2BFVH

Monoclonal antibody fragment fv4155 from e. coli
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
QVQLQESGGGLVNLGGSMTLSCVASGFTFNTYYMSWVRQTPEKTLELVAAINSDGEPIYYPDTLKGRVTISRDNAKKTLYLQMSSLNFEDTALYYCARLNYAVYGMDYWGQGTTVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FV4155
publication title Antibody fragment Fv4155 bound to two closely related steroid hormones: the structural basis of fine specificity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 1997-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bfvH00
1T6VN 2EZ0D 1HKLL 4GG6F 5KS9F 3ALPA 4W6YB 4DKEH 2BVOB 2LU3A 1I7UB 4Q9QL 4G7VL 5AD0A 1FCCA 4XHJD 4LEOA 2X42A 5E5UB 1QFWH 3BXNA 4M6OL 1A7QL 1J8HB 4UOJA 4HBCH 2FWOA 4M6ML 4RAVB 4TUOA 2VXSH 4PJ8B 3BP4B 4HAGA 2DRUA 1GYAA 1BBDH 4UQ2B 5CSZA 3I84A 1XR8B 5E2VL 5GS1A 1OTUC 1HHHA 4GKZA 3LQZB 4HUVB 3QNXA 2IANE 5FYJE 4AT6B 4U1SB 2NY1C 4P46A 4PTUA 3HFML 3RX7A 3EOBA 2C1OB 4AEFA 1PKQE 3JSSA 1D5XA 3OPZH 5IGXL 1XFPA 3M17B 3MJ6A 2IPKA 2BVEA 5C07A 1C5BL 4ODVH 1A4KB 1MCWM 5CLWA 5BVPH 4G6AD 4Y4KA 4YXKH 3ET9F 1KV3A 2V5TA 1V5JA 1I1FB 2YRZA 1SJHB 5IB1B 1NCUA 4O51A 5DTFB 5FYLH 4JFED 3TJEL 3UTSB 3LN5B 4LLUA 4F7EA 2F5BH 5DMYA 3MA7A 1E27A 1WCBA 2HTLC 3AROA 4OGAC 5DQJB 1DDHB 4Y5VB 5CZVH 1RZJL 3SDXB 1TTUA 2A9MH 4U6VL 4OCMC 3LDBB 3RWGB 4PRDB 4WFFE 3T0AA 2J6EL 3PWPA 3CPLB 1NFIB 1S7TB 1RUMH 5HYQA 5EN2A 3SPVA 3ZL4H 3B2VH 4K7PX 4HV8B 2BHZA 2DMCA 3VXQB 3BSZH 4J4PA 1KTKE 5CFHA 3MRLB 4NNYB 3VXNA 4OLVH 1TIUA 5DGQA 3VWKD 1V3KA 4X5XA 4OD1L 5EU7E 1NBYA 3O45A 1F8TL 4WEBH 1OGTA 4LASH 2HFTA 4NCC2 4PY8I 2DQCH 3I75B 2YUWA 3TCLB 4UTAH 4HT1L 1WZMA 4P2OB 3U6RB 1MREH 1CR9H 4W4OA 3N1QC 1F13A 3FRUA 1X5HA 1IGJB 3TYGL 1A14L 2FR4B 3O0RH 1UYWL 2O61B 4QRRE 1EEYA 2VTFA 4WU7B 1FBIL 4YK4B 4LDLB 3HNVL 4P2RD 3UDWA 1ROWA 4OIAA 3WXWL 5IFAH 1RULH 5EUKA 1U92A 2NTSP 1LO4H 3IAGC 1TQBB 4FQIL 1I9IH 3O4OB 5IB2A 3WFDL 3TT3H 2EECA 4WFED 4YUEH 5F3HB 3JVGA 3BWAB 4G8FA 4QHMA 3RBSA 1NDMB 1M7IA 1R3LB 5GGRY 5FV1L 3T77B 3ZT7A 4WWKA 2EKSA 2ZZUT 3GB7B 1VKXB 3DBXA 1I3VA 1LO3H 5CJ8A 1OP9A 1A6UL 1FVDA 1XH3A 1U3HB 1X5FA 2GQHA 1CFQA 4KDTA 1A2YA 1HXMB 5A2IH 5KN5A 5BV7L 1IM3A 4Z77B 1I7TB 1H3TA 4P2QD 5KJRL 3SDDC 3WKNA 1DBMH 1TJIL 1YNLL 3KYNA 2VUYA 5CKAA 1GGBL 3C2SA 1FFOA 4U6HA 2CH8A 4I1NB 4JLRB 3TA3C 3MRBB 4BZ1L 4ZFOA 1XGQA 1NGYB 1EGJH 1H8SA 4X8JB 3RNQA 4OV5A 2HVKA 4FQ2L 5IR1B 5HPOA 2J8UF 2SEBA 5K9OB 1QRNB 1CGUA 1OD9A 1KTDA 1Q9LA 4YBHA 3EO1A 1LEGA 5HI5C 2ADGB 4I18B 3WIIL 3LEXA 3TBTB 1X5KA 1FE8H 3VE0B 5DJ0B 3RIAF 1SJEA 4YHNA 3CZFB 4JO4H 2YPLA 3C6LD 1CDBA 3OZ9H 4MXWL 3LKQA 4AIZA 1GH7A 3A6OA 1KUMA 1JYWA 4Q6YA 1CD8A 4JY5H 4NQED 5BRZA 3CVHH 4OFYA 3S36X 3KHOA 1ONQA 2HJFB 1HYSC 2CXGA 4PFEA 2G60L 4WW2F 3MV8E 3T3PE 1N6VA 4M00A 3UC0H 3ARDB 3G6JE 4Y4FB 5FHBL 4MNQD 2GSGA 4LVEA 2YXFA 3P4OA 4H26B 4K07A 4NNPL 2X89D 3OJMB 4BQBA 5FKAA 4WTZA 1EPFA 5C71A 4MAYD 3KPSB 1DTUA 4U6XB 4CADA 2JKXA 2DQDL 1T7VA 4K9EC 1FLRL 4A6YL 4DOHB 2EIBA 2OJEB 3BH9B 3HPJA 4ZPTA 3BP5B 4NHCL 1A9EA 1J8KA 1CFSA 1D5MB 1X7QA 4CVXB 1NMAL 1IMHC 2AXJA 4HUUA 1V7MH 4DUXA 1DN2A 3KDMA 5D2NA 2VLKA 5E03A 4RGNB 2QQNL 3SQOH 3MR9B 1IEAB 5I71C 1BQHG 3DUSA 1M71B 3KPMB 4DTGL 4EOWL 2VYRE 4KKCC 3RU8L 4LCYB 4RDQG 1LNUA 2IBGA 1IGCL 1IGFL 3DV6A 3O6FD 1BLNB 5JHLH 4CDGC 1J1OH 1L6XA 3VFVB 5CLTA 3X14B 1VEMA 3PXJA 3IS0X 2VDRL 4DVBA 4AIOA 3D25A 2GT9B 1LE5A 1LP9F 2P7TB 1ZE3C 1YEDA 1EHNA 2UVFA 3P11H 4QGTA 1F11B 5D2LE 3A6CH 1BJ1H 2GW5A 3C8DA 4R0LC 5JA8B 4NDMB 1MCPL 5GGQH 2E8YA 4PLKD 3VI4F 2OS7A 1MRDH 4N5ED 4KZEH 5AWNL 3MRNB 4NSKB 4U1MB 1CXFA 1FYTE 4HUNB 4GRMA 3JWOL 1MRFL 1MQKH 4HS6A 4YIQA 2EXWD 3ULVL 3DVNA 1BAFH 1JI1A 5DJAA 5DEFB 2DMKA 2H41A 3V6FB 1XGTB 4XC3L 1XT5A 4YX2L 3NCCB 1NMCC 1PZ5B 1XGYH 3TBYA 1FG2B 3MJ9A 4GAGH 2F5AL 2GTZB 4N1HB 4I3RH 5C0EA 4ZUVB 3C2AL 4WNQB 4PJ8D 5DMIH 5EIIA 1NBQA 3MV9E 4TTDC 5T1DH 3DUHA 4LSQH 1KN4L 4O2FB 2VXVL 2L7UA 3OGOE 2B4CL 5LGJB 3KLSA 5DJXA 4Y16B 3QDJA 3GMRA 3UJIH 3DX7B 5MEPB 4CDHA 2AI0H 1HQ4A 1WWBX 3VD5A 1FZMA 4NBXB 1Y18B 4LMQE 2EDHA 3P0GB 2H32A 2FH8A 4JGMA 3FOMA 3CLFL 1P4BL 3NZ8B 1HHJA 4XMLH 1NANI 2ITCB 4MYWB 1UVQB 2NY5L 3QEQE 4OF8A 2XN9A 3KPRE 4KFZC 1DBBL 2CUHA 3L5HA 2XFXA 2ZOKA 4L4VA 5C0BB 3MUHL 1YEJL 3UTSD 3O2DA 4QRUB 2IQAB 1FJ1B 3HZYB 2PETA 3E1F1 2R1XA 4M1CD 1CFNB 4DKAA 1DLHB 5EIVA 4H25A 3QRFM 2NZ9D 4Y1AA 3F5WA 5I0ZA 4JM2C 2E27H 4H1LA 5ICYB 3NCYP 4XP4H 1IAOB 4IEFB 4LLDA 5ENWB 4X0KB 1XR9B 1N0XH 1DQJB 4JR9H 3EGSB 1NLDH 4Y5YA 4GW4A 2CLZB 1XF4B 2J2ZA 2Z4QA 3MX0A 2BERA 2VC2L 5DK2A 2HKHH 5FV2A 3EOYG 5A2JH 2EE3A 1Z3GH 3UJTL 4G5ZH 1UXWA 3BJLA 1T83A 3Q3GA 1XZ0B 4L3EA 5LWYL 1DQQA 3E6FB 1LO5A 1DVFA 4GMSL 1J86A 4MX7B 3LV3A 4JZJA 1KEGL 5CMAB 3GIZL 4XVTL 4NRYB 3DROB 5DHVH 5KW9H 4HZAA 4ZS7L 3I6GB 1JN6B 1QBLL 5IQ9A 2FEEI 1N3NA 4KROC 1C12B 2HJKA 3TA3B 4E41A 1Y6KR 5JMRA 2B5IC 4QRRB 2WBJB 2QR0A 4W70A 3CC5A 3O6KL 2V7HB 1CN4A 1OAXL 1DEEA 4QXTB 1I9JL 1I8KA 5T3XE 2Z92B 4PBWD 1RUPL 4UZGA 4M7LH 1OARL 1JP5A 1A9BB 4YXHH 2R8SL 5F9WC 2A1WH 3K74B 2CLVB 3C08L 3TPUA 1S7WB 4OZFH 4Y4HA 4JVPA 1YEIH 5IM7A 43CAA 1CE1L 1MVUA 4Z95L 3U7AA 4RFOL 3QISA 1QSEE 1WJ3A 4BH8A 4EXKA 