2BFWA

Structure of the c domain of glycogen synthase from pyrococcus abyssi
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
196
structure length
196
Chain Sequence
GIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWARSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFRENCKKRAMSFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of an Archaeal Glycogen Synthase: Insights Into Oligomerisation and Substrate Binding of Eukaryotic Glycogen Synthases.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Transferase
molecule keywords GLGA GLYCOGEN SYNTHASE
total genus 83
structure length 196
sequence length 196
ec nomenclature ec 2.4.1.21: Starch synthase.
pdb deposition date 2004-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00534 Glycos_transf_1 Glycosyl transferases group 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2bfwA01
3IA7A 1NOKA 4N9WA 3E3OA 4GYYA 2Q6VA 2XGMA 3O3CA 1L5WA 2AMVA 5TMDA 3TSAA 3S2UA 1PYGA 3QHPA 4GPBA 3E3LA 5JTTA 2H1HA 2SKDA 3OT5A 2VCHA 4RIIA 2YJNA 1UQTA 3VDNB 3C4QA 1XKXA 3D0QA 2H1FA 3CUVA 3NPAA 3HBJA 1AXRA 2F9FA 3S27A 1F6DA 2XCIA 3L7BA 3OTHA 4GZ6A 3C4VA 1EXVA 1P2DA 2VCEA 3MS2A 2AW3A 3MT7A 2F3UA 1JIUA 2R4TA 3NP7A 4M83A 3IAAA 3MTBA 2QRQA 2FFRA 1K08A 7GPBA 4YI5A 4YI3A 1WUYA 3ZCTA 1FTQA 3CEJA 3CUUA 2ATIA 3MSCA 1RZUA 3DDWA 3CX4A 4NC9A 3ZCRA 4KQ2A 1L5SA 2ACVA 1UQUA 9GPBA 1A8IA 1GFZA 4CTMA 4WHMA 1L5RA 1NZFA 1C8KA 3T3EA 4QLBA 3MT8A 4EJ2A 4AMBA 1LWNA 4MHSA 3WAGA 3BDAA 3COPA 3G2NA 3VDMA 1VGVA 2P6PA 4CTOA 4X7MA 2XMPA 3G2KA 4PQGA 3L7CA 5HXAA 3G2HA 1LWOA 4NEQA 3H4IA 1JIVA 1RRVA 2GPNA 1P29A 3WADA 4YUAA 3OY7A 3AMVA 4G2TA 3UYLA 3MRVA 4F97A 1XL0A 3S28A 3SYRA 1C8LA 2QRHA 2X6RA 3CEHA 1Z6PA 4FKZA 4MRAA 4FZRA 1WW3A 3RHZA 4LDPA 2QN2A 1BX3A 1NLMA 3BD7A 4N3CA 3L79A 4XIFA 2G9RA 2X0EA 1K06A 3TAXA 1XV5A 3L01A 1RZVA 2QN9A 1GPBA 3DZCA 3G2JA 5TMEA 2JZCA 1PN3A 1L5QA 1JG7A 1SXQA 2C4MA 1Z8DA 3PE3A 4N3AA 3MRXA 3T5TA 3GUHA 1YGPA 2JLBA 1Y6GA 1L6IA 4MI3A 1QKJA 4BQIA 4HLNA 1FU8A 2PRIA 2JJMA 4KQMA 1Z6QA 1NVKA 4RIEA 3CUTA 2XCUA 2BGUA 4CTNA 2GJ4A 5C1DA 1XC7A 3ZCUA 1WV0A 3RSCA 1B4DA 3CEMA 2GEKA 3T3DA 1HLFA 3D0RA 2G9VA 3OKAA 1E1YA 2QLNA 1YA6A 2OFFA 2GT1A 4GYWA 3OKCA 5TMBA 1IXYA 3BEOA 2BISA 4RBNA 2C1ZA 2X6QA 3MTAA 3HBNA 5BNWA 2QN8A 1F0KA 3CUWA 4X6LA 2QLLA 2QRPA 1FU7A 3OTGA 4MI9A 5DLDA 2ECPA 1GPAA 3E3NA 3CV3A 1KTIA 2QZSA 2IUYA 3ZCQA 1UZUA 3S0JA 3MS4A 2QRMA 4HWGA 5D00A 3NB0A 1QM5A 2QN1A 2R66A 2XA2A 1AHPA 1FU4A 1NOJA 2XA9A 3L7DA 3OTIA 4Z5XA 4RENA 2KS6A 1NOIA 5IKPA 3Q3EA 5ENZA 5LQDA 2GEJA 2G9UA 1J39A 4CDRA 4EL0A 3MRTA 1H5UA 3T3GA 1E4OA 3PE4A 2IV7A 4RIHA 2ASVA 1O6CA 3H4TA 4MHOA 2QLMA 3FROA 4X7RA 2QRGA 2XGOA 3NC4A 1FTYA 2O6LA 2R4UA 1Z62A 2HY7A 1Y8ZA 1M5RA 4N39A 3C48A 2FF5A 4BQEA 3CUYA 4N3BA 2VSYA 2F3SA 3UYKA 4WADA 3G2LA 2GM9A 1IIRA 1GG8A 4GZ3A 1WW2A 2XGSA 2F3PA 5I45A 3BCSA 4KQ1A 2QN7A 2IEGA 2IV3A 1EM6A 3OY2A 4M7PA 1FS4A 2GPAA 1GGNA 2PYIA 2ACWA 3Q3HA 4AY6A 3DD1A 3G2IA 2IYAA 2F3QA 4RIFA 3MQFA 1GPYA 1JG6A 4MICA 5JTUA 3QKWA 3T7DA 3MTDA 1P2GA 3Q3IA 4EKEA 2QNBA 1ABBA 4AY5A 1JEJA 1WV1A 2X0DA 3RSZA 3RT1A 3MBOA 1V4VA 4F96A 1FA9A 1P4JA 3EBPA 1WUTA 1PSWA 2AV6A 1SXPA 3VUFA 4RELA 3ZCSA 2C1XA 2X0FA 2VG8A 3S29A 4REMA 2QN3A 3HBMA 4AN4A 2AZDA 1FTWA 3BCRA 4M60A 2IYFA 1NZDA 3T3IA 4F9FA 4W6QA 6GPBA 3L7AA 5D01A 4XI9A 1PNVA 2FETA 1JIXA 2R68A 3WC4A 5DXFA 2VSNA 3TOVA 8GPBA 2XA1A 5IKOA 4GZ5A 1C3JA 1XOIA 1GZ5A 2BGTA 2PRJA 1XL1A 4RIGA 2IW1A 4LEIA 2G9QA 4WACA 3MT9A 3EBOA 2R60A 3MS7A 4X7PA 3GPBA 3VUEA 1FC0A 5GPBA 1L5VA 1P4GA 2PQ6A 4EL5A 4L22A 2SKEA 3DDSA 2IEIA 3NAZA 4AMGA 3BD8A 2ZB2A 5TVGA 3SYMA 1C50A 2PYDA 1Y6FA 1P4HA 4MI6A 3D1JA 3T3HA 4EKYA 2SKCA 3OKPA 1P2BA 3BCUA 2BFWA 2WTXA 1L7XA 3ZCPA 2C9ZA 4BQFA 3NP9A 4BFCA 5DU2A 3ZCVA 3HBFA 3BD6A 2GPBA 4NESA 3NCHA
chains in the Genus database with same CATH superfamily
2OZKA 3FOFC 2CL5A 4LCJA 1QH8A 1YQDA 2GTPA 3ZDEA 3IA7A 4E5SA 2IH5A 6LDHA 2GQ0A 1HWYA 4PBSA 5IP5A 1XX6A 4JJGA 5TRTA 4GYYA 4KMRA 2XADA 5EHZA 3KVRA 2QX7A 4PLZA 1M10A 5TF4A 3MOSA 5JMPA 3OEHD 2AMVA 4GAEA 3A31A 4EPXA 2C5BA 1KOGA 3WMWA 3G9XA 3QPVA 4FHDA 3NAGA 4ZQEA 3TL2A 3NBFA 2X3UA 3U80A 1CQZA 3GQBA 1M1YE 2ZB4A 4CMIB 5JFTA 1Z3CA 5CLHA 3RWMB 1E5TA 5M34A 1A4IA 1YCGA 3FX2A 2AN3A 4YJHB 4K6KA 2IHKA 1JR6A 2D2VA 3NFYA 1T8TA 3DFFA 3IVCA 2SCUB 1UOOA 1ZRSA 1QAMA 4IDAA 3DMTA 4NWIA 1NHGA 4I0WB 3HCOA 1D8AA 2WINI 1HM5A 2DBVO 1XKXA 3C4QA 3I3SR 4HDAA 2UYHA 1J5PA 4G4IA 3IE1A 4GICA 1ECJA 4K1LA 1WHTA 1G18A 2E0IA 4QBKA 4FI3C 4Y2UA 5TJ9A 3ZDZB 4B76A 1GCOA 4N0QA 4Z6KA 3D6TB 3DCNA 1G8YA 2QIPA 3EWNA 1V8ZA 3L1UA 3V2HA 1HX7A 1JHPA 4JT2A 3UAOA 1UADA 3DOUA 3AF1A 4P3YA 1IZ0A 1YVPA 3HSYA 5J2UB 5FCDA 3DB1A 3U4DA 3T1TA 1EU1A 2OHGA 3IH5A 4LV6A 2EFDB 1IMJA 4J3JA 1MFPA 1S3GA 1LBIA 2E9SA 1ZH2A 2P1ZA 2VR1A 3CW8X 3ZGYA 3MTBA 1P72A 4B3HA 1FP7A 2ATCA 3AHGA 1HE1C 3GROA 4CQNA 5B1DA 1WXWA 3QZUA 3OCZA 5FORA 4DLSA 4EKDA 4YAOA 3LCRA 2BMEA 3W0LB 4ER3A 2MMCA 1F2DA 4GIBA 2XNSA 1GGJA 2MINA 4P93A 3WZLA 2EFJA 2AEFA 4GUDA 2I6QA 2Y0PA 3Q0IA 4CM3A 1PYOA 4ZC1A 5AW6A 3O75A 4JJAA 2LCQA 3DE7X 1ZGHA 4I1UA 3ZWAA 2WT4A 3DJYA 2ID9A 