2BFVH

Monoclonal antibody fragment fv4155 from e. coli
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
b'QVQLQESGGGLVNLGGSMTLSCVASGFTFNTYYMSWVRQTPEKTLELVAAINSDGEPIYYPDTLKGRVTISRDNAKKTLYLQMSSLNFEDTALYYCARLNYAVYGMDYWGQGTTVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FV4155
publication title Antibody fragment Fv4155 bound to two closely related steroid hormones: the structural basis of fine specificity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 1997-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2bfvH00
1C5DA 3U83A 1KYOK 3P40A 3JTTB 1AHWB 1SYSA 5H2BB 3VRJB 4APQC 1LP9B 4GKNB 4MJID 1ZLSL 4G80A 1DBKH 1F13A 4DOHB 3M1BB 4NRXB 3VXOB 5FM8A 2R1XB 4ONGH 3NA9H 5I8EA 1S9KC 2IMMA 3FQXB 4XBGB 5CILL 1EBPA 1QLFB 1KBGL 1IM9D 5C09D 3PL6A 3O8XA 3QDGA 2DL2A 2X4NB 1FFNA 4X7DC 4ZSOB 3OR7B 4RMTA 4DVRL 4N0CC 4AZ8A 4ONFH 3DHJA 4NQVA 4NQXB 4ODSH 1QQDB 3F7YB 5I1AA 2ICWB 4X4YB 3QDJD 5KVMC 1I3GH 2AEIT 3ROLB 2X2YA 5D7IF 3GMRA 4UIMB 4DTGH 2OX5A 4Y1AE 5IB3A 3T4AA 4WHTA 4LCIL 1A3RL 3QI9C 1WBYA 5HI3D 5KANI 1T66D 3QIUD 2J12B 2QSCH 3CAFA 4G7VL 3VFOB 1EFXB 4PJDF 1XIWD 1FO0A 3KPPA 5D7KE 4QRQA 2Z31B 4PJAE 5AUMB 3MYJB 4I18A 4MJ6A 2D4DA 5GRXG 2VZUA 4QXGH 3TYGH 3MV7A 3IB4A 3GDBA 4HKBA 1KNOA 5DUPL 2EH8H 4FQ1H 1JNHB 3IETA 1H0DB 5DRWB 4W6WB 4I0PB 4X80H 1MCWM 3MUGA 3CZFA 5CZVL 3VXTA 2FIKB 4JG0L 5TE7L 5DYOA 3UTPD 1MREL 1N3NB 1UB5B 1YQ2A 3SGDI 4EBQH 1BF8A 3VFUB 5CAYB 2P48B 1FVDA 2BK8A 2GAZA 3OAZH 4WWKB 5F1IB 5KS9A 1AJ7H 1OAXH 5D7IB 1Q9KA 1TITA 1LEIA 1NBQA 2VDQH 3SE3C 4MA3B 4HJGB 5JHDE 2MCG1 1J0KA 5IHZB 5I6XC 2ARJQ 4P2RD 2R0KH 4QCIB 5I8CA 3VI4F 1K4CA 2HRPH 4YHYB 3GRWA 1OTTC 3DTXB 5J11C 1QRND 4JRYA 4HUWA 2A6KB 4D2NA 3PQYA 3MBXL 3QQNA 5GGQL 1I7TB 5F70A 1TIUA 1WF5A 4UQ2B 2VABB 4OGAD 4LCYB 4Z78A 4Z8FH 4M7LT 4K7PL 2NY3B 2BFVL 4JCMA 1WUNT 5TQ2H 4KV5E 3BN3B 3BI9X 3RZCD 5EUKB 4QRRA 4J1UA 5MENA 2GSIA 3GSNL 4X5LA 1I8KB 2BHYA 1KN4L 4UDUB 1TETH 5H37H 2IBBA 3ILQC 1DVFC 3MJ8B 2P5EA 2R15A 4QNPE 2UZXB 1BQHB 3OKKB 1YQVH 2FX7L 3EGSB 2IH1B 1OAZH 2C9AA 1NEZG 5T5FL 5GRWA 4R7DB 1T3FA 2N7BA 3D39B 5TGBB 4AMKL 1L7TH 2V9TA 3BVNB 4X6CE 3T3ME 2VDLL 1IGTA 3BP4A 4LCUA 4M00A 2EIDA 2VZOA 2VSDA 5E1AA 3CC5A 1MWAH 5IB2B 4ERSH 1SJVA 2HYMA 4PPTA 2VISA 3TO4C 1D5BB 1BVKB 2XQBH 3VMPA 4MCYA 3OF6A 1MEXL 3SE9L 1ZGLA 4Z18A 1XGPB 1OAYL 2EYRA 4HIIB 3LD8C 1MPAH 1PLGH 1QD0A 3G6JA 1FVCB 4F7MB 3AY4C 4X7CC 4KU1A 4U1MA 3I6KA 5HHOE 3GHEH 4R3SB 3TGXA 1I7ZB 4ZAKB 5I1IH 1OGAA 4UOW1 1E4XH 4GBXA 3B6SA 3HG1D 4JE4B 5T1LB 1I8LC 5HVGB 2BERA 2X4QB 4GXUM 5DT1H 2GUOB 5I1DB 3R1GL 3QPQC 3N1FC 1U91A 3LVEA 2WZPD 1G0YR 5DK3A 1AI1L 5HDQL 3BKCH 5JHLH 1NCNA 1NMBL 2X70A 5IB1A 4WO4C 2BVUA 5I75C 2FB4L 3DYPA 2B0SL 3ARRA 3O3AA 1I8MB 3RVTD 3FRUB 4HS3A 5HBBA 3OJDB 3ARBD 3TYFB 4MNQB 5I17A 2V2WB 3MV8E 2VN4A 3RL1A 1QHPA 3TV3L 4BKLA 4S2SA 2XFXA 1T1XA 4B7IA 4LSQL 4APQB 1QNZL 4MDJA 1RAMA 2R69H 4JLRB 2J2ZA 1VA9A 3P0YL 3LZFL 4LLUA 4IJ3B 3U46B 2GQHA 1K4DA 3O4LE 5C0IB 1E27B 3ALPA 1JL8A 4TUJA 4JVPA 1D9KD 3EYQD 1CXKA 2DBLL 2H2PD 2DLGA 5BV7H 1VCAA 3HI6L 1K3IA 1UZ8B 2HH0L 2X1QA 5IKCB 3QA3B 1NUDA 5IESL 3EO9H 2YPLA 5DD6B 5C6TH 2OCFD 5C0JB 4K23L 1EGJL 5FHBL 5C09E 4Z77A 1CL7H 5A2FA 4H8WL 3CFBB 4OCYL 3D3VD 1SY6A 3U30C 5TDPB 4YBQC 4NHUB 2C3HA 2AKRB 4WFHE 1UH4A 1F6AB 4M7LH 5H35B 4ENED 3U4EA 2EIEA 4EQ3A 3NIFE 3V0VB 5C71A 3K46A 5E8PB 4FFYL 1A7PH 2FX9H 2GT9B 3BP6B 1QACA 1NUNB 3ZYIA 3EO0B 5K33A 3QUZA 5IEHB 4YDVA 2YR3A 4DKEL 5D2LE 4FZEH 4JFOA 3VXQB 4DGYH 4YEFA 4RQQB 2FJGA 5DJ6B 4IOFD 2V17L 1DN2A 2ZP0T 4LLAA 1YMHA 3OAYK 4R96B 2XXCB 5F89B 4F33A 3O2DA 4OLYH 1K5NA 4G8GA 1XF3A 2A2QT 4YBHA 2DLHA 3E6HB 3VD7A 4N8CH 3V0AC 1GC1C 3V6ZB 1MFNA 4H0IA 4LVNC 3QBTB 3TT1H 2A6IA 4LRNH 5L88L 3D69A 2XTJD 4I2XE 5LVEA 3QRFM 3QUKB 1MJJB 1DUYB 4OCXH 1UWEH 4EDWL 2VB5A 4EI5C 3FMGH 5IOPB 1DQDH 5GS1A 4S1DC 3QEGH 1QR1A 5IJKA 1LEKB 3JZ7A 1CICA 3DYMA 5FF6A 1A0QH 1MFEL 2GFBA 5JIKA 4XPAH 3ZKXB 4ZS6D 1NGYA 1RHFA 2XRAL 1KJ2A 1BQLL 4BFIB 2DQHH 4OF0A 2JELH 2HVKB 4JY5H 4F7TB 4P2RE 2X4OA 4FFWD 2F74A 4LU5H 3RGVC 5HHPA 5D1XA 1NCBL 4OGZA 4KZEL 2YWZA 5B3NA 3MFGB 5EB9A 3GGWB 1DQQB 1RUKH 3PHQB 1BEYL 3I2CH 2W65A 1UCTA 2VL4A 4FQXC 4WI7A 5DK2A 5B39B 3HFMH 4LAQH 1K8DB 5JORA 4HC1A 4BQ8A 1DVFB 4LMQE 4ZXBD 4C56D 5HGDA 3PWVB 3FKUS 1T7VA 3N1GC 5F6HI 2EDEA 4FXLA 3CFJB 4NZRL 1FAIH 1OP5H 1MF2H 2M1KA 1DN0A 1JWSA 5DD5H 1PAMA 3CU7A 1QFWM 4RGMC 1FE8H 2J8UF 4PJ9D 4TVPL 5E4EC 3REWA 3I3BA 4J4PD 5I1JL 3X12A 1A4KA 5DI8A 1JYWA 4HK3N 2AV7A 3VXPA 1IKFL 3HE7A 2EKSB 4XWOC 1TDQA 4MXVE 2AEQH 5F7WC 2H1PH 3WFDH 3VWKB 4OCWH 2R0ZL 4Q2ZB 4CBPA 1EO5A 2HJKA 2Z93A 1U8IB 4PLOB 3L3OB 5FYJU 4XCCL 4ZO8A 3QUXD 3HZKA 1PW3A 1JFQH 1MIMH 3AREC 5T5NG 1CG9B 3L9RA 3O41A 1Q8MA 4ODBD 2VR9A 5D7JC 4QY8B 5I16A 1QKZL 4LHUG 1J9CT 4Y16A 3DRTB 3TIDA 5J1AB 4DWHA 1Z9LA 2A0LD 1HDMB 5DFVC 5ANMA 1BVLB 4Z7VA 2EDNA 3I85A 5GGTH 3QIBB 1NCCL 2J8UB 3T0XA 1NSNH 4XPHH 1H5BB 3MREA 4XMKH 1NGXB 4N0UE 1ZGLM 1Z3GL 1U2HA 3V4PL 4NBXB 3UO1L 1P5VA 1ZTXH 2X4TB 5C7XH 5IB4B 2BOCB 3KPTA 1NGPL 4KQ3L 4HGWA 5K9JH 1X44A 4HUXA 1GOHA 4FQHA 4MD4B 2B2XH 3NCBB 2BVPB 1Q0XH 3C6SB 1YNLH 