5ANMB 2VZUA 3SE9H 2YMXL 1CD9B 3L5IA 3IFOA 2VXUL 3MUZ1 4M7LT 4PY8J 5I30L 3NAAL 4XPAL 1HDMB 1Q8MA 3FB5A 4KAQL 5J6HB 3GMNA 1RIUL 3U46B 4OD2B 3O8XC 1R3HA 3WIFA 3ALWA 3TO2A 1T0MA 4KK8D 3D85A 4P57B 3HNSH 1UWEH 4PJAE 1P7HL 1IGMH 2L4OA 3D9AL 2HJLB 1IL1B 1CZ8H 1I8IB 1ZGLA 2AEPL 3MYJA 5K9QI 4EI5C 3L3DB 1KB9J 3ILQD 3LKNA 3TWCH 3AC0A 4BUGA 1QFWI 5JUEL 1TVBA 1QRND 1OTSC 5A2KH 5DUML 4OKVA 2IFFH 4PR5B 2NCMA 3ZDXE 5DUBA 4HMEA 3G5VA 5DO2D 3FFCA 1MJJA 4YDKL 4OZ4A 3ARGA 5KTEH 5I8KL 1ERNA 5CD5C 5IOPB 3CJJA 3U0PA 3D18B 4M9PA 3KPOB 4V1DA 1U8OA 3TN0A 2A6IB 1FVEB 5I1EL 2E3VA 3T04D 4GO6B 3W0WB 4HKJB 2DN7A 2EDTA 3QUZC 4LPUA 4AQ1B 3I85A 1K5NB 4HSQA 3P3YA 1OTTD 3ARDD 4DW2H 2FEDC 2N7BA 1UXSB 4Y4FD 4YDJA 4MNGE 1YQ2A 4KHXH 4QHLB 4U49A 1AXSB 2PTVA 4XP6H 5B8CC 1S9YB 3VRJB 1U8PB 4M5YL 5C0AB 5IW3A 1G6RL 4R0LB 3KPSD 4F7TA 3MGTB 2FHBA 3B9KA 1CLOH 4D9RD 2VIRB 3REVA 4RISH 1BGXH 4PJHB 4CW1A 1RHFA 1ZHBB 4NM8L 2XICA 5AYQA 2UWEB 3REWA 2GIYA 1UKTA 2NY4C 1W72H 4KK5D 3V6BR 3CFKB 4KTDH 4LVHC 1R24B 1S9WB 4UNUA 2EDLA 4FQHA 2NYYC 2VDQH 3BH8B 2AV7B 5D70H 3HE7A 5LG1A 4G43B 4GKSB 3V7AG 1DQMH 3LQAC 1MHHA 3MLVH 3P77A 5HY9A 2WLZA 3RWHA 2XWTB 2FSEB 3AU1A 5J6GA 4GG6A 5KS9A 5GIRB 2OX5A 4DQOH 2DLTA 5I17A 2XKNB 3WD5L 4F33B 4HGMA 4ONHA 1IKFH 3O2VL 2CGRH 5T5NG 5IKCA 4L4TB 4ZYKA 4KK9C 3BQUC 1AGEB 1FDLL 3IXAA 3GRWH 4XPFH 3I02B 5HGBA 4F15C 3FQRA 5EO0A 3KJ6H 1C5DB 4XWGH 4AYFA 3V6ZA 5C1MB 1QA9A 3R06A 4K3DH 4JAMA 5E7FA 2WSKA 3D0VB 3OL2A 2FB4L 4GKNB 2QLVB 2OL3L 1B4JH 4Z9KB 2BJML 4JN2A 5CCKL 3RZCC 5C0IB 1IAKB 4JPWH 4TOYH 4G8GA 4BSVA 5FM4A 2A6KB 4D0CB 1Z2KA 3MLXL 4AM0B 5D1QA 4PJXE 2PUQT 1GZPA 5ACZA 2IBBA 3MXWL 2WINB 4OGAD 1F3DH 1B90A 1FL3A 3MODH 1U0QA 3AY4A 3EFFB 4XP1L 4JM2B 4Q9CA 1UM5L 1RIVH 5DD6A 5BJTA 3SDAC 1FL6A 2A6JB 5EO9B 4XTRD 4JPVH 1E6OH 2X9XA 4LCIH 4NQUA 4P5TA 3V8CA 2JJTA 4Y16D 2IAND 3BPLB 5FYJD 2IH1B 5L88L 2CKBB 3G5ZA 2R56L 1UJTA 3EYSL 4HJJH 1T7WA 4J2XA 1IQWH 1RZJC 2OTUB 5TDPA 1IM9A 2XTJE 2ZCLH 4G8IA 3P4MA 1CT8A 3QEQB 4NM4L 2EIZB 3QDGE 2BNQA 2X4RA 3VDBA 2FBJH 3K4DA 4BKLB 3VFSA 4I0KA 4HZLA 1DN0B 5IB3B 3WIHL 4JFZL 1GGCL 3VFWB 1T22B 4PB0L 4KROB 2YHGA 1YPZB 3FONB 3QQ4A 3L5XL 3BVNA 3I3DA 4HQQH 3BIKB 1LEIA 4HC1A 3BZ4A 2D03H 4LLVA 4JFQB 4PREB 3NH7H 2D7QA 4QHKI 1M05A 3JBG7 5AEAA 5KVEH 1AJ7L 4L1HA 2AK4E 1U8MB 35C8L 3RWEA 1JHLL 3PGDB 4LSSH 2P24A 5F70A 5FFLA 4KI1A 3MFFA 5D9SA 3VRIB 2BMKB 3OJVC 2DQGH 3T8XB 1ZS8B 4LGRB 1INEL 4MJ5A 1GAFL 4ZSOE 2D7OA 3V5KB 3LB6D 5J4MA 1NCDH 5JW5A 2XTJC 4KK6C 4ZNCD 3LPWA 2J8OA 3KNBB 1JV5B 5BOZG 1GIGL 1IC7H 1FL5A 3FMGH 3O8XB 1EJOH 1MFCH 2A74A 3MROB 4MQSB 12E8H 3D5OF 1GRWA 3CX2A 3TA3D 5T1LA 4ZPVA 4QRRD 4EI5B 3IJSB 5E94B 3MBXL 2YD2A 4DAGL 5HVGB 3EDJA 5J3HC 1K8DA 3LPGA 3LN4B 3QB7C 4DGIL 5FB8B 3QHZL 2GITA 4OF5A 5BV7C 4ZUUA 2BDNH 4TUKL 3FQNA 2MOVA 1U8IB 4C54A 5C7XL 5HI5D 2QSQA 4RBPK 3MNVA 5JR1H 5CJOH 2X4QB 3EDKA 2NXYC 3JUYA 2BCKB 2ID5A 4Q9BA 5I1IL 2LABA 5IK3B 5IMLA 3QFJB 1JGDA 1F6LL 4KZDL 4LOUC 1FORL 4NZTL 5LBSH 5IFJA 1FVCA 3V8OA 1VADB 1HYSD 4JRXA 1KXVC 1RJYA 2H26B 3OMZA 4TNVF 4Z7WF 1YN6B 4ZQKA 2R2BB 1MAML 4HS8L 3P30H 4LLWB 3MOBL 1P9MC 3OGCA 1KLGB 4HMDA 4NZDA 2C1PB 3INUH 2AV1B 1S7XB 5IVXB 1GGYA 2FYYB 3G04A 1T1ZB 4IOIB 3O9WC 1IT9H 4PJ5A 1H3GA 3O11A 4LHUB 5I1DA 4ODSH 5A16B 1H15A 1NJ9A 1CDUA 3KPQB 2GJZA 2JE8A 3UJJH 2J8HA 3QUMA 5F7EL 2N1KA 2ZP0T 4LK4A 2J7LA 3QDMB 4OIIL 1NGWB 2FBOJ 2VQ1A 1WFOA 5EUOE 2ICEB 2C4FT 2YEZB 4LVHB 1IARB 3LCYA 3RWCB 4FQ1H 5EH1A 5D6CB 2DQIL 5HGHB 3ARSA 5TE4H 1A1OB 1JZ7A 1T5XA 4IMKA 4OTXH 4AK1A 5DD5L 1JGLL 4G42A 4KKCD 1IGIH 4OZHB 4PGBB 3W0WD 5ACLA 5GSRB 2DDQH 4OCXL 3RL1A 1KN2L 1TZGH 3DURA 3PV6A 4JY4B 4F9PA 3ZKXC 4F58H 1OHQA 1FIEA 4X4XB 3ULVE 2OMBA 3MV8D 1MOEA 2ZPKH 4HH9A 5TGBA 2D7NA 2PO6C 3QPQC 1OM3H 5ACMA 5C0AD 1FIGH 2NY0B 1GHFL 1WBYB 4F15B 1S5HB 1HI6B 5IJVB 2VLLA 3NA9L 3TFKC 4RFNB 2DQUH 3S98A 2DQTL 3JWDL 4WV1B 3WNPA 3CIQA 5I8CA 1YYMH 4LRIC 1YNTA 4OZGE 3WFHB 3LRSB 3FB6B 4WU5A 4HWZA 4WHDA 4OM0H 4RSVA 4MQTB 2LE9A 5B3NA 3IS1X 3HTLX 2ATKB 3UTTB 3KPNA 4MZ3A 3DX8A 4IM8A 5F1IB 4C55A 3Q2CA 3WHXA 4N8PA 3T09A 3U36A 5L2KA 4U3XA 5FK9B 1B0WA 3GSNA 1BFOA 5DEGB 4UV4L 5J12B 5ID1A 4KTEH 4L8SA 5AUMA 4HPYL 4ODWB 4MJ2A 3S37L 4XCYA 3JWOC 4HUKB 3WLWC 2X1PA 4TTDD 5IVZA 4J1UA 4LCUA 2YKLL 1HSBB 3ILPB 4L4TD 3ULVC 3EBAA 4NPYA 4Y5XB 3LSOB 1QTYT 2HFGH 1M1SA 1QR1A 3TESA 3L95A 4TVPD 1I1RA 1VENA 1D5IL 3DHMA 4ZO6A 5E8EA 3T0XA 4APQC 2R4SL 2AJVL 3GI8H 3N9GH 1NFDE 1CI5A 1LO0H 5TF0A 3RY6C 3J8F7 4HPOL 2EDXA 4OCYH 3MRMA 1K2DA 3VGFA 5IF0A 4PRAA 2VAAA 1W0VB 4R9HA 3GSOA 3X3GH 2B4CC 3CSYB 3BAEL 4KDWA 2OZ4A 3TC9A 4YGAB 2AJXH 2W60A 4NQCA 2DM7A 4G8EB 2A0LC 2R1YA 3WV0A 5TE6H 4XXCC 3PHQA 4TTGA 4GAJH 3WMSA 3EYOA 2LTQC 4PJXB 5BO1H 3UX9B 2VISA 5I16B 1TVHB 3BMVA 4M4RA 4PJ7A 4JM2D 2NY5C 4BJLA 2E7LA 4GS7C 5DK0B 3FN0H 1UM6L 5GGRB 3VXUA 2XWJA 3QH3A 1YEGL 2Y23A 4DVRH 3DUUA 5D7JB 7FABL 1MJUL 1UFUA 2BRRL 4LCCB 2ICWA 3LVEA 3TP4A 1EO7A 3RWJA 1GC1L 4NYLB 4YZFE 3L3OB 2J12B 3G6DH 1CU4L 3GJFA 4TVSa 1CL7H 1ZWIA 3UTZB 2VLJB 2RR3A 4YHLH 2AXHA 3O6ML 4N8CL 4N0YL 2X10A 2ZUQB 4E9LA 1KB5L 4WO4C 3SE3A 4NOFA 1W8NA 1I9EA 1ADQL 4GBXC 