1GGHA 3TLJA 3UFXA 5CJ2A 3CVOA 4RANA 5H80A 2GCGA 3VX3A 1FL9A 4B6EA 1WKCA 3QA9A 2GVDC 2KPOA 2JCBA 4MARA 2ONJA 4B7XA 5GIPE 4POOA 2Y76A 4NS4A 1T5BA 2X6TA 4EUEA 5IC4A 5A04A 3E2MA 3HUUA 4XX1A 5F64A 1OHHD 2Z2XA 3O73A 2HFJA 5T6MA 2ZUVA 1I80A 4POAA 2FR1A 2F90A 2VP4A 3PQFA 3BS4A 4R3UC 4KWEA 5AW9A 1KYVA 3JQBA 4JLWA 5JUWA 4O4HB 4ENWA 4B81A 3RYIB 4NU6A 4MEBA 2LCIA 5AVOA 2A78A 3QIAA 2JEYA 4HNQA 2NU7A 4LMRA 3SZUA 4LOHA 4W1RA 2XR1A 3CRVA 3RSOA 2KM1A 5K3CA 2AGVA 3RV4A 1Z6XA 3R74A 5K09A 2ATEA 5HGJA 2D2FA 4I55A 3IAS1 1G9TA 4BNMA 1O5IA 1F8UA 2X1VA 1M1YB 1DC5A 3M3PA 1UK6A 3Q0EA 1Q92A 3OFKA 2GZHA 3GLGA 3EQZA 3PGKA 4ZRDA 4F92B 2VYNA 3RRJA 3ICWA 3BJMA 1LFDB 1H2AS 3WGLA 1OU0A 4XQ0A 3UCFA 3E5MA 1DXYA 1FF9A 4JP1A 5J5VA 4QUDA 2PIAA 3G1UA 3NHLA 4QVGA 3SQWA 1OX4B 1V95A 3U81A 1Z16A 3TNFA 3U7FB 4J7XA 2FRXA 5A5FA 2D1RA 3R20A 4Q4HB 1WUHS 3N2KA 4D4MA 2NNWB 1IM8A 3U0VA 4OXXA 3MUFA 7AT1A 3TIVA 3ABOB 4IZOA 4NBNA 4P7BA 4A10A 1HDRA 1FW8A 3A1WA 1J9ZA 2XTZA 3OZEA 4I55B 3AGPA 2PJUA 3KXPA 4CIYA 4LDPA 4MKZA 3SWWA 1M67A 2HBYA 2ODWA 4U2DA 1VHWA 2D0IA 4DR1B 4N5DA 5KQSA 1SKBA 2ZE8A 2C1EA 4AF6A 5FR2A 2NO7A 3TPZA 1A71A 1WCYA 2B20A 4XIFA 2RHMA 3K4HA 3L07A 2VYCA 3PNYA 4X3CA 2XYQA 1T2AA 1XCMA 3WSTA 3W6OA 1F14A 3SXUB 4J3NA 1U7DA 2VKTA 1N5IA 3DLPX 2OGSA 1DIHA 3E4DA 2ZUFA 2YIVX 3LAWA 5B4UA 3F7TA 3O7WA 4HDMA 1G291 5IMBA 4YCSA 4WX2B 1WZCA 1TM4E 1ICIA 3KQWA 2EBWA 1SC4A 5GADl 3D6NB 1U63A 1H69A 4C29A 1N9GB 2LTAA 2F1HA 1AM4D 4KKVA 4CFZA 2F1RA 4G85A 5IDXA 1QG6A 3S1AB 4HYEA 1KP2A 4MS3A 3T5CA 1FUIA 1JR2A 3HB7A 5DOVA 1LS6A 4R7GA 1TTQB 1YR7A 2EC5A 3MWEB 3ZDFA 2ZSEA 2Y1OA 3KJQA 3SZLA 3EULA 2NMVA 5JAPA 4RYLA 1Z8FA 3DW1X 1J42A 4H60A 3I1JA 5DHAA 5NULA 3NHMA 1COZA 1CQJA 4PZCA 2F1JA 2FW6A 4TMYA 1FVFA 5THKA 4BEVA 1VRVA 4HFNA 5FOTA 3E9QA 1ZHOA 4YJKA 1CEEA 4JUAA 1G8KA 4FONA 4H4DA 1E6LA 1T0UA 1W2HA 3BWCA 4AJEA 4XCXA 2LR0A 1QRUA 3I2IA 2R6JA 5CDTA 2Y77A 3N6RA 4Z4FA 1NE2A 3JTMA 1QQ5A 5JLAA 5CDHA 1NN5A 1P74A 2ZG6A 4JKYA 4QDJA 5KS2A 4JYAB 3G85A 4HGNA 5DX8A 3FZEA 2BMJA 1X1RA 4YUXA 3Q3GE 1U9CA 1J20A 1DC7A 1DS6A 3AF2A 2RAPA 4GR9A 1CJCA 4OXQA 1NIPA 2Y92A 4PONA 1RACA 1QFMA 3OHMA 4JNCA 4IZIA 4XDGA 3N70A 1EQ2A 1OX5A 1REQA 3WGJA 3BUSA 4HSGA 5B4VA 2JAUA 1UKVY 1DJLA 1EP3B 2MYNA 3K2EA 5ECYA 3CVJA 1OFUA 3MTIA 4K8OA 5DWDA 4OSOA 4YDRA 4CTKA 1K97A 1OWNA 3UJDA 4DA6A 2O59A 1KY3A 1UH5A 3MWGA 3FPSA 2XHZA 2W2OA 3VNAA 5IT5A 1AZWA 1Z5OA 1X74A 1CP2A 3E7FA 2JPDA 2QL5A 3AM4A 3LGXA 3MFYA 4WESA 4EHIA 2PS0A 3LHKA 3WFZA 2V74B 4D9EA 4N5MA 3TAHA 3OJLA 2ET6A 1E2GA 1Z4QA 2J3JA 2Q6TA 4M99A 3RVBA 4BP9A 1QUEA 4MRVA 4GFDA 3CRW1 4UUMA 1AHPA 1DHTA 1T91A 1TUEA 1JU4A 3PZBA 3ETDA 1O94C 2C58A 3RSLA 1GSHA 1TK2A 3HLKA 1S7GA 4YJGA 3EUAA 1NPTO 1SJ9A 4NARA 4YROA 1BXZA 1X3SA 2R2GA 3NANA 4LHYA 3LQYA 1XZFA 3UO8B 1Q3HA 3A1SA 4CG1A 5KX5A 4DTIA 2R7NA 2PUAA 1UANA 4Q4AA 2H1CA 5JAZA 3K9FC 3A7DA 3BB1A 4Q01A 5BNTA 1YB5A 2ZR0A 3NEYA 3DO6A 4P82A 4RDCA 2ORYA 3PXBA 3F7MA 3GJ5A 3QE2A 3QLVC 4NE2A 4ZEXA 5KUTA 2WNIA 5E7JA 2ZPAA 1OAAA 5ALFA 4H1TA 5H3HA 3DHEA 4PE5B 2PQ2A 4ZAXA 1QZTA 1DAIA 2JD1A 2V0NA 3FY4A 3AR4A 1HETA 4WKPA 5DP1A 6CHYA 1XU7A 5FHQA 5KHLB 1YS1X 4OKSA 1PJ3A 4X41A 2WB2A 2RCYA 5IHXA 3DQPA 1GCUA 3O31A 2EFYA 1G98A 4RZIA 4UTXA 1ZVKA 4R81A 5CYFA 4AT1A 4B35A 1ONBA 3NORA 2F4VB 3QUSA 4IOJA 1Z5GA 4HRAA 2OZPA 3TOXA 4AICA 1FSPA 3SIXA 3G0BA 3E9ZA 4TN1A 4LY3A 3RTGA 1TLLA 3LA6A 4OQQA 1IBKB 4CF3A 2GK6A 4UHJA 1AV7A 1O6GA 1C7EA 1ZK4A 1JJFA 1KO1A 3G82C 3TLCA 1EGHA 3BWEA 4DCVA 4Y7CA 2XKAA 1OGYA 4PZEA 1NTOA 5I7HA 4FCTA 1E2QA 3RD5A 1CZRA 1HDGO 1W7AA 4RQAA 3JYQA 4X1KA 5DTEA 3FR8A 4PHFA 4B3CA 2Y2VA 1O95D 1DXHA 3WLHA 4ESHA 4HAVA 2Q8NA 5CW2A 3J7TA 4DA0A 3WGGA 2P78A 1EUYA 1L4LA 2JH3A 5CA0A 2I91A 3RFUA 3KETA 3T41A 4UCFA 1IEVA 5EP3A 3UENA 1Z08A 3KG2A 3SM3A 4DMFA 3AJAA 3QENA 4OXYA 3P45A 5ULLA 1ZN9A 4KBGA 2R1UA 5E6RB 3JR3A 1OI2A 5ALXA 1SCQA 2CFIA 4N47A 1KJ8A 2R1TB 4J7AA 4AY6A 4UHFA 2YBEA 5K4GA 1RLIA 2O2SA 2Q3FA 4KREA 2RB5A 3JSXA 3SEFA 5AIAA 2Y1DA 1T6NA 1J0AA 2YQ5A 5DGIA 1P0CA 4BVGA 4B3DA 3B13B 3W5SA 4MWZA 2MOKA 3DEKA 2O19A 4MICA 1F8GA 1M34A 3PGVA 5DN6D 1S96A 3OWOA 1WXEA 1KA9H 4QJ5A 4XB6B 3JY6A 2P9TA 2Z98A 3I0MA 3T9AA 4EKEA 3NMUF 4LCBA 1XU9A 5BW4A 1AGPA 3OZGA 4LE2A 4PYNA 4K05A 2JLRA 4L5YA 1IOVA 2GB4A 3GFRA 3L8MA 2R5FA 3H9QA 3STWA 1T4CA 4M89A 3S44A 5DEIA 4QDUA 5KJFA 2G17A 2PMKA 3EBPA 3U7HB 2HA7A 4J6FA 3B1WA 2REOA 4S1VA 4JS0A 3OFND 1WUTA 5KJ1A 4N12A 4G86A 5D1NA 1RSZA 1T9GR 4FQ8A 4QRIA 4G0MA 1EUQA 3HHEA 2PUWA 3NIGB 4D5EA 4PW0A 1D03A 1AY0A 2OESA 3EFHA 5IJ9B 3HABA 5LFAA 2BR5A 2W2VA 3WQBA 2FUG6 3ENKA 2IXEA 4JLNA 5H59A 3FTCA 3RUPA 2HDHA 1VL6A 2XITA 4G25A 2CNLA 4EEXA 2ZJ2A 1XLUA 4Q0MA 3IBGA 2YN2A 5CA1F 4Q3BA 2JGIA 4GLJA 4EVIA 1GYQA 1HC7A 1QOZA 5AM2A 4OGLA 2PU7A 1JJIA 5ALPA 2IL1A 2OQIA 4FHEA 4GXNA 4KXMA 4CG2A 3E27A 5C80A 3CH4B 2GGSA 2G8NA 2R68A 4JC8A 3TG2A 4X91A 3T5BA 2PJZA 3W34A 4I7EA 3RVSA 1GAQA 4IIUA 1M0TA 2VDUE 2VPZA 3GR6A 1DJQA 3QUBA 5LJLA 4EW1A 1R37A 2QM3A 2CSUA 3CTPA 1UPUA 4XOUA 1O5TA 2MYTA 1GU7A 3LGAA 3JYOA 1FYDA 3R5JA 3NBXX 4AX4A 4N0MA 1EM8A 2NU9A 1RNLA 3N39C 3LX8A 3M5DA 4IF4A 4BAGA 4B2PA 2FPGB 1TFUA 