4IRSB 1NFIB 5IROA 4ZTOL 1VEMA 4P23D 2VLRA 1MCLA 1X5LA 1A6TA 4M6MH 5HYSB 4LSUL 5BZWB 1F3JB 5CD3A 2NTFB 4Y19A 1HQ4A 4NWTL 1D5ZB 4HMCA 1UM4L 3VFTA 1XCTB 3H7LA 5DUBA 2PKDA 4F15C 4NO3A 5J12C 4Z0XA 2V7HA 4HCRH 4OZHE 3L3GB 4CAGA 2XACC 1KTLB 3OQ3B 2YPKB 1QYGL 4GUPB 4GMTL 1JHLL 2DQIL 5DJ0A 1MCOL 3MRPB 1NLDH 5M7QA 5A2JH 3CX5J 4P5TC 4RGNB 3JTTA 4HV8B 2AJYL 3VRJA 4G6AD 4B7LA 1X5GA 2CDGB 5F21B 4F7CB 3HTLX 3R06A 4O00A 5CWSB 1B4JL 3M1BA 1E4WL 3DXAB 3UC0H 4X8JA 1CLZH 1JGVL 2QL1A 2NY5L 1Q72L 4TSAH 1YEEH 2XWTA 3KYNA 5F9JB 1QLFA 4KMTL 5J3HD 4LLQB 1J1OH 2LTQB 4HHAB 2IH3A 3NVQA 1NFDF 1A6UH 3U82B 3MNWB 2DI9A 2ZZUT 4OTXL 4PY8J 4MNGE 2KQNA 1IGJB 2VDRL 5E00A 5DDHB 3CLEL 5T3ZE 4YDIL 1B6UA 1NJ9A 4OGYH 3HNVL 3MOQA 3LEYH 3PWNB 1OTUD 3U7YL 4R2GB 5ILTL 3WEXA 3F12B 4OBRA 4JFEB 4LDLB 1TZIA 3BZ4B 2P43B 3L7FB 3RIFF 4URTB 4R97C 4JKLA 3DLQR 3A6OA 2X9YA 2YEZB 5EU5A 1AY1L 2DQCH 5FFLA 2BVYA 4R90H 3MUY1 4UT9L 1KB9K 2NW3B 4NM4L 4F2MB 4M1GH 3BQUD 5ECJE 2JJTA 1HXYA 1XZ0B 4PGEB 3DETC 1TZHB 4G9FE 2SEBB 4YC2B 5DRWA 3T3PE 4CDGC 3TBVA 4L8CB 2VIRA 4JM2F 3VA6A 4OLVH 1NCDL 1TQCC 4ZNEE 1RZJL 2JIXA 3T1WA 4I4WB 1NFDB 5D8JL 2AJUH 2MKLC 5L8JB 4NQDD 5F7EH 2EZ0D 4MD5B 1LE9A 4OFIA 1E6OL 5EUOE 1UC6A 1A9BB 2VQTA 5CFHA 4Z7QE 2ZUTA 3QDMA 3C8KB 5C3LD 2OMNA 3BZFA 3MRGB 4PJIF 3T0ED 4YXHH 2WUCH 2BNRB 2NY1D 1S78D 3SKNB 4MA3A 1CE1H 2VMFA 3V4UH 3VD3A 3ULSA 4Y4KC 3RWJA 5J06A 3UZQA 5F3HB 5IHZA 1P84J 3U0TB 4D9QE 4JR9H 4DZ8B 4GJTB 2XA3A 2J4WL 2RIKA 4PJDA 1R0AH 5DQDH 5F9OH 4HFUH 5JLZA 4HK3J 4OGXL 2HP4A 4P9MH 2R56H 4FXKB 4JFHD 1KXTB 1S7QB 1QVOA 3KPOB 3AGVA 2DB8A 1OGTB 2F54B 1ZSDB 1NAMH 4RMQA 1MHCB 3JWOC 4FQXB 3NBNA 4AEIL 4UQ2A 2ENSA 1FNSH 1O0VA 4JM2B 3DOSA 4D9RE 4TSBL 5DGRA 3PIQB 2Q86B 1JPFB 3SDAC 3K3QA 4PJXF 4XWGL 1KOAA 3W2DL 5EZLB 5FHAH 4X6EA 1BQHG 2EO1A 4G9DB 4GSDH 1BZ7A 4KGLA 3H9HA 4I3RL 1MVFA 4PJIB 5GGSY 4G6KL 1HHHA 4BSVA 4G42A 4KJQC 4GAJL 2YD3A 1IQDA 2X7LB 3MOAH 1KXVC 4JN2A 3WKML 4IDJL 2V9RA 1EO8H 2D03H 2GJ6E 4OD2B 4Y2DA 3WNPA 5FDWA 4LBEB 1V7NH 3MJ8A 4X9BA 5INCB 2RQ8A 1BX2A 2AJVL 3OBAA 5KANG 5GS2D 3GJFK 4R7NA 4OF8A 1HSBA 1XCQA 2KKQA 2D2OA 3EYVA 2CDFB 1QBLL 3ULUH 2E7LC 4OKDA 4QRSB 2H32B 1MRDH 5DD1H 1O5DT 4YQXH 2BNQA 3AREB 4K7PY 5GGRB 5EZIL 1JGLH 1RFDH 3RUGA 3MRHA 4JVUA 1KUMA 2ESVB 4U1JB 3SDYL 3BKYH 2K9UA 2VDNH 3SE4C 4KTDH 4A6YH 3PJSB 4PJXB 5IB2A 2LV4A 5KSBF 4MVBD 5FEBA 4PV9B 2DLIA 5I8KL 1IGIH 4JFFA 3P3YA 2AK1L 5E99H 3DX9A 3LB6C 4MZ2A 2VDKH 4HIIA 1QSFD 3G5VA 4PJEA 4NQTA 4P46C 2FEEL 4X9FA 4JPKH 4XTRC 4F7MA 4JGJA 4KHXL 1W2KT 3JUYA 3OJVC 1RUQH 2K7QA 2ZCHL 3LKRB 5L2KD 3OXSA 1RUPH 4ZAKA 1DFBL 4NO0A 3BXNA 4X5XA 4Q9RH 2DIBA 1OARL 2YUZA 3A67H 3SKUD 1FV1A 3QUML 3V6OE 4QKXB 1DQMH 4Z95L 5GZOD 2KUTA 3SBWA 3S88L 5I1DA 4KJPD 3FO9B 4QTIL 3N9GH 2A74B 5DJZA 3D85A 1ZHLB 5SWQA 2ZPKH 5KSBB 4G43A 4OUUA 3TZVA 1CLYH 5D6DC 5TQ0H 4KGJA 3QXAA 3MUZ1 4EXKA 1MRFH 4F15B 4YHPB 4PUBL 3G6DH 4PP2B 3FRUA 2IPKB 1ONQB 1P7QA 4MNQA 4HX1B 1HKLH 3U0PA 2WMPA 3SQOH 3HRZB 3QIWD 4OQ1A 2G60L 3A6BH 1D5IL 4ISVA 5CCKL 4DGVH 4LF3A 2F19H 2F5AL 1I7UA 3W0WB 4APQA 2GTZA 4GKSB 3CPLB 4L1DA 1A6ZB 4S1QL 2Q7NA 1INQA 4WTZG 3FO0H 1A21A 7FABL 3C08L 1URLA 4NSKA 3RGHA 1A3LL 1ZWIB 3VXNA 4PRIA 3QXUA 3O6FB 5CHNB 4PGDA 2NZIA 5EC2A 4U31A 3ELAT 5BOPA 5C2UB 4Z7WA 1KJVA 5JZ7D 1DBML 3JV5A 3ZKND 2A9NH 3VGAB 2EEDA 4NO2A 3VI3E 3FRPG 4J6RL 5DGQA 1QBAA 3E2HB 1NGWA 4OF5A 4OZIE 4KJWC 3PGDB 2OK0H 3TVMD 3QA3A 5IBTH 1KIPA 4OFDA 4QWWC 5D93C 2BJMH 4KI5E 4OLXH 1U8LB 2NXZC 2ZUVA 4OKVA 3GKWH 5ITFB 3L3JB 2FZ3B 3U0WL 1NBYB 3QI9A 3ZHKA 2HMID 4PRPA 1F8TL 1MHHA 2PF6A 2AKRA 2D0HA 3UX9B 1F6AA 1WFNA 3V0VA 3VXMD 4JFYA 4DQOL 1NC4D 1U58A 2GT9A 1D7FA 3B2VH 4OCRL 4JKPL 4NNPL 1KFAH 5IEHA 5IIEA 5D7LE 2D0GA 2ENYA 3VCLB 3L5HA 4V1DD 4UV4H 1FNLA 5IW1A 3VXSB 4P5MA 4QRPA 1FN4A 1L6XA 5F89A 3ZE1E 1TQCB 1EHXA 4PB0H 4O4YH 1AQDA 1VPOL 5GJSH 3IDYB 4DZBB 2D7NA 3KR3L 4CN6A 2Y36H 1HZHH 5FOJA 5F1OB 4L3EB 5KSUB 1WVZA 2OI9B 1JZ7A 2VQ1A 3SE3A 3QUKA 5ISZB 3CMOL 4NCC2 2EXWC 4AEHL 1NKRA 3E0GA 4JREB 3QNXB 1AXTH 4IMLB 5IOPA 1MCKA 1UWXK 3HRPA 5C0RH 1ZA3B 4KKNA 1TQBC 2AXGB 3VWJC 3WXWL 1UACH 2DWEB 2YC1B 1QSZA 3P11H 3QHZH 2E9IA 4E41D 4KC3B 3DVNA 3TWCL 1LNUB 4Z7UE 1I1YB 1BPVA 2WNGA 2R29H 4WY7H 4POUB 1DBAH 2IBGA 5TH2B 1TTGA 3L5WA 5B39G 5CMAA 2EXYD 4X7EC 1F3DH 3BHBA 1B90A 5BS0B 2E7BA 1YY8B 5IMOA 4GS7B 2YD2A 4JFHE 3H8NA 1N6QH 4W6YB 4OFYD 4J3UA 1KCVL 3EHBC 1VKXA 2X4PB 4LKXA 4U33A 3LV3A 3U9PH 1QLEL 1FYHB 5A2KH 1RZKH 2R4SL 1B0GB 1XGRB 3IDMA 4CADA 1K8IB 3RVUC 2G9HB 1MRCL 2L0DA 4DGIL 1DVFA 3RWDA 3KPSE 3GSXB 4MB4A 1VESA 3CFJA 5FK9A 1KGCE 5L7XL 3BN9C 5GGSA 3WNKA 5CZKA 3SKJH 3P0VL 2FBJH 1W8OA 5FYJH 3HCVA 3HS0A 3DROB 3ZKMC 2ATPA 4GRWH 3PWLB 1FG9C 5HVWA 1FDLH 4Q6IB 3CDGA 2OSLA 3SDDD 4PJCE 1OSPL 1UXSA 3GUTA 2EKSA 3DX6B 2P49B 2C4FT 3TO4A 4S1SH 2EDRA 1TJIH 3VDCA 1ZANH 4K3EL 1KJ3L 2FBOJ 4MWFA 5E03A 1HH9A 1GZQA 2JJVA 4KH2A 5F7HA 3HUJE 3R0NA 4YIQA 4TTDD 5ALBL 5KJRL 4ELMF 4IS6A 3VJ6B 2BRRL 1IARB 3AY4A 4S1RH 1DSFL 1CTOA 1DQLH 1T22A 3BP7A 1EUUA 3KPRB 4P3CH 1K2DA 3ME0A 4NNYB 4KZDL 2WBJD 5I1KH 3OB8A 4UT6L 3GSNA 3H2WA 1U93A 1BQSA 1CD0A 1QSFE 3B9AA 1YUHB 