3I6LD 1R3IH 3QEQD 5CUSH 1EZVX 2OJZL 3IGAB 4FXKA 4KXZI 3W11D 4GFTB 4M7JL 3ZKSD 2AJUH 1ZT4B 2ZSVA 3OXRB 3QNZB 3ZDZF 1A7QH 4YFEA 3OAUH 2BX5A 4M6MH 4KROD 4WEMB 1F5WA 2DLFL 3PL6B 5ERWA 1FPTH 2FHFA 2BFVL 1KLFA 1QACA 2NLJB 3SGKC 4OB5L 2FL5B 3QUKB 4G9DA 5IW6A 3UPAA 2JJVA 5BV7B 1S78C 3VXSE 4BQ8A 2W0PA 5FA4B 5KSVB 1JWUA 4JFEA 4IBLT 1N7ML 5TE7L 5FOJA 5JNYB 2HLAA 3IJYA 4F3FA 2X4OB 2IGFL 4NHUB 1PG7W 2R1WA 3E6HB 4BA8A 1TJGL 3CFCH 3D2UB 4P9MH 2GFBB 2LU7A 2ZKHL 2UY6A 2D3VA 2XXMB 2YUVA 3ZKQD 2EICA 5EOCL 4IRZH 3SKMB 2JJUA 4LU5H 2CUMA 4OAWB 4MCZB 3WEXB 1J05B 3O8XD 2AABL 1KENL 1MFDH 5EBWA 2UVEA 5DWUH 2BVQB 5H35A 4K7PY 3S5LA 3ZTNH 1BQUA 1FFPB 1RZFL 1B9ZA 4OQ1A 3VWKA 3O9WB 3BFOA 4UQ3B 5JOPE 3O3EB 4EI5D 1MCFA 4N0UE 3GZKA 1MRCL 4LQ1A 4YC2C 3AM8A 1IVLA 4QHKJ 4HDIA 2CIKB 4D9QE 5EO1A 4ZFZB 2PXYB 3CCHA 3ROOA 3EOTH 1WBZB 5T3XD 3JTTB 4K23H 2AJ3B 4M7ZB 4OLWL 1BJ8A 4X99B 1T3FA 2UZYB 5CD5D 3BKCL 1K6QH 1VPOL 4OD1H 1CGYA 3QFJD 1IKNA 1J11A 1F8TH 2MCPH 3QEGL 1UG9A 3UZVB 4A6YB 3QUZD 4D9LH 4WJ5B 5C8JB 4J8RB 2F9BT 3VG0L 4NO5B 5KVFL 4XZUB 4HT1H 1E6JH 4CAGA 3IDXH 1M4KA 3ZKXB 4P4RA 4YO0B 4LP4A 2ADFH 2FEDD 4P9HL 4F7PA 1A6AA 5EORH 2PO6B 4CVZA 2GSIA 25C8L 4M48L 4X6FA 1UYWH 1I8MB 4GLRI 3PQYE 5F96L 1RZIA 5AAWA 3L5WA 4LHUD 1Q94B 1G9MH 3NCFB 4JVWA 3ULSB 3WXWH 4YGVB 5C09B 5DSCB 1Y0LA 3NFSH 1P6FA 3D1MC 5L7XL 3SE4A 4EKXA 3QDMD 2P8LA 3M8OL 3RDTA 4JG1H 1T1XA 4Y0GA 4K8RD 3EO0B 3WS3A 1U41A 5EUOB 3FQWA 1FO0A 4LPWA 1OPGL 1QLFB 3S36L 3STLB 3B9DA 5DHYA 1QRKA 5JIKA 1SM3H 4XAKE 1P69B 1LQSR 2W0FA 5DHXB 4YHYB 5JXAL 3UTPE 1IAIM 4HIHA 3SGJA 5FYKH 3BW9B 3MRFB 4N9GB 4PRIE 1K85A 1N2RA 1XGPA 4WHCA 1HHIA 2CPCA 1Y6MR 3HMXH 1CTNA 4ODXB 5KJRH 4QYOA 2QEJA 2F53A 4JPIA 1TJIH 1U58A 1MHCB 3T2QA 5GGVL 3WBDA 4OJFH 1F6FB 4B7LA 1S5IL 3ARBA 4KK9D 4YDIL 1IZJA 1TNMA 2R15A 1I9RH 5MP6L 5EU6E 3C6LA 4ELKB 3GSRB 1JRHH 4H5SB 1P4LB 5L6YL 1YECH 5B3JF 1CDGA 5DRNB 4APQB 1G9NH 4HWUA 3GKZA 2VDLL 4NQEA 4OT1H 3BUYB 4HW6A 4FZEH 4OZGB 3WIIH 4BYHA 5HHME 2JIXB 2GCYB 3RZCD 4M8QB 4KKAC 2Q86B 2OQJA 1OLZA 3GHEH 3Q6FB 2FJGB 4LDEB 3UTTD 1NGXB 2HFEB 3KYAA 4P3DB 4Z0XB 4MXWH 4M62L 2NNAA 3MJ7A 1A6TA 2HG5A 1VACA 1MCIA 4RA0C 1PG7X 1LVEA 2BSSA 4MAYA 1YMMA 4XBPB 4JREC 5I1JL 1QFHA 5EZLB 5KSUB 3ZE1E 3MBEC 2NY7H 3OKEA 1S3KH 2LTQB 5DVNA 4YNYA 2YUZA 2AXGA 4XBGA 5CWSB 1JPFB 4GS7B 5EULV 4MHHI 3E8UH 4I4WB 1S9VA 4ACPA 2NW2B 1L6ZA 2CLRA 4LKXB 2DQDH 2DQJH 2EYRB 2R2CA 1RVFH 1J5OL 1J18A 3MJ8A 3O6FA 1HZHL 4U1JB 3G6JF 4OI8A 3EOAA 5F9OL 1WBXB 1BF8A 3VD7A 1U95B 3A6BL 2ED8A 2QQNH 1DBKH 1NBZA 5HHNA 5FYLD 2O5XH 4DKFH 2EDKA 4AMKL 5IHUH 3QWQB 3PWLB 4PJHF 1KELL 2DQFA 3QHFH 3RU8H 5EPMA 2F19H 2WWKT 1KG0B 2UWEF 1IGCH 2YD3A 1RURH 5KVMC 4FZ8H 1AGCB 1QQDA 3AS0A 3F12A 3F7YB 2AAVA 2QL1A 3G9VA 1BM3H 5F3BA 3WNOA 4JFFB 1HOCB 4XPHH 2ADIA 3L3HB 3DO7A 1H3PH 3C8HA 3MRRA 3TV3H 2QADC 1XGRB 3BDBA 4BFBD 3X3FH 5IEKB 1RJZA 1MCPH 1E4XL 8FABA 5EG6C 3HRZB 4Z7QE 4ZNEA 4GMTH 3EIFA 1CBVH 1NL0L 3FO2A 1JPGB 2VLJD 3BEWB 3DX9B 2NX5E 1MFEL 3NCJH 5AWNH 5IT2L 2PW1B 5SWSE 5JXEA 2WBWB 4X9IA 2OXHA 2P5EA 1MRFH 4ETYA 2XTJD 5GSVB 3ULVH 4UQ2A 1A7NL 5EIQA 1ETZB 2VMFA 5ALCH 4I8DA 4HUVA 4JJ5B 4P23C 3KLHD 5DLML 2OR9L 3U4EA 4LQFL 1U8JB 1GVIA 4B41A 4U0QB 3VXRB 5KG9A 2WNGA 2EIDA 3OR6B 5D7LB 3NPZB 3W81A 2E8ZA 5I0DA 4YHZL 4BZ2L 5J3HD 4HF5H 5HHPB 2X4PB 1YMHA 2CKNA 2PYFB 4YC2B 3MSPA 5GXBB 2XZAL 4PJDE 4FQJH 3HZKA 2FX9H 3MXVL 3CFBA 2I27N 5ECJE 4P5MB 5B4MC 4K3HA 3LPFA 4HEME 1X4XA 2X1OA 1JF1A 4HEPG 4C83A 1DANU 3H9ZA 5DGRA 2Y5TA 4ONFH 2PKDA 3LN5A 1O0VA 2W9DH 2NXYD 4JM2F 2I9TB 3HR5A 1T5WA 2PYEA 3CLFH 1P4BH 2Y5EA 4OQTL 4CUCA 4XMPL 5HJ3A 4LHJB 1FP5A 3D2UD 4UT6L 3VGBA 1BQHB 3ARUA 3GM8A 4Q2ZB 3LN9A 1QVOB 2MHAA 3V95A 5GZOC 2WV3A 2GK0A 3OR7B 1UJ3A 1NEZA 4GQPH 6CGTA 3QJFB 5GGUA 2E7MA 1R5IB 4Y1AE 4L8DA 3DIFA 4I5BA 1F4HA 4F8TA 4KDVA 4KHTL 4YHOH 2MQCA 1RAMA 3MV11 2KL6A 2Y72A 4ELME 4Z7WA 3VGGA 3MO1B 4QRQB 4YR6B 4ETQB 3O9WD 1C7TA 3EZ8A 1QSFE 4BSWB 2W38A 2W0LA 1HKFA 3G6AB 3QCUL 1IEBB 3QAZC 3RWFA 3MJGX 4PJCB 3UPRB 2MKWA 1G6VK 3QT2A 1M7DB 4DCQB 2BOCB 2PXYD 3I75A 4ODTH 2B8OT 2CIIB 2P45B 2VC2H 4LPYA 1ZTXH 3U6RA 4POUB 3LS4H 4KUZL 5C0JA 1IGJA 1ZGLM 2ZJSL 3T0DA 2O61A 3SCMC 1G7JA 2I60L 5DF0A 5MHSE 5I1HH 3S4SG 5LWYH 4MS8D 4YJZL 4X80L 3BN3B 3R0NA 1KEGH 5E2TL 4E41E 1EEQA 3QEUB 3BGFC 1F6AA 1CF8H 4NO0B 3GBML 3OKNB 4NWTL 1AC0A 2PO6D 2Q6WB 4R26H 1CFTA 3QPQD 4ZTOH 4R2GB 5L2JA 1YC8A 1QBLH 3IAQA 4YHML 5JW4N 1BZQK 1JUFA 3QJHB 3T77A 1FQ9C 3PQYB 1G84A 3TO4B 1VKXA 2WM0A 5C09D 3H3PL 3IDNB 5IHBA 1MAJA 4I13B 4JRYA 4KMTH 5TH2A 4LPVA 2BOBB 4WGWB 3D69A 4NKQB 1K4DB 3IETA 1PLGL 4JDZB 5HYJE 4MGXA 4QRPB 4P49A 3PJSA 3RA7H 1TMCB 5L9DL 1QOKA 32C2B 1E0OB 3HB3C 4JLRA 4QRTB 4Z95H 4E0RB 3MRBA 4FXGB 1BEYH 5C08A 3UO1L 4JREB 2ARWA 1PYWB 3JWDC 2YMXH 3RWDB 1JGUL 4HWBL 2F74A 3NFPB 2OL3B 4XPAH 4GXUM 1G7PB 3WNKA 4KAQH 1JTOA 5K9OA 3H6JA 3WLWD 5I1KL 2R23B 4JQVA 4MDJB 5DJ8B 3L7EB 3B83A 2XACC 3RGVC 2ADGA 1EO8L 1KTLB 5IMMB 4FTVE 4NBYB 3WS6C 5KVGH 1BOGA 3VFUB 4MWFB 1UM4H 5FKPA 2LQRA 5ID0A 3N50A 4HIJA 4CMMB 1ZAGA 2EH8L 4APQD 3OF6D 3QA3A 4Q7DA 3FFCE 1OGAE 2GKIA 1FNFA 3K0WA 4TUJB 4F37K 4JB9L 