1H3EA 4KW7A 4EJSB 3I61A 1GTL1 1YRLA 5JU6A 2NUTA 2BGTA 1HQKA 1D2HA 2Z1DA 3K2BA 2BFAA 1N0HA 5JSHA 2OHXA 3QMMA 4IZHA 3V4PB 5K0FA 5F5XA 2FK8A 1O03A 2Z04A 4PFJA 4QG3A 5KU1A 4AZ3B 2F62A 3HH8A 1URPA 2AG0A 2WJWA 1CVRA 3C39A 3QOFA 4ZVPA 1JEYB 3DW3X 2VSQA 1UINA 2FOIA 4NS1A 2YFQA 1R5JA 3EOAI 3OIUA 2V7QA 3PR1A 4W8HA 4WQMA 4WL0A 2ZSAA 3LIIA 1RQGA 1KOLA 3DE3X 1FDRA 1SC9A 3AH8A 4PY2A 3EAFA 4HWRA 3VUEA 4DM7A 5JPCA 3K6KA 3HPQA 4OX9B 4HLCA 4L8VA 4M8KA 1H3FA 3RVJA 1K4YA 3GD7A 4X1YA 3M1IA 4JR0A 4NCIA 5EKTA 4QKQA 3TLYA 3JAMA 3GLSA 2X14A 4D57A 2ZRPA 2IEIA 2REXB 4LV5B 3L7LA 1YGYA 4MKIA 4UQPA 3NAZA 2WJYA 2WWWA 4D96A 2L42A 3PNBA 3R6TA 4PLYA 2H7YA 2WYUA 3SNHA 5KDLA 1UMBA 2C84A 1WSAA 1O5OA 4UFNA 3A9TA 5TQ2A 1GRRA 2X86A 2WYIA 1A8QA 5IT4A 1GOTA 4KQWA 2I62A 2WILA 3DV0B 1JVBA 2AYYA 2VJPA 4QJBA 4YUZA 4NOLA 1E6UA 4NOJA 5EE5B 1NVEA 2O2XA 1A9XB 2DHDA 2H2HA 3ELBA 3RAFC 2P9BA 2VSFA 2ZVJA 3F1KA 2IEAA 1B6SA 2WHRA 3PWKA 3MLBA 1YAHA 3HU2A 3VRHA 2VDOB 3UAXA 4ZT6A 1Q57A 4J1QA 4U2BA 5E7MA 1P7YA 4UAGA 1QDUA 2JHFA 2P67A 5A4DA 1GPLA 1L3IA 2V0CA 1RKBA 5EKUA 2FN4A 4Z3DA 1IVNA 1P2BA 3DEJA 4XB1A 3BCUA 1C9EA 2QTVA 4Q9JA 3COZA 1SBNE 4IVPA 3ZBTA 1EX1A 2NVOA 2PV7A 1YE8A 2XUGA 3NBAA 3GP5A 4B6RA 2PUCA 4HF7A 4KIFA 1KNXA 4F38A 4MO2A 2QR5A 1X94A 4MKXA 2BTQA 3VZCA 4OL9A 4L8FA 4N5HX 2F3RA 2HCBA 1UF9A 4I6GA 4Q3CA 4FFOA 4O4IB 4TL8A 2GD2A 3M6FA 4WCDA 4YCCA 3ZJUA 3QKIA 4KQJA 3Q1LA 1AB6A 4QTTB 2C5LA 2XGMA 3EQ7A 3ETLA 4D02A 3D7NA 2R751 1YL5A 4UM9D 5FULA 4UTOA 3WKDA 2PRKA 3DBVO 1KPHA 2E4WA 2QPOA 2Y4NA 4FHFA 4OQEA 2VP2A 4QYSA 3TSAA 1U0FA 5ARCA 2XMCA 4LF8B 2VQEB 3VPCA 4F0JA 4PX9A 3UHJA 4MQLA 2GVZC 1XXHB 3Q6MA 1D5CA 1NVUQ 1N5JA 2R8BA 3PR3A 3TFQA 4DLUA 2Q28A 2ZT5A 3RPEA 1U65A 1I36A 3HCDA 3IEXA 3QFHA 4FMBB 1JQJC 1RPTA 1PSDA 3A4VA 4HDRB 2BLNA 3C5CA 4S0ZA 3U0BA 3WHLA 4DW8A 2VS1A 1WU7A 1YS4A 2ZR8A 2RJ3A 3AR5A 5CX4A 3D6UA 5SZIA 4B2YA 3EEOA 4F8YA 3TNYA 2OAGA 3UXYA 2C95A 3JSAA 5JNWA 2PGJA 3ZBPA 4NYJR 5B58C 221PA 3I62A 2QW8A 3ZOKA 5IABA 5TDHA 2X9QA 2QD4A 1RQ7A 3A9CA 4XJSA 3RARA 2VCEA 3ZDAA 2FW1A 3LG2A 1WVMA 2I5PO 1MQAA 2HK7A 2IJGX 1AVTA 2OBNA 2PWPA 3QTLA 4MUYA 2G6BA 3A9SA 1FQKA 2EYUA 3N74A 3DM5A 5EJMA 3WJ1A 4K0KB 2ZJ4A 1EDBA 1AKMA 2MR5A 2O8NA 5HKKA 3ZWQA 1L4NA 4GC5A 4BMZA 4XDZA 2YXLA 1C7RA 4DS3A 1Z7EA 4BFZA 4RPIA 1KO4A 3GLTA 1VE6A 4IJVA 1E6WA 4BRWA 1F6WA 3TX2A 4R2KA 4TTQA 3R7WB 3GY0A 5HIKA 5EMLA 3X1MA 1EFHA 1Y34E 2RAVA 3NHSA 1ISPA 4GP6A 4LOLA 4NMLA 5JFGA 5KSYA 2O8EA 5AXBA 1N2BA 4KQ2A 3DHNA 3KVOA 3KHTA 2OA0A 4QGHA 2HQ1A 1CUUA 2LE0A 4CQMB 1VJTA 2OGZA 5DI9A 4JJFA 1I6LA 4XFKA 3CR3C 2IBTA 2WVJA 1VKJA 2VXYA 2YC4C 4C0KA 4ZGGA 1I2AA 3U61B 2O8DB 2XXJA 4LXQA 4QLBA 2E21A 3O93A 4EJ2A 4O2AB 3MMPA 2G06A 2E4YA 1KMNA 2RHTA 2YYAA 1FPMA 1VA5A 1XD2A 4YJ3A 3RVKA 2IYRA 3UK7A 3WAGA 3L4SO 5HCIA 3SKVA 3NTRA 2C96A 3I6MA 3WV5A 2KX7A 1NI4B 3MB8A 4LDZA 4CKWB 4DNFA 4X6YA 3UJ8A 3G9UA 2HXYA 1A8UA 1X19A 3WJAA 1NNI1 3JQ7A 3QW2A 4LZPA 4B7CA 2C7QA 3K73O 4B33A 4K5QA 3BFKA 2PVPA 4F11A 4L8YA 4PF1A 4OTZA 4C7JA 4CLHA 1YIOA 3I23A 1TVKB 2O0KA 1U3WA 4JL8A 4KWCA 2XUAA 2HJHA 5K0TA 2NV2B 2RH4A 2GHIA 3B6JA 2VAWA 3PX2A 2GO7A 2VJNA 3WADA 4Q1EA 1AKUA 1FFBA 3NOXA 2AOTA 1H94A 4HVTA 4LGVA 2XECA 4CV3A 4CIWA 1ENOA 2FE4A 1A8PA 5EEHA 2M32A 2WF7A 4JQSA 1IQRA 1H3NA 4ZCPA 2Z5LA 3W3AH 4GQIA 4C4RA 3OQOA 1IBLB 3HJBA 5GJWC 5HZMA 1HDYA 1YRYE 2Z3WA 1G2PA 1S4MA 4QYIB 3GJ7A 5AK3A 2QGZA 2FVYA 3KYJB 2X40A 3CW2A 1BNCA 2FHPA 4WEOA 1Y5NA 3U48A 1IG3A 3A6LA 3CEHA 1JKXA 3L6CA 4RPHA 4TXNA 2OHJA 2JLSA 1I0ZA 2NU8A 4B84A 3GLGE 3ZWCA 5BSMA 1G20E 1N6HA 4RO0A 4DQDA 3Q8MA 5A2QA 4CGZA 3WGKA 4EHNA 2C61A 5CAEA 4NZZA 2OQRA 5TF0A 4HB2A 2BI4A 2OE2A 1TAGA 2I71A 2NYAA 4L0MA 4X61A 4OLAA 2XD4A 4N65A 1I7DA 4FIDA 4CEJB 4IHJB 2G9RA 1KRWA 4KAJA 3RVRA 2AJ8A 4K87A 3VR1A 4BX3A 2W8BA 1MX1A 1NJ5A 1WP9A 3HDJA 2PNJA 4KOAA 1CEQA 3SC6A 4TKVB 1A7UA 4CKWA 1MV8A 1OGJA 1GA1A 2JFPA 2UZ3A 2W6MA 2X3YA 3GFOA 1BQ4A 3KYDB 4G26A 5I9NA 3EXIA 1IBSA 4ER7A 5ILGA 3UMFA 5HIMA 3KR2A 3SQDA 2C54A 2CL7X 1C7FA 1HYGA 3MNFA 5DIZA 3ZX5A 4OK6A 4KZPA 4O63O 1CEXA 2DH5A 4AJ2A 1EGVB 4EB8A 1YB6A 1ZLXA 3QV2A 4JLMA 5BQ3A 3FSGD 3DZKA 1JYSA 4BHTA 1T1EA 5EAIA 2A5JA 3OQHA 4M22A 4MWDA 3SS7X 2PUEA 1TQ8A 2HCTA 2PRIA 3A3OA 2L69A 3EMDA 1UMCA 4WZBE 4AIRA 2EZ8A 4WK2B 5KNCA 1QO0D 1QF9A 3H1EA 4ZKEA 3CUTA 4IF6A 2ZIUB 4G9BA 4E5UA 1FRQA 3RIYA 4EARA 1HEIA 2F43B 1E9RA 1IEQA 2ODPA 1TX4B 4KXUA 1RPNA 3MCZA 2NSHA 4RK1A 5EQFA 2ASEA 2P62A 2QP9X 3M70A 4RPKA 1QHIA 3E7PA 4R3WA 3VSCA 2XE8A 3DTNA 3KLNA 4P3OA 2GEKA 1DUVG 4M53A 2V6BA 3HE3A 2HCJB 2K87A 2OOKA 1Q0LA 1E1YA 1HEYA 1NRJB 3BXHA 3GAAA 4OP2A 1QGYA 4LG1A 3CUEF 1YA6A 5EG5A 3SBXA 2OFFA 1NN1A 3FH0A 4TSKA 4ZIRA 3VPXA 3WISA 3W5JA 3H9JA 4MIKA 4YO7A 5GVRA 1YC2A 3ESCA 3GK3A 3SSMA 2BISA 4ZTUB 1L4KA 4JMPA 3BHJA 1N6LA 1SO8A 2OECA 7MDHA 4DG9A 2BM0A 1QE3A 1RHJA 3QPWA 2UUAB 1IHPA 1RIFA 2FN7A 2ST1A 1SRRA 2QROA 2VF2A 3LDAA 5THXA 3GLGB 1FU7A 3DH0A 3FCAA 2MSKA 1E2DA 3IIIA 1Q0RA 2JIQA 1K2VN 3P9PA 4KDEA 1JFSA 1IHXA 3LKDA 2VDWB 3T3NA 3G9ZA 4RNDB 4OQLA 1IOZA 2XNCA 5IJ9A 3H6GA 4ITVA 3W2HA 1D0VA 2ZYGA 3P4XA 1D04A 1YE3A 3EDCA 4Q1FA 5C8YF 3RK4A 2C82A 