZU1X 1JG6A 1E3WA 2VL7A 3SR0A 1ZQ9A 1P1FA 2XUQA 3KAJA 5AVTA 1H1LA 3H5LA 4U6QA 4F4FA 2X1LA 1ZOSA 2Q8PA 3PPWA 3UWKA 3VNBA 1TKAA 3HB7A 8GPBA 1KYYA 4Y2QA 5P21A 5DTRA 4ARCA 4Y2UA 3LWZA 5JXHA 1UZLA 3N0WA 2RC5A 3ZH2A 2Z8YA 1UJBA 4MB2A 1EXVA 4V3CA 1Z0FA 3COZA 3FDXA 4LJSA 1U0JA 5A3RA 3VUEA 1HDGO 3O91A 1XL0A 3RUDA 2GKGA 4HQFA 4F38A 4YCJA 4E1BA 1BOFA 4ENUA 1BYIA 3F1LA 4ZK6A 3K6RA 1PFQA 3RUIA 1IM5A 3A3KA 4RXTA 3GVPA 4QQFA 4MTCA 2QP3A 4P5EA 3TIXB 3WFZA 1GNRA 4EHFA 3WADA 2R97A 5DW0A 2IYSA 2B20A 4L5YA 4B85A 1UKCA 2JEOA 1N9KA 1VIDA 3ONNA 4IDAA 4ENPA 5BNZA 3BMNA 3KZCA 4CG2A 1QMPA 5LLDA 1Z4JA 1WZNA 4QGSA 4FX2A 4K6GA 2X8BA 5BQOA 4Q9AA 1J6UA 3DXFA 3KQYA 3OX4A 2HSJA 2W2PA 1COZA 5EAIA 4YREA 3KZOA 3UXMA 2Z1NA 4C3UA 5C18A 4RZQA 3DOCA 3ENQA 3PRHA 2CLFB 3CJTA 1HLFA 4C07A 3THOA 1JQDA 2FX5A 4PO8A 3UOWA 4AMYA 5JROA 5CAEB 3OE4A 3VNVA 4OBWA 1MG0A 1XZEA 3FETA 4KLAA 5AK0A 4L08A 5HUQA 2IZ6A 2LXNA 1H2HA 3CW9A 3O92A 4EB3A 1VZ2A 3QPWA 4WQMA 5D3ZA 1ZVJA 1CQZA 5D2CA 5KKCA 2IUSA 4AZTA 2R87A 2AX3A 3KHSA 4P35A 1KYQA 4ZKDA 1CUYA 3HXQA 4DLKA 1M6VA 2AD1A 5C7LO 1SUFA 3RROA 2FE4A 2OLEA 2JJQA 2W6OA 1EDOA 1RHKA 2FPRA 3REGA 2A92A 4ZI5A 4LFBB 5E0OA 4KKVA 1BXZA 2XVZA 5JSUA 4KPGA 3HN7A 1J70A 3DC2A 4HPJB 2HJVA 3X1JA 3T3GA 1QYCA 1E9RA 3D0KA 4CNBA 1OWOA 1RYFA 3WVNA 2PPVA 4XSVA 5U9CA 3I83A 3CO5A 4JXJA 4LUCA 1PZMA 1RRGA 1QPBA 4Q3OA 4MHTA 4NBKA 1KYXA 1S5PA 4NMHA 1S2MA 1U2DC 2OHGA 3PPYA 4OV6B 9ATCA 3P9IA 3EF3A 4RAOA 1E2DA 1YT5A 3FYDA 2YV1A 3B20A 4GI7A 4RCYA 3U13A 3W5HA 1WHSA 2FKNA 3KS9A 3SYKA 3AP1A 1HE3A 2ZI9A 4WXEA 3SWWA 5F9HA 4DSZA 2I5PO 3H6GA 1QZUA 4MPJA 1DBVO 4JV5B 2I33A 5KKAA 5EP2A 1NRWA 5E4TA 5IVHA 4X45A 2CLLB 3LRXA 1R8SA 1M5TA 1P1JA 2IEAA 1OWLA 4DCOA 1V95A 2F00A 1TZCA 3AUAA 3ES9A 2NG1A 4FMPA 3K9WA 4HHEA 3KOUA 5KUTA 2C3UA 2Q1SA 3B1FA 4HGOA 4HLNA 3WL6A 2JJ1A 3PD0A 2R85A 3IQHX 3GLKA 4S1NA 4Y9UA 1E63A 1NC3A 4H3KB 1MAWA 4DCSA 4NCKA 1V47A 3KWLA 2Q45A 1EWRA 3LLVA 3I28A 1WXWA 3O4VA 4NG5A 4RV4A 1WHTA 4PRZA 1IJFA 2GXSA 3GMSA 4HQRA 3JQAA 3SE7A 3EIFA 5BMVB 4JC0A 4TVOA 4QGBA 2B92A 4BQNA 1KAQA 3I6ZA 4KE8A 2XV1A 4QEDA 1JVNA 9MHTA 5BW4A 5L3QA 5C7OO 4H1HA 2VG8A 2WAOA 5CPBA 4AKTA 3GCXA 1NYTA 1SWWA 1PT6A 4ND5A 3ZD8A 1NZJA 4Q00A 5IHPA 2OBXA 4D57A 1Q74A 4EKEA 1L7XA 3HJTA 4MVYA 