5DUMH 1ZHKB 3IXTB 5IVXF 1MCSA 4ZFFB 2JIXD 3HS0B 1DE4B 3TZVA 4S0TD 1X6LA 4PJAF 4UB0L 2BNRE 3S97C 1YUHA 4UIKH 5T1KB 2Z35A 1T2XA 4RNRB 3QXUA 1AI1L 4LSTL 3W5NA 2DYPA 4NT6B 4H26A 2X9YA 2A0LD 4TQEL 3QUXB 3AB0B 5INDA 4ISVB 2ZCHL 3PWNA 4PRHE 3WN5C 4P3WA 1ZLWK 5K59E 1LEKA 3S96A 1D5MA 3K2UH 4NJAL 5E24E 5F6IB 3FTGB 3NACL 3PHOB 1KFAL 4K2UL 1ZLWH 2O5ZH 3B6SB 4UBDD 4QTHB 3MR9A 4XCEA 2VH5L 4J7RA 15C8H 1UENA 3KPMA 3NTCH 2VZTA 3CK0L 3VG9C 3QFDA 3C6SA 4LCYA 4NRZA 1OWWA 5DJCA 2I24N 4RWYH 1BLNA 3DX6B 1E4KC 4WO4D 3RTQB 2YUXA 3VFVA 1CK0L 3X14A 2XRAH 5DD3L 1NC2B 4QCIB 3WE6A 4XRCA 3GGWB 1FZOB 4GRLC 2GT9A 1ED3A 3HE6A 2BNUB 2A2QT 5A40E 4P23B 3U9PL 3P2TA 1F11A 1CD1B 1GC1C 3BP6A 5F7KC 5IMKB 1RU9L 4NDMA 3QNYB 3EJYC 3SE8L 4FFYH 3P9LB 5IIEB 4JDTL 3MLZL 4PIRF 1S7QA 1G7LB 4MJIB 3WFBH 5FA3A 4X5WB 1UB6B 3O3UN 4JFFD 3O2VH 4FQPA 5K33A 4OZIA 3EYVB 4IJ3C 1IFHL 1J7VR 2AEQH 3DGGB 4XNZC 4QNPE 1FDLH 1OAQH 1S78D 1UH2A 5DEFA 3ULUC 1EMTH 1B2WL 2YWYA 1YA5A 3T0VA 5F21B 4L5FL 3X12A 5D7SL 1PZ5A 1T6WA 3MRHB 2G2RB 3WJJC 3CSPA 2GTZA 4XCNB 2KH2B 3DVGA 4R8WH 4G6ML 4OZFA 2R4RL 5IVOA 2GJ6B 2ESVB 1IGYB 5EDXA 4X9GA 1UWXK 2IWGA 4YBLC 4FFVC 2VZSA 4UDTA 3VH8A 2C26A 3T1FB 3X13B 3MCKB 2QTEA 4DGVL 1M6OB 5F89A 5L8KB 1UWXH 1PZUB 1BREA 2Q8BL 1JMZA 4MD0B 1NCTA 4JN1L 1Q72L 2IANA 1X5XA 1GGUA 4LDOB 5HGAB 4U1LA 5ADPH 5CZKA 3VXRD 5DRWA 5DFWH 2GTWB 5GRVL 5D7LD 5HD8D 4PJFB 3VFTA 2QV2A 4RQQB 3MA9H 4JHAL 5HYSA 1TPXC 3L9RB 4KV5E 2D7TL 1MHPH 2ITCA 1HXYA 4U2ZA 1N5AA 1OSZA 3C09B 2VQTA 5IBTL 1IZKA 1NLBL 3DXAE 3EYQC 4LKCB 3S35L 1T66C 4PJDB 4TNWK 1MUJB 3W2DL 4ZS6C 3VXSD 4PJXF 4FG6C 5EZJB 2BC4A 5I1GL 4U7MA 1FZJA 2R56H 3EYSH 4XXDA 1EAPB 2AEIT 1MWAA 1EFXB 2XPGA 1DLHA 3L3GB 5DD0L 5CJ5A 2BNQE 3SCMB 1UEMA 2APFA 4Q0XH 5ICZA 1JRHI 3HI6L 5ICYA 5JLZA 4NM4H 5DJZB 43C9B 5ENWA 5F7DB 3NFNA 4PS4L 2MWCA 1IAIH 3CDGA 3SGDH 4PRPE 4KUCD 4MA8L 3TF7C 3Q5YA 4XC1H 4YPGB 1GGCH 1UQSA 2PN5A 4PB0H 1R0AL 3OSKA 2LV4A 3QDHA 4ELMB 1PEWA 1T20A 4XNUH 1AIFA 5MERA 3LS5L 1QSFB 4GOSA 4HXBL 3VFMB 4HCRA 2RCSL 3QIBC 1AJ7H 3SO3B 5GRWA 5CSGA 4KQ3H 1JHLH 1T1WB 1VEPA 3W5MA 2PR4L 4MX7A 2ENYA 4QT5A 4TRPL 4D9QD 4GRWE 5CMAA 3QIUA 4G7YH 4P9HC 3SDDA 3I2CH 1W72A 2IQ9L 2HAZA 4JFOA 4JFXB 3RI5K 5AYUH 5DRXB 1JCKA 5D1ZA 3I6GA 1GAFH 3BE1L 1JN6A 3UROR 1R5VB 3BRGC 3U0WL 3VJ6B 4HJGB 4GSDH 4QRRA 3WHE0 3PABA 1LDSA 4FN0A 5ISZE 2V7HA 3BD3A 2AVGA 4AH2B 5DT1L 2VXTH 4ESKA 1ZGLP 1YQVH 2Z92A 4FMFA 4FMKA 4JG0L 4ZO8A 4RZCA 4CKVX 2CK0L 4R3SB 3RGVB 2ATPB 3CH1A 1KPVB 4R2GD 1CYGA 2YC1A 1NAML 4OBSA 3GRWA 5EB9A 5CINL 3PQYD 4TSBL 3TO4D 2J8UE 4NKMA 4D8PA 3BT2H 4IMLB 2IALB 1BQLH 3TBWA 2EKJA 3CMOL 4R97C 5C7XH 4AG4H 1HDMA 3P40A 5J6HA 3GNML 1I1AB 4A2LA 1JGVL 3U46A 4KKAD 4QRPD 3MREA 4JFDE 4LCWE 2CD0A 2YD9A 5HYJB 5JORB 4M3JA 4P57A 3C5ZC 4OFPA 3U9UA 4HH8A 5MENE 1IL1A 1A7RL 1KC5H 3RBGA 4MD4B 1FORH 4X6DE 2R69L 3L3DA 3WFEL 1R5WA 3ESUF 1LD9A 3KYOB 2B1AH 1AO7E 4NNXB 3D0LB 3WN5B 2D4FA 2Z91A 1Z9MA 4HS8H 2I25N 4NZRL 1KNOB 3IDIB 4PB9L 1D3CA 1U8HB 3MMEA 3STZA 1D6VL 1ORSB 3DRQB 2P49B 1TQCC 2A6IA 3QG7L 3VG9B 1NAKL 3QXDB 3O2DH 2HN7B 1F90L 1UZ6F 1BQSA 2HYMA 2DBJA 4IS6A 5FUOH 4XH2B 3F58H 5GISH 4OIIH 4PJEB 2IMMA 4MDIB 3DMMC 3B4NA 2OMNA 5E9DE 3MV8A 2OM5A 4ZD3H 1UXSA 4H1LH 5F7UA 1BD2E 3G6JA 4PV8B 3IU4L 1OAUL 1D5BB 3VRJA 1U8PA 3TM6A 5J7CC 5MEQA 5D1XC 3GMLB 3HG1B 3RIFK 4N90D 4ORZC 1NKOA 3H0TB 2CR3A 3MGTA 5DFVC 4P59L 1AGDA 2ZSWA 4PJHA 1ZHBA 3CAFA 3MLRH 2F54E 4PRHB 5EUOF 3U1SL 3BESR 4WW2C 2NPLX 2UWEA 1TJHH 1DSFH 1LP9E 1KLUA 5JW3L 5FO8A 3CFKA 4IJ3B 4KI5C 5D72H 3FQUB 1YEEL 4WUUE 1GJIA 3NA9H 4O2EA 3VI4E 4G43A 3EO9H 3MRPA 4LVNB 2EH7L 4CVWA 1UKSA 2Y4SA 3HLAB 3WL9B 1C1EH 1TETL 1QSZA 4U1NB 2FSEA 5I1CH 1FHGA 1DBJH 4KQ4L 1A7OL 4OCRL 4R90H 5I76A 3OKLA 2IG2L 2CDGA 3RTQD 4F57L 1E4WH 4X7CC 1NC2D 1FFRA 4D0BA 1V7NH 2NY2C 3E2HC 4F33A 2B7DT 4YBLB 4F7MB 5J0BA 3GMOB 4JHWL 1PD6A 3CDCA 4P23D 1P7QB 3SGEH 2DLHA 2H2SC 3U7WH 2FATH 3KWWA 4JVUA 4X7FC 1CD0A 5E00B 1ZT7B 1N6QL 2VN7A 5F7YC 1C5DA 1YEFL 4DZ8A 2C4XA 4OZGF 2HT4C 3PNWA 2B2XL 1BIIB 1VGKB 4LPTA 4MJID 1CXHA 1L0QA 4UV4H 5E8OA 1C8PA 4V2BA 2HH0H 4GKNA 5DK3A 4TSAH 2Q76A 3GSVB 3GDBA 3FAXA 5JQ6L 4PG9B 4HUWB 1FYTA 1YN7A 2XG4A 2JJWA 4GW5B 1J10A 5IUSA 1IAKA 1KJ2L 2ITDB 2N4IA 5B4MD 4OSUL 2I07B 3EYUH 5E2WL 3S6CA 1D5IH 2A6KA 4XWOC 4M1GH 5D7IB 5L0QC 1OAZH 2AJVH 1NSNH 4XNXL 5E4EC 3H9HB 1D7FA 1HYRC 4M9OA 3UYRH 2X70A 2GJ6D 2ESVD 2DQEL 4XMKL 4N1EA 3NVQA 4JM2A 1A1NA 2H45A 5GZOD 2UYLA 1A4JA 1YYLH 3T4YA 3MV9A 2BVPB 3V4UH 2Z8VC 3GK8L 1SQ2N 5CILH 4OGZA 3GSUB 4UOW0 1CLYL 1A0QL 2CDFB 1IEHA 3DV4A 5CGMA 4M4PA 1XGUA 2XOTA 2V5SA 4XPBL 1KPRA 1F4AA 1R6VA 2XY1A 3HMWH 3CU7A 1YEGH 1A47A 3QIBB 7FABH 1X5AA 5ICXB 3QEQA 2Y07H 3VFRA 1ES0A 1KCRH 4BH7A 3ZKNC 5D93C 1ZHLB 2HT3C 3SDYL 2XI9A 5GGTL 4L8CA 1EZVY 3BO8A 4R4FL 4KKNA 2NQCA 1WIPA 4N8CH 3C60C 1PX3A 3DSFH 4U1KB 5IB3A 3VFGL 1EFXD 1HHKB 4WY7L 1HINL 3ARFB 3SCMD 1S7SB 2MJWA 4I2XB 1U2CA 3QCVH 3FONA 5DRZA 3OHXB 2QJDA 3S8WA 4JFQA 2IAMC 4ONGH 5DQDL 2H8PB 1KXTB 4YZFF 3SJVB 3VFOB 3WSQH 1FNEB 3FJTA 1JPTH 4IIQC 4YHKL 3I6KB 3WNLA 5CEYB 5TPWL 2X4UB 1H5BC 4EN3B 5F9JB 3VRIA 5LJYH 1INDH 