1BC5A 2BKAA 2Y6VA 2N47A 3TW4A 3GJTA 3WDLA 3UV7A 1KBOA 2FB9A 3THXA 1G7SA 2WAYA 2IVFA 2Z8YM 3OOEA 1SBTA 3AK4A 3VM6A 3STXA 2BGWA 1Y8QB 2C83A 2NUPB 4ZTBA 3X1YA 1DHRA 5KNBA 1ZC4A 3BE6A 1I7PA 1J4AA 3B6EA 2I2WA 1H22A 1YXMA 5EWLA 4X93A 1N3IA 5TJHA 4R68A 3N8GA 2HKIA 1WB4A 3QU2A 1KAEA 4MVJI 5CDSA 2O2IA 1PAUA 2E37A 4H7KA 1ZK0A 4WZBB 4DMMA 1T8RA 1VPDA 4EJFA 3ASUA 4ZK6A 2FG7C 5IEJA 4EH1A 1W581 2BI7A 2Z2JA 3KAJA 4EWLA 3NONA 1M5TA 2O9JA 1LTKA 2W2QA 3W1VA 2ASVA 4DHWA 4AKIA 4RWZA 2OHOA 2H4WA 3DLHA 1XK7A 4BTLA 1KKMA 3VKWA 2AMFA 2I7VA 4A1OA 3I9JA 2ZSHA 5DNVA 2XWQA 3EGCA 2ZRAA 1UK7A 4OL0A 2CXXA 1Y3DE 3QKRB 4I36A 3KT6A 4JBIA 4NAHA 4NJEA 4RH3A 3WMGA 5ICCA 5KINB 5KTOA 2HYDA 3W6PA 2Q3DA 1BN6A 1EAMA 2P4QA 4PX2A 4PZUA 421PA 4BC0A 5I4KA 1U1FA 4UW9A 3DFKA 1LPPA 4M0PA 2JZNA 2C8LA 3B7WA 3A6KA 3WK5A 2XY4A 4D4LA 4IMRA 3PC7A 4R8VA 1AKYA 3IUMA 3L8YA 4OBWA 4QPPA 3K9GA 4QU8A 4Z7JA 2O2ZA 4CL2A 1UWLA 1J33A 2GM9A 1WEKA 4IX1A 1E58A 3EGVA 4LYYA 3SEQA 3NYWA 3UWPA 4MX8A 2IYUA 4W8OA 5ALQA 5KNDD 1JLSA 3GEIA 4UMVA 1TJ5A 3AP3A 4Y2RA 4FE3A 4D92A 4KQ1A 3TD2A 3UC9A 2GCPA 3MJTA 1KZHA 3ZH9B 2P6UA 3L0SA 1RI1A 1BXRB 1I5OA 1QRRA 3DL7A 3GW8A 3H3XA 3M89A 2HQRA 4OHCA 1OXTA 3WIVA 4BVBA 4EHAA 2Y67A 1G4AE 1QHXA 3H2IA 3HB1A 2I29A 3KJZA 4JASB 4X1OA 1ZIXA 3GRAA 3Q3HA 3IPLA 4MA5A 5B53A 4WN9B 1NLUA 3G2IA 2ZRGA 3LPMA 3ANXA 2IUSA 4TLDA 5TQ0B 3QUTA 5BMVA 5A06A 3LT4A 4ZEOA 4E2YA 1A4UA 2X8LA 3B5JA 1WM1A 4L51A 3RANA 4P80A 4LXHA 3H84A 4PZLA 4FFNA 3C85A 4RPCA 1SHKA 1JMKC 2W2KA 3NQ41 3H16A 2O5RA 4DV6B 1SVMA 1EXMA 1GL9B 2PTGA 3AEKB 1P2GA 3NTLA 4RE5A 2ESRA 1D4FA 4JITA 4WY2A 2AE1A 5F77A 5L3QA 2FWMX 1KEEA 5IM4F 1M74A 3REQA 3WS7A 5IVKA 1VFNA 3OLZA 3ZI0A 3OJWA 1QDLB 3K6SB 2H00A 4RY2A 2QL6A 3AHEA 1MGPA 2EKQA 4GPD1 4UQOA 2DPLA 2Q6IA 2R6GA 4K9KA 4X95A 4RETA 4UTRA 1BFDA 1I1OA 4X1KB 5CB4F 2J3EA 2P91A 1U2DA 1X8KA 4LOKA 3UFXB 4MUHA 3VJKA 3FZYA 4KGDA 4CM4A 1HT2E 3BRWD 5CGZA 5HRAA 2PKYX 4XEUA 4BEWA 2GWRA 2ZI5A 4DV3B 3C4JA 4Y2YA 3LX4A 4EVQA 2EZUA 1L8XA 2QZZA 3GPIA 1QG4A 5BOSA 1BZYA 1BDHA 2J6CA 3AR8A 1YU6A 2ES4A 5JECA 1ZCJA 1MPXA 1XE3A 5G0UA 4PCAA 1LPBB 2XCSB 4KFSA 5J40A 4DLAA 1DO8A 3HDHA 3FFXA 4AI6A 4B3GA 4BB0A 4G5SA 4JLJA 3SE7A 5LZ4A 4I4LA 1P4RA 1A9YA 5LD2B 1U9JA 3JALA 1UPXA 1QHHB 2L17A 3FYUB 3HCEA 2NU7B 3CF2A 3LQFA 1QIHA 3OBBA 1XDGA 2FETA 2CFSA 3AY7A 3FJ1A 4NJMB 4FFVA 4PAGA 4TUYB 3BWXA 5EXXA 1WDTA 3L8GA 3ZWYA 3EVBA 4MQBA 2A5LA 3KUXA 1RI2A 1K9VF 4G1VA 1PEYA 4U9UA 4HH1A 2HHHB 2QNRA 3PFCA 4IXDA 3HKEA 2IT1A 1DPGA 4D3ZA 4D74A 1JDUA 2CHVA 3JAKA 3OEWA 2D1TA 3FTQA 3M1AA 4NV0A 5JT1A 5CIWA 3KCNA 4XX0A 4YRKA 5JLJA 2OXEA 4RV9A 2PLAA 1H93A 2NZ2A 1N2GA 5DE3A 4DTCA 4IUCS 2VC2B 121PA 4M7WA 4PTLA 4OX9Y 1VHJA 2J87A 4GRIA 1IDOA 3ZE9A 3HRKA 2GESA 5LQAA 4B4KA 1KO5A 1PT9A 1YMVA 4KXNA 1II8A 3PXCX 1XXHE 3EXEB 3SF0A 1J8FA 1LS1A 1I4DD 3VAZA 1E9SA 1QR6A 3KLMX 7YASA 4EBBA 1K8ZB 1XVAA 3IP6A 1ZNQO 3PFBA 1JSCA 2WU8A 4G4SP 4P7JA 4PIMA 3RVDA 3GVPA 4FC7A 4CF4A 2P7IA 2FG6C 2Y1XA 5JZMA 3LQQA 2GZRA 4QOSA 4IXWA 2JNWA 4R2XA 2FCAA 4LPKA 5GOTA 1QCDA 3LC2O 1ZGJA 2FPIA 2FPLA 2XXAA 4F6RA 3D1LA 3K31A 4RZ2A 5J2UA 5AW3A 1NAHA 1PJBA 4BNKA 4JB8A 3A6PC 3C6BA 3K5IA 5TVGA 4ASUD 4BU0A 3C24A 1AQYA 4L4SA 2MIIA 5JASA 2XD9A 1UXGA 4LYEA 2I2AA 2I4IA 2PYDA 1ONPA 1YUMA 1L8OA 2NTJA 4RSRA 2PIDA 2D8MA 3UKJA 5A5VA 1FE8A 5ALLA 4M0FA 1F0NA 2B4KA 2LKCA 4ABTA 1ZGGA 3MHTA 3T0FA 2GEVA 3OJCA 3QEAZ 2QX4A 1KFCB 2ONKA 2B7LA 3IDZA 4L5BA 1QP0A 1R0LA 2GZ2A 3H04A 1C1DB 2BE9A 1P61B 3CX6A 3DMTC 3IQFA 1Z4NA 3IVAA 1BHO1 4I9GA 1YU9A 5LQRA 5ELXA 1C80A 4KV7A 1I7LA 1F6BA 4XX0B 3USZA 4JYBA 2YY7A 4JP5A 3ZCPA 5AKHA 1DTSA 4BRSA 2PXCA 3I2FA 4BGIA 4H1WA 1VM6A 3BZUA 5BV1A 4HH3C 2A9VA 3L84A 2J3KA 4QLOA 1NW3A 2GPBA 4WA8A 4YHHB 1BDIA 3RRBA 2FKAA 5MHTA 1TQDA 1U4OA 4OMUA 4YP1A 2ZPTX 1VG8A 1P44A 4XR4A 1OB5A 2B99A 1EHYA 4O25A 1NN3A 1H2XA 4WRRA 4K2AA 3E6AA 1XZAA 1T13A 2QXUA 2XE6A 3IGFA 4X65B 1IPEA 1WNTA 1OROA 3TEJA 2C97A 2P3OA 5TMDA 4YBRA 5KTMA 1E2FA 3PXUA 3C0KA 3EARA 1NG1A 1K86A 1DGQA 1LQUA 4JBGA 4B3FX 5JQGF 4FNGA 3QA3E 1G5IA 1X80A 2WYOA 5FLEX 3QBDA 3RYIA 3AIKA 5KJ6A 1I7SB 2BCEA 3KJGA 4NYJQ 4WMLA 4KNYA 4N18A 5JYBA 4C6HA 1T9GS 3EG5A 1FFGA 1E2BA 3OT5A 1Q0SA 4ZOEA 1WCXA 3T61A 2Q4RA 2YMLA 3UXHA 1CJBA 1RZ3A 1YS6A 4C08A 4PAMA 1GG2A 4CWAA 4DR5B 2PUFA 2DWUA 2X4IA 3GGPA 4B4OA 2JDIA 2XWPA 2GWHA 2VBGA 2PX5A 4V38A 4AROA 3SY8A 4D9FA 5A4IS 1LPNA 3D4OA 4C1NA 3DB2A 4A0SA 1BMQA 3QEMB 4JYMA 9LDBA 2J7PD 5TEWA 1JEAA 1EGQA 4PPQA 4MJ3A 2Y0CA 4P4TA 1GNTA 4YXFA 2W71A 2FYTA 5B7QA 3MS2A 5AXCA 2Q7DA 1OH8A 3A4TA 3ZLUA 1M66A 1MG0A 2W11A 4BX0A 4YCBA 1T4MA 4GX2A 2IY8A 1Q77A 5H3CA 4MK4A 1SVKA 6Q21A 2Y05A 2YFHA 3ASVA 1TGYA 1YR1A 2G40A 3PG5A 1SUEA 1O8BA 3DUWA 3CWCA 3EMBA 4KH1A 4MIOA 5GONA 5LOVB 2CMGA 3A8TA 2Q7XA 4PSDA 2JRLA 2X42A 3JWIA 1UDWA 4RA9A 1UOQA 3QVSA 4R9RA 5FA5A 2LP4Y 1V4NA 2JFYA 4MJXA 3VSDA 4RCZA 4I50A 3DHWC 3BMXA 1M54A 1NW5A 3MJVA 4IGFA 3TG8A 3W5BA 2IWRA 3EODA 3UA4A 2D6FA 4JI4B 1TZ2A 2WABA 4FEAA 3HB9A 1BE8A 3JYHA 3U09A 2YKGA 4LN1A 2OUKA 2P68A 5HRCA 3THWA 4IEEA 3IB3A 1ZCFA 1K6IA 1ZD3A 3K1AA 1F2VA 3FWPA 2X8JB 2D62A 2JGKA 5TT0A 2J9GA 4WXPA 3C3KA 