3ZDXE 1I8LA 5KVEL 1T80A 3K2UH 1DCLA 1CD1A 5HHVL 2DYPB 4KKLC 2C1OB 2DJSA 3HI5L 5L2KE 5IFHL 5D2NC 1A1OB 5DMKA 2PCPA 1HE7A 1U8JA 4OLUL 1I9RH 1NGXA 2ARJA 5SWZE 1J0JA 3MLVL 3L3HA 5HYSG 2Y06L 5ELIA 3C60B 4LSPL 1I9IH 2BOCA 1OP9A 1I1FB 3MJ9L 2XWJB 4WO4A 1N5YL 1LDPH 2CRIA 3QUYB 5EPMB 4CN1A 1KEML 1A3QA 3ECBB 5CGTA 2AS5M 1C16B 4ELMB 1WLHA 4UNUA 2CKNA 5E8EB 3VG9C 4LQFH 2VZSA 1J05B 4GAFB 2AI0L 1F3JA 1T5XB 2HFGL 1G9MH 4RFOL 1HWGB 4K94L 1OT2A 4POZD 4O51A 3N1PC 3RTQD 1M7IB 3AS3A 3QPXH 3UXFA 4GUPA 4TULH 2AW2A 5EOCH 2Y25A 4TUOB 3HPJA 3MV9D 3RRQA 1T1WA 3SGDH 5DR5H 2F9BT 5I1HL 4Y4HB 3VFRB 1BFTA 3IXAB 4WU7B 5AAMA 4NQCB 4PJ5A 1WC7A 1WZLA 3DUSB 1Q9OB 4ZUUA 3QCTL 4X9IA 3FHQA 3MCG1 1PKQB 3VFVB 4JHAL 5D93B 1W72H 1S7TB 4ZYKA 5TFSL 2NTSP 1OWRM 3WIHH 4LLQA 5EIIB 2CMRL 4OZFH 4ZUTA 5CBAB 1EUTA 2E7CA 2OS7A 4ORZC 4ZFZB 1ERNA 3DVIA 5C3TA 4M8QB 3VRIB 1F4XL 5DK0B 4Z0BH 4JFDE 1IGJA 3ZL4L 3IU3A 3KXFE 5DD0H 4KKCC 5CD5C 4ZD3H 2EE3A 3K7UA 3GZKA 5C0BD 2MJWA 2PO6D 1JF6A 2O5XL 2MNUA 4K94C 5I1GH 4HT1L 1CVSC 2BMKB 4PD4J 3VXME 5MEPB 2IPTL 3KPLA 5FM4A 4MSWB 5BMFL 1RJLB 1CFVL 1EVUA 3ZKSD 3UJIH 2NW3A 3PP4L 4BZYA 1J1PH 4GKOA 3FFCD 2NY6D 5DUMH 5EDXA 4JO2H 3WUWA 4FXGA 4C83B 1KJMB 4EI5A 3GJFB 2VLJD 3GSUA 1BD2B 4U2YA 2R9HD 3S34H 1JGEA 4G8EB 2WINB 3L5XH 5C0EA 1J87A 3GIVB 1YNKL 3KS0H 5GPRA 1HHKA 1Z2KA 3K1KC 1CXEA 5IHLB 4PG9B 3HE6C 43CAB 3IDGB 3KYMA 1UZ6F 3WIIL 2W9DL 1ZLUK 4WU5A 1JI1A 3O2WH 3TH2T 4GRLB 4JQVC 1FL5B 3TH4T 2BXYA 3KJ6L 3RGVA 4DZ8A 1FSKC 1JHKH 4WI9A 5CKAA 3K81A 3BD3A 1S7RA 5DSCB 2PYED 1YYLL 4JZJC 5KTEL 5IFAH 3CSBA 2DD8H 1TTUA 1LO0H 3OKDA 1FL3A 4FQXA 4HIXL 5L2JB 4J3OC 1MHEB 3MLYL 1YEHL 2ZJSH 3VDAA 3TJEH 3ZZ1A 3P0GB 1P6FA 4FQLH 1KN2L 3MMEB 1X5KA 3PIQA 5L0QC 4JPWL 1VFAA 4M93B 1RI8A 4G8FB 5EZLA 3RWFB 4FN0A 1KPUB 4Y5XB 2FD6H 4KK8D 4OD3H 1OM3L 3OKYA 3PABB 2JE8A 1S9YB 5D1ZC 4YHLL 1GGUA 3O0RH 2E6PA 1E4KC 3OTTA 1ZLVK 1AKJA 3BH9A 2W38A 5FXCH 4O2FB 1CVRA 4BYHA 2P5WA 2IAMC 2ZUWA 3PP3H 4BH7A 1S7XB 1SJEB 1IAOB 5JOFA 5J89A 4WW1B 2NX5A 4QHMB 4RFNB 1RVFL 2RBLA 4GAGH 4OIBA 4BA8A 5E8DL 2J1KA 3AREA 1I75A 3Q1SL 4G6ML 4M6OH 1WFOA 3BEWB 2RHEA 3NFSH 5D7JA 1RURL 5I71C 5D7SL 1PQZB 1JGUL 3GM8A 1EO7A 2HFFA 1ZAGA 2C5DC 5JTWA 1JZ4A 4XVUD 2EKJA 1E6JL 1CXHA 2UWEE 3H9YA 3EIFA 5BVJB 2A77H 3VXRD 4ODXA 3SOBH 1CLOH 1T7WA 3T8XA 5EULV 1V8HA 1F2QA 1RUML 2DDQL 3TBTA 3MFFB 3NAAH 2LU7A 1C1EL 4MDIA 4PJ7A 4JO4H 3ZE0F 5DQJA 1A47A 4R8WH 3MRNA 3SKMA 4BJLA 3E8UL 3W81A 2V2XA 1E4JA 2NY2B 3F62A 2H6PA 3JV4B 4XMLL 2YK1L 4HPOH 3MRIB 3FO9A 3D48R 3VE0A 4PP1D 3VG9B 2CLZB 3CVHB 5EO9B 3L7EA 5KBNC 3M17A 1NL0H 1JZ3A 3ES6A 3ULUE 4GT7A 3MJ7A 4L3AA 1KEGL 1CDYA 4TNWK 3KLHD 3QO1B 4WHYH 1ONQA 3QNYA 3CSYA 2ZKHH 5D1QB 1ES0B 3HRZA 3FFDA 5JNYA 4QOKB 2XA8L 5KSVA 4DVBB 2ZUXA 1ETZB 4P5TA 5E2JA 5INDB 4U3CA 5DVKA 3W11C 4KHTH 4RAVB 1A6ZA 1IM3A 1U8MB 2Q8AL 1J5OH 2CRZA 4KRPB 4MLSA 4HZAA 3S96A 2WWMC 4MXQD 3UTQB 5JPNB 3RPIB 2R2HB 3H3PH 2HTKD 3CXDH 5KSAD 1Q0YL 5FUCE 2PR4L 4YE4L 1PSKH 3H0TB 5ACMA 2BVOA 1ZKAA 3TEUA 3HKFA 3ZT7A 4PRHE 3EYFB 3BIAX 5CEZD 4PYHA 4D3CL 1UQSB 5IJVB 3O45B 4K71B 3SCMC 5ITFA 1NBYA 1TCRA 2XNAA 3G5ZB 5C07B 1U3HB 4YFLI 4EOWL 2I9LB 1LO3L 2ADGA 3FCTB 4IMKC 4HGMA 2B1HH 1EMTH 4O2CB 3QFJB 3FQUB 1V05A 4RMSA 1KTKE 4L8SB 4MX7A 5MI0C 5EFIB 1MLCB 3T1FB 3NCFB 3E3QC 5T33H 4EN3D 3WFZA 3FQNB 5BRZB 4HAGA 2AK4B 5DRZA 4PJHB 4DZBA 2XKUA 4H0HB 1YDPB 5DMIL 1RJZB 5DD3L 5ENWA 2F53A 5HVHC 5KSUA 1G0XA 2EE9A 3ARTA 4PJAF 1QFOA 1OD7A 4I9WE 1UVQB 1HYSC 5C2BH 4P2OB 2JB5H 1JNNH 4UDTB 2ICWJ 4Y4KA 5D71L 2R1YA 1EBAA 3I50L 1EAPA 2RJMA 2IAND 5C0AD 3P4OA 1EERB 2HKHL 4X6FA 4MXWL 5EU7C 4JZJB 4YPGA 1RULL 5CEXB 4NN6C 2F5BL 2NLJB 5L6YL 1X4XA 2OR7A 1LNUA 1H3TA 2DKMA 2XN9D 4L4VE 3BE1H 3H42H 4DKAA 2NY0D 3QDAA 4CKVX 5HYJA 4Y8DC 5TH2A 1NDGB 4OAWB 3RY5A 1F3DJ 1G6RL 2PYEE 1NGZA 4WUKH 4HQQH 4YFLF 1BZ9B 2GEEA 3SDAA 4U6YB 2FO4B 1LP9E 3RDTB 4LL9A 1A64A 2YPVH 4DOHE 2X4PA 3PGFH 4L8DA 4PJAB 4HWUA 2VUYA 1A6AA 4FRWA 2GJJA 4Z6AT 4I3GA 1B0GA 4WFED 5F44A 1ZK9A 3LKSA 5KVFH 5D1ZB 3QIUC 5ESAB 2IC2A 2Y07H 4QXTA 3FT4B 2HKFL 4ZSOE 4U6VH 3GEWB 3FTGB 5D5MA 3S98A 2VXSL 5C70A 1NBZA 5A2IH 1QA9B 3R4DA 3S4SG 1S9XA 3ULVH 5E5MB 3QB7C 4OCSL 2G2RA 3DROA 4LLVA 4OLWH 1CDUA 4KV5F 4MLIA 4BQ6A 2EYTB 3UEZA 5IMMA 5IFJB 2EDHA 1P7KB 3MXVH 1A7OL 4XBPA 1P2CA 3P77B 4XBEH 5SX5K 4JRXA 4U0QB 5DMYA 1FO0H 3SE4A 5GHWL 3WLBB 4Z9KB 4TYUA 3S4SA 2VLLB 4GAYB 3C87A 5E9DD 1P1ZA 3FO2B 4JDZB 1NCUA 4YDLB 1HN1A 1GOGA 2NY4C 2Q76B 4HWEH 3FT3A 5A16A 3OB0H 2VLKD 4P46A 1MCCA 2GSGB 3OV6A 2YD1A 3KNBB 4P2QA 1HNGA 2DIJA 3T3MF 3MRDB 4X6CF 4HMEA 4XCFH 1D6EA 3V52H 3NPSC 3D0LB 4JO3H 3S37X 4N5UA 4NQEB 4J2XA 3D18B 4OV5B 4JAMB 3EFDL 5I1LB 1A8JH 3QQ4A 2OZ4A 3VFGH 1HSAB 4K3DL 1H15B 4JN1L 3MLUL 5E2TL 4P4KD 5ID1B 1J0IA 1QEWB 3ARDC 3V6FA 4OIIH 2BHZA 3K4AA 3QEUB 2I60L 1MHPH 5FYJE 3QEHB 4X0KB 2KZ1B 5KZCD 5ESQA 5D6DA 1L4IA 2XWJA 4CVZA 2H32H 4UTBL 3MLSL 4JB9H 1A7QH 3DURA 5C0FB 4MA1C 1PEZA 3NCEB 4EVNA 3STZB 3DVGA 5E8EA 3CH1B 3TA3C 5DRXB 2EYSA 2OL3A 3DUUA 4EXPX 4DKFL 2CRMA 1FYTD 1UKSA 3OG4B 5J8OA 3UTSA 2MPAL 4NN5B 5I0DA 2HT4D 2YSSA 3LRHA 1MIEH 4UINL 1SEQL 5ERWB 5EOCJ 