2EDJA 1AGFB 1T03L 2XIDA 2X4SA 2V2XB 1ZS8A 2NTFB 2DLFH 4LVOB 1DQLL 5IW1A 1QSFD 3V5KA 1MVFA 1QLEH 4IOSD 2DQHL 4EJ1C 5BS0E 4X6BB 3ZYJA 2H2PC 5H37H 1SEBB 1JV5A 5H94B 3BKMH 3VW3H 2IPUG 4GRWB 3O8XA 2MPAH 4U33A 1WT5C 6FABL 1T0NB 5GRUL 3SKJL 3C5ZB 5EU3B 2IGFH 2YPVL 4JZOB 3HB3D 1EK3A 4LSPL 3PDOB 4CN6A 5EZIL 4FQXB 4YEEA 4EI5A 5EOQL 2W65A 1JPSH 1B0RB 1A3RH 4GKOA 5EOCH 5FB8A 3RUGE 4E5XA 3O3AB 5ISZB 3CD4A 4HUXB 1KBGL 1ZV5A 3L3JA 4Z76B 1KENH 1F2XK 3RGVD 3LKOA 4Z7VB 3ZE0F 2K7PA 2I9LA 2X4QA 3T08A 1CICB 2RBLA 3NZHL 4Z5RB 1KOAA 2BCKA 5KVDH 4PJGE 3L1OL 1T89C 4RDQF 1JPST 3BN9C 1TQCB 5LGHL 5BZDA 4PBXA 1JHKL 1T2QL 2EO1A 3P73B 1QSEA 3QUZA 1Q9KA 4KUCF 1Q9OA 4R7NB 5TF1L 3U83A 3K7UA 1I1AD 2WWMD 3DMMB 3FT3A 4BM7A 4LLWA 4KRPC 4OLWH 5GGSA 1GGIL 1MCWW 4P2RE 3W9EB 5HYJD 3BDYH 1JYXA 5B8CA 3OKOB 1Z9SA 4IHOA 4PJCF 1ZKAA 1T1ZA 3B43A 4IOIA 1F4WH 1W0WA 4S1RH 4OLZL 4PJAA 1V3MA 2AGJH 3RX5A 2VWEE 1T0PB 2KPNA 2KQMA 4HK0B 4LHUA 4XVJL 3UTQA 4X6DB 3KPQA 2FZ3B 1QPPA 1RK0A 4XPGL 3U7YL 1NGWA 5C0FB 5DZOA 3MRCB 4M48H 1KJVB 4U0RC 4NQVB 5D6CA 4GW1B 1HH6A 4WGVB 3DYPA 2RFXA 5DMKA 4JPKL 4MLSA 3K2MC 3V0WL 4P2QE 5HHOB 4D3CH 1AHWB 1MJ8H 1Q38A 4PGBA 4MMZC 3BIBX 1HH9B 1YY8B 3JV4A 5LXGL 1EXUB 5GJSL 2V2WA 5BZWA 5ITBL 1KJMB 4JQIH 4B53A 2VQUA 1KEML 1PG7L 3E2HB 4I0PB 4OGYL 4X4XA 4GRLD 1F02I 3QIWB 1DLFL 4HC1H 1UB5A 4OGXH 1JZ3A 1XCTA 1N8ZA 1L7IL 1QZ1A 3BQUA 4MNGA 1ZHNB 3IKCB 4HCRL 5HGGS 2FIKA 1FNSL 1S5HA 1HI6A 1T1YB 3EJYD 3LKPB 1JWSA 1X44A 4PRNB 1A6PA 1KJ3H 2VWEC 5CBAB 4DN3L 2DM4A 3FO9B 3HI1B 4PRHD 1MCEA 1RPQA 2JCCB 2IH3B 5ESVB 2QBWA 2F54B 3LRSA 3OB0K 5GGVH 1OSPH 4YBQC 2X4TA 2IF7A 4CNIA 3B5HA 5D4QA 3RZCA 1AQKL 4K3JH 4JZNA 3ULUD 3OB0H 4WUUB 5ETUB 4Y2DC 1T21B 1SY6L 5JPMB 4NQDB 1IAII 2QKIA 5L0QB 4QOKB 3SGDI 2FO4A 2OK0H 3AUVA 4MJ6B 2M1KA 4MNQE 3MTRA 1EHLH 4ODWA 3MACL 3X11A 5JPNB 3O41B 4FFVD 4JFYB 2AERT 5TFSL 1MIEH 3SDAA 1RZKL 3OAZH 1DBAL 1P7QD 2XA8L 1TLKA 3LSOA 5MEOB 1HE7A 2X1QA 3QQNA 4LNVA 1VFOA 2Z9TA 3VWJC 2FJHB 4NJ9L 2VLRE 4BFIB 4P3CL 4NN7C 1NH6A 1U3ZA 3D39B 1QHPA 3RIAK 2DWDA 5JTWA 1P2CA 1EUUA 3TNNB 3AVEA 4TULH 2Q3AA 5EZOL 5GRJL 5C6WH 5EC1B 1WZ1H 1YC7A 2D7MA 3ECBA 3H42H 1BF2A 2J6EA 1B0GB 4KDTC 4DFHA 4PGZA 4KMLB 3EYQD 3CSYA 5SX4H 4ZS6D 1JNLH 1LO2H 1QFOA 5D93B 1RZ8B 4FG6D 5E99H 3VXPB 1N64L 1NGQH 3VI3E 1HQRB 1F4YL 3P0VL 5E1AB 1T4KB 2DI7A 3MLWH 3C60B 5CEZD 4H20L 4PJ9B 4PJXA 1MCNA 4GAYB 3W9DA 1TVHA 3ZO0A 3D3VE 1NBVL 1A21A 2VABB 4WI3A 4KRNA 5B38G 3MRJA 4KRLB 5GGRA 2YZ1A 2IAMB 5AZEH 3CDFA 4AMKH 1FNHA 3KJ4C 2UZIL 4YDLC 1CLZH 3VFPA 4IIQB 1KYOK 3QUMH 1X4YA 1H5BB 1MPAL 4OCWH 1PQZB 4XVUC 3TYFA 1ZK9A 4PTTB 1AD0B 1NGZB 4YE4H 3SOBL 3PWUA 3QIBD 4WW1A 1QEWB 5IEHB 1FGNL 1J8HE 2H1PH 2FJFB 2YK1H 2P8MB 3HRPA 4F2MB 4LSRH 1JL8A 3TH4T 3TEUA 1RK1B 3OXRA 3KXFB 5I19H 2DD8H 1G7MB 3O3BB 2Q1EA 2E7BA 1MHEB 1HHGB 1AFVL 3ARFD 3RY4A 4Z7UB 5GRXG 1PDKA 4QXGH 3BI9X 1DUZB 1WC7A 3MRGA 3LZFL 3RNKB 4M8VA 3Q48A 1N4XH 2Z0BA 1DFBH 1A6VL 1I7ZB 2OR9H 2HWZL 2AK4A 5FA4A 4EN3D 2WUCL 2AEWA 4YWGL 1UT9A 4HS3A 5J1TC 2DTML 4N0CC 5C3TA 4R96A 4NQSA 2EXWC 2X4OA 1IILE 4DZBB 5BVJB 3O6LL 4XP5L 2G5BA 5AD0B 4LEOB 2GJJA 4Z8FH 3BXNB 4ZSOA 5D71L 4D0DA 4KJPC 3UTSE 2XZAH 4TVPL 1I4FA 2FWOB 2J4WH 3MXVH 4EUPH 4UT7L 1JNHA 4TUOB 4H0IA 3GSNH 4FQCL 1BFVL 4Z6AT 4RCAA 4C57C 5BS0B 4BFGA 3VU2A 5I66B 5CSZB 2KZ1B 3SDXE 3WEXA 3MV7E 3QP3A 4PJFF 4L9DA 4KRPB 3RAJL 3VA6A 1HHHB 4GKZB 3FRPA 5HHXH 1F42A 1SBBA 2XQBL 4G6KL 3OQ3B 3QNXB 4I48A 3C5ZD 5JOFB 2WLYA 1U6AL 4P46B 4O9HL 3O9WA 4FQXD 4M7KH 4PJDF 1BZ9A 1D5XB 3BKYH 4KY1L 5GS2H 3IDMB 2IPKB 1OOAA 4ZFGL 5C07B 5ISZD 4GXVH 4BFEA 3RUGB 4M5ZL 4Y4KB 1WBZA 2VR5A 4EDXA 3JTTA 2AJ3A 3R0MA 5K9QG 4U0RB 4KVCL 4YQXH 1CICD 3V0AC 4X99A 4ZUSA 2HVJB 5I18H 4O51B 4X7TA 2M8XA 3PWVA 3SGEI 3QCUH 2XXCB 4LLUB 2PF6A 4X4ME 3TVMC 2ADJA 3NABH 5ESQA 1WCBB 4A6YA 1NCNA 1O5DT 4KPHH 5C8JA 4J8RA 3GBNL 5J89A 4M3KB 3ES6A 5T5NF 4PV9A 1VFBA 2CKBL 2V2TA 3DMMD 1A6WL 4YO0A 3TIDA 4TPRH 2F8OA 4ELMF 3PWPB 1A3LH 4XNQA 3L7FA 3SBWA 2YD7A 1N5YH 3QZWA 3FN9A 3LDBC 3P4NA 2PO6A 5HYQB 4NGHL 5EN2B 1ZT1A 3SPVB 4I9WD 3GJFK 4JKWA 1I3RB 4UV7L 1U3JA 5DFVD 2WZPD 4IDJL 1CXKA 3WFCL 3VXNB 1CDIA 3ULSA 2DJ4A 5DSCA 4QXWA 3GJFH 2KUTA 2C7UA 5EWIH 3FO0H 4X5XB 2AKRA 3PHSA 2EDEA 2EDBA 1FGVL 1IBGH 4LRIA 1I3GL 1T80A 1NBYB 4QLRA 5D6DA 1MNUH 3RVTC 3CXDL 1OGTB 4KI5D 4S1SH 5EUOA 4FP8L 3O4LB 1RUKL 4X9FA 3WKMH 4YHIB 4GQ9L 1IC4L 1QYGH 5D5MB 4H8WC 1CQYA 1MFBL 2VDML 3PP4L 3OJDA 2ZCKL 4PJBB 4HIEA 3FRUB 5GS0C 4P2OC 1YEKH 4K7FB 4NUJA 3BW9A 5JHDB 4LGPB 2V9RA 1EEYB 4N9GA 5C6TL 2FX8L 1XEDA 3WNNA 5J1AA 4ODXA 2WBKA 1PLGH 3GBLA 1T7YA 3ZE2F 3QIWD 5A1AA 5EUKB 3IFLH 4NOBA 5E9DD 1U92B 4YK4C 4J3TA 5L9DH 1QPXA 5GZNC 2H2SD 5IB2B 4O58H 5CEXA 2A6DA 3UO1H 1QRNE 3VWJB 4JKKA 4K3EH 5DRNA 5IB5B 2HT4D 4YPJA 4G8FB 4W6WB 1M7IB 3WXVH 3RVWC 5GJTL 5I15H 1QBML 1A64A 4WWKB 1RZ7L 2EKSB 2F54D 4PP1D 3DBXB 4RMUA 1XH3B 1FVDB 4OLYL 4OZGA 2QQLH 1HILA 1CFQB 1DVFC 1A2YB 4I77H 2Q86A 5C0RL 2Q7NA 4OI9A 3K4AA 5F7LB 1IM3B 4JZJC 2FJGA 3F7RA 1U3HC 4WUUD 4XWOD 3KYNB 4NQDD 4POYA 5HSFA 1FFOB 1WQVT 4QOKD 4U6HB 3ELAT 1AE6H 1RQ5A 5EFIA 4NCC1 3ARPA 4ZFOB 4JB9H 4LBEB 