1NM5C 2PRZA 3OBBA 3OP4A 2AZ4A 4CCYB 1UINA 2I78A 3FZNA 3NHPA 4K9OA 1E3TA 1T5LA 1PCXA 4EABA 1WXHA 1W88A 3D81A 1Q83A 5AKHA 4J0GA 5IC5A 2J7KA 3E18A 1I1QB 2BKLA 3ZK8A 4Q7QA 3X1ZA 1KY2A 4OH1A 1Z0SA 5IKMA 1AG9A 3O75A 1IZYA 4QA9A 5GGXA 3V7NA 3KE8A 1PJQA 4RADA 4YRKA 2AW5A 2WJ6A 4MIOA 4GPEA 4YBRA 5B1SA 4ZEXA 1KI3A 4IJ5A 4A0FA 5IAAA 3ACBA 5J47A 2P2NA 5J5CA 1NYRA 1OFUA 4DA9A 4HRXA 5I4CA 5FFNA 2F8SA 4BNYA 5EWJA 1DQSA 4EOGA 2GUWA 2ZQYA 2QY6A 1SUAA 3SZGA 1PR1A 3PFKA 4FHDA 4FYMA 4RVFA 5DF1A 3RAPR 1XA3A 5LP6C 1SKQA 3A1FA 3PF9A 4G25A 4G5YA 3KSZO 2BIFA 4RA6B 4XEUA 3RVQA 1BXRA 3E58A 2QS9A 4A5SA 2PX0A 3B1KA 5B3AA 1Y4SA 2FFJA 3GJ3A 3V8NA 1C0LA 4JKOA 5A06A 5DYGA 4ENSA 1NJSA 2I67A 2BGJA 3NBFA 1K1EA 1OXXK 2Q4BA 3A31A 3GDHA 1RWBA 4P4GA 2PGNA 1I3OA 3QXSA 1T3ZA 3M6FA 3OIDA 4KMMA 4Q9NA 5CM2Z 4ZO9A 3FOFC 1JPUA 4U02A 1I6LA 1K66A 2FRVA 2AR9A 3OQ1A 4I14A 5F7XA 3OO0A 3A7EA 3UJBA 1K2WA 4J7XA 1BTOA 2GYWA 2VWGA 4BJHB 2BMAA 3AJAA 3EF1A 4B2PA 4ZDJA 5B30A 2KWIA 4Q0MA 3WAGA 1QS0B 3H9GA 1PR6A 5BV7A 2IYTA 5F2EA 3ENWA 4PPNA 2VYVA 4JLPA 3QBDA 2ZKIA 1Y4DE 2VHEA 4LYHA 3RW9A 3C24A 3LPAA 3O4RA 3WNBA 2GJSA 1SK9A 4OKSA 1YJ5A 1NXVA 2MSNA 3JSXA 2BJWA 3MTJA 2HWKA 3KYDA 5DCLA 1R5OA 1SHTX 4CQMD 1BMFA 1G7RA 1AMUA 3BN3A 5CX4A 2O07A 1Y8RA 1OAAA 2E89A 3BMCB 3ITEA 4CLRA 4ABTA 1RRMA 5FIUA 1OYOA 4IQ8A 4QM6A 2BKXA 4ZC8A 1NRIA 1TT5B 3KPUA 4QBIA 1NJ5A 2WZDA 1DJNA 2OAQ1 3Q8LA 3TZQA 4D4GA 3BJZA 4REQB 4JI8B 4C14A 1ZDMA 3OMWA 3M6XA 1RAGA 3PC2A 4WK0B 4TS3A 1YJCA 5LCXA 2RD2A 4AKIA 4QUJA 4OFXA 1WUHS 5HIMA 4DXHA 1O94C 4N7MA 4Q3CA 3F4KA 1DTWA 1D0SA 1EBUA 3BHIA 2R7MA 4XVUA 4FSHA 3SJCA 2BV3A 2QYSA 2REXB 5JCJD 3AI7A 2NACA 3NYWA 5THQA 3ZZNA 3INRA 4F2DA 2PUWA 1UJ5A 5ALVA 4YACA 4DR4B 5KO2A 4B3CA 3GRPA 3IVAA 2GN8A 1ISPA 3X44A 3BAZA 3L92A 1H8EA 5TARA 5DM0A 3VNRA 3Q41A 1KR5A 3JW8A 3R09A 3BMOB 1KZHA 4EKNB 3KQVA 3NHMA 4ZGGA 2QSUA 3A6JA 3W3ZB 5KMGB 3DOUA 5K4HA 3B36A 4FYHA 2IU6A 3Q7EA 1CZKA 2NU9B 1L7QA 3SQWA 2C2HA 1LJLA 2I54A 2OBLA 3EQ9A 3AY0A 3F3KA 3Q6IA 2C57A 3O31A 4LE2A 4PZ9A 5FAKA 2FP4B 3E8MA 3LFTA 2SECE 1C0IA 1Z4LA 3HN2A 3L82B 4KH0A 4ZT7A 3IQGX 4IHKA 4PYOA 1H5QA 3MWLA 4UREA 1U6JA 2B4KA 3BICA 3MAJA 3JZAA 4RIFA 3RWMB 3X1MA 5FWNA 1SKMA 3DDNA 1CRQA 3RQIA 1KKUA 3HCOA 2P5SA 1VJGA 5DM1A 1WULS 1KERA 