1YE5A 3HXPA 1ORRA 3CT6A 3LY8A 1E5QA 1T2CA 3IUNA 4FBMA 4ID9A 2J5QA 4OJMX 5JD6A 5LQMA 3KZVA 5AKKA 3Q7QA 4ZGWA 3EOZA 1OLSB 5K99A 3PQDA 3RRFA 3WJ7A 1R3DA 1E66A 5JCZA 1NBME 1OZFA 1GSOA 1QHSA 1EFPA 2WK1A 3H7IA 4MLPA 4KDCA 1VPEA 1JV2B 4HWTA 3ZIAA 3TOCA 5FV4A 4RZUA 3E58A 1R18A 3AW9A 3OP4A 3AFHA 3WNVA 1PZEA 1WXDA 3FOBA 4A0GA 1Y5LA 1KR5A 3KSDO 5EWMB 4ZDWA 1ULBA 4DLXA 2IP2A 2MSLA 3AG5A 3TKAA 4BFVA 2PX0A 3REOA 5KHOC 3M1YA 3R0JA 1U8FO 2A7QA 3BMNB 4EHKA 1KDOA 4HFJA 2QTWB 1WY7A 3H83A 5ED0A 4R8SA 4YR9A 5IN4A 2E7ZA 3WMFA 3LC1O 1EUCA 3BSYA 3WY9A 3L4BC 3MRVA 3WK9A 1FQJA 1QGUB 2BJWA 2I0FA 3QWAA 4I14A 4R9SA 4RSHA 1DIGA 1LC0A 2PO7A 2BH9A 3ZLBA 1IQPA 1IY8A 4PYOA 3RO7A 4MW7A 4MQUA 5JCOA 5E9QA 2OKGA 2ZSDA 3M4ZA 3C6XA 4Q4JB 1Z29A 4YPFA 1XDWA 1XQVA 2JEZA 1P31A 3EGIA 1LJLA 4ITRC 5F3RA 5HS4A 3K7EA 2A14A 5JAHA 5L6LB 2QE7A 3OG9A 1A9OA 1KEVA 2DFKB 2IODA 4I6EA 3E82A 3R2JA 4M0EA 4ZU6X 3I45A 1LVGA 2NM0A 3BD7A 4G89A 4IDDA 1TKRA 4AW9A 1W85A 4KPYA 1O97D 1T5HX 4BZQA 1Z0SA 1UXJA 2RHBA 5K8JB 2GXQA 2AOXA 4PAWA 3Q6NA 4AZ3A 4J9UE 4QG7A 5CX1A 4DLPA 5BN1A 2ZS8A 5CDGA 4BP3A 1TMGE 4TMFA 4X90A 1RI3A 4DVGA 3KKOA 1NP7A 2XVZA 2D5CA 3BB3A 5AKIA 4O4HA 3N3AC 4HQ0A 4XM2A 5F51A 4EYEA 2OCPA 3WZMA 2ZJ3A 3UH0A 3VI3B 3KFXA 4IH1A 2RHWA 4UPDA 4F2WA 4TQGA 4UM5A 1C1YA 5AHKA 4RXUA 4U5XA 4DCJA 2WMDA 3OICA 4H4CA 1YGPA 2OPHA 2XAAA 3DMNA 1C9JA 3NLLA 8ABPA 1WDKA 4Q15A 4FNAA 1YR3A 2IOFA 4ZA2A 3I64A 5C37A 3NNNA 4WBNA 1U1CA 2H9IA 5CPBA 1P5HA 2JJMA 5FIUA 3UUGA 4LHXA 2ZCVA 3QELB 2QORA 3BK2A 3FWKA 5DTRA 2XIQA 4DLNA 2V3VA 2ZBVA 4HG2A 4IICA 4YJ3F 1OH5A 1FNDA 3PNMA 3V6LA 2V7GA 5CTAA 3SVTA 2QOEA 1RQNA 4IJMA 2VLIA 2RG7A 2Y1CA 2JFHA 1JMYA 2EFHB 3AWIA 1C1DA 4INZA 5BW5A 1Z22A 1KMIY 2R4QA 4K03A 3T3DA 2IU4A 3B1VA 4O4IA 1U2TA 3L1IA 5FFNA 5JBIA 4REQB 4ZCQA 2HW8A 1UP4A 1F06A 4R9NA 4HAWA 2ANBA 1ECCA 2DP4E 4BTVA 4OU4A 3H9CA 3VU9B 4CM1A 4EYSA 1IG0A 1EH5A 1S8FA 3H0CA 1QHGA 1S5PA 5TQVA 3VAAA 3PF9A 4Y2GA 1CZUA 2PX2A 2WJIA 4B8ZA 4RLQA 1N2CA 4GC9A 4I4TA 4ZQBA 3WLPA 1Z47A 1B8NA 1OV4A 4CLDA 4ENRA 1QZXA 5C8ZA 4AO7A 2AJLI 2W2KB 3HBNA 3I42A 4L50A 1ZR4A 2QG4A 4R9UC 4LC9A 2BGMA 4U7FA 1CVIA 1E3WB 1W1UA 4WZAE 3WLRA 4I1OA 1RXCA 1V43A 2PGDA 3D02A 3IIEA 4KSBA 3NT4A 3WHPA 1U6IA 1MGOA 1N8KA 2IQIA 1VMKA 4R2IA 4NH4A 4RLHA 3RK1A 2YZ7A 4QVKA 3U4CA 3TO5A 1XZHA 5JVDA 5KC8A 3O8BA 5EWMA 1PTJC 1WZEA 4M9SA 1KTIA 2VJMA 4FU0A 3CO0S 2PQ0A 1M1UA 2CMKA 1UZUA 2DJ5A 2MSWA 1ZBDA 4J0FA 1C30B 1R0ZA 2BDTA 3V7NA 3ZQJA 4XWWA 2SCUA 3I53A 5ARBA 1F5SA 1NVTA 2O8FB 2FJPA 4KTTE 3W6UA 4IKPA 1DLIA 5ESRA 1DBIA 2QUJA 3F3YA 1E6KA 4LDQA 4GBMA 1Y5MA 2IOHA 2ZUCA 5CB6A 1HNXB 1VCHA 1YFJA 1ZIYA 2HPVA 5FR1A 1ZKDA 1IUKA 1YBVA 3JQFA 2ZSFA 4FFWA 4Q4CA 2JFNA 2FNAA 3KSUA 4Y0VA 3SF8A 4D43A 1IBCA 5A4AA 1TF5A 2WOJA 4CKBB 4YYEA 3R4CA 1Q20A 1X1BA 3UIEA 3PJEA 1ZD2P 3W8FA 1PR2A 4WNAB 2YWJA 4YRZA 3GIWA 1PEAA 4HMQA 4MTCA 5H1YA 5JS6A 4HSEA 3SMQA 1KSHA 4DNQA 3A28A 4PPNA 6ABPA 2GVNA 2WWIA 1DJNA 2WMYA 4HS9A 5E2BA 3ZXYA 3EXG1 4TTIA 4ZVUA 1NJFA 3CXUA 3T3GA 4B44A 4BNVA 2HMVA 6AT1A 1L4GA 1XZKA 1E4OA 1ST3A 2BONA 4PG8A 2X15A 4IM7A 4X60A 4I1VA 5EINA 4ZVRA 3V2UA 4QBFA 1GCAA 3GRUA 4OFWA 3WNZA 3T7JA 4F1KA 3TTUA 3CLUC 1KK2A 3TLGA 5F7JA 3VNBA 1IN4A 2XGOA 1DKUA 4R8MA 2EJWA 3T7AA 4MWBA 3ZXUB 2CLIB 1L5LA 1AIPA 2NAPA 1XNJA 1M1ZA 2GHTA 1Z75A 3KZCA 3ANYB 1N1EA 2APJA 3C14C 4OQMA 2PUHA 3A1VA 4UMDA 5I3ZA 1Q7RA 2PH7A 3K35A 5EMJA 2CNOA 3EGDB 1N5DA 3FVWA 3ACCA 4KGXA 4KLAA 1E1LA 1XUOA 4Q02A 4C21A 2VSYA 3OJXA 2AW5A 5ALMA 4F5EA 1W1WA 4KQ6A 1O6ZA 4IWYA 3OZSA 1V9SA 1NU6A 4UNPA 2VWQA 4QE3A 2XEXA 5GOZA 4FDAA 1JHQA 5KYTA 3K0FA 1TKCA 1EG7A 5FYDA 1YJBA 3BHMA 4EY3A 4JLUA 3NH6A 1JECA 4LWQA 1U2GA 1K3TA 4IVRA 4QXPA 4C89A 3ZHCA 5IH3A 4BFYA 4CTJA 1P5RA 5CBPA 2A57A 3QE9Y 3B9PA 4GWLA 1FS4A 2PO5A 3IPAA 3HFRA 4EO7A 9MHTA 1GUZA 4JOQA 2R6AA 4UREA 4IWXA 3BDVA 2IKSA 2VDWA 2Y1KA 5U4QA 3N8KA 1TIPA 3BSFA 4QARA 5CIQA 3OJOA 2W37A 4PWZA 1BW9B 1JG6A 1SU7A 5TXGA 3BRWA 3TDNA 1HNNA 2ZUDA 4GHWA 4E2WA 4EHLA 2PJRA 1VXOA 1I3NA 1JR3A 2O4UX 1B14A 2WOOA 4JLPA 1Z25A 3VR6A 1WMEA 4LC0A 4N7MA 3STVA 4AECA 3FFBA 3TJRA 3T9FA 3H8WA 4QD3A 2J32A 4YAEA 3R41A 2H8KA 1THMA 2P65A 4NBSA 3H19A 2OXIA 1GGVA 1P0MA 1M2OA 1ECPA 1UEJA 3MGAA 4HYTA 2PS3A 3FPHA 4L9SA 4WECA 1FA9A 2VTBB 1SR8A 3COSA 4HFRA 2A94A 4QA9A 2DWQA 3FKSD 3T12A 5I4IA 1QYIA 3IO3A 1BS2A 1G5QA 3NR2A 4JLSA 4ZMBA 3JPYA 4MKFA 1T0JB 3EIQA 4LZZA 1VJRA 3ZYCA 2GTIA 2WWXA 3MVEA 3OE7A 5G2OA 1FYVA 2CC2A 2XZDA 3R3XA 2K4MA 2WU4A 1V16A 4I66A 4UUQA 3CZ9A 2NTVA 3D0KA 3M4YA 5HF5A 4BXOA 4Y1RB 1S3IA 3RODA 4YLGA 5LNK6 4NYMQ 1G2OA 5SZHB 3ZGVA 4JXZA 1CUYA 3ML1A 3R9WA 1RQ2A 4AN4A 2DFLA 1XAHA 2CNNA 2DUMA 3OI7A 3GXBA 1V3UA 3QOWA 3TQTA 1BE1A 4JVSB 3CNBA 4GLFA 1SFRA 4KE8A 4MW9A 3KLPX 3SOZA 4EFDA 4OFBA 2B3TA 1X7WB 4UQLA 4MGIR 1VJ1A 3NWEA 1PBTA 1JE0A 1V26A 4XI9A 1ZG3A 1F0YA 3VU1A 5DLYA 2YVUA 4UDXX 4XGNA 2JCSA 4EJ0A 5JRDS 3R9XA 1UEXC 3BXXA 3L41A 5L3ZA 2C3MA 1U8AA 1DRJA 1U3CA 3E1SA 3UKDA 4CQLB 3DPSA 4L27A 4HUTA 1ESZA 3FYTA 2PGOA 3R77A 2O3TA 4RVNA 4HDNB 1M2EA 2F6RA 3KQUA 4ALIA 4IJ6A 3OE1A 1D9XA 4MEJA 4E1BA 1G4HA 1HPLA 1OT3A 2K6GA 1JBKA 1NW6A 3AHHA 4BNHA 1KZ6A 