5CZXD 3DGGB 4N9GA 5CEZL 3MODH 1NCWL 2V5MA 2RCSH 5LG1A 4Y5YB 4NN7B 5D72L 4L4TB 3WUZA 2FLRT 1QSED 4NM8L 5HI4C 3BDXA 3EOTH 4JHWH 4HIEB 1CZ8H 4S11A 4D8PA 1ORSB 4P2YA 4NQCA 3BRDA 4ONHA 4FQCH 5MEOA 1FNAA 3KYKH 1N64H 4PLJD 4ETQA 1GIGH 1BLNA 3MACL 2WUBL 2XQYK 4OFKA 4M7KL 2PNDA 2QLVB 4KROD 4QRUB 2CGRH 1LDSA 3UAJD 4OZ4B 3PWPB 1EEZB 2HTLC 4WUUE 3V5DB 2VDML 4MAYD 3QULB 2UVEA 1NAKL 5I8OH 5FA3B 5TPWH 3WL9A 4NWUH 3V5HB 2Q8BH 3SDCB 1FRGL 1IGCL 1JCKA 2QHRL 5MI0B 1AD9B 4XP6H 3NFNA 3HLAB 3CK0L 4LPTA 1A4JB 3MJ6A 4ZFFB 2NZ9D 1P84K 4KUZH 4HBCH 3X17A 3IAGC 2IADB 2W0FA 3T2QA 2R8SL 1Q1JH 2W91A 4OD1L 3MGTB 3NMEA 4CMMA 3NIFF 3B9KC 5HVHB 4PGBA 5E8NB 1HQRA 3C09B 1DANU 4KRNA 2J5LC 4JFZH 1AGFA 1SJHA 1ZE3C 4XCEA 4XP5L 5D2LF 4E9LA 3RVVD 3ZYZA 5BO1L 1BD2A 1EHLH 3MBED 3V5KA 4ESKA 3FL7A 4I0KA 4P99A 4LMQI 5JUEL 3KS0J 4FFVC 1AO7D 3BW9B 3VWJA 2A6DB 4MJIB 4NGHL 5F8RC 1MAML 1RZGB 2BSSA 2W60A 4X6BB 4H0GA 1B0RB 4F58L 1TJGL 3EFFB 3LKQB 2FATL 2DICA 5I1EH 1N7MH 3SY0A 3MRMB 3EYQC 2BSTB 5C09B 2IANE 2BX5A 4GXUN 4UUJA 5C0AE 2X6MA 4TNWF 3ALXA 1DLFH 3PGCB 4XAWH 2ED9A 3O6LH 1CDHA 1FGVH 1WAAE 3LQZB 1XGTB 2CDEB 1VFMA 3QDJB 2DL9A 3W82A 1G9NL 1GYAA 4U49A 3BPOB 2A1WL 2WIIA 1LWRA 3DRQB 5L2JA 2Q7YA 5LWYH 4HDIB 3QRGL 1HINL 4Y88A 3RL2B 2H8PB 1S7WB 5D2LB 3TBYA 4JZOA 1GGBL 3QIUB 5EOQH 4FQJL 4ENEC 1XIWB 2QSCL 4G8FA 5ICZB 4AT6B 3EYUH 5DJYB 1ORQA 1KPUA 4MMZC 1YZZA 1NC2D 2N7AA 2DQUL 1JPGB 5F96H 1PZ5B 1MNUH 4Q0XH 1RZ7H 1SY6H 4HKJA 1U8HA 4PJ8D 1WV7T 3GO1L 1OPGH 3NGBB 1CQYA 1HHGA 4RAHA 3I9GH 4BQBA 3G6AB 1G7HB 4ODWA 4MCZB 2DTML 3EOBB 1KCSL 3GMNA 4YHKL 1SJEA 3TCLA 1IAOA 5AD0B 3X13B 2ADIB 1J8HD 2OQJB 4WW1A 4QHMA 3RVXD 2I07B 2HVJA 1CGTA 1UYWH 4BZ2H 3IKCA 4P9HL 1G9NC 5GJTL 3HI1A 1QLRB 4P2RB 5E9DE 4L5FH 3NPSB 2R0LL 3C5JA 4ZS7H 4DW2L 1ZHKB 1U8QB 2R2BB 3NA4A 3QJFA 3PL6D 3O8XD 3QDGD 3O2VH 1KPRB 5FAAA 5ACZB 1QRNB 5B8CC 2QQQA 2AQ1A 3VGGA 3BPCA 5D2NA 2CXGA 3UBXA 1U6AL 3FZUD 2DM7A 4X8XA 4LSRH 4HJ0D 2FECL 1DP0A 4I77H 1EXUA 1FZJA 4NUJB 5HVFB 5GZND 3MRKA 3G9AB 3Q6GH 3TPUB 1UKQA 4MA1B 1ZVSB 4PY7B 3RZCB 3NABH 2J8OA 4XNZC 4MQSB 3TA3B 1FFOA 3KPQA 3QJHA 5C0GB 1G0DA 3MV7D 4XB7A 3OMZA 1KYOJ 4LK4A 4ZXBC 5D9SB 5HYQB 2NNAA 4U1NB 1P4BH 1U8KB 5GRYA 1LO4H 2LABA 2J6EL 3T4YB 4LSDA 2EEBA 5IUSA 4X4XA 3CUPA 3OWEA 2VXQH 2JCCF 4RWYH 4XC3H 1D5MB 1ES0A 4IIQC 5FYKD 3SDXA 5HHQB 3RJQB 4N1CA 1FYTE 4ODTH 4PJ9C 1JJUA 1LD9B 1ETZA 3IJSA 3O9WC 1HXMB 3LKPB 1GAFL 5C6WH 1LK3L 5BQ7B 5E70A 3V95A 5F7KC 5E94B 3MCKB 1CT8B 1NBVH 5F1KC 2E3VA 1YJDL 1BFSA 5LGKA 1TMCB 1QSEE 1XGQB 3ZSTA 1YEIH 2ITDA 4TOYL 4JRYD 8FABB 4G6FD 1HI6B 3PQYD 1GGTA 1MFBL 4N0UB 2XZQH 2HJLA 3F7VA 4NKMA 1UQSA 3INUL 3O45A 3HG1B 3EOAB 4YXLH 4H5SA 2JCCB 4WFGD 3EDJA 4B5EA 5C07A 1AGCB 4PY8I 1L6ZA 1VADB 1H3PH 1XR8A 4ZFOB 3B3IA 5GRUL 3FQUA 1NCAH 4QRRD 2RFXA 1DBJH 1Q94A 3OKLB 5MEND 4BZ1H 3SGEH 4FNLL 1BGXL 3WNOA 3ARBB 4K2UL 3CLFH 3F7QA 5CKGA 1TZGH 2VXUH 3ET9F 2VITA 4NC2B 4O5LH 1BREA 2J8UE 4XCYA 1BM3H 1T1YA 3QH3B 3FQNA 1A5FH 2KH2B 1O7VA 1MCPH 5E7BA 4YWGH 3WFCH 1YJDC 1YDPA 1S7UB 5DFWH 3FAXA 1ZT1A 1AD0B 1I3RB 3BWAB 2VYRE 3W9DB 3WN5B 4PRAB 5FECA 3HE6A 4OB5L 2BCKB 4AM0A 4JQVA 1WCQA 3T3PF 3OF6D 5E2UH 1AO7E 1YECH 3I6GB 2H9GB 3IRPX 3WNLA 5ADOL 4LVOB 1N0LA 4FQPA 1IEAB 2NLJA 3V7AG 3O4OC 3LQAL 2MTPA 4MNGB 1OP5K 5EUOF 1B2WL 1M4KA 4M61B 1CK0L 4Z7QF 3MNVA 3JV6B 2IALA 3WFHA 2PW2A 1OGAD 4N8VB 4KI5C 3BDYL 4Y1AA 4XMPL 3D3VB 4GBXD 1CGYA 1CL7L 2A73A 3W9EA 5LGHL 3CSGA 1BZ9A 4PGJA 4RGNE 1T21B 2FO4A 4YK4C 2YRZA 3MR9A 1NLBH 3HNTH 4MB3A 5BCAA 3SO3B 3BEVA 5EBLA 1U3ZA 1V5JA 3DXAE 4L9LC 1R24A 4NRYA 5B38B 1KENH 1OTUC 4Y7MA 2BRQA 1SYVB 1T89C 1II4E 5IW6B 1BFOA 1H3WM 2DM2A 5D1ZA 4BK4A 4G9FB 4QHUB 1E4KA 3GIZH 3TN0C 4YH6A 4PRDB 1LO2H 2RGSA 2IAMA 1TLKA 4MQ7B 5JDJA 3BYTA 5EUOB 4U1LA 5E5MA 4NP4L 1M6OB 1CR9H 2X4UA 2XTJB 2BDNL 5BV7C 4TNVK 1F4YH 4C58B 3L3IB 2Q3ZA 2PXYC 2W9EH 5JHDA 2IFFH 1EX0A 3QG7H 3ZT6A 3Q5TA 3BO8B 2FEEI 3L3DB 4U0RC 1N5AA 4DEPB 4KTEL 2FJHB 2Q76A 1OAUH 1CFTA 4I1NB 4WGWB 3Q0HA 4HKZB 2CLRB 4IBLT 5EN2B 5HHXH 1KF9B 3RKDD 2KBGA 1SEBB 1MCDA 5BW7C 4HUUA 2LFGA 2YPLD 1MCRA 4MJ5A 4N5EC 3DX8B 4UIKL 1NFDE 2NQCA 3STBA 1E0OB 3OL2A 1QFUL 3WSQL 3QDGE 3WLWD 5JOPD 2EECA 5IK3B 4FOMA 1ZVYA 2P8MB 4QTHB 5DHVA 5AYUL 3IS0X 3VD4A 4OV5A 2C4XA 4PTUA 1A14L 2MOVA 1HSAA 2VTFA 3BOVA 3IU4H 3OSKA 3RIAK 2BNRE 4GRMA 1E4XI 4UTAH 4XNZB 4GMSL 2YUWA 3CFCH 3SGKC 4ZOCA 4J8RA 5FYKL 3GBML 3ULVE 5C08E 3GSWB 3QUZD 5E5RB 3MRCB 3S36L 4PR5A 2J88L 3RY4A 1R3KB 2XKSA 4ZXBB 4C56B 3LKNB 4IRJC 3CFDB 4BM7A 2ZCKH 5CINL 2UZIH 2ADJB 2PW1B 4G8GD 3KLSA 1PKOA 2F54E 4WV1B 2DLEA 1UENA 4WNQB 1S5HB 4PJ9B 4I0CC 4OM0H 3BJLA 4X6CA 4K7PX 1UJ3C 2P46B 4U1HB 3F7RA 3GRWL 4ODHH 5GGUA 1F6LL 1F45A 4RZCB 3QHFL 5DJXA 4JY4B 1JRHH 4MJ2A 3KPMB 2DQJL 1CICD 4PJIE 4TUKL 3QUXB 1YEGL 2CIKB 4YHIB 3WDHA 1I1AC 4PD4K 1ZLWK 1X5IA 3WHXA 1QFWL 5HHOA 1T0NB 5DWUH 3U1SH 3K8MA 4QYOB 2ZNWA 2NXYC 1F90H 1OAQL 3TO2A 1MH5B 4JPVH 3SCMA 5D1XD 3QQ3B 4PBVC 1M7DA 4JG1L 2E27H 2B39A 4QRUA 1RJYA 2AJ3B 2YMXH 3IFOA 4IMKA 4ZUWB 3UJTL 2VR5A 5HY9B 5IM7B 1NSNL 5JW3H 2ESVE 5JXAH 1YPZB 1CDBA 4PJXE 3IDNB 3CCHA 4XPTH 3DV6B 5ID0B 1VGKA 