1PJ2A 1EZ1A 1FDUA 1QOZA 4IJ6A 4EZIA 2HADA 1N2CA 2YN0A 3O1HB 1ZIXA 4R3NA 2X0DA 3QUCA 4GGOA 3W04A 3KZVA 4DABA 4AIIA 1ZRNA 3THSA 5JRZA 2ZSJA 1RPZA 1J5EB 4LXUA 2Y1WA 5J4KA 1LPPA 1ZX1A 5IN5A 5DLQC 2OO7A 3LX6A 4FNOA 3LWNA 5EY5B 2DPHA 3L77A 3PR1A 1JR4A 1XCOA 1O3YA 2ISCA 1WD5A 2C77A 4RH0A 4PLYA 4U7PB 1S8FA 3GLRA 3ZWAA 3FXAA 5LOVB 1CUJA 1H6BA 2ZUFA 4JA0A 5EWLB 4BLWA 1BWQA 2ZR7A 4C4TA 3WXMA 5CNKA 4YAUA 2R68A 1XL1A 4J0HA 3UC5A 4PX9A 4A36A 3PENA 4G5QA 4X6XA 4M1SA 4DMKA 1JDTA 4YWJA 1X7ZA 2WTMA 2P9QA 4DQXA 4PR0A 3B89A 2QQ0A 5KTPA 4F4JA 2OCXA 2P9EA 2YC2C 3FLEA 3NP9A 1ESEA 1T34A 2CGEA 3WA7A 3Q10A 3T35A 3OLXA 1OTYA 2ZUVA 2QJOA 4YVFA 3N75A 2ZM5A 1II9A 2L0XA 1MW8X 3O84A 1KO7A 1JIUA 3HB9A 4DJTA 4ZVKA 1UBEA 2H2DA 3CX3A 4E7PA 1GZ7A 4JJ7A 1O95C 1R12A 5FFFA 2H7YA 1CG6A 3NWJA 2WT9A 3UMMA 3CIOA 3U3KA 2C7RA 2IXFA 1DT3A 3ZWPA 4UM8B 1XK7A 1WXIA 1V1MA 5IBRA 2OV1A 3AKYA 3NAMA 4DWVA 1YL5A 2GKOA 2LWIA 1MQ8B 1SOWA 1DQNA 1SU7A 2PJDA 3ABIA 3ENKA 3L8CA 3SN6A 4EGSA 1XVVA 4J1TA 3LP5A 4NYJR 3ROEA 4AXBA 5JJ5A 3VU3A 4DLSA 3PTZA 3TZCA 5BUSA 3A1NA 3PNSA 4GXTA 5JC1A 1O2DA 1YDGA 3BDAA 5D00A 4EO4A 4FUTA 3MJEA 4Q3EA 5LXTA 2H11A 2V7EA 3GT0A 4Q5IA 4AWAA 3AEKB 2PJUA 4YJFA 4IX9A 2A86A 4AP5A 2B8NA 3IR6A 4XIJA 3TLBA 4IOJA 1FS6A 1A98A 2A6PA 4N12A 1TEVA 4YJFB 3ZVRA 4IHJF 4RF3A 3FLMA 5DGXA 5B5SA 4I19A 4ZAWA 4JU8A 3EFOA 5LIPA 3QVGA 4W5RA 3OPNA 4NCXA 2QE6A 1D8AA 3VGJA 4L51A 1JHUA 1ZONA 4IIGA 3ASYA 2FN3A 2VSYA 3KQQA 4HDRA 4O4IA 4U00A 4AXXA 1T2NA 1ISMA 2P68A 3P2OA 1EXWA 5MN5A 2OFOA 1ENYA 1D2MA 3MINB 3N8DA 3QLTA 3GN1A 4D9KA 1DFHA 1NGSA 2COEA 2F6RA 2WKPA 1THGA 2DBRA 2ZAOA 3VYWA 4CLDA 1HFKA 3I32A 3VAAA 3MTEA 1XEAA 4GOMD 3I6MA 1BFKA 3JATA 4U7TB 1J22A 2CZQA 1RBQA 1DNPA 3K0HA 3LTEA 4G1MB 4NF2A 5REQB 2OFFA 3WQBA 2EQAA 2P5YA 2OC9A 1R3UA 4K9KA 1ATIA 1RABA 2QTTA 1RWQA 1XRMA 2HHCA 2BKUA 4BMCA 1GAXA 3X1WA 4HH1A 1VL1A 1CEXA 4LZOA 3B9RA 4H3SA 3WWPA 3SHOA 2QZPA 3V7WA 4OHXA 1ZGAA 4IVPA 3D7NA 4CMJA 3BHNA 1PZGA 4X7MA 4QHSA 3L1JA 1E9EA 3UOAB 4LOHA 3S8MA 3MJVA 4F93B 3IQXA 3KK0A 3OQBA 2B78A 1K3UB 3ONDA 2PTGA 4YRFA 1LF5A 2XCIA 2IX9A 2A5LA 4KLCA 5DHAA 3S3TA 1D6JA 2ZTLA 3L01A 4BKOA 1QF6A 2VAXA 1WX1A 1JS1X 1F48A 5PNTA 3EPJA 5FI1B 3GLHE 1QP8A 3SXJA 1BKDR 3PFIA 2AL7A 4TQGA 4LCJA 1V6AA 4WN3A 