4O4LF 1NVWQ 3A1DA 2FQYA 1J2TA 4KMOA 5FP0A 3WZ2A 1VPVA 1PD0A 1U2ZA 5C8DA 5IF3A 3JAKB 4J7UA 4Z0HO 3CS3A 3F5FA 1K3UB 3NOQA 2GCOB 3NKVA 1HDXA 1ADGA 1G64A 1WOMA 3QU5A 4MB6A 4LEIA 1W47A 3EXFA 2NN3C 2XHEA 3FB1A 4KVFA 5C52B 4GPIB 3DV0A 4CKEA 1UT5A 3MTJA 3A6EA 2DLDA 3FYHA 3KQYA 3L06A 2NYVA 2J5KA 5B3JA 3TSYA 3ZVLA 4F7DA 4X7PA 4P3PA 4AMUA 2B8TA 4BN4A 2B82A 4QBGB 5LCXA 1HQCA 3DQZA 3T9BA 5AH0A 3QXXA 1PT6A 4RHFA 3QX8A 3A9UA 4TZ6A 2OXTA 1FMJA 1EVJA 2NZUG 1VIAA 2R6HA 4B87A 1KETA 2DAPA 3WYDA 2XH8A 3PKIA 4AJ9A 3L8ZA 3BD8A 5JDCC 4HNUA 5HKOA 3JYPA 3RTBA 1N2HA 1OAOC 4QTZA 3BMOB 3ZXXA 2IPOA 2BBWA 3AY0A 3D2AA 4IHKA 1NN0A 2VYVA 3F4BA 2BTEA 5FH9A 3D64A 4AB1A 3OA0A 5AW5A 2ZP1A 4P92A 4QULA 5AVRA 5L53A 5JMWA 3KTAB 3IMFA 2ZBDA 4YA6A 2G04A 4O6VA 1IWOA 1CIJA 3M9WA 4FJ2A 5FI0B 1VLQA 4ZI5A 4PQFA 3S2SA 4Q9AA 1CERA 1O54A 5K3FB 3KOOA 1N0VC 5DLPA 4C3ZA 4KK4A 4HN2A 4FB5A 5KPDA 1EFRA 1MHTA 1O95A 3OKPA 1SXJB 4D0SA 3P0EA 4HZIA 4WXHA 3PUKA 2QA5A 3OURA 1ONSA 3O4FA 4QQRA 5IM5A 3ZHRA 5HK9A 1SOWA 3PIRA 4ZT3A 4MCHA 1IHUA 4QBHA 4ASUA 1U1EA 5HS6A 4KAAA 1XTZA 2XWSA 1PJ8A 4EX6A 2MYUA 1NOKA 3EF1A 4FC6A 2V54A 4DNOA 1V41E 3NM6B 4LHVA 1RMYA 5DBHX 4ZANA 4MH0R 3TUIC 2VF5X 4EGCB 4KLNA 1MOZA 1QJ4A 3X2EA 4KFUA 1RHUA 5K2MA 2OORA 2RGNA 3IMCA 1XKLA 5CTJA 2O8BA 3R6WA 2QU7A 4QATA 2QD1A 3NHJA 3QYPA 3KT8A 3U37A 1RLTA 2IDJA 3EVFA 3U49A 4DAEA 5I47A 4YV0A 3CWZA 2P11A 5I7WA 2VEOA 5FOWA 3KTDA 1VP9A 3A9WA 3D8SA 3TD9A 2X4DA 3NIWA 1UDBA 1C41A 4NLLA 3GA0A 4DC0A 1YBHA 3OQVA 1XRPA 4X0EA 4W63A 1RVV1 3NHZA 1NNLA 1PFWA 3V80A 4PYLA 3IEIA 3JPWA 2OV2A 2ZI7A 3TLGB 4LMBA 1F4PA 1DQNA 1OFGA 3OPYB 3E22A 3V1MA 4K9OA 3A10A 3KKMA 3NDRA 2AHOA 3N2ZB 3TJMA 2GYYA 4C0LA 5BWOA 5ER9A 2PWAA 3JQ8A 2Z5VA 3LDUA 3SJUA 5HTOA 3DE4X 3BX1A 3D2LA 5ESXA 4DCNA 3QXGA 1KU0A 5KYGA 3BRSA 4X92A 3SDZA 1FUKA 4X8MA 3OPQA 3QMPA 3QRWA 1UBUS 3UJHA 1GRNA 2DHRA 1CR0A 5HIAA 4Q1AA 3CSSA 4V0SA 5LA6F 4RTLA 1TYCA 3LNCA 2IY9A 4LPSA 4A6EA 1CQXA 1T8YA 1HBJA 3HYSA 1PI3A 4I3GA 3SU8A 3V7YA 1NUQA 1E99A 3M5PA 3PUXA 3B8HA 3NHBA 5SY4A 4DV0B 2YICA 4RKYA 3F4KA 3FCSB 1JLRA 2QMQA 2ZWAA 2H8GA 4TMTA 3RIGA 4RS4A 3REFA 3AL2A 1O77A 3IV7A 4MUXA 1YA4A 4NTZA 2H5EA 4R8LA 3NBZC 5LP6B 5EMMA 1OC2A 2HTFA 2LBPA 1FDSA 1M8GA 2P2GA 3QBEA 4XD7D 4E5MA 1QTRA 1EXWA 3MTEA 4KQXA 3NBUA 2E82A 3H5NA 5F21A 2GI4A 1BW9A 3VXKA 4PX3A 1R0RE 5E4FA 1UBLS 3M6WA 1XMVA 2AD1A 3LLUA 4Y2SA 3T3EA 5HZKA 4AQYB 4DILA 3NUGA 4AMBA 4MHSA 4RVDA 3OJEA 5FL7A 4KE7A 4TTJA 1S2NA 3COPA 5BYBA 3DNMA 3ZVRA 2DT8A 1KZ9A 1Y1RA 2D5BA 2ISSD 1SZJG 4IDGA 5DM0A 3BWBA 5KB3A 1O08A 1CVLA 2DT5A 1XG5A 4RXMA 4E09A 5L6MB 4N3NA 1ZU4A 2ZRQA 5AKZA 1P39A 2X8WA 4G5QA 1SMKA 3ZZNA 2OAEA 1JA0A 4HAXA 1BCSA 2IIPA 4ARZB 3PEFA 1GQ2A 1LWOA 2E4UA 1V8FA 4HAZA 1E69A 1GNLA 1RYBA 2ETVA 3HKDA 4RY0A 3E15A 1GD1O 5IZ4A 1Q0TA 1IY1A 3DAHA 1SXHA 5F3DA 5B7GA 4OHPA 4XCVA 3C15C 1ZD4A 1QIEA 3QI7A 1U9IC 3IUPA 1SUPA 4RC9A 5TT1A 4DIUA 1TT7A 1N32B 1E6EA 4IZ6A 2JI9A 2XF8A 2XI4A 4KR9A 3V2GA 4YUAA 2ECOA 2GBLA 2JHAA 2NUAA 1Y1SA 3ZC3A 3F6BX 3CXRA 1MJFA 1AKVA 1HXHA 4LNHA 1QRSA 2VHWA 2AC2A 3VVBA 4IGKA 2J6BA 5DLEA 3RIEA 2X76A 4RPGA 3IDSA 1X1CA 3F97A 3BG5A 4WBNB 2PH5A 5L3QB 1RRGA 2B2CA 1K27A 2FOLA 4NL4H 4QJIA 1NA5A 1U5CA 1XK6A 2M1XA 1ZKMA 2F1IA 5A9TA 3SS9X 4HOYA 3M49A 3CZQA 2VHQA 4A2PA 2FLWA 2CUTA 1RWWA 4LRWA 3ZWDA 1Y7LA 1MQ8B 3AI3A 3BE5A 2ADOA 4N6GA 5EUCA 3B3QA 3OWXA 3LT2A 4AM8A 4WOKA 2RCNA 4IIDA 3IRVA 1IBRA 1UT6A 3DSRA 1J6UA 4HGPA 4U9HS 3GJXC 4UXIA 1PR0A 4KNVA 5FNVA 2GHQA 3CJQA 1N75A 1K06A 4N7BA 3OEED 1EA5A 2Q9CA 4RFLA 4WKNA 2ZVQX 4JC0A 3ZE1B 4MNTA 2AVNA 1I30A 5BORA 2RJNA 1KPGA 4Y9TA 1DAPA 2K5UA 1XQXA 3PHCA 4FHGA 5GZ3A 2FA9A 2CFCA 4WD3A 2ZIAA 1Z8DA 3DCJA 3GT7A 3MCWA 5AP9A 2DY1A 2IA5A 2CJWB 3GYGA 4LYDA 4B47A 5B3KA 4MV4A 1X1AA 1XVVA 2V7QD 3G0OA 1ADJA 3MWDB 4NMMA 4CYMA 4A2QA 3AVUA 2RGNC 5H02A 1LH0A 1UZLA 4KDFA 3VO9A 4C4XA 5C51B 3KBOA 1QKJA 4H35A 4LIPD 1DEHA 3W5HA 4BNZA 4RJTA 5JSZB 1GA4A 3G0IA 3B1ZA 3WTCA 2DJIA 1BVUA 2Q5CA 4M38A 1CUXA 4Y2TA 5H5JA 3SSAA 4PHCA 3RC7A 2OCBA 2HREA 5CH5A 4CTNA 1J1UA 2GJ4A 1U2QA 2ZT7A 4AJ1A 2AN4A 3I9LA 4RTSA 3T06B 1TQ4A 3ND7A 3O21A 4MRMB 1DRUA 1P77A 3TH5A 3UMBA 5KYXB 5HE8A 3JQFC 1GCGA 3CEMA 4FSXA 4K81B 4BEBA 1HLFA 4H6PA 3TFWA 4L5AA 1HQYE 3RM3A 1NUAA 5K6AC 2HK6A 1E0SA 3R0VA 4RH0A 3PXGA 1DJPA 1SULA 1J24A 2NO5A 2WTEA 3L0IB 2Y1EA 3NPMA 3R0QA 4BWFB 2IIVA 1ZHFA 3L2OB 2X6QA 1CFJA 3DBRB 3RUCA 1M2OB 1X0XA 3RAEC 3F47A 2V4MA 4MYRA 3KQKA 2J9ZB 4FMDB 1Y1PA 4EY6A 1NLYA 5CVEA 3D5QA 3KT3A 4WA7A 4JFAA 4TLLB 1W0KA 1P9OA 2C77A 2KYRA 4KR2A 4U2CA 1UDCA 2JCGA 5E2IA 3M4NA 3TDKA 1CUHA 3C98A 4E3ZA 1JJ7A 4WKBA 1E63A 2YJZA 4QDZA 1X7YA 1R0KA 5DHTA 3FCOA 4N6OA 4YRJA 4P4SB 4TMWA 2OHVA 2WT9A 5JOQA 2HX1A 2WM3A 4G56A 4C1BA 1RJWA 4YJFA 1Z2CA 1ZIPA 1GZ7A 2B8WA 4GPAA 1KY5A 5ELLA 4URWR 4YBZA 4X62B 2CUNA 1NW9B 3P5SA 1SD5A 2CDRA 4OEHA 4EBFA 3VZRA 4EIWA 1R0XA 1OFIA 2WTNA 3HA7A 3OCXA 4MLCA 4M7OA 3L0YA 4OKNA 4QT0A 1CUAA 4WXYB 2FPKA 1ADYA 3HCCA 2IH2A 2P4UA 4RHEA 2IX3A 5FJIA 4KE9A 2LIVA 3PQ5A 2WT8A 4HMOA 4RHUA 3R7AA 2OXRA 4XD2A 3KOWA 4DLBA 4LMPA 3AG6A 3WFIA 4Z1OA 1KZ1A 3KQPA 3OZIA 4B31A 5FDFA 1CX9B 3LE8A 