4XHQA 1XGQB 1NCBL 3RNQB 4OV5B 4NZUL 4KGLA 3K8KA 1O7SA 5D7KD 3KPSE 1JPFA 2X2YA 3S4SB 2R2HA 1LDPL 2W0KA 4B0MM 4PY7B 3ILQC 4DOHE 3KJ4B 1UACL 4TQEH 4YDLB 1KTDB 1Q9LB 4I4WA 4XVSH 1LEGB 4LKXA 4PJEF 5CJQH 1SJEB 2EYRA 4EI6A 1TCRA 2VLRB 2VDKH 3D39D 4Y4HC 1MCKA 2AJZA 2BVUA 1XF3A 4RGNE 3LKQB 3MZGB 1NFDA 2RHEA 4U1JA 4WO4A 5DO2C 1ZANH 2W91A 5DVLA 4GBXA 2QHRL 3C8KA 3G5XA 4LAJH 1PFCA 2DL9A 3ZKND 5IV2B 2HT3D 2VH5H 3ARVA 4PGDA 3PWLA 3IJHA 2GSGB 5T3ZD 1FFNA 5DQ9A 3C60D 2FEEL 3GSQA 1MFAH 4K94L 3P4OB 3ARDC 5GRZA 1UH3A 3BHBB 1AGCA 4MXQD 4MD5A 5JMOC 2O5YL 4K8RL 1Q0YL 1FAIL 4OFIA 4POZC 4CADB 3B8YA 2JELL 3ULUF 3OKKA 5TDNA 5I2IB 4MAUL 2XWBA 3FB8A 4BSJA 2IAMD 3SGKA 3PGFL 1YJDL 5IJKC 5DS8A 3HPJB 4UILL 4ZPTB 2V5MA 1A9EB 3FHAA 1CFSB 1RU9H 4JO2H 1X7QB 2Q7YA 3ZDZE 2JB5L 2PW2A 3SE8H 2V9QA 4O00A 3HRZA 5D2NB 4WDIA 4EDWH 4OD3L 3TT1L 4WIQA 1BECA 3DX9A 4KK5C 5C9JB 1ZA6A 4LF3A 3T2NL 2J1KA 5B21A 3DUSB 3CVIH 4RGNC 3AS1A 1DQDL 1NEZG 3NMEA 5FCUL 2R0ZL 1LNUB 1X5JA 3DV6B 3HC0A 4P0DA 1IFHH 5GSVA 1A02N 1CE6A 2H2PD 3TJHC 1S7VA 1B2WH 1QFUL 1VGEH 4DVBB 4L5FH 5C0CE 3EFDH 3THMH 1OF2A 1LE5B 1U8JA 1YEDB 3OB8A 3V52L 4WTXA 1NAMB 3OR6A 4MNHB 1FLTX 1S7RA 2A77H 5D7LA 1NMBH 4HG4K 1JVKA 4QNPF 2E5EA 4HWEL 1QFWL 5F1NA 4DGVH 5D7IF 4HBCL 2EDNA 3BPCB 4XNYH 2E9BA 2VXSL 2WP3O 4P5MA 3VXSA 4HS6B 5F1KC 2AJYH 1BBDL 3DVNB 2NW3A 2VDPL 3AXLB 5DJAB 5C6PB 3DETC 2I9TA 2NR6C 1KCVH 5INCA 1VA9A 4IOFD 5TJWK 3BN9D 3TBYB 4L9LC 5C0BE 3TVMB 1G7HA 4U1HA 1BQHA 1O7VA 5C0EB 5EU4B 1QVOA 4L3AA 1NLBH 3OPZL 2BY3A 3QJFA 5BS0D 5EIIB 4ODVL 1CFVH 5BVPL 4YXKL 4KRPD 4LEXH 1MCRA 4XP9L 3MV7B 4RFEA 5DJXB 4QRQA 3QDJB 3GMRB 4YR6A 1J12A 4KV5F 4P46D 3VXTA 4XTRC 3MUGA 2D31A 5IROC 5LCVH 3G6AA 3HI6H 5FYLL 4Y16C 3U4AA 3AMKA 3NCYS 2F5BL 2H32B 3HZMA 2H3NB 5C07D 4N0UA 4MCYB 2IPTL 5FDWB 3LH2H 5CZVL 2A9ML 2CIIA 2BVTA 4AL8H 3CSGA 1JZ8A 3DVFA 4L4VB 2ZOKB 1RUML 4JANB 4X4YB 3LS5H 1G6RA 4H0GA 3ZL4L 4HXBH 4BUHA 5C86A 1RUAH 4ZUTA 3BSZL 2R1XB 4UI2A 4H25B 1EEZB 4OLVL 5F88B 5ILTH 1GCFA 4TRPH 3OKYA 3PWPD 5HYFA 4LLDB 3NGBB 1BBJB 3WUWG 4WEBL 4LASL 3ZYIA 5E6IA 4Y5YB 1BVZA 2DQCL 2XQYK 2DIJA 1L4IA 2Z4QB 4UTAL 5SX4I 3QJHA 3BPOB 5DK2B 3PQYA 1MREL 3DTXB 1MCLA 3IDNA 4GRWF 3O0RL 1UXWB 3FQXA 4N0FA 4JG0H 2VO5A 2BOBA 4L3EB 3OAYK 4OCSL 3RVUC 1LO5B 4YBQD 1DVFB 1SJVA 4QRPA 3LB6C 3GUTB 4LRNH 2BSTA 5E5MA 5ANME 5IFAL 4X7DC 1RULL 4HFWA 3LV3B 3O4LD 1KIQA 4JZJB 4WUKL 1LO4L 2WIIA 4Q74A 4Y2DD 5B3JE 1A22B 2Q8AL 3HC4H 4FXGA 3TT3L 4UINH 1PYWA 3MBEA 5IQ9B 5JHDD 4Z7VF 5EBMA 2OL3A 4PRIA 3BJ91 3CC5B 4MDJA 1EHAA 5DJ8A 1I75A 1WISA 1KJ2B 2WBJC 3G08B 1I8KB 4MWFA 5CGYD 1E4JA 1RIHL 4GG8B 1A7RH 1FH5L 3GIVA 3VWJD 2R69H 2QQQA 1DBML 5EU6A 3IYLW 2WIMA 4Y4HB 5IM7B 43CAB 4TUJA 3RKPA 4BH8B 1EGJL 4NZRH 2EC9U 4WVRA 3QEHA 1RZKC 3OJ2C 1VHPA 4M6NH 3IFOB 3NCEB 3W0WE 4RNRA 1D6VH 4JKPL 3FB5B 4X6DF 2R0KH 1PY9A 4TNVK 1R3HB 5LAXA 1AR1C 1ZA3A 3TO2B 1T0MB 3QUYA 2YRPA 3D85B 3FO1A 1FE8L 1D6EA 4KI5F 3QWOA 3OZ9L 5C0AE 2F58L 3R1GH 4DGYL 3LKNB 1H9VA 5I1AB 2DJSA 4JY5L 3BD4A 3CVHL 4GT7A 4WI5A 4M43H 3VXME 5HHQB 2MQ3A 3B6SA 4PJHE 5CP7B 2DWEA 1YEHH 3TPKA 4UIMB 2UWEE 3GMQA 4OIBA 2XTLA 1MJJB 1P7KB 4OZFG 4OZ4B 3ARGB 3WIHA 2VLRD 4JDVA 5E8DL 4XVUD 1TXKA 4V1DB 1U8OB 3SY0B 3VH8G 3UXFA 1NC2A 4NO3A 5JW3H 3IVKA 1FZOA 1SEQH 5T1MB 5F9DC 5T5FH 3S34H 1VEOA 1OD7A 4UNVA 4P23A 4X6CB 1U8QA 2Y7QB 4K3GA 4OCRH 1V7ML 1A7OH 2GAZB 4WWID 2XNAA 4HGKC 3UBXA 4L4TE 5HYSG 4FNLH 3H9SE 5I9QC 3C5SB 4UUJA 1XAUA 3SQOL 4F7TB 4OKDA 4TVPE 3D3VD 4JHWH 3R8QA 3REVB 5BQ7A 4MA3B 1M7XA 4CW1B 5KZCB 4LNRA 3DGGA 3REWB 1J1OL 1ZEAH 3BYTA 4Y8DC 5KSBE 1YEFH 2PTTA 2EC9T 5FGCB 3QG6B 4FQHB 4OLXH 4N0CD 3UZQA 3HE7B 4F9LC 1NQBA 2NX5A 3IDUA 2LAGB 1MHHB 3BZFA 3P77B 3WDHA 2GJ6A 1IGYA 3RWHB 4L9LB 5EOTA 3T4AA 5J6GB 1OP5K 5GGQL 5SWSA 3WDIA 4KJPD 3OXSB 1NCWL 2FD6H 2ICWI 1MRDL 5SX5K 5F44A 1PY4A 3T1FA 5C3LD 3EDFA 5I17B 4OSUH 5MI0B 1BFSA 1OP5H 2YN3A 1J8HD 1FYHB 4MD0A 5EOCJ 4NC0B 4WI9A 2LVCA 5SX5H 1C16A 5IKCB 5C0CB 4ZG1A 1GZQA 1MQKL 5HGAA 1IRAY 3SKOA 4O5LH 5FAAA 1BAFL 2GTWA 1JHTA 3K1KC 1L9NA 5HGBB 1ZVSA 1NDGA 2DQEH 4HK3N 3HAEA 4PJFA 5EO0B 5I73C 2FIRT 4RQQA 3V6ZB 1KULA 1QA9B 2G75A 1DCLA 1H8OA 4RGOL 4GAGL 1G9EA 4YDVA 5C9KA 1WIOA 4EVNB 4LKCA 3NIGF 4JKLA 5CIPB 2NXZB 4PJDA 4OBRA 1NCCH 1UA6L 4JN2B 1CDCA 5DMIL 4ZUWA 1J1XH 4WEUD 5T1DL 3HNTH 3I6LE 1IC1A 2VJXA 4LAQH 4LSQL 5K93A 3BGMB 1YNKH 4ZO7A 1G0XA 1EAPA 4OF7A 3CLEL 2N56A 4ZXBC 5D1QB 3TVMD 2AI0L 1QO3B 3EHBC 1GZPB 4MSWA 4WI2A 5ACZB 4YXLH 3BKJH 3GJEA 5DD1H 4RRPA 3PIQA 1N26A 5GGTH 2IJ0C 1YPZE 3FFDB 1LE9A 2W9EH 4YAQA 1SBSL 1FL6B 1I1YB 2KDGA 3MV7D 1A7PH 4P5TB 5J13C 4YHPB 4WY7H 1IAMA 5IWLA 4ELMA 2D0FA 5JDSA 2CO6B 1K8IB 5I1LB 3LKRB 1P5VA 1XF2B 1QSFA 3G5ZB 3A67H 3BPLC 5IG7A 3H8NA 5DMGC 5E6ZA 2ORBH 1ACYH 2Z31A 4NWUH 4ZAKC 4EQ2A 5TDPB 1IM9B 1IQDA 1T1WA 1OY3B 1AKJA 3P4MB 1CT8B 3UAJC 1F4XH 3RVTD 2E27L 4XP4L 5FEBA 1FV1A 4Z7UF 1T03H 1JIBA 3HR6A 1N0XL 4K55A 2VSCA 2X4RB 2CJUL 4ZOEA 1AD9B 2GUOB 2HKFH 4NC1E 3VFSB 3O2WH 1R5VA 3VJ6A 4HZLB 3QXTA 1QNZH 4P2OD 3W11C 5GS0D 3T3ME 3T65A 1NC4A 2VXQH 2HKHL 2OP4H 4AH2A 1LEIB 1KPUB 1Z3GL 4I3SH 3BZ4B 4G5ZL 5IFHH 4LLVB 1H0DA 