3UPRA 4WFGE 1IMHC 4F7EB 1O7SA 1U92B 4WI2A 2A83A 4GG8B 1HYRC 1R3HA 1NMAL 1Q9LA 1WTGT 4PTTB 1OB1B 4KTYA 4NQUA 4M1DH 4P23B 4KI5F 4FMKA 1MWAB 2AXHA 3MV8A 1MFDH 2OLDA 1K6QL 1W0VB 1JP5A 5F7DA 4LP4A 3MCLH 5FUZL 1UWXH 3QUMB 5F7YC 3ZTNL 2C7UB 2UUDK 1IKNC 1HCVA 2PTTB 1H3VA 2P47B 3GNMH 5E6IC 4CNIA 4R4BB 3O4LA 3OKOA 3HMXL 3D2UA 4MA7L 1U3JA 2E9BA 1YEDB 2GCYA 2A38A 3HPLB 1G7JA 2ADFL 3HZVA 3ARVA 4JJ5B 5CUSH 4ELKB 2HT3D 4OLZL 3CVIH 3MRFB 3BSZL 1CLZL 5T1MB 1S7SA 5AWNL 2CKBL 1I7RB 3DIFB 5D96B 1KIRA 1KB5H 3QAZB 1KLGA 4Y16D 3BKMH 1FIEA 1C7SA 1IC5H 1ZV5A 3FN0H 3RAJH 4XGZA 3G6JE 3BGMB 4HS6A 3W0WE 1F58H 5I15L 1UA6L 4EQ2A 3DUHA 3ZTJG 4YK4B 4HUVB 2CDEA 1OW0C 4L8BA 3TVMC 1U8NB 3V4VL 2IGFL 1T0MA 5GIRB 5GSVB 1VFBB 3D9AL 3BKJL 3DJ9A 3UROR 1OGAE 1FBIH 1MCJA 4XVSH 1AFVH 3NFPA 1HHIA 4LIQH 1IGYB 4HDIA 5IHUH 4Z7UF 1S7WA 3DGCR 4NJAH 1FL6B 1IT9H 4YR6A 5MP6H 2W0PA 5DVLA 1GGCL 4D0BA 2Z91A 4IDLA 1TTFA 1AIFA 1HH6A 3F58L 5A3ID 5KG9B 1AE6H 3MJGX 2D7TH 3KLAA 5BVPL 5IMKA 2VLRD 4A2LA 1CF8L 4UB0H 4OT1L 3RWIB 3BGFC 15C8H 3BQUB 1Y6KR 3NCCB 4Y19D 1OT1A 1MVUB 5J6HB 3IFPA 1UB6A 5LQBH 3ROOA 4I2XA 2VAAB 4JEGB 3U36B 4ODVH 1WZ1L 1N4XH 5J7CC 1IAKB 3FONB 4NQDB 4R4FH 1AC0A 4F37F 3V0WL 4DN3H 4G5ZL 1A1NA 1BJ8A 3F8UB 3X13A 5C0CE 4JM4L 1Z5LB 3ARFC 2VE6A 5KN5A 1ZLSH 3HC3L 3EO1B 2NY1B 2Y72A 4KAQL 2OMBA 3IFLL 2HJFA 3AB0C 3NCJL 1KBGH 4J12A 5J4MA 2XKNA 4RDQF 2FHBA 4CRPA 1KCUL 4HLZH 4DVRH 1KPRA 3BRFA 4U2ZA 4L3EE 1T83C 3BGAA 5DA4A 5FYLL 5J9PB 2AJZB 1MY7A 5ISZE 4KPHL 3HUJF 3O2DL 2ZCLL 3U48A 3ARDA 3IXTB 1LE5A 4LCIH 1A3RH 3QNZB 4D0DB 3U9UA 2DLTA 5DMGC 1VFUA 3P4NB 4V2CB 1X5XA 3FQTA 4G7VH 1J0ZA 3VXUD 1IGFL 2R23A 5J6GB 5FHAL 1RHHA 2G5BA 3ZDXF 5TDNB 1C12A 3TA3A 1QO3A 3FB7B 1JUFB 5DUPH 5C0GA 4KVNL 3MGOB 1I9EA 3DMMC 1UJ3B 4NDMB 3DBXA 4ORGB 2JJSC 2ZG2A 5HYQA 3IYLW 1U8KA 3ARSA 1IBGL 5CZVH 4JG0H 4M48L 5TE7H 4G8GE 4HG4J 1MREH 1KJ2L 1X9QA 3REVA 3GSVB 1MI5A 2JIXD 4PJBE 1MQ8A 1T4KB 4AENB 1SJXA 2WBKA 5HHQA 4CJ0A 1GZPA 3TBWB 1V3MA 4JPIB 3VDBA 1LD9A 3HUJB 1YEKL 3GI8L 3B9VA 3IDUA 3QDMD 1DQJB 5J13B 4LOUD 1A7RL 5I18L 4JDTH 4MAUL 5BQ7A 2VDNL 4KTDL 5CGYC 2GTWB 3LOWA 1CQKA 3UDWC 1J11A 4FZ8L 5HSFA 1QSFB 4HC1L 4K3GA 4MA8L 3KDMB 1XGQA 4NPYA 4P4RA 1JGDA 3MBXH 4OQTA 5ALCL 5AZEL 5GGQH 5L2KB 2Y1VA 5IBLD 5J1SC 3K4ZA 2VLMD 4N0UA 5FM5O 5MERB 3STLB 4LCCC 4NT6B 5LAXA 4XZUA 5DJAA 5T1KA 3O6ML 2XZCL 3MROA 1RK1A 1G9EA 1SM3L 4K7PH 4JDVA 1V7ML 4NKOA 1L9MA 1KB9J 1EEQA 1XR9B 1QBML 2BFVH 4K8RL 3M8OL 3D0VA 1ZT7B 1CXIA 5BXFA 1JWMB 3BIBX 3KPRE 4P59L 5CP3H 2PUQT 3GSNH 4PGZA 1KN4H 2GK2A 1BBJB 2FEDC 4LLWA 5FM5M 1J88A 3ULUC 3V7MA 4Y2DD 4D0CB 2BVQB 3B9KA 4OFVA 5I76B 4KKBD 4XP1L 3I02A 2FX7H 4OZHA 3SJVE 2EIZB 3QIWB 3S97C 5D6CA 5I73C 3EOYG 4AMKH 1ZLUH 3U7WL 2VDLH 5JMRA 2Z4QB 2OTWB 3IDJB 2BNQD 3RTQC 3RIAF 3BWAA 4JO1H 4LPYA 1IL1B 3WS3B 5GSRA 1BIIA 5EIQA 5EA0L 3WCYA 3HR6A 1K85A 1MEXH 3IJYB 4EKXA 3SE9H 4JFFD 4LSTL 1OAYH 4N8VG 3P2TA 5FUCC 3BZEB 3O3EA 4K8RC 1CGSL 3C2AL 1PG7L 3TVMB 1L7IL 4U7KA 4Z76A 4MNGA 3EUUA 5FA4B 4AH2A 4X6DA 4XRCA 4DKDC 4E42A 2CUMA 4ZAKD 1MQKL 3OX8A 1YMMA 3LRSB 4NO0D 5B38G 1DEEB 1G7QA 4R0LC 1WZKA 5IB5B 1JNLL 2JB6B 3PXJA 3VXMB 3ARUA 4JFPB 2UV3A 1NC4B 5IVXA 1ZLVH 1CI5A 1AI1H 2X4RB 5HDQH 4MMXC 1PKQE 3D85D 1WSST 3B2VL 2FRGP 1NMBH 1CU4L 2PO6C 2QADC 3FB5A 1KFAL 5HPMA 2K3TA 3KVQA 1RZ8B 1GGIL 1AH1A 2FB4H 3TZVD 2B0SH 3MLRL 4H20L 4G9FA 2XZZA 1RU9L 1FQ9C 5DTFB 4KDWA 1P7QD 4MNQD 4ZNEA 4HLJA 5H94A 3TV3H 5I9QC 5K9OB 5A2LH 4AL8L 4LSQH 1QNZH 1ITCA 3ARFB 2H26A 4APQD 4Y89A 3P0YH 2OJZL 3LZFH 3KPNB 4ZDHB 3T0BA 4WDIB 4ZOBA 4LPCA 4PRID 4LNRB 2HA1A 2DBLH 5BZDB 2X1WL 4AIOA 1WWAX 3HI6H 4E41B 1I8IA 2FJHA 5B8CA 1U8PA 2B4CL 3VGDA 1DEDA 3DO7A 2CQVA 2HH0H 3MRQA 5IESH 1DLHB 1DE4B 1IEBA 3WFEL 4K23H 1EGJH 5FHBH 3PWUB 1MLBB 1XH3A 4H8WH 1F4HA 4OCYH 2BSRA 1BECA 3TBSB 5CIPB 4YHNB 2FSEB 2EDDA 2W92A 1AHWC 3QI9D 2FR4A 2DQFA 2A9ML 3EDEA 3QXDA 4PRPD 4QTHA 3JTSA 4G3YL 5D4QA 2HN7B 3OAUL 5HHNA 4WJ5B 2CIIA 4FFYH 5FKAB 2UWEF 1CGVA 2EH7L 3QWOB 1RZKL 4G7YL 5ESVA 4IOIB 4DKEH 1IAIL 4U1IA 3GSWA 5JW5B 3MRCA 2GJ6A 1X3DA 4AIXA 2DQDL 2X10A 2V17H 1PBYA 4L29A 3VXUE 4N1HB 1AGBA 1MUJA 1TJHL 3CFDA 4UU9A 4QRPD 2ADJA 5ITBL 4IIQA 4GQ9L 1P4IL 3FT2A 4X5WB 2WAHA 4WNQA 2VXTL 1AXSB 3MA9L 4JY6A 2UYLB 5L88H 1X5FA 2APWA 3O11B 3CGTA 2B4CC 3O9WA 3SDDB 3G5XB 4EDWH 1KLUA 4RZCA 3RWCB 1YN7B 4ZO7A 4M1CC 1NAMB 3ULUF 1HHJA 4GKZA 1TJIL 3IDIB 1MFEH 1INEL 3QG6B 4DAGL 3WDIA 2CIKA 4JZNB 3LPGA 2XRAH 3QDHA 3GJEB 4YO0A 1BQLH 4HD9A 3L95B 1Z0MA 4W6XB 4I0PC 2WBJB 3U6RA 3VFSA 1J0HA 1U3YA 1E28B 4LCCB 4EEEA 4F9PC 3LMJL 5HGGS 4E0RB 3T04D 3SE8L 4QYOA 4UAOC 5I1KL 1RZKC 4XNQA 1NCBH 3MLXL 1S9WB 3VMNA 3D25A 1FGNL 1GVIA 4KZEH 2NW2B 4WWKC 3H7BA 5E0QA 4K9EH 2J6EA 5K59E 1XGUB 2Y4SA 2OM5A 1BEYH 5I2IB 4JQIL 5C0NC 2I9TB 1N0XL 5C8JA 3DV6A 3C6LC 3FO1B 3TT3H 4F7EA 2BOBB 3ILQD 2VH5L 4K7FB 1DVFD 3AAZA 4QEGA 4YHYC 1N2RB 2P24B 4NZRH 3E1F1 4A6YB 3FB8A 4ZFGL 1KPVA 1DR9A 2M2DA 4FFZL 1DDHA 1FORL 5EBWA 5I73B 3OKMA 4MYWB 4JFXB 5HHMD 5I1JH 4HH8A 3KLHC 3RTQB 4FQIL 2NY3C 1IKFH 4ODUA 2PTTA 4FQQA 5LCVL 2OJEB 4R4BA 2R0ZH 4XCNA 3TO4D 2AGJL 1CE6B 2XPGB 3MXWL 1FZMA 