5EXTA 1G3IA 4ZZIA 5BSKA 4EKGA 1G59A 3I2IA 1ZK2A 4HNUA 2VT6A 1IHYA 4PANA 5BQPA 5FF9A 1F6WA 2C2KA 3OT4A 3AUYA 2GZAA 3FPEA 1GGVA 4D9NA 1SQGA 2P4SA 1WDLA 3NEAA 1R6TA 5D5QA 3WHIA 2WSBA 1BKYA 1TM4E 3EXHA 3TOCA 2V97A 2EZ4A 3A0RB 4YQZA 4DR1B 1MZPA 4BBPA 3R9IA 2DWOA 3SG0A 1QYWA 4ZYUA 3R9XA 1JKIA 4Z0HO 2AFRA 1L1RA 3KWFA 4ARZB 2I1VB 4MQ6A 4IMIB 3EQ6A 1YFLA 3RFFA 1Z5WA 4E5PA 1QVRA 4HEQA 1NRJB 4LC1A 3WICA 2XAAA 2PUTA 1CTQA 3WRVA 4B8WA 2ZRDA 3OM8A 1E3EA 4GWKA 5IJWA 3PC8A 4QZVA 4KAFA 3AOGA 3OQMA 1R3DA 4AX8A 4MKZA 3R0JA 4QAJA 4H08A 1V2GA 4POOA 1QHHA 1CBUA 3MELA 3Q40A 4FK8A 4OJQA 4FHCA 5C8XA 3AOEA 1LTHR 1W75A 3ZQ6A 2AZMA 1EESA 2YRFA 3I01A 3QNUA 1QGAA 3OPQA 1DKNA 1NW5A 2O14A 1ECPA 1RQXA 4Q9DA 5CNMA 4JWTA 1KBOA 1YHYA 1G8JA 1NNUA 2QTWB 4NOJA 2ESRA 5HHTA 3DT8A 2WWIA 3PL1A 3O73A 2XDWA 4J1SA 2DFLA 4KN9S 5CXQA 3O8CA 5EZSA 4LY6A 3CLTD 5AKJA 3UW1A 1CKEA 3CRQA 1LVUA 4TGLA 1N4AA 3U4AA 4ZTBA 2HRQA 3FB4A 3MJHA 3W7AA 3NM6B 4ZOCA 3JASB 4DR6B 4X6UA 1Q19A 2QUBA 3HHEA 3ZNQA 2CHGA 3DB2A 1AGPA 1YK0A 1QIKA 1JKMA 4LJLA 2OBBA 3G0CA 4PCAA 2E37A 1ISIA 5DGTA 1VSBA 4WZAE 2HWUA 2QQEA 2Q28A 3LO8A 4KQWA 4L7VA 4MVJG 1ZNWA 4F6RA 3MERA 1TJ4A 4R6XA 3W5IA 3ZDQA 1BD4A 2A9QA 2H1RA 2W2TA 3GUUA 5L7WA 3Q72A 4QODA 2A9RA 2NZVG 5I9TA 2XMDA 4RGQA 2VN8A 3HBNA 1XP8A 2R1TA 4C3OB 4COKA 4S1TA 1BGVA 4EVSA 2VJCA 4DYDA 3EXIB 4X24A 3KL4A 3MF4A 1QO0A 1ND6A 3M70A 3PFWO 3DMYA 3LYUA 4QRDA 4AYWA 2HSZA 4YB8A 2MSLA 1PUXA 1U3FA 3O8LA 3CLUC 3SM9A 4F0JA 4KWEA 3AF4A 1YUMA 4LDQA 1YKSA 4CM1A 1QSGA 3MMNA 4UTOA 5J58A 5CURA 1GP2A 4YJ2F 4LI3X 4ZHQA 5ALFA 2Y1CA 1DXQA 3IV6A 3LFHA 3ZHRA 3BGWA 1VLMA 2FSUA 3DDSA 4FDTA 4HSEA 5TLSA 2IYOA 4ALKA 3H5NA 4HQLA 2CFTA 4LTMA 4J16C 1ENOA 4UOQA 1C3OB 3MOIA 4V1CA 3E1KA 5K0LA 4LWPA 5FH9A 3EPLA 3RJZA 2X5KO 4QM7A 2CK3D 3AM5A 4TMTA 2A9OA 2HCFA 4LY9A 1R18A 1OT3A 2VQ6A 1OIVA 2NUTB 3LAWA 3HXOA 2P35A 2F1OA 5EI5A 4BS9A 1U7PA 4BQRA 5IC6A 4GSYA 4L9AA 5JYEA 1KRHA 2ZM6B 1J0DA 1R0SA 3K4HA 2O7SA 1F12A 1NJGA 3A3YA 2PA3A 1UIRA 3HQ4O 1N4DA 5F12A 1GZDA 4B82A 3II6X 1AURA 4NDNE 1E62A 5ALLA 5JCXA 3Q8XB 3EIHA 3K3PA 1U1CA 2CCKA 4EA9A 4YV0A 3FDZA 1DAMA 1N7HA 3CLVA 4MVJM 4QATA 5HMMA 3R4VA 4IDHA 4B4OA 1YB7A 1Y9EA 2PWZA 1ZN9A 1JFFA 1R5BA 1WS6A 2QRVA 1E89A 3CH5A 5EXEA 4B40A 2F4VB 2A0YA 