2A73B 4EEEA 1ZXQA 4HLZH 4DKDC 1M05B 6FABH 3RGVA 5GRUH 2G9HB 3SKNB 3SKJH 3RWEB 5GZND 3WS6A 1CDHA 4QKXB 4QHNA 3MFFB 5KW9L 5D9SB 2IBZX 1U2HA 1QLRA 2Q3ZA 4MJ5B 2IALA 3RVWD 5JW5B 4L3ED 2DTSA 5CBEB 3K46A 1DVFD 3QFJE 3BRFA 4R7DA 4R4BA 1N6UA 3IDJA 3ZDYE 3NZHH 5HYJA 5JORA 1BZ7A 1U3HD 5M7QA 5HTSA 5LGHH 5EBLA 2XZQH 4LLYA 2VITB 3U0TB 4NC1C 5DI8B 3RUGF 3VXOA 5FYJH 2A1WL 1SYVB 1LK3L 5T1LB 4EBQH 4NNXA 3D0LA 4P2CG 5IVXE 3QQ3B 2EDRA 5BW7C 1K8DB 3NIDE 4CL7A 4PJGF 2GITB 4ZUUB 1MCQA 1P4IL 4J23A 3FQNB 1U8HA 4FTVA 2YBRB 3TH3T 3QDME 4XVJH 4CVUA 3MOQA 5FXCH 4UU9B 3RL2B 1FSKB 3LD8B 4RIRA 4Y4HD 4QF1A 4HX1A 2V5RA 1IGML 4MHHG 3BZEA 2OSLA 1MWAH 1CZ8L 5IMLB 1OGAA 3IF1B 1L7TH 4MDIA 5IFJB 4Z0BH 3RHWF 1NUFA 1K9TA 4GRLA 2XT1B 4JRXB 1MELA 1G0DA 4OZHE 4A2MA 1RJYB 2BNRA 2B1HL 4JPKH 1Z0NA 2QSCL 3F7PC 3OGCB 4U1IA 2Y36H 2IFFL 5DYOB 4AEHH 4URTB 4G3YL 3QPXH 3G04B 1KSRA 1CGVA 5I9QB 1KB5A 4UAOC 3NCBB 2ERJC 4PJ5B 5DURB 5AZ2H 4POZD 4AENB 1ADQA 4PRHA 3LAFA 4N9OB 1KYOJ 3HPLA 5D5MF 3N06B 1WUNT 1WK0A 1UEYA 3FQUA 4HCRH 4PJBF 2V7NB 4YEFA 3RPKA 1TZHA 1FNSH 3VXMB 2VQ1B 1MEXH 2ILLA 4XPTH 5AG8A 3WL9A 4K94C 3TBSA 4KHXL 4U1NA 4XP6L 1CIUA 1MCOH 1PX4A 4K8RC 1T5XB 1U8LA 2DIBA 4V1DD 3UTTE 1JFQH 4RGND 3LHPH 4G42B 2JK5A 1T04A 1CLOL 4F7MA 2FX7H 1YJDC 1BJMA 3OTTA 5DUPH 3RL1B 3DI2B 1AQKH 3DURB 2RQ8A 3GMOA 2P43B 3PV6B 1BGXL 3TJHD 1EFQA 3NBNA 1P7QA 3IDYB 1Z0MA 1MI5E 4KTDL 1CXIA 4FFZH 5DJYA 2VDQL 5HI3C 2VLLB 3HZVA 5D70L 3H9SB 5I73B 3MLVL 3PP3K 2NY0C 2AJSH 5KZCD 4RFNC 5I8CB 1KT2A 2F15A 1YNTB 4GW5A 5BMFH 3SE4C 5A2FA 4C59B 4WU5B 4DQOL 3O3DA 3PP3H 2F8VA 3RDTC 4G80B 2I07A 4HWZB 5D96C 5C2BH 3KPPA 4QY8B 4WV1C 1IKFL 5KSBB 3QCTH 2CGRL 4NBZB 1TTFA 5D7IA 3B3IA 2VDNL 3DETD 2NR6D 3KPNB 3DX8B 4HJ0C 1WITA 3GO1H 4HFUH 1RZGB 5FYLE 2PCPB 5GRJH 5HPMB 5L2KB 3BUTA 2UUDK 4ZXBB 5JO5B 4XWGL 5F9AC 3GSNB 1BFOB 4K3DL 5ID1B 4L8SB 2BVPA 4XCYB 2UUDH 4K9EH 1WFUA 1Z6JT 5IVZB 3TBVA 4J1UB 3P0VH 1LWRA 3HC3H 4LCUB 5J12C 1VFAA 3CFJA 3GSUA 5C0CD 4NPYB 3ARBC 4KWUA 5J13B 1HSAA 1QR1B 4JPWL 4TOYL 3L95B 5C2UB 3PF2A 5ESAA 4EIZC 4Y5XC 5TQ0L 2KBGA 5E8EB 3ARZA 4HULB 2IADB 2FGZA 2XA3A 2OTWB 4GUPB 3QIBA 4ZAKB 2VLJE 3VI3F 5BCAA 3MRMB 1K2DB 5IF0B 4Z7OF 2JLLA 3RGHA 3MNWB 4QXUH 1NUGA 3IDGA 3DXAA 4PRAB 2VAAB 3GSOB 3QI9C 1AXTH 4JPVL 5DDHA 1KIRA 4LCIL 4NQCB 4U1KA 2R1YB 4KU1A 1UGNA 4RAUA 1S7UA 5D1QD 3PHQB 4U05A 2A83A 5C0BD 3EYOB 1RMFL 2ICWJ 3ME0A 2VISB 4N8VG 4HJJL 4HKXA 4NKOA 4PJ7B 2H8PA 2ZCLL 1FNEA 1Z5LA 2OCFD 1MH5A 3NIFE 4ODHL 3VXUB 5I74C 2XWJB 4NFDA 3QH3B 3DUUB 4P5TD 1MLBB 4PRPA 5F9JA 2DI9A 2PTUA 3OV6A 3RWJB 3V79C 3LQMA 4JM4H 4OM1H 5D7JC 2FBJL 4LCCC 1AQDB 3M1BA 5DFTA 5GHWH 3EYFA 2NY3C 4LARH 2CRZA 1F3RB 2ARJA 1AP2A 3RWIA 1IM9D 5ITFA 1GOFA 1A6VH 5DR5H 1SEBA 1KACB 4DWHA 5C0NC 4IRJC 4HQQL 4JE4B 1MJ7H 2ZUQC 5H94A 3RVUD 2VL4A 4KMQA 2BXYA 3EJZD 2D03L 2D2OA 5EA0H 3NH7L 3G5YB 2C4FU 1F97A 3BMWA 3TH2T 5CGTA 5KVEL 3N1PC 3C5ZA 3EKCA 2YA1A 4LSSL 2VDOH 3QQ9C 4TVPH 3KLHC 4O4YH 4X7EC 1B0RA 3GMMA 2DQGL 5ERWB 3O3AA 5ISZA 3JXAA 4XX1G 5F7FA 1NCDL 5IW6B 4G9DB 4Z76A 3PL6C 5B38B 2XZCH 2WBJD 4KC3B 1U6AH 4LLMB 2H9GA 3KYMB 1IC7L 4TSCH 1JWUB 4JFEB 3FMGL 3LKSA 1EJOL 5E08H 1MFCL 2HLAB 3IJYB 1RJLA 2J8UA 5DJ6A 3SDXF 1MF2H 3IB4A 3V9FA 1GGTA 3MLPA 2DBLH 3AREA 3CUPA 4PGJA 3VMPA 3PGCA 4RBPH 2DKUA 4XI5D 5CJXC 4JFDA 4LCWA 1INQA 3WLBB 1CCZA 2FO1A 5D1XA 1AR1D 1UZ6E 5MENA 5JR1L 3QWRD 4HK0A 5CJOL 4X6DA 3VWKB 4Q9RH 2FZ3A 4UAOB 2ERJB 3H3KA 2Y06H 5CD3B 2CKBH 1AO7A 3JV6B 4WW2A 2Z93B 4FQQA 5LBSL 3MRCA 5E8NB 4HDIB 3FCTA 5C09E 1F2QA 5FUCE 4JHZA 5EO1B 3CCHB 3ROOB 4NQVA 3PV7A 4MB4A 4JJHA 3ROLB 5E2UH 3P30L 5F1SA 1VSCA 2PXYC 1CGSH 1T3FB 1TCMA 3EZJB 1PBYA 4M7ZC 3KPLB 1HH9A 1YY8A 4X7SL 5HI4C 1NKRA 2E6QA 2I26N 3T1WA 2BP3A 4PPTA 1IT9L 3FOLB 5HVHC 4AEEA 1UJ3C 3W39A 3QRGL 4JRXD 5E9DA 3UJJL 4NN5B 4MS8C 3FB7A 3OX8A 4P4RB 1ZHNA 1BD2A 4C4KO 1QG3A 2N7AA 2ZNXA 1A6AB 2ZCKH 1K4CB 3TIEA 4CVZB 3LKPA 2GSIB 4N5UA 4PRNA 4FQ1L 5C0DA 5C6TH 2FX8H 3ORJA 4PJ5D 1EH9A 5DURD 3HI1A 3QULA 3L5WB 4OTXL 2F54A 1KCKA 2APBA 3DHJA 4XNMA 1IGIL 1Y0LB 5IB4A 1NCAL 4RX4A 1LP9A 5SWQA 2DDQL 1JMXA 5FUCC 1WF5A 3VXMD 2P8LB 3RDTB 1I8LC 5D96B 1T1XB 4WUUA 5ETUA 4F58L 3ARXA 5KSAC 5JPMA 1N59A 3WS3B 3FQWB 1FO0B 2AW2A 3GHBH 5K9JL 3MLSL 5KAQG 3DRTA 1OM3L 2OR8A 2A9NH 4MJ6A 1KCLA 4LL9A 2W0FB 1FIGL 4LPXA 2LAAA 5IESH 3VGDA 3C5JB 3MLYH 1X3DA 5TQ2H 4HIHB 5JPNA 5DA4A 2DQUL 1X9QA 1N2RB 3QO1A 2DLGA 4XAWH 4EUPA 4YHYC 1HHIB 2F53B 2ZG2A 1U36A 2QHLA 1JGEA 4HMCA 4JPIB 1JWMB 4HG4J 2BSED 4Z78B 1MI5B 3ARBB 5T3XH 2HRPH 3RPIA 2EDDA 1KCUL 3VCLB 1NCBH 3FT2A 4L3CA 4OQTA 3H9SD 4LSVH 4NZUH 3TNNA 5EC1A 4S1QH 2VSDA 1LDPH 4NQEB 5F7WC 4IRSC 2E9WA 1U91B 3QYCA 1UKQA 3G9AB 1G7IB 1BWMA 4DN4L 5IQ7L 4KTEL 2YA0A 3V6OE 4QTIH 1RZ8A 3MLUH 4P4KA 3VXPA 5I8OH 1BX2B 3QI9B 1T4KA 1I7RB 3N1MC 3C60A 2NNAB 3MJ7B 1A6TB 3OBAA 3TGXA 2HG5B 2C3HA 1VACB 5L2KD 3K3QA 1YMMB 1JTPA 4ZXBD 2X7LB 2VABA 3EHBD 3OKEB 4U3HA 1F58H 1IC5H 4AIXA 3CSBA 5EU5A 3GI8L 1B6DA 1JK8B 4YNYB 1LO0L 4XBGB 1TZIA 3NN8A 3PWJA 4OCYL 4DEPC 5DZLA 4JFFE 2FLBT 4XCFL 4IIQA 5I74B 1H5BA 5HXMA 3P0YH 2O5YH 3GKWL 1Q0YH 1WTGT 3ZHLA 2CLRB 5H2BB 2AJXL 