3LEXA 4XCCH 1WFUA 2O26U 3HC0B 3HPLA 1GJIA 1A1MB 4HW6A 3RVWC 3HA0A 4OZIA 4J3WA 2ICWI 1JF1B 3BD4A 1QKZH 4TRPL 3DIFA 4JFFE 4YZFE 2FHCA 5KSAC 4F7PA 2X1PA 2QKIB 5ADPL 1RK0B 3DARA 4QOKE 3F5WA 4NIKB 1F42A 5C9JB 5FOBB 1NCCH 5ICXB 4XHQA 2O61B 3B9DA 3QZWB 1I9JL 3N06B 1Z3GH 3QPQD 5DVOA 5CEYB 3V4PH 2ZG3A 4L9LA 3DX7B 1YY9C 3UO1H 4GW1B 3GMLA 1J1XL 5C0BB 2PO6B 4PJGE 1NGPH 4KQ3H 1T89A 3TNNA 5D7LA 3WIFB 4E5XB 4U1SA 1FIGL 4WO4D 4RCAA 4Z5RA 3VFWB 3TN0A 4RGOL 4ZTOH 1FFPA 2FL5B 2E9WA 5SX5H 5DJCB 3KJ4B 4LSUH 3B83A 3LN5A 3PWJB 1LEGB 5GS0L 1LP9F 4XNYL 4NWTH 2DF3A 1UM4H 4HWBL 1MVUA 3FFCB 5JPMB 1XF5B 2NY6B 3BYYA 5H8DA 3P30L 4OSUL 5F93C 1BBDL 3K0WA 2PXYA 1QYGH 2Z35A 4PG2C 3SO5A 3TIEB 4GMTH 2VLJB 1JHLH 1PD6A 2DQIH 2KQMA 1MCOH 4LASL 1HOCA 43C9A 3DV4A 1AXIB 2WM0A 4RMVA 2AJYH 3QFJE 1K3ZA 2MHAB 3K80A 5CJOL 4MS8C 1R3LB 3WFBL 1B4JH 1E4WH 1GH7A 4Z7UA 2DWDA 1JGVH 4M5YL 1A6WL 2NY5H 1Q72H 2Y5EA 4PJ5D 2CLVB 5BW7A 4RAUA 4LLYB 2ZUQB 3X3FL 3GI9L 1FZOA 1C08A 4Z7WE 4KMTH 3VFNB 4LIQE 4HWZA 1BQUA 2AK4E 2PYEB 4PJHE 5HJ3A 1YYML 2ZOKA 5GRZA 1AGEB 2APFA 3N85H 3VMOA 4YBQD 3BUYB 2EDKA 2ZOLB 4OTXH 4P57A 4RNRA 1C5BL 2VDRH 1WCBB 2GHWB 3CLEH 4IJ3C 4G8IA 4YDIH 4HIHA 1M05B 5GS0C 3HNVH 3SGKA 2HRLA 3KYOB 3U7YH 5ILTH 1H8NA 3GSOB 2OR9L 4AQOA 1N8ZB 5DO2C 5JIIA 2H45A 1KACB 4OM1H 4IRJA 5F9AC 3VH8B 3KPSA 4RDQG 4HS8L 5EU6E 4NRZB 1AY1H 2DLFL 3WO3B 4UT9H 1G6RB 2H3NB 2HAZA 4NM4H 3ZHDA 3G08B 5K9KA 4UV7L 3EJYC 5EU4A 4XNMB 1PJ9A 1UJ3A 3JVGC 1B88A 4KQ4L 2ED8A 3V7AE 4PJCA 1NCDH 1UXWB 2R4RL 1RZJH 1CFSB 4QRPE 5D8JH 1HK6A 1ADQL 4JKKA 4EI5D 4GRWF 4HH9B 4S1DD 1E6OH 3V8OA 4WEBH 2ZUSA 4NYLB 3W39A 1MAKA 2VDOL 4HZLB 3SN6N 2XWBA 4M03A 5C0DB 1S8DA 3NTCL 3GBLA 2P7TB 2R1WB 4H26A 1I1AA 4M7ZB 3TESA 2DJ4A 1RZIA 1T6VN 1OD9A 1VACB 3SKOB 1VGEL 3GMOA 3MO1B 4UAOB 3UTZA 1T20A 2J4WH 1V3LA 4H25B 3RGVD 1A2YB 3QO0A 4EIZC 4YDJA 4RX4A 5EH1A 4C54A 4OGXH 1OP3K 5DQ9B 4M43L 5JQHC 3MNZB 1F11B 5HGAA 3VD9A 2YOCA 1UCBL 5CJXC 5SWZA 2JJUA 4AEIH 1BF2A 1J86A 3RWHB 4FQXD 2FIRT 2I5YL 3MRLA 4TSBH 3C6LB 4M62L 5MHSD 2YZ1A 2YBRB 3ZDYE 4HFWA 4XWGH 4GRWB 1MFAL 3FQRB 1XR9A 5GRVL 2Q6WB 3W2DH 3ZKXC 2HLAB 3EDDA 2AXFB 5FGSA 8CGTA 4ETYA 4JANA 4I3RH 4QF1A 3L3KB 4G6KH 1P4LA 1EHNA 4KKAC 4ZPVB 4GAJH 3PF2A 3CFEA 3WKMH 4IDJH 1BBJA 2KPNA 3ESUF 5DVMA 3ZO0A 4O02L 2LAGB 3VW3L 3DSFL 4NQEE 4LSSH 1JTPA 2OXHA 2AJVH 1RPQA 1IKNA 3H9SA 1AKJD 4LAJH 5E6IA 3PG2A 2P5WD 4F9LC 4XWOD 3QEQE 2NX5D 5FB8B 3TNMB 1QBLH 1SBSL 2IFGA 1AGDA 2Z4QA 3T77B 2NPLX 4ZG1A 2R2EA 4KHTL 5EZIH 4BSWA 3IDJA 2JLLA 3ARED 3BIKB 4FA8A 5GGTA 3S3PA 2M26A 4MD0B 3P73B 2D31B 4WW2F 4YGVA 2C3VB 5D7JD 3C5SB 1ZT4A 4XNXL 5I8KH 4NQSA 2AK1H 5KSAB 5FO8B 4NO5A 4KJYA 2AQ2A 4LLDB 5DFVD 4KHXH 5EZOL 1OHQA 2BNUB 2ZCHH 2X4SA 4WUUB 1NEZA 1QOKA 4JFDA 3VGBA 3KXFA 1DFBH 1OARH 3VWKC 5F88B 3S3JA 1DEEA 3QUMH 4TVPD 6FABH 5EOTB 3TP4A 3BH8A 4LNVA 4Z95H 1FPTL 4CVXA 3S88H 4LARL 4QTIH 4L4TE 1D5XB 2FLBT 4HCRA 2EDFA 2Y7QA 4PS4L 5JO5B 5JQ6L 4EI6A 2WWKO 5DJ2B 3HMXA 1EEYB 5KVDL 3RWEA 5EZJB 1WAAF 4WW2B 4YHZL 5FO7A 1I3UA 1YNTA 2ZSVA 3OB0K 4XI5C 4PV8A 1VEOA 3IJHA 5IG7A 4HJJL 3QIBC 4M5ZL 1KIQB 5DHYA 4EN3B 2IQAB 2CKBA 5EORL 3PWPE 1H5BC 3RWGB 1WBXB 4F3FB 1W72B 2G60H 4I5BB 4UBDC 1D5IH 5CCKH 2F5AH 3HZMB 1R5IB 1KCRL 4P5TD 3ARFA 1Y18A 1ZA6B 4S1QH 4WTXA 4OZFB 7FABH 4QRTA 3C08H 1RMFL 1A3LH 3VFMB 3OXRB 5BJTA 3MA7A 1XGYL 4LEOA 4IRZL 4IRSC 2VZ3A 1ZHNA 2IANB 1DBMH 5C0AB 1LHZA 2COQA 4Y5VB 5BZDA 2QTEA 2HLFC 1M71A 4J6RH 4L3CB 3PV6B 3C5ZC 5CP7B 4N0YL 3NPZB 1T83A 3UP1A 2QSQA 3HMWL 4GG6B 5SX4H 2NY0B 1NGQH 1B0WA 2JK5B 5DJ8A 1IQWL 2GITB 2DTSA 1MLBA 3I6LE 3U79A 2FJFB 1GC1L 1YC8A 1Y0LA 4YHNA 1F8TH 1JZ5A 4QGYA 4PJFB 4RGNC 3X11B 1T7YA 2HWZL 5CSZB 2AEPL 4OFYA 4FQ2L 3HR5B 4MJIE 4A2MA 1TVHB 4XAKD 2HN7A 4NOFA 4DQOH 2APBA 1MCQA 4OCRH 1EJOL 3QWOA 1GL4B 3LSOA 2JKXA 5FO9B 4WFFD 3DMMA 2YD6A 1WQVT 4KY1L 3FB6B 2ICCA 4XXDA 5I74B 2JJSA 3DETD 1FJ1B 2LTQC 3G5YB 2BZDA 3HAEH 3QDJE 1VPOH 1JPST 4QHKJ 1FG2B 4LQ1A 4AEFA 4CW1B 1ZS8B 3KR3H 1EPFA 4UMGA 2XTLA 2DM4A 3FOMA 1T5WB 2DQTL 2UYLA 4P5KB 4OI7A 4Y4FC 3O11A 4HPYL 4OZGE 4ZODA 1TPXB 4R2GC 4MNHB 2F53D 4ZPTB 1TFHA 2IPUK 2AJSL 3CMOH 3KWWB 4AEHH 1PYWA 3K8LA 5CJ5A 2W0LA 1G7LA 5E9DB 4UQ3B 4Y4KD 1OQXA 3OKEA 2KZWA 3UDWA 3WXWH 5IQ9A 3QSKB 2UWEA 2VLKB 3TWCH 3ARGD 1NQBA 5KW9L 2VXVL 3L95A 4YC2C 1S7VB 5TF0A 5DEGA 2QJDA 5JDSB 3UTPE 3QYCA 3S6CA 3CFKA 5HYJD 4XVTL 3O8XC 4JO3L 1S9WA 4CJ1A 3SDAD 4FTVD 1KCVH 3GB7B 4KI1A 1OF2B 2R2CA 1X7QA 2VJXA 5GS2H 3VFGL 5IGXL 4KMLB 2DQGL 4P4KB 2R4SH 5F3BB 1T03L 4KJQD 2YKLL 5KZCB 3ULVC 1YEJL 1MRCH 4DGIH 3FN3A 2Z8RA 1QRNE 3HC4L 4JB9L 3MC0A 5DRNB 2FH6A 4P3DB 2OTUB 5L7XH 4XPBL 1JK8A 1MJUL 3QWRA 3DPBA 3LKOB 4X98A 4RFEB 3P0VH 4AQ1B 3S5LB 2ZSWA 1R3JB 1FYTB 5JW4M 1HEZA 1LO5B 5HDOA 2PYFA 2EDYA 4JM2C 4G6JL 1DUZA 1RUAL 5HGHA 3FQWB 1U8OB 1OSPH 4JRXD 1PZUB 2NMSA 3P9WB 2OJEA 4K3EH 2NX5E 1KJ3H 5EC1B 1VERA 2B8OT 2E8YA 3C9NA 5SWSA 1P9MC 5ALBH 5KJRH 4W70A 3LB6D 3HC0A 2P8LB 1QSEB 2EDTA 1RD6A 2FHFA 2BRRH 4P46D 1FH5L 5I66B 1DSFH 1HILA 3SPVB 3UTTD 4P2QD 4XTRD 4KZDH 3UPAA 5FKPA 2AVGA 4LPVA 4PRHA 3QZWG 4X99B 1KT2B 3EDKA 4UT6H 3RA7L 5IV2B 4KK9C 4HXAL 