4MV7A 3ZH2A 1J2RA 2RKWA 4G4SO 3WK7A 3R75A 4M46A 3JASB 2OCXA 2AR0A 3V1NA 4NE7A 5EQTA 4Z4QA 2GEJA 4LDAA 5CNIA 1RIIA 3MWJA 2DWPA 3PNKA 4J6EA 2DH6A 4NP6A 3R7WA 4BNTA 5ALZA 1H5UA 4ND3A 3H9GA 3WK6A 5A9RA 3AIOA 1RHRA 4F4UA 1OXSC 3O95A 4GMXA 3G13A 5DT2A 1KK0A 3CRMA 5IUJC 4EI2A 2D2XA 1GRVA 5JBNA 3PTZA 1TCCA 4N0EA 2O2HA 1W4BA 1VCOA 4E2XA 3AL3A 4F9EA 4RPLA 5IKMA 4NKRA 1R9NA 1OA1A 1P6QA 1KIMA 3K6SA 3AHJA 1X7GA 1OILA 1MAVA 1RKUA 2R4UA 3Q10A 4H9GA 5DRTA 4PC2A 1W4LA 1LPOA 1Z5ZA 2GYUA 3F0TA 3L1HA 3PRKE 3P0FA 4MIYA 4YMIA 3TBKA 3ZV6A 1BO6A 4D6YA 4MQEB 5DTIA 1QQ7A 3CINA 3GCGA 1SHLA 5CVDA 4QNRA 2CDAA 1DFHA 1H4VB 1KSFX 5B4TA 2V55B 3WL5A 1ISSA 3G2LA 2JVIA 4ADSG 1XPOA 3D0OA 3W2GA 1J56A 1Q7TA 2EKZA 4P22A 4D8UA 5F2NA 3L8EA 4TS4A 3H18A 2FEPA 4FOPA 4BYMA 1OH7A 3ET4A 3OTQA 4JA2A 1IY9A 1YIAA 3L6RA 4PS1A 4TV9B 4UBLA 5CB8A 2XDQB 2BHSA 1OZAA 2I2FA 1MDFA 2IV3A 3Q8XB 1EM6A 5ABPA 3DEHA 3HEBA 4YJFB 3HN6A 2ZRLA 4IQ4A 5KAMA 4MRPA 2ZGVA 1GGNA 1UBTS 3ECCA 2Q9UA 2ALJA 1GVNB 5FBLB 4BIIA 4FFMA 5FBRB 1GEEA 1LXCA 3HBAA 4KMSA 2VJMB 3ORYA 5AJZA 1WHSA 2HRCA 1GPYA 1J0EA 1FQOA 2R1TA 3BWYA 4A8JB 5HKAA 5CLFA 4GOLD 2P6NA 4YHBA 3OU6A 2Y4OA 4KITB 4TT3D 4IIJB 2NQ8A 4U7PB 5IT0A 3HU1A 3L0PA 4XYEA 2Y1GA 1YB2A 2ID7A 3GRCA 4DLYA 4EVSA 2JH9A 5CT4A 5ALOA 3L4KA 1SB8A 3I9OA 4AY5A 2FP4A 3S2GA 1H4TA 4F96A 2EFCB 5J1SB 5G02A 1VJ0A 3I5MA 4OJYA 1KE1A 2P9CA 2VPWA 2ZYAA 2Q21A 4LXYA 3H6HA 3RSGA 3UJ9A 1GR0A 4Q7EA 3ZZ1A 1NHWA 2H2IA 2JKVA 3NHWA 4TMZA 1A4XA 4WLVA 3W7BA 4BMVA 2B8NA 1KI1A 3K70C 2X19A 1E3QA 4JJ7A 1JHRA 1W96A 2Z09A 2H3HA 3MJFA 4G0OA 3I5XA 5JHHB 3CYFA 5IW8A 1SXPA 1ZW6A 4DDWA 4RELA 1R8JA 5AD1A 1E9CA 1VJDA 1C2YA 1NRWA 3LLSA 4GEKA 5LBTA 1P7PA 3EG9B 4C9BA 4U39A 1EK1A 3KZOA 3PJDA 4RF5A 4EOGA 5JSZA 2CDNA 1EK6A 4OHVA 2I33A 3A6HA 1FNBA 2R1VA 4P7FA 4YO8A 1T0BA 3IIKA 3SX0A 1JU3A 3LT0A 1JKJA 2V59A 2P4SA 2VHVA 3VAYA 1OWLA 4FYXA 4DV2B 2XZTA 3DKKA 4US2R 3HFJA 4XGRA 5JXHA 1DEOA 4YMHA 1SXJE 3NATA 2OO5C 3SAJA 2YWGA 4WCFC 3WC4A 3HPRA 1YMUA 3T5MA 3KZMA 4X3OA 4EABA 2XSZA 1PX2A 1BG6A 2Q5HA 3B9RA 1QH8B 3P19A 4KKXB 4DRXB 1CRLA 2JKYA 2ZUUA 3DAFA 4H7DA 3N05A 4FYIA 3NBMA 2GNPA 4X20B 3H1GA 4GX5A 4AO8A 1EZ1A 1FLDA 4ZAWA 3L8FA 1PDVA 1AJEA 3D3JA 1WZNA 1A4RA 1EB8A 1K3FA 4NBTA 4UOEA 1N6PA 1IQUA 2N3ZA 1HF3A 4PGGA 3ZLJA 2V7UA 1J9EA 1HOTA 2XB9A 3PCTA 4AZWA 2IOQA 3FB4A 2OVFA 2OVBA 3OPVA 2PRJA 3IUYA 3T38A 1HZJA 5DRYA 3RRYA 3R3UA 5L3SB 2TYSB 5E3IA 5KNBD 1OWMA 2VWHA 1H8HA 4EG8A 4K0RA 3LQ4A 3C1OA 2W2NA 1W5AA 2B4AA 2G9QA 2RK3A 1V8BA 2W6JD 1AQLA 3OZRA 4HXYA 2HWUA 4Q4LA 4D0LB 5BMOA 3M8KA 2YWXA 4QBIA 4P98A 4CU2A 1OUMA 2D59A 3JW8A 1J97A 2L82A 4LC1A 3RFCA 1U0BB 1GCIA 2YVLA 1XZEA 3UAWA 1OIXA 4XYLA 3WWPA 5J63A 2FMHA 1GIAA 1ZJ5A 2BBTA 2P9YA 4B6SA 1SK9A 3G8YA 4GKJB 1VL5A 1PNQA 1E94E 2PQ6A 4YRDA 5AKLA 2PL9A 5HG0A 3KDSE 3F7OA 3PVSA 1D2GA 1R74A 3STHA 3X43A 4IHQA 4ZJZA 1FMFA 3D7KA 1ECFA 1G66A 2O2EA 2WIFA 3DKPA 5SV2A 2Z8YA 3THYB 2JIOA 1CB7A 5C5CA 3RVLA 5KSOA 1NV8A 1NXSA 4IQ0A 1LLFA 4X85A 2DETA 3RTAA 4BDTA 1JW9B 5ENDA 4NK4A 3E9YA 1OFHA 4XPZA 3QH4A 4MUAA 1AF7A 1JQKA 4ZQCB 3VH3A 1ZNXA 2FAXA 4D44A 3K1ZA 1TYEB 3IBSA 3QGMA 1JWAB 4NZYA 4DQXA 3MN1A 1GPUA 2WWYA 2J3QA 1OLUA 3AVPA 4MI6A 1ODKA 1PJRA 3L02A 5L9AA 3ZOZA 4R2JA 5CLJA 1TU4A 1TIKA 2BKLA 2QRVA 2PXHA 3CR7A 3EF3A 1ZS9A 3EZXA 5DTJA 2W6CX 4QOHA 2YFYA 4YASA 3S6JA 4X45A 4UUPA 2CCJA 3O8DA 2BEKA 1EFAA 1E1QA 1S2IA 3S8MA 1R3UA 4Q3LA 4ZQGA 4ZQFA 4OMDA 3GCXA 3TZ6A 5IZCA 1T1RA 2NSLA 2FR8C 1CRWG 2W8BB 2IVZA 1A9SA 4HNAB 2ZLBA 4ZQHA 5KYNA 3WP0A 4WT7A 4LF5B 2BZGA 1NBEA 2ZTMA 3QLVA 4HH0A 4B0OA 5JCPA 2ZRNA 3SKYA 1QE5A 1W46A 2YBDA 3R9KA 5EWLB 3FOWA 1ZM2A 5HJ2A 1RXIA 1JDBC 2VTEA 3ZPXA 2JLUA 1YT5A 4EMSA 4HYYA 1PFQA 4CV1A 4ED9A 5LP6F 3UGJA 3I2HA 1ESCA 2ARKA 3B2NA 3C6MA 3QE3A 3X1JA 2QVCA 4PM4A 4K86A 3Q7SA 5G0VA 3QHPA 1R27A 3OT1A 4J1TC 1YJAA 5UKDA 2IXBA 3E3LA 3F3SA 3OO1A 4RKEA 1VSUA 3FMFA 2FE1A 3HLYA 4KU4A 5B3JC 3EEIA 3T1QA 4X1IA 4ZO6A 4B3BA 4M98A 1LX7A 5IFKA 3S2IA 3OLYA 4NJMA 3DKIA 4TUYA 4EYQA 5EZQA 5FADA 3O74A 1Z2EA 3ZY4A 3WK4A 4JP3A 1NMEA 4IIJA 3WGVA 3JXEA 1VA4A 4QU0A 3SIRA 4QGFA 1OXKB 1SB9A 4EUSA 3NNSA 5LLDA 1LK0A 1Z0JA 2F9FA 3M7IA 3Q7RA 3IIMA 3R3ZA 3S27A 5K3SA 4CW7A 1BMDA 1AQIA 1DWQA 3U3JA 2X8AA 4BO2A 3FTFA 2X5JO 2YHIB 1JAYA 2GLUA 4JYPA 1FEZA 5EC8A 4AJIA 3FMVA 4GD3Q 1P2DA 4C3OB 1DSSG 1QYWA 3AIIA 4OGKA 3EE6A 1E9AA 5DXFA 4LNUA 4P4UA 3AUFA 2I6SA 5DYYA 4DPLA 4YAGA 3DTVB 1D7OA 5KVSA 3IX7A 4NCXA 3Q8LA 3NP7A 3CLTC 5G4KB 2BGNA 2YV1A 4TQAA 4HPWA 4BVLA 4CMGA 1H9BA 1ZA1A 4RD6A 2HSZA 2NUBA 4IIJF 4JBLA 4RVCA 3H8VA 2QPAA 2P9QA 3A32A 3L5OA 3WAKA 4ALMA 1TK9A 2YHBA 4O4JA 2NSDA 5T4BA 1NUTA 1AB5A 2HSEA 3JCZA 5J2TB 3F96A 1AS3A 3R5FA 2V7BA 3ZHOA 2YNMA 4LBVA 1QYCA 5BOVA 5FOSA 1SA0B 4WOBA 1KEEB 3D8BA 1GL7A 3F2IA 4UNIA 4L75A 5JJCA 4P32A 5C8VA 3DWFA 2Q3JA 4D82A 4MQEA 1L5RA 4L07A 5T4HA 3RR2A 2I1LA 2EP7A 3LFHA 4ZVQA 1X7XB 2VXOA 5AXAA 3ZE2B 1KYWA 1RI4A 2VH1A 1M8JA 3NVKI 4J94A 1WBBA 1T25A 4MWCA 5BSUA 1W85B 2AI3A 1VKNA 3V00A 4HPJB 3PA6A 3ZCXA 1J00A 1MAAA 1JDZA 2BMAA 3LI2A 3NI2A 1E98A 4RL4A 4IY1A 2HYIC 2EG5A 1AX9A 4ZZ0A 1IRIA 2DHCA 1LX6A 4GI1A 1JKJB 4K26A 