2FPIA 4JIGA 4EJMA 5JATA 4MAMA 5DYIA 4NICA 5L3VA 1GT91 4ENVA 5IAJA 2MYTA 2HJHA 2P65A 2QL9A 4QLOA 3RPEA 2IGTA 2H7XA 3SLGA 4BNFA 3LUHA 1WNFA 1TU0A 1VCIA 4QTXA 4TTSA 5CNJA 1DLIA 3HUEA 4OL9A 4D92A 2UZ4A 1E1LA 4FEYA 2NXNA 5IBQA 3FIUA 3HVJA 2Q6KA 3M6UA 3RV4A 5ALYA 2P8SA 1R8QA 1OLXA 3THRA 5JECA 1ZYUA 5LYYA 4KTTE 1PS0A 5G4KA 3ZWXA 2J0EA 4CKBB 5FWXB 2RK6A 2ZTHA 3AY6A 3QPDA 4UMFA 5JHHB 221PA 2BGRA 1T3LA 3AL3A 1O03A 1OLXB 1CY2A 4P7BA 1KS2A 2OHXA 5EOVA 4XX0B 2HQRA 5L4LA 1JFVA 5H83A 1EB8A 3V4PB 1ILEA 3C5EA 3I5UA 3ZDEA 1DV1A 3AR3A 1H22A 3H2ZA 4C0AC 3KR0A 4K9NA 5T41A 3S1AB 1XMVA 3ZU2A 5A0VA 3CVOA 2XMRA 2X3FA 3LKZA 2CDBA 2PXCA 3LUFA 4GU5A 4E31A 3AR4A 1EK2A 4ETMA 3LCCA 1RYMA 3A9VA 3VO9A 4I5FA 4EW1A 3G2MA 1SUWA 2GXUA 4I6EA 2RSLA 2J46A 3PWSA 2OB2A 1WP9A 4KO3S 5DSTA 4TS9A 2NAFA 3IUJA 1OZGA 2CHEA 3G1TA 4KJXA 1JDPA 2B3DA 2GLUA 4FKZA 1JAIA 3ZGOA 4CEIB 4W5NA 4Z49A 2Q7DA 3O3MB 4RVHA 1VBNA 2GM4A 2JFBA 1NQVA 1Z6PA 2FDRA 2N42A 3BCUA 3CX4A 3SFZA 2GA8A 2REQA 3L6DA 2PD3A 4CTOA 4LJ5A 2NUBA 3CRZA 3O7MA 3RRMA 4UHCA 2E4WA 4W7SA 4R2LA 4O4IB 1DJPA 2H1SA 2A9JA 3EIWA 2WIKA 3QVMA 1W35A 2J5BA 4MYCA 3QE2A 4Q21A 4ESHA 4NMWA 1II8B 4DXAA 3AHFA 3Q1KA 3RKUA 1TE2A 1X38A 1QFXA 2HU8A 2KS6A 3K1ZA 3LT1A 4JI4B 4OP3A 1K5DA 2VUUA 3D7KA 4LQCA 1V71A 1NFRA 1SD5A 4IUDS 2GCNA 3HCPA 1C7JA 1C8LA 4AJLA 2P9YA 4JXKA 2GNAA 4E51A 4EG3A 3RHTA 7REQA 1BMTA 2IU3A 3EGEA 1ZRSA 4TSFA 2P2YA 3ELWA 5LSAA 4OQYA 1FQKA 2RGRA 1IPFA 3W77A 3PQ2A 5K8IA 4XTCS 4YAWA 2XOEA 1L4LA 4JJZA 3TQQA 1Z6ZA 2G08A 1A4UA 1GPAA 1K97A 4V38A 1RKBA 4MR9A 2J3KA 3L8ZA 4OGFA 1BE0A 2GPJA 3H5IA 1KS9A 3N2NA 1FYFA 4GS5A 3H17A 3SC2B 3MJSA 2CN1A 3L0YA 4C06A 3OJEA 2WYUA 1G63A 3DTYA 1OFGA 3IP1A 3WGHA 1GJRA 2IYAA 1HRDA 1WXGA 3GAMA 3PA8A 4OUDA 1V8DA 3PBKA 4GKAA 4WKGA 4FXPA 3L1KA 3H87A 5DXJA 5ENZA 4R1QA 2P3LA 4MUMA 3F5SA 5IK2A 2HPZA 1H05A 1XRQA 4N7BA 1YO6A 3W4IA 2Z58A 1LDNA 4MXDA 4N3GA 2VSOA 3SYRA 1OFUX 4C9BA 5CFRA 3DZCA 5B1HA 3AIKA 2ACEA 5JMOA 4MV3A 4IZ6A 3B53X 1QAOA 2JI4A 1TZKA 1O5TA 3T5CA 3MWEA 3LBAA 2YWEA 2I8AA 4KN6A 1IN5A 1I5EA 2R0QC 4JKIA 5ALWA 1R9JA 1QQAA 3SKVA 2O3TA 5AW3A 4X60A 2XAUA 1U9IA 4YAJA 3G5LA 2FWBA 4FBGA 4RGBA 3ZKAA 3U7FB 3HXTA 1RR6A 4OQLA 4V03A 2XODA 2XB8A 1M3SA 5HOEA 2WJ4A 3UA4A 4TTAA 1KZ6A 2LTAA 1U0TA 1YKFA 