1GPOL 5KVEH 4HULB 4KROB 4R0LA 5HHVH 3GSQB 2C3GA 3VG0H 1WWWX 3HI5H 5ICXA 5HD8C 1I4FA 3MLZL 5IFHH 4TQEL 1KG0B 4DCQB 4OLUH 4MAYB 2OP4L 3BP5A 2XT1B 3R0MA 3MLVH 2Y06H 4LSPH 1TENA 1F4WL 3MJ9H 4NKDA 1XF2B 1N5YH 3GMPA 2Z8WC 4E5XA 1JHTB 1EIBA 3BPNB 3T65A 3MLTB 4WWID 2HFEB 5T1DH 5DJCA 4LHUA 1EZVY 1CS6A 2HFGH 3ZE2F 5EO1A 4HXBL 3Q3GA 4LKCB 5IF0A 4RFOH 4K94H 3HG1E 5E8OB 1BOGB 1SVZA 3ILPA 1XF5A 3UTSD 2JCCE 2V2TA 4XPFL 3WS6A 4X7TB 1G1YA 3U4BL 4YNYB 3EJZC 4I48B 3MBEB 4GH7B 4DK3A 4LHQB 4NKQB 4KXZH 1AO7B 2AAVA 4NZJA 1U42A 5I1HH 3C5ZB 3LPWA 4U1KB 1JMZA 1GOFA 1AP2B 2YA1A 4GW5B 4O2EB 1U95A 3QCTH 3RNKA 2X40A 4KJWD 4L4VA 4NQCD 4QHLA 4HK0A 4JHAH 4LLYA 5TFSH 4QWWD 2GJZB 4U6XA 4EDXA 2G75B 1I1CA 2NXZD 3WE6B 3U0TA 3I3EA 1AHWA 1CGWA 5H2BA 3R8QA 4N0RA 1LP9A 1Z9OA 3BUYA 4ZTPL 4GKNA 4AY0A 3IVKB 4HG4K 1F4XH 3VH8G 35C8L 3ZL4H 2MSPA 4NRXA 3VXOA 1WCBA 2R1XA 4GW4B 1OTSC 3O6FC 3FQXA 1YN6B 4XBGA 2O5XH 3TJHC 4FS0A 4HT1H 3P4MB 2X4NA 5LBSL 3VGAC 4ZSOA 3OR7A 4PRBB 3GMMB 3WYRA 4NQXA 3E2HC 1IRAY 1QQDA 3F7YA 3G04B 5BMFH 1UKTA 4X7FC 2ICWA 1CFVH 4X4YA 1GHFL 3ROLA 32C2B 4PJ8B 3PP4H 5MEQB 3O3BB 4UIMA 3N50A 2APTA 4Y4FB 3D3VE 3ZSSA 3OHXB 3UYRL 3ULVF 1UXWA 3VFOA 1WEJL 1EFXA 1ZLWH 1J8HB 1C5DB 1BD2D 1BHGA 2Z31A 3JWOL 1SYSB 1YNKH 3MYJA 5AUMA 5DXWA 2DQEL 1KLFA 1MY5A 2CO7B 5F9WB 1A7NL 1QFWI 3VFPB 1BAFL 5CIPH 3VWJD 2R1WA 1JNHA 5I8EB 3WIIH 1H0DA 1FZKB 2W9DH 4I0PA 3SKOA 4F9PA 2FIKA 3KJ6H 1N3NA 1UB5A 3GK8L 3PL6B 3VFUA 3O8XB 3QDGB 3WO4B 3IDYC 2CK0L 5D70L 5KVGL 1FFNB 1RIUL 1YYLH 5KTEH 1CFQB 4WWKA 4NQVB 2XTJE 5F1IA 4HUNB 5D7IA 2OI9C 2FGWL 4WI5A 4XNUL 1DBBL 3EHBD 3ZYJA 5KS9F 4HJGA 4JREC 1F97A 3MLYH 5HYJE 5IB3B 1YEHH 5C08B 3T4AB 4WHTB 1KN2H 3C6LA 4NC1E 3TC9A 1WBYB 3RVUD 4JPWH 4QCIA 2H2SC 4FTVE 4KK6C 2Q6WA 2C4FU 3AMKA 3DTXA 1C5CL 2AXFA 3Q6GL 2CK2A 1FO0B 1PY9A 3KPPB 2F8OA 2A6KA 2UUDH 3L3KA 3BN9D 1I7TA 4I18B 4MJ6B 1OM3H 3MV7B 1WT5C 4HKBB 1KNOB 2VABA 3C2SA 4YHLH 2J8HA 4BQ9A 3ZKMD 4LCYA 5DHVH 5DLML 3IETB 2OXGA 4GS7C 1LO4L 3MUGB 2QBWA 3RHWK 3VXTB 5DYOB 3GKZA 2NR6C 2VXQL 2E9JA 1RVFH 2GAZB 5CJQL 1H9VA 5EUKA 4ODTL 3S37L 5KS9B 1F02I 4JCLA 1Q9KB 5E8DH 1I8KA 3T77A 1LEIB 4UDUA 3Q1SH 4G6MH 4JRXE 4C56E 5TE6L 1BQHA 1RURH 2D31A 1ACYL 5IVNA 5D7SH 3OKKA 2OZ4L 3EGSA 1X4ZA 1JGUH 2IH1A 3LAFA 5F7MC 4OLEA 2Y6SC 5I8CB 3K4DA 1E6JH 1NBVL 1K4CB 3Q5YA 4R7DA 4WHCA 3D39A 5TGBA 3BVNA 4JRYB 2WV3A 1UJTA 4HUWB 4G6FB 3UTTE 2DDQH 4KKLD 4OF7A 1AQKL 4Q6IC 4AK1A 3OPZL 4WUUA 1C1EH 1FLTX 1EAJA 1D5BA 1BVKA 3ORJA 5D1XC 4XC1L 2PN5A 4JGUA 4LGPB 2OL3L 3E8UH 5A1AA 1XGPA 5F7LB 2CH8A 3DWTA 4XMLH 2YK1H 4XPGL 5BOZG 5IHBA 1FVCA 3QQ9C 1EFQA 1H3PL 2EC9T 4ONOA 4YBLB 4QRRB 2I27N 3GSRB 5DJ2A 1YC7A 3G6JF 5MENB 2GSIB 4R3SA 1I7ZA 3IS1X 2IBZY 4BZ1L 5DC9B 4Q97A 2QQLL 1CWVA 4J23A 5T1LA 3H9ZA 4N90D 4OZFG 2X4QA 2VC2L 2GUOA 1T3FB 4F3FA 2XA8H 1A6VH 3IAPA 2VN7A 5EBMB 4UNVA 1YPZE 1G84A 4NBZB 3S35L 1Q9WB 2CJUL 3C60C 3BP4B 4LCUB 3UTSE 2Q8AH 2D7OA 3UTOA 2N4IA 5E1AB 3VFMA 3QUYC 4YFDB 1I8MA 2EE2A 2VISB 3OJDA 1TNNA 3MOBL 4NKIL 3TYFA 2YD5A 1IGMH 3VGFA 2V2WA 4I3SL 2W0KA 4JKWA 3BISA 1ZGLB 1Q0YH 2PR4H 1NANH 5L8LB 2EYRB 4HWNA 2AABH 1CDCA 3G6JB 3AVEA 4LPXA 1HKFA 1WAAA 3ARQA 1CTNA 4U1MB 1UEMA 4JLRA 2YD8A 1OGAB 3U46A 4GBXB 5C0IA 1E27A 5DZNA 2IEPA 3B6SB 4DUVA 4HWBA 1DL7L 9CGTA 4EOWH 1LO3H 4ZNCD 5C07D 4MQXC 4WTZA 3O6KL 5C92A 4Y4HC 1UZ8A 1U91B 5IKCA 3N1QC 3HNSL 5DD6A 2OTPA 5C0JA 2DRUA 4LP5A 5GISL 4UILL 4DK6A 2X70B 5IB1B 3CFBA 3O3AB 3FRPA 3JVGA 4HS3B 5TDPA 5I17B 4NHUA 3HZYB 3G5YA 5DURD 1KTDB 5CJ8A 3NH7L 3EYSL 1SBBA 5H35A 3WJLC 4P48A 4BKLB 4S2SB 5C0CB 2XFXB 1ZS8A 3F6LA 5E8PA 1T1XB 1EHAA 4YHOL 5DMIH 5DD3H 4MDJB 3BP6A 2DBJA 3EO0A 4P5KA 4CU7A 3I75B 3VXQA 2FO1A 2BC4B 4RQQA 4LLUB 5DJ6A 3HE6D 5CS7A 5F97E 5D71H 4R96A 3I50H 4TUJB 5GRJL 2ZG1A 3LS5L 2ARWA 1Z0NA 2HKHH 3E6HA 2O5YL 4J7RA 4MXWH 2V7NB 5FGRA 4WEMB 3CDCA 3TPKA 3V6ZA 1RULH 5GS3A 5L6YH 2F5BH 3DECA 4PJBF 3IDXL 1FC1A 3NOIA 2R39A 2YPLB 2YA2A 5CJXA 1MJJA 1DUYA 2LU3A 4Z77B 4NQDE 1G6RH 4Y1AD 1LEKA 1T2JA 5F8QC 5CGMA 4HF5L 3RKPA 3T0EE 3U4EB 1IAIM 4PLKC 1ADQA 2B1AL 5D7KD 4BFIA 3H3KA 2VL5B 2E6JA 3Q48A 2HVKA 4LCWD 5F3BA 3QUZB 4YDVB 4F7TA 4GRLC 4JFOB 3HB3C 2FJGB 5D1ZD 2HKFH 1YMHB 1KC5L 5LKNA 2VXSH 3UMTA 4F33B 3OZ9L 1K5NB 3GGWA 4G8GB 1DQQA 1XF3B 4PJBB 3PHQA 2IAMD 4F9LA 2CO6B 3SGEI 1AR2A 4OCSH 2YS4A 5B39A 4QXUL 1F2XK 1K8DA 2A6IB 3D69B 3WXVL 4O9HL 4NUGL 1A7OH 5AG9A 3MRRB 1U8OA 5GHWH 3PWVA 4CMHB 4M93C 5ACLA 5GS1B 5JHDD 1QR1B 4GXVL 5JR1L 1CICB 4Y5XC 1ZVHA 4F80A 3DHMA 2LAAA 5FF6B 3NIDF 2GFBB 1CIDA 4KMQA 4WCYL 4PB9L 1JF5A 1NGYB 4F8QA 4Q6YA 3T0AA 3DSNA 5I66A 5FDYA 3CZJA 1R6VA 5GGRY 1T0PB 4IOSD 4RRPG 4WHYG 1WZMA 1OAKL 4UT7L 2F74B 5D1XB 4NZUL 12E8L 1FVEB 3VWKA 3ARXA 4Q2ZA 3CVHL 4RFNC 1U8IA 3L3OA 3EFDH 2B7DT 2APVA 2QQNL 3LQMA 4K3DH 1CG9A 2W65B 4JN1H 4O58L 3MPCA 2AJXL 1BFVL 5DK2B 2I60H 5JORB 4QY8A 2VERN 4XVJL 3DRTA 4UTBH 4UOJA 5J1AA 5HGDB 5HYEA 3A0OA 3CIQA 1HDMA 3SJVB 3MLTA 1KCLA 1BVLA 3BT2L 1FLRL 1JWSB 3QIBA 5E24E 2J8UA 4P3WA 1H5BA 3LDBB 5FYKU 3MCLL 4LKCA 3V9FA 4Y2DC 3K1DA 3REWB 2X4TA 2MPAH 3X12B 5IB4A 3KYAA 1A4KB 5DI8B 2ID5A 2AV7B 4UINH 1SEQH 3LS4L 3VXPB 