1ZLSH 4L4JA 5GS2D 5TE6L 4HKZA 4UBDC 1NGZA 5BXFB 4X6CF 4XBEL 3V4PH 4JO3H 4G6JH 2NY3B 5DMGD 3MJ8B 3LQAH 4ZAKD 3U4BL 1OAYL 3EOAB 3IRZA 3FRPG 4IRJB 3UAJD 4EZMA 3TZVC 3HHRB 3V6OC 1A5FH 3HCVB 2VB5A 1NBZB 1RI8A 5HHNB 3GSXA 4NQCD 4UTBH 5IBUG 2J5LC 3S37X 1HKLH 1DQDH 1ORQA 5EPMB 5FCUH 5IMOA 2R0ZH 5CHNA 3ULUL 4Q9QH 4G7VH 1DUZA 3MCLL 3F12B 3VXRE 3B9VA 4YHLL 1TDQA 4U6YA 5GGSY 3RNKA 3MRIA 5E4IA 4M6OH 4RMWA 1GPOL 4PG2C 5D7LE 2Q20A 2ADIB 3DO7B 3VXUD 1NFKA 2XKSA 5K9KA 3MRRB 5FO9A 4NO2A 1R3IL 4K7PL 5CUSL 5E2VH 4P2YA 1RJZB 1ZOXA 3QO0A 3KR3L 8FABB 1FZKB 4WHTB 1T89A 2AJUL 4DZBA 5BVJA 3FO2B 3L5JA 4HWEH 3HFMH 1J0KA 3OAUL 1JBJA 4HWBA 5JIPA 1EJ6A 3WDJA 2P5EB 5IGXH 5B39A 3MLTA 3QZWG 5BS0A 4PLJC 1FPTL 4OUUB 3BEVA 4TN9A 5I66A 1C5BH 3ZE0E 2VDPH 3HE6C 2HTKD 4GXUN 1HN1A 1A1MA 5JOFA 5JA9A 4AEIL 2C9AA 3U4EB 3FN3A 4UDUA 2FCBA 5KG9B 3LEVL 4S1DC 1CG9A 2CSPA 1EX0A 3TJEH 3ZSSA 2CQVA 4PGCA 4ERSL 1XMWA 3IDMA 3MYZA 5CEZL 5J8OA 3KG5A 3RUGA 1YMHB 1MLCA 1RZJH 3CFCL 4P9ML 1X5GA 4U6VH 4XP9H 5HD8C 3HZKB 3CFBB 4R4NC 4PJCE 2J6EH 2HVJA 4S2SB 1CDYA 3IFNL 4IRZL 3P4LA 1S8DA 4LU5L 2HLFC 1JF1B 4C83B 4PJGA 4DK6A 2Y5TB 4HIIA 1K3ZA 2YD6A 1MFDL 3LRGA 3HR5B 5DWUL 1T5WB 1LK2A 2PYEB 1CLCA 4S0SD 3ZHDA 3ZTNL 5FYKU 2IPTH 3WO4C 1IGTA 5HJ3B 5HVHB 3V5HA 1G7QA 2MHAB 2Y6SD 2GK0B 1UJ3B 1NEZB 5JOEA 3BPNC 1SHMA 3CVHB 5GGUB 3C9NB 5FECB 4L8DB 4BQ9A 4P2RA 3DIFB 4I5BB 4KJYB 3EOTL 1I3RA 4K23L 1AGBA 5C0GA 2YN5A 4Z7WB 4XB7A 3TYGH 1A14H 1K6QL 3RWFB 2MCPL 1FBIH 4XGZA 4D9LL 3HNVH 1K3IA 3FHQA 4JFHE 3O4LA 1E6JL 3LIZL 3IDXL 1EAJA 1D9KC 4YHIA 3K81A 4Y2DA 2ADFL 2B20A 3DSNA 4FQIH 4K71B 1MQ8A 5D5MA 5KSAB 1P84K 3WFDH 5EORL 4PJBA 5C0JB 4QRPE 4P2QA 4JQXC 4K7FA 1VCAA 1BWWA 1RUQL 5JHDA 4JFPA 1G7JB 5IHLB 3PG2A 4OCSH 1GL4B 2CMRL 2OI9C 1G9ML 5FO7A 4HKBB 1A6UH 4WUKH 3KLDA 4L8BA 5D8JL 3NFSL 3UP1A 5J9PA 1F6AB 1FNGA 3P9MB 2Q8AH 3F7VA 5BV7H 2ARJQ 4JG1L 1CFTB 3VWJA 5L2JB 1YNLH 5IB5A 5HI3D 1GGBH 5FGSA 1JUFB 3VGHA 1SM3L 2Y9RT 4R2GC 5HDOA 3B5TA 1S9XA 1TVDA 3GMPA 3KYKL 2FECI 2NY0D 4BZ1H 5EU7C 3VDAA 2P8PA 4IRSB 2H6PA 5FYKL 4FQ2H 4JRYB 5TH2B 3TO4C 1RIHH 3D69B 1FH5H 3QIUC 3RDTD 3HMXL 3IETB 3H9YA 3PJSB 5D1ZC 2RIKA 4OJFL 4HJ0D 3WHE1 4F7CB 1I9RL 1V3LA 4LBEA 4MNQA 3TLRA 1JRHL 5C08B 5FM5O 1YECL 2V5YA 1OCWL 4N90E 3BIAX 3MRQA 2X89A 3S4SA 2F74B 1G9NL 3BP7A 4JKPH 4OT1L 2F53D 4PY7A 5E95B 4DEPB 1U8KA 2VL5A 5FF6A 2YPKA 4FZEL 2G60H 4V2CB 1BVKA 1MI5D 3ARBD 1EBAA 5CSBA 3GHEL 1BOGB 5C70A 5FKPB 2VLRA 3WUWB 5FHBH 3ZT6A 3MRDA 2F58H 5GQBA 4DGYH 5ID0B 3FQTA 4HIJB 4M93C 3VGAB 4MJ4A 4J3VA 4NNPH 3QA3B 3QXVA 2NY7L 4KGJA 1WWAX 1S3KL 2M2DA 3VGEA 1FLRH 4A6YH 5IV2A 4C56E 1QKZL 3BZDA 4PRBA 3TZVB 4NHCH 1YUHB 5J1SC 3CFDA 2Z35B 4LP5A 3QI9D 4HD9A 1NMAH 2MTPA 3E8UL 2DYPB 5E8DH 3BHBA 2J5LB 3T0BA 2G5RA 3IKKA 1X5IA 2JF1A 3ZKMC 1P1ZA 1YY9C 5INDB 1YMMD 5BOPA 4YH6A 3VFNA 4M6AA 2DQJL 4YFDB 3D3VA 3PWNB 2R9HC 4DTGH 5I2IA 3QUXC 4EOWH 3AB0C 1RVFL 2XV6B 3V0VB 1WICA 1IGFH 4MJIE 1LEKB 4JRWA 3S88L 5FOBB 3S96B 4LSUL 3L3KA 4MXVF 2UZXB 2VDRH 3QXAB 4W4NA 1DBKL 2WAHA 5C9JA 5F6IC 1DUYA 2O5XL 3B8SA 3IT8D 4XCEB 4DKFL 5D7JD 5IHUL 5F93C 3QFDB 3QHFL 3C6SB 2F19L 4NRZB 2NY3D 4W68A 5DJCB 2BVOA 1RURL 1LHZA 2EDQA 1I7UA 4FZ8L 1OT1A 5C0ND 3WE6B 1BM3L 4IRJD 1MCDA 1NEUA 2CK2A 4XRCB 2GJ6E 2ESVE 1J8HA 3RTQC 4XPHL 1ED3B 3HE6B 4RAVA 1H3PL 4LMQI 3JWOH 3L6FB 4PJ8A 3BP4A 3TV3L 4ODUB 2EE9A 2V17L 1NAMA 1OL0A 3BP6B 4MNHA 3ARWA 3X3FL 2NY1B 1XR8A 1YDPB 2VOTA 3LQZA 5DHVB 3F65A 3QQ9D 4XC3H 4YX2H 4GMTL 4AT6A 1NCWH 1CBVL 1S7QB 4U1SA 3RVXC 4J6RL 5FA3B 5KSBF 2C1OA 3NCJL 2F5AH 2EDWA 4PJFE 3BPCA 4OZIB 3M17A 3C2AH 5F97E 3IFPB 1JTTA 3PL6D 1A4KA 2E6PA 3AXLA 4XT1C 4MB3A 5ADOL 1KN4H 2VXVH 4MVBD 2ZOLB 5ALCL 3MOAL 2B4CH 3X12B 1I1FA 3V4VL 3BWUC 1SJHA 5IB1A 4RGOH 3TVMA 4X83A 5DTFA 5EU4A 3DVGB 4OZFB 1MCJA 5JXED 3Q1SL 3UTSA 3WO4B 2P5ED 1UA6H 4UDTB 3HUJE 3VH8B 5DQJA 1DDHA 4HF5L 4Y5VA 3MNZB 3BPNB 3MRKB 3V7AE 3SDXA 1CGWA 2NY5H 3MV7A 4FHBD 2MFNA 4ZOCA 5F89B 3RWGA 3VRLF 4FQJL 4PRDA 2FX9L 4JO1L 4X98B 3CLEH 3VDCA 4Y8AA 1XIWC 3CPLA 2IANB 2YS4A 1DBBH 1NFIA 4U1LB 1S7TA 1WCQA 2HP4A 5DRWB 4ONFL 1YEJH 2W9DL 4HV8A 3CMGA 2ZG3A 2R0LL 3Q0HA 1PKQB 3VXQA 3VFTB 2H3NA 4MCYA 4KKLC 1WWCA 5T3ZL 5HYSB 5FDWA 1SBSH 3MRLA 2BXZA 4NNYA 1HXYB 1N5AB 4OF0A 1OSZB 4I3GA 3E3QE 3C09C 4JANA 4X4YA 2O26U 1D9KB 2BC4B 1FZJB 4PJ7F 3TCLA 4YHOL 4XXDB 3RKDC 2PYED 1MWAB 2XPGB 4P2OA 4X4MA 5SWZE 4X5LA 1YPZF 1EEZA 5HI4D 2IMNA 5F88A 2D0HA 4CU8A 5ICZB 3CH8A 2FR4A 3UJTH 5JLZB 2OI9B 2FDBP 4WU7A 1BBJA 3NFNB 3QR2A 2DF3A 5M94B 2CJUH 3D6GA 3CDGB 4UOW1 4CJ0A 4GMSH 4AQOA 4ODTL 5DC0A 3GIZH 1ZTXL 1UQSB 4XVTH 3LS4L 1WAAE 3DTXA 3ESVF 4OFVA 4ZS7H 4Q97A 1T20B 2IBZY 1AIFB 5MERB 4HGWB 1SMAA 5F3HA 3ZE2E 3WCYA 5I1HL 3BWAA 3KS0J 1NDMA 1R3LA 4RA3A 3GUTA 1WIUA 1IE5A 3GB7A 3O6KH 4QT5B 4WFGD 2CRMA 3QIUB 1OAXH 1U3HA 3E3QC 4ORGB 3U30C 1T2JA 1ULVA 3SO3C 4Z18A 3SDDB 1W72B 1I9JH 5EC2B 1CF8L 3T3MF 1HXMA 2AQ2A 4JFOB 5KSAD 5A43C 1RUPH 2VERN 3TNMB 3GSWB 4Z77A 1U42A 1OARH 5D1ZB 3AMLA 1I7TA 4R26L 4ZTOL 2R8SH 2VR4A 1P6AB 1BMGA 3C08H 4Y19E 3ZT5A 4WTZG 2COQA 2BZDA 3PABB 1CE1H 2D0GA 4RFOH 4D2NA 1NGYA 4X8JA 1KJ2A 5E0QA 4EIGB