1Q57A 3L4JA 1G64A 1PYDA 2BHLA 2UDPA 3GBVA 3QX8A 4IFBA 1KMIY 5TT0A 1SVMA 3ETHA 1RRCA 5F33A 3O7WA 1YRAA 3EGWA 1JKJA 1WB4A 2XHEA 2V98A 4ZOLF 1W5EA 2GHIA 2QPAA 5C1IA 3WGZA 4H60A 5JAOA 1ZL0A 2H51A 1A27A 1QXSA 2XQKA 4L0MA 4TT3D 3N7UA 4BX9A 2B3TA 2C5EA 2R8EA 1JLMA 1AKYA 4LXXA 2AG1A 3K35A 1Z06A 2HCRA 2YXBA 2FSVC 1XJCA 3P1JA 1OREA 1ZOIA 3AEQB 3E0XA 3K09C 1Z35A 4I1UA 4PF1A 4WKCA 3G0BA 5CH5A 1H85A 4E33A 4QDZA 1QH1A 3RG2A 1GGNA 3V48A 1Z16A 2AHRA 1N6IA 4PLCA 5C46F 3UGQA 2V45A 2FW8A 5EIEA 3JQ9A 4N8DA 5DX1A 3SF8B 1YULA 4GM0A 1Q1BA 1WZCA 4V24A 1LK5A 1R0YA 3GEIA 5H5JA 3KALA 3NOVA 5CUQA 4C78A 1EMDA 3CQ9A 3VJKA 3FLAA 3D31A 1K5GA 1E6LA 1TU4A 2GASA 2ZXFA 5LZ8A 2YFQA 4Q3DA 4BYMA 5IW8A 3MTGA 5LZ2A 3IXLA 1G16A 4CGZA 1TAQA 3I5YA 1S0UA 3DV0A 1LH0A 4GLOA 1GGHA 4GR9A 1PEDA 3D3QA 4PHHA 4AJ9A 4ZI7B 4BNVA 1U0BB 1D2GA 2X13A 3ZZ0A 5DLPA 3R23A 1ZICA 2CSUA 1FF9A 1XZ8A 3LJKA 3NVKI 3DHWC 4ZEOA 3DBOB 4JT4A 1YE8A 1UJ2A 1Q17A 2ACKA 4HFMA 3QWBA 1NBHA 4II3A 4PHTA 5JZ9A 3A9TA 2F55A 1QU2A 4CKEA 3N2EA 2ODNA 4S3MA 2B9VA 4BFVA 1VE3A 4JSRA 4A2QA 1I3CA 4HLUA 4MTLA 4BQFA 1DLJA 2HJRA 3PI7A 1YWGO 2BZ0A 4FGWA 4KK4A 2HD4A 2AXEA 3C45A 2X9QA 3G9ZA 4JLOA 5KMGA 1MO2A 5FWYB 1OH7A 3OE7A 3UTCA 2AN9A 3WWDA 4D8XA 1KXJA 3LC0A 3QFHA 4NTZA 1T6NA 9GPBA 4X00A 1FZQA 4GGPA 4CIVA 3S2IA 3L0SA 1QAQA 4TT3A 2OHJA 4FIDA 1IUKA 3K9CA 5KYUA 1MJNA 3KUUA 4BLSA 3RF7A 3ZE2B 3VC2A 4DJAA 1GTMA 1JXOA 4KDRA 3UFBA 4AY5A 5F5XA 5IM4A 4YIKA 1Z75A 1CZOA 3ZZUA 1SXQA 1WDWB 1YS6A 1V3UA 5T4EA 4CHGA 4PAMA 2HNKA 1NV9A 2QUAA 3B6IA 1C2TA 1QLJA 1Z73A 3GARA 3TKYA 1WCXA 1WMFA 3T7DA 1EJ0A 3WLEA 1F51E 2Z43A 2POQX 1LI5A 5DULA 5CFQA 1H4QA 2OO5A 4QG7A 3WNDA 1TPYA 1GPYA 4LYJA 2Z5FA 2ANBA 4HP8A 3QEKA 2PKQP 3EJWA 4JB0A 4RVGA 4B6EA 1UOQA 1HL7A 3P0JA 3CSSA 1T9GS 1YFKA 4Y1FA 5HK8A 3STXA 5AXDA 2DB3A 1EFAA 5AHKA 1EFRD 5BNWA 2HPVA 2DRIA 1SUCA 1UKYA 3U9SA 3OOSA 3R3ZA 4DG9A 3UIEA 5FWDA 5K6RA 4FYXA 3TW4A 3DOIA 4H4CA 1RJFA 1SA0A 3BILA 1EZ4A 1J1UA 1AMOA 3H6KA 1E6UA 1MRSA 2ZZNA 3BXPA 4LSWA 2GHQA 3AEYA 3S40A 5U4QA 4RS4A 2MTBA 1EI9A 3ANTA 3VHRA 1EJ6A 4Z7NB 2HWXA 1N25A 4BASA 2J7PD 1I3LA 4EHIA 5TRTA 3QF4B 1SKAA 1E4EB 3ZN2A 4WBXC 3DEZA 1TIBA 3L5OA 1SCJA 3ZTTA 5EHXA 4MVCA 2C8VA 2G28A 3L02A 4A26A 4ALJA 1MJGM 3AK4A 4DDHA 4EELA 3T1NA 