2NY2C 5TF1L 4MD4A 2MCPL 2BVPA 1IC4L 3C6SA 4IRSA 1NFIA 1ZEAL 3SDXE 2WWMD 2HJKB 2W59A 2Z93B 5CEZH 4NC0B 5HYSA 1NCWH 3HZKB 1AO7A 4Q7DA 5BZWA 5D72H 2NTFA 2HT2C 1FC2D 1JPSL 1JTOA 3C5ZA 3L9RB 3O41B 1D5ZA 2ERJC 4NM8H 1XCTA 3NZ8B 2VQUA 5HHOD 3L3GA 1KTLA 2YPKA 4B0MM 5T3XL 4CGTA 3MACH 2GY5A 5D1QC 3TIDB 2WUBH 3SGJC 3MRPA 1NMCC 4M7KH 3SCMD 3RHWF 5ANMB 1CDGA 4HV8A 4Z7VB 1WIUA 2CDGA 2WLYA 4F7CA 5J56B 2VDMH 3T2NL 4FG6C 5CWSA 3H3BC 3DXAA 4TN9A 1NAKH 4KRPC 1FBIL 1EEUA 4LIQL 5F9JA 1T6WA 1FRGH 1IGCH 2AXJA 2QHRH 4FQHB 3CK0H 1WIOA 4ALAL 4HHAA 4PRBA 4D9LL 1PEWA 2VLRB 3MNWA 1A6TB 3MV8D 1WISA 3ZT5A 1NUFA 2R8SH 5CD3B 1IFHL 4Y19B 4LFHD 5DDHA 4OD1H 5GRVK 4V2BA 32C2A 1HQ4B 5IT2L 3VFTB 2IMNA 4K71C 4N9OB 4Y4FA 3PWNA 5B4MC 5DUBB 4Z0XB 2V7HB 3F12A 5F1SA 2BY2A 4JFEA 1U3HC 3BDBA 4XP5H 3BZ4A 3L7FA 2FX8L 3L1OL 1F5WA 4U1GC 1HYSD 5DJ0B 5E2VL 5BO1H 4ZUSB 4LVHB 1T2QL 3O4LD 2YEZA 3VA2C 5JUEH 3D2UD 4NGHH 2IG2L 2APXA 1MAMH 4F2MA 3VFPA 3R06B 4Q9BA 4L8SC 4F58H 1TJGH 3UJJL 4V1DE 4BFGA 1XZ0A 4PGEA 2FATH 1TZHA 4X8JB 2SEBA 5EWIL 1FZKA 1JRHI 5JOEA 2XWTB 2ORBL 4L8CA 3KYNB 3KG5A 4I4WA 1NFDA 2PTVA 3IFNL 3WBDA 1XF1A 4MD5A 2IH3B 5KOMC 1CFQA 1A9BA 4WFHD 2ZUUA 4QLRA 3C8KA 5E2WL 3MRGA 1G9NH 4H1LH 2ZNXA 1FP5A 2A1WH 2BNRA 5E00B 3SKNA 1RIHL 1RY7B 4P2OC 4TSCL 3QRGH 1HINH 1NJ9B 5F3HA 3WEXB 5C08A 4WTWA 3B5TA 1R3IL 1GGBH 5JXEC 1TZIB 3VXUB 4FQJH 4CN4A 4E41E 2Z92B 4FXKA 1S7QA 5EU5B 3KPOA 1OGTA 2F54A 2DQUH 4LCWE 1ZSDA 5GQBA 1MHCA 3RI5K 1REIA 3GO1H 2F15A 5K59F 5I19L 1HXYB 1KV3A 1QZ1A 1UM5H 4JM2A 4FMFA 2Q86A 1JPFA 3TBVB 2FDBP 2VIRB 2D7MA 2DTMH 3RDTC 3S3SA 2JIXB 1KCSH 4YHKH 3FAWA 4M6NL 4G9DA 4NOBA 1INDL 1LE9B 2CXKA 4PJIA 3S36X 4BELD 1P9MA 2WWKT 3QDMB 1GCFA 2NY4D 2X7LA 3BZFB 4OD2A 4F57L 4LBEA 4P9HH 5GJTH 5INCA 4LEXL 1IE5A 4JDTL 3ULSB 1JYNA 3RWJB 2R0LH 4DW2H 1MCWW 4R4NC 3QXVA 4PJDB 4YX2L 1GRWA 5AAWA 5JLZB 1JZ2A 2CDFA 1WIPA 3RU8L 4QRSA 2H32A 4FP8L 1QVOB 5TJWK 5GGRA 2DOCA 4B53A 1U6AH 3GHBL 2ESVA 4U1JA 3PJSA 4PJXA 3MLWL 3ARDD 3RUGF 2YXMA 4PV9A 1FAKT 1C7TA 2OYPA 4YDLC 2C26A 2IQ9L 5F6IB 4X6EB 4GOSA 4YZFF 4I13B 1BZ7B 3H9HB 3JWDL 4FABL 1HHHB 4PJEF 3LKRA 4G42B 3GSRA 4BSVB 4GLRH 1JV5B 4XT1C 1MCBA 4EUPH 3TA3D 1IQDB 4JN2B 5FDWB 4Y2DB 4HIJB 1JWUB 2IWGA 1DQTA 2J6EH 1BX2B 5IBUB 4QHNB 4R7NB 4DN4L 3Q2CA 4PJGF 4NZTL 2IPUG 1HSBB 1UM6L 1XCQB 2VWEE 2NYYC 4M7JL 1MI5D 3MZGB 4U3XA 3EYVB 1JN6B 2A74A 5EBMA 1ZHLA 4M3JA 1Q9WA 2BNQB 5KSBA 3E6FB 1IVLA 1UWGL 1GAFH 2ERJB 3MRHB 3RUGB 3DYOA 1LK3H 5HI4D 4YHPA 1S5IL 4JO1L 1J8KA 3RIFK 4PP2A 2IPKA 4CU8A 1CFNB 3B9EA 4HX1A 1Z9SA 4JFFB 3B2UC 1R5VB 1YJDH 3DX9B 1SMOA 1NMCB 4PJEB 3G5VB 3W0WA 4TPRL 3PUCA 4TOYH 4GKSA 3CPLA 4NN5C 1MFBH 1RIVL 3OXSB 1X5JA 3JWDC 2HTLD 1D6VL 1ZWIA 5IQ7L 4J3TA 3QWQB 5HI5C 3O6FA 2YZ8A 4NO0B 3INUH 3BXNB 5CHNA 4X5XB 5T1KD 4PJGB 2E7MA 4YUEL 2OBGA 3MV9E 1FV1B 2ATKB 2DS4A 4KVCL 1AR1C 1S3KH 4Y5YC 2KL6A 4NN7C 4Z7WF 3THML 1JPTL 5F7FA 4PJHF 3JV0A 2FH8A 4OJFL 5GRUH 3TFKC 3PGDA 5DJZB 2JJWA 3D85B 1Y6MR 2O5ZL 2XZAL 3X3GL 5SWQB 4NHCL 1TVBB 4FNLH 1BGXH 4G43B 4OUUB 1DZBA 3TZVB 4RISL 1U8LA 3QXAB 2WLZA 4MJ4A 3B9KD 3L3JA 4K2UH 2FZ3A 4UNTA 3PV7A 4ZO6A 1OCWL 1P7QB 3NACL 2Z8SA 3HZYA 4U1GB 3LEVL 1KTDA 3IKKA 3U0PB 3E3QE 3MUJA 4XHJC 5C0CA 1KB5B 4ISVB 1BWWA 4YAQB 2FWOB 4LF3B 1I7UB 1JZ6A 2GTZB 5LXGL 5C0BE 4FFVD 1INQB 2DI7A 3SDCC 1C8PA 4NSKB 1OP3H 3I75A 3KHQA 3VCLA 3VXNB 2BC4A 2MQCA 2XXMB 2R0WL 4OB5H 4PRIB 4NCC1 3OJ2C 4PGDB 5EC2B 3VXSA 1WICA 1X6NA 2C3WA 4Z7WB 3UYPA 3BAEL 1KJVB 1OQOA 3RX7A 2V7NA 5ADOH 5EU7E 4NO2B 1RZFL 3A6CL 1VFOA 1NGWB 3LQAH 4L3EA 3FFCE 1B2WH 3C09C 1CK0H 1KIPB 5ISZA 3CMGA 2VLJE 3RX5A 2I24N 3BDYH 4XMPH 3QNXA 1W0YT 4IMLA 5T3ZD 4OKVB 1YMMD 1UADC 5LGHH 3QI9B 1ZA3A 3LH2L 3WKNA 4PRPB 1MHHB 2AXGA 2GW5A 5M94B 2ITCB 2DWEA 2YC1A 4YDKL 1EA9C 5EU6B 2KDGA 1I1YA 4JFYB 1U58B 1NDMB 4W4NA 2VL5A 1BP3B 5IIEB 1YA5A 1WT5A 2F58L 5BS0A 1JYVA 4G9FD 1YY8A 5IW1B 4P5MB 4QRPB 1FN4B 3GBNL 1HIML 1AQDB 3ZDYF 3MYZA 4PJBA 2DKSA 4AIZB 3BPOC 4NP4H 4K55A 2IJ0C 2BDNH 1XGRA 1QG3A 5HI3C 5I1CL 1K8IA 1T66C 4LSVL 2G9HA 3MRRA 25C8L 2VQ1B 4HEPG 2EDBA 3GSXA 1XIWC 1YEFL 5I6XB 4D9QD 4QO1A 4H8WC 4KUCD 4WIQA 4KTEH 4U6TA 3UZVB 5FCUL 2GK0B 4YXKL 1LK2B 2DN7A 5J11B 2E7LA 2K1MA 3DVNB 3NGBC 3PWLA 3WMSA 4Q6IA 4UIKH 3WSQH 3DX6A 1QFUH 2X1XR 3L5WB 5CMAB 3BHBB 1FVEA 4D9RD 2VDPL 3Q5OA 5IMOB 5AYUH 4KDVA 3BUTA 1CXFA 3LHPL 4K9EL 1A14H 1VKXB 4LKXB 4X7SL 3VJ6A 4XP9L 3LV3B 4GMSH 3KPRA 5FYKH 3VGEA 4NNYA 3GBMH 3IDMB 1A6PA 4CADB 3S36H 2J88H 4H88L 5FUOL 5GGVL 2GJ6D 3TT3L 3RWDB 1CN4A 1JVKA 1YUHA 5CINH 3SJVA 3VXRE 2DYPA 4UZGA 5FK9B 1F3RB 5GGSB 2C1OA 3FJTA 5I30L 1A1OA 3HCVB 3QEQB 5DJDB 3HS0B 4LHJB 1OWWA 4OGAC 3TF7C 2ATPB 5HHMB 3RPKA 3C60A 3GRWH 2E6QA 1I1FA 3CDGB 3O9WD 4GRWE 3QCVL 5AZ2H 3QHFH 2OSLB 1UXSB 4YHML 3QUYA 3GUTB 5EPMA 3AM8C 4OQTL 3TO4B 1MI5E 4JVWA 3ECBA 2DQJH 3RZCC 2YRLA 1C16A 4TUKH 4ELMA 1MSPA 4MWFB 1MJ7L 1YEGH 1HH9B 1GZQB 3MRJB 1J05A 4YIQB 1T5XA 3LD8B 1CBVL 4IS6B 4K9EC 1QFWH 2QQKL 1T22B 3NZ8A 3BP7B 1K2DB 1WFTA 3RI5F 1M7IA 4AG4L 4ZFOL 1OAQH 3GSNB 1U93B 4TUOA 4XP4L 4OI8A 1CD1B 1FNFA 1IC7L 4JG1H 4K3JL 3UJTH 3LN4B 4Y4HA 3VFRA 1J18A 5DMKB 2PCPB