3BZUA 4MR8A 1KDRA 5AW1A 4JJGA 4ZICA 1PJ3A 2WY2D 3TW0A 1G4AE 1A9ZA 2BKEA 3BK7A 3GW8A 3A06A 3F9CA 3D7SA 4HQ0A 3TLZA 4CEJA 2UVPA 4LI0A 1DKQA 2AE2A 5HKBA 3ORSA 3AJEA 5K3CA 3WL3A 2VO1A 1UBNA 1ZGHA 3K9HA 3OKAA 4HQOA 3U49A 3H1GA 4Q4HA 4WY8A 1ATZA 5CAEA 3WBKA 1LFDB 4ZQCB 5BXQC 1PW7A 4B46A 3GP3A 2BELA 1E0AA 5L4NA 1G3QA 3GQBA 2EKZA 3X2EA 4JA2A 2DSNA 3PQEA 4C0KA 3TNYA 3NU1A 1RIFA 5L3SA 4EPWA 3OOHA 4K46A 4UNNA 4DS3A 2CFIA 2HMAA 1SXPA 1YJ8A 2IXEA 5K05A 5KU7A 1IJEA 1UKAA 3LBIA 3U19A 3ASZA 4ZCPA 2VXOA 1I7DA 1MQAA 3E82A 3UV6A 1LPAB 1SH7A 1Z3CA 1XEWX 1R0LA 1E94E 2VA8A 3GLVA 5HF9A 4D3XA 5L7TA 3ROKA 4D6XA 3DZFA 1XU7A 3IEPA 5TPWA 2OCDA 3V8RA 3PYMA 3ZDCA 2H52A 3T5DA 4C7MA 4A8JC 3L7OA 5B3KA 1XLWA 2QTNA 3EMKA 3OG9A 2VP4A 2FWIA 2YV2A 1AHNA 1X92A 3H3JA 1QYDA 1OU0A 4K28A 1QJCA 2OHVA 3VPAA 4NLLA 3BIXA 5GP1A 2OFPA 4FQ8A 4RTQA 1FVOA 1HLPA 1LTQA 1YB4A 5LLTA 1G2IA 2OK8A 3GPLA 2VJLA 2GO7A 4ZO7A 1D03A 1I2BA 1KFJB 3COVA 3VPFA 4LDNA 1E7RA 5IKEA 1E20A 2GPTA 1N7IA 2OGUA 3EYAA 1FFBA 1OBHA 2AN5A 2V0CA 3YASA 4LZWA 1JPNA 3WKDA 1KDZA 2Q6OA 1DC4A 3MQFA 4BE7B 4EKIA 3KYJB 2WAAA 1KOGA 4R2XA 3JATB 2AKYA 1F8GA 1DAFA 1XTPA 3MW8A 2VF4X 1V8ZA 4KBYA 3JQGA 4MO9A 2VJPA 4QLAA 4ZI2A 3R0ZA 4TSKA 5HRAA 5JARA 4QWWA 3GLGA 3I39X 1IY1A 1GPJA 3OQJA 1N2SA 4P22A 1ONOA 5LLSA 4Z99A 4R8LA 1E59A 2IH4A 5CJPA 5JSKA 5JWHA 4K9DA 4WD3A 1EK0A 4G4SP 5C1BA 5ILQA 3H9EO 3DZGA 3MA0A 1A2KC 2EYUA 4RFVA 2HMSA 3IT3A 1CVRA 2IC5A 3O2QB 4HUJA 1UR5A 3V1MA 4YV7A 3EZ9A 2Q5HA 5HP4A 2Z3VA 3QXCA 1NASA 1TNDA 2ZCVA 1Y8CA 1F0KA 2Q3BA 3ZX4A 2E48A 5EJMA 1E5LA 4RJIA 2FU5C 3DYVA 1NNLA 3GXBA 3OY2A 1ZKDA 2DY1A 5HEKA 1UOPA 5DMXA 1TYDE 4FJ0A 1SCUB 3GVXA 1PJBA 5LA6A 4RM2A 3F98A 1NX9A 3F6YA 4DNFA 3I64A 4C7OA 1CP2A 1UDXA 3CX6A 5HKLA 1IUNA 3A6LA 1HDIA 3ZV3A 1XCLA 3U81A 1MAHA 1Y1TA 3FOBA 2H5JA 2Q9UA 1QNLA 1ZA2A 3B5JA 2H4YA 4G5SA 4MKGA 3AFHA 2V7TA 4ECAA 3KU1A 5KOHA 5FI0B 1EJBA 1W85A 1EGAA 3IO5A 2GCOA 1A7AA 1BS9A 2KPOA 1ZIDA 1ONNA 2W83A 3ED1A 2NUTA 1XTBA 4GG1A 3GLFE 2OSBA 1QKIA 1I4EB 5ED4A 5BYAA 1Z4MA 4KNWA 5THXA 3HDHA 4ETWA 2GGSA 2F9LA 2ZK7A 1QX3A 1ZS9A 2ZRAA 3IYLW 4GT1A 3ELDA 5JALA 3E9EA 3IUPA 1H0KA 2NSLA 4R69A 1G9XA 4ESVA 4DRXA 1TKCA 1SVIA 5JMTA 1RLJA 2YWXA 1MAUA 1JL3A 1WWKA 4Y6OA 4YRDA 3PICA 1EE2A 2FN8A 3LHDA 1F2UB 4LDJA 3CZQA 3EDRA 1KFBB 4X3PA 2G77B 4JLVA 2RJNA 1O8CA 1UMDA 2EFGA 3LLCA 4PXAA 5J59A 1Y1QA 4DPMA 4DZRA 4EHJA 2BFWA 4YMHA 5BWNA 2NMVA 2KI5A 1XMQB 3ZGNA 3C7AA 4E5UA 1G2PA 3IP9A 2WJHA 3C7TA 1UQRA 2J0QA 1UBJS 1K8RA 3WSTA 5JJLA 3O94A 5F1KA 1DKRA 1CRZA 1Z45A 2OV8A 1U9YA 3IE2A 4PG6A 2PV7A 5GOTA 4TZ0A 3ZWVA 2FF5A 1J0BA 5K0NA 1JFLA 3W7BA 1WXFA 1VKNA 3D54D 3MWYW 5GAJA 4CIDA 4EPVA 1X1RA 2ZBFA 5EPOA 4DIDA 5HQ3A 1PKEA 1Y7IA 3QOFA 4JOSA 2XB9A 1H3NA 4IMJB 1OI2A 3TUIC 4AM8A 1F8YA 1NMQA 3MT0A 1N78A 3IUQA 3QMWA 3HI6A 2IZ0A 2UZ0A 4UBJA 3ZK9A 5L8VA 4QG3A 4WK6A 2ODAA 1MEJA 4ILKA 4YH1A 3RTCA 4HATA 3HC7A 1UPUA 3L6EA 4C0HA 1A76A 2VJMB 3NDRA 3ODGA 1DDIA 4QULA 3QMMA 3U6BA 1KI2A 3HA7A 1XAHA 4KGVA 1TFRA 2G80A 2ZGVA 1F6BA 4JBGA 1XO1A 1C0PA 4OM7A 4ZIRA 3ONEA 1D1QA 2FW6A 4IWXA 2Y6UA 1KQPA 2P40A 3D02A 4D82A 1ST2A 2F1JA 1GSAA 4L4ZA 4NPHA 2GR9A 2ERXA 3Q2KA 4MVJH 3HZRA 4D26A 2WZQA 2C04A 1B16A 2XTJA 1HTBA 2NNLD 4PM4A 2FEPA 2ILTA 5DFAA 1GKYA 2O8VA 5DHTA 2FW0A 2ZAIA 4XVHA 2XGGA 3BM5A 4AJHA 3K0KA 4HGRA 3A1DA 3ORFA 2IY7A 3O4FA 5KTNA 2VNHA 4UAGA 1TC2A 4GPD1 2J32A 5CH8A 5AKIA 1GOTA 4LBWA 2GFQA 2OGTA 5JXWA 1W0JD 2JCYA 4UXJA 2HBRA 1KKLA 1P5HA 1JMKC 5FBHA 3LTNC 4DEXA 2YBEA 2XYQA 4XGNA 5FI5A 3WQSB 2BFPA 3NBMA 4MWGA 4I3HA 3WKEA 2CWWA 3CVUA 4GQBA 1I1NA 2E4XA 4GBED 2PKRA 2VPTA 4AJ4A 2V4ZA 3OOWA 1ZI8A 4IDQA 1P2TA 2WFZA 2HXSA 2JK1A 2O2JA 2X5XA 1S8NA 2DCMA 5CPFA 5ALGA 1I2ZA 4CT5A 1G5FA 3MQ2A 5IARA 4E12A 5IRCD 2Q0QA 5KWJA 1C80A 1HDRA 4F06A 3CLUD 3IPCA 3VR1A 4YMIA 3AF6A 2JHPA 2YJGA 3GUHA 3BG5A 3JYNA 5KB3A 3U4MA 3AR2A 5KYWA 1ZW1A 1RPTA 2JJ1D 1JSXA 2JGJA 3CG4A 3FF4A 3BUSA 1NXXA 1W5FA 4DIMA 4OXRA 3JWPA 4ZEVA 1GA6A 1ONSA 2NSYA 3ZDXB 3LQYA 5F23A 3QTTA 2XBUA 2PRSA 3BTSA 2IVFA 3OSZA 2DVMA 1P60A 4TPKA 5UKDA 3D2LA 3AHIA 3VQTA 2E5FA 3RAGA 2NIPA 4OMCA 4I9NA 3W2FA 2BSAA 3WL4A 3RIMA 3RVDA 3GU3A 2JI7A 5EJGA 2XZOA 3KU4A 5KKNB 2FKAA 2ZW9A 1TO1E 2HN9A 2XUIA 1PBNA 2J5RA 3DB1A 3IAEA 1NJ1A 2R8ZA 4BLRA 4LMBA 4QO7A 2J1LA 2ZYDA 3E3OA 5FLXA 3PT5A 2GEJA 2ZR0A 1MOQA 3BRWD 1Y9AA 4MCAA 2P4EA 4ZOBA 4OHUA 5ELLA 2MSDB 2OXTA 1TK9A 1L1EA 3IT0A 4A91A 4LNUA 2BI7A 2FPUA 3SFTA 3F7OA 4P36A 1FRFS 4V0OA 2Q1UA 4GBGA 3DFKA 1UKBA 4NKRA 2QRNA 5CLHA 1KP3A 1E2PA 2UUOA 4QUDA 4NYMR 1A2OA 3B78A 3R0QA 5FLKA