4L74A 3OIGA 4CCYB 4E4RA 3FCCA 1P1RA 4F4DA 5D84A 1VZ2A 3EPLA 1JIIA 3G2KA 2D5AA 4ZODA 5AK5A 2HXGA 3FI0A 4BO7A 1VE9A 1BWSA 1QGED 1QPGA 1XZQA 2D2EA 1WTAA 2IELA 3PWTA 1UMKA 5EYPB 4AWXA 3RIHA 4TXHA 4PSCA 1RM5A 2ZIWB 4G1CA 2PVSA 5D7NA 3MUEA 4XRGA 1CY4A 2AHRA 2ZBRA 1F9AA 1U5BA 3DXYA 3H5VA 3KZKA 5BR7A 5IXSA 1O94A 2R8RA 4W8GA 3A4YA 1CULC 3UMGA 2ZIXB 4KNWA 1ISJA 3KTOA 4MGZR 4U8GA 2ZUTA 2UVPB 4DJAA 1XRJA 4JGGA 4Q00A 2P0YA 1MH9A 3VV2A 3L49A 4ZEVA 3PITA 4BNFA 5ADWA 4F91B 3ECAA 2IYNA 2AUTA 1E9BA 2NXJA 2D4HA 1YMQA 2WSYB 3OETA 4GX0A 4QRDA 2EYQA 2ZJBA 3M6IA 3OT1B 2OZLB 3ZX4A 1T9KA 3EXEA 2BYTA 3C3WA 5A4FS 2RKBA 4FQ7A 4XH9B 5IDYA 1S1MA 5EJGA 1FIUA 3ENWA 2O06A 3EZLA 3JZMA 5H9WA 1SUWA 2J5XA 3OU2A 3RFVA 2C9YA 4IIHA 5DHUA 3ROTA 1FP1D 3ILSA 1B0UA 3E81A 2FFQA 5F1PA 2B36A 4CEHA 1Q2XA 1VLZA 5JANA 5KJCA 4W7HA 1PUIA 2G07A 2BTQB 3ZIUA 3GC6A 2MU1A 2BGKA 3TRHA 1GPBA 3FSRA 2DQYA 4YRLA 1N6NA 5TMEA 3SLGA 3AINA 1SZDA 2Y1FA 3HUTA 3LC7O 4H0NA 4OUDA 3C1AA 1NPYA 1JG7A 2JAQA 1ZEJA 1UK9A 4RKWA 2OYRA 4DARA 1QUFA 1RE1A 3IXQA 2WJJA 3B2EA 5EJFA 5LZ2A 2QDKA 3WXBA 1IULA 3BDIA 3FPAA 3KQLA 2GCNA 3FFWA 2FMKA 1JE1A 1YQ9A 2REQB 1WBDA 2JLBA 3KAQA 1Y6RA 2A1TS 3AWDA 1JTVA 3VR6D 5JH7A 1E2MA 2HA4A 3A1CA 4BZPA 4O2BA 4IJKA 1M2GA 2GJ8A 4JJ8A 9ABPA 3O7MA 2QTMA 4XGIA 1S9DA 1PT8A 2NO9A 4FGSA 4WLFA 1W75A 4LHWA 4DA7A 1H8EA 2ZUSA 1RRKA 4KN8A 5JD4A 3C5EA 2XYHA 1HE5A 5CJPA 5FKJA 5J5AA 1WV0A 1K7YA 1RBYA 1N2CE 1AUOA 4GSKA 5DPMA 1B4DA 3ADDA 5IZCC 1L1RA 4QNNA 3VDXA 2GBGA 3NTUA 1AA9A 2BH2A 1KOJA 4R8KA 3D0RA 4R1LA 2AX4A 3KWMA 3ROGA 1DRKA 1JHZA 4GRAA 5D6NA 2DBZA 3DUFA 4YMTA 2IOFK 3BFXA 3QY0A 4IOLA 3VHLB 2AZXA 1YB7A 4PG7A 1KAHA 3H2YA 1BEUB 2YYYA 3BF8A 4U0JA 3KR9A 3LCUA 2FHSA 2Z08A 4UARA 1YRBA 4RBNA 2C1ZA 2R6FA 4P3KA 4OQXA 1OU4A 1V5IA 1XYGA 4I1RA 4ZIRB 3O84A 3HGMA 5BNWA 3TQQA 1U6JA 1SU6A 2B0JA 4H31A 2AFHB 4HDSB 4AG3A 1GXSB 1UJBA 3CNOA 1M7HA 2D8AA 2QRPA 3PC3A 4K6HA 4BV8A 5BVGB 4OM8A 5IMSA 4RTRA 1NF3A 4FDVA 4Y6OA 3WWOA 3I9FA 2TMDA 2NVUA 5ALKA 3ROQA 2Q27A 3IOMA 1UM8A 3UUEA 3OQNA 1XTPA 3DV2A 2FQWA 1CEYA 3QWBA 4DQUA 1UAGA 1EP9A 2EAUA 4CQMA 4B45A 3E05A 3LBIA 4HX2A 4MVJA 4WJKB 3ZD9A 4C07A 1CY6A 2FXIA 3LRXA 3VSAA 5CX1B 3I0ZA 3M5WA 4N8DA 5DW0A 1XB2A 1C14A 3NDBB 5EEGA 4D9HA 2QVLA 1OJLA 2OXCA 2LZ0A 3AL0C 2N1BA 3IVGA 5B7NA 1F1BA 5LOVF 1KSGA 2WIDA 2R7KA 1SBHA 2Q41A 4JKIA 4YMSA 1QVAA 5L45A 3CEPB 2J7PA 1AURA 3IVRA 3O8CA 4RTPA 3MHPA 5K2OA 3PE6A 1YZKA 2O1WA 2XTJA 3HGQA 4XJVA 5E6UA 2JGEA 2IUFA 5JFOA 5LUBA 3TCXB 2PLFA 2VA9A 4LF7B 2VRBA 3MB5A 2H1OA 1NUHA 2P27A 2BEWB 1B2LA 1ISHA 2Q5IA 2Q5OA 1ULHA 5DP2A 4EL0A 2EG9A 1GFIA 1JQBA 3LX6A 4KZKA 1ZCAA 2XLBA 4FJ1A 4N82A 1KBZA 4C04A 1BSVA 1MNAA 3SDBA 3RS7A 3N2LA 5HE9A 4BNUA 5HR5A 5CCXA 4L6IA 1G6OA 1DTEA 1NXVA 4HDRA 3WLQA 4MW4A 3Q9UA 3CG4A 3RU2A 3TNDA 3ES9A 4BO3A 4KDRA 1EX6A 1GPNA 1T4GA 1PEKE 1TIBA 5DBOA 1QB7A 1Y82A 2C3UA 1DQPA 1C0LA 1V7CA 4K9MA 3M81A 3P9KA 1GTG1 3K9LA 2JH8A 3KOYA 4WCFB 3W3AD 1X14A 2C0QA 2ZI6A 3ZHBA 5A3QA 4CEIB 2XMQA 3DMGA 3W5UA 4D4HA 4BWGA 2JHCA 5AW7A 4MS3B 1N2SA 2A1IA 1WX1A 2KQUA 5AVXA 4E1AA 1SIOA 1KZGB 3C43A 5FPTA 3NKLA 5B6JA 1DPFA 2LRHA 3RSSA 3QPBA 1NBHA 2P2DA 2FRVA 2FMUA 1U7HA 1BJTA 2ZDHA 4JELA 4Q21A 4C3VA 3ERCA 2OTCA 5I45A 4O2AF 2QX6A 5L8VA 2CXHA 4PGMA 2QN7A 3BAZA 3C97A 3RBVA 4DQKA 4BBPA 1P1CA 2ZRBA 3KP1A 2OLEA 1U94A 1I1HA 1XTKA 4BPRA 5EPOA 3LZCA 1G3RA 1I4LD 1M6NA 1R6BX 4XSHA 1EEHA 2JGMA 1JX6A 1KMCA 2XODA 1XZGA 1XI2A 3ZZMA 5BV0A 4XWYA 4P2GA 1Y4SA 2XDQA 2E4AA 2HIHA 2D5LA 1C1XA 3J81k 4FM9A 4EYKA 5B55A 2EHJA 4KR3A 4BATA 2B5WA 2O14A 4RD3A 2IIBA 1G20B 3RKUA 1V47A 4BMSA 3G3EA 5B1SA 4RIFA 3QIVA 2IYTA 3QNWA 5JJIA 2PZMA 4MWOA 1YR8A 5TR9A 4CI0B 2XBMA 1D7AA 3BMCA 2HSJA 3N5KA 1E3IA 3WL4A 4ETNA 5KOIA 1PJQA 3L7OA 1Q22A 4TS3A 3P9NA 3CPHA 4EM6A 2EX1A 3PC6A 2V3WA 1EE9A 2KLBA 3Q8KA 1EBBA 3FUWA 1M2HA 3UJAA 1A7KA 4RM2A 3MJSA 1W88A 4L8WB 5DYGA 2VUIB 3MBKA 1Z5UA 3GGCA 3DE2X 3GJYA 4JH0A 4UDOA 4Q9NA 5LDHA 5DIFA 1MB2A 5K8CA 1EUDA 1HYHA 2ZETA 4ZDIA 5CYPA 1GNPA 1E7MA 4ZREA 1QANA 4IDCA 3AR2A 4QQ8A 5KOHA 4B3SB 4NCHA 4NZMA 4JHXA 2R0QC 1F0PA 1QK3A 3KSRA 4P36A 5DWVA 5FBQB 4JX8A 1BA2A 1T9HA 3BH0A 4WERA 3GP8A 2R85A 1VMIA 4RZHA 1X7HA 3VYTB 3NVMB 2PBRA 2X5KO 2WD7B 1D9ZA 1YR2A 2EF1A 3KALA 2G8LA 5CD9A 2OB2A 4JY7A 1G1MA 1KK1A 4MVJE 4PO9A 4BO8A 2ZJ0A 2G1JA 4TT3A 1TMOA 2Q0HA 1KYZA 1B0PA 1O9GA 3GRPA 4QHTA 5E95A 3WV4A 5I7VA 2HZ7A 4RK6A 2Z57A 4MGKR 4BQPA 2BUBA 5DNYB 2ONYA 3EVGA 1EWRA 4Q37A 1Q0ZA 2IHJA 1WL8A 1XTBA 2J9YB 2P2ZA 3E9CA 3OP1A 1ISMA 3QFFA 4XLLA 3WBBA 2JAPA 3BKXA 1G63A 4G4GA 3PR2B 3GCWA 3CCCA 4OK3A 1WQ4A 4F9FA 3RADC 1U5AA 5AFSA 4LYGA 5E0KB 4C43A 4Y6PA 3ROXA 1ZONA 2VHZA 2JJ1A 1Z88A 1LVUA 3OM9A 4UEJA 4A0RA 2GETA 4M9QA 5BVGA 2AJTA 3G5UA 2RHGB 3EA5A 2QP3A 4TKMA 3LBYA 3LUBA 3LZ6A 2Y1WA 3W8RA 4ZXPA 3EQ9A 2PANA 2P77A 3PPXA 4BMOB 4ZAFA 3WYBA 5TMPA 4LNUB 3C3PA 3ETCA 1C3JA 3M2TA 3MXOA 3O8OB 4BUJA 1JQ5A 1XIVA 1KEWA 2O50A 1Z17A 4IX9A 2FW9A 1FXWF 1UFOA 3DUFB 1GZ5A 1R0YA 3EIHA 3HCAA 3KUDA 1AUXA 4HR7A 4C7XA 3WYAA 3L4EA 1YOVA 1FNSA 4HAUA 4RIGA 4UCQA 4CM7A 4OMFG 2QTLA 2I2DA 3CE6A 4YCJA 2IW1A 7REQA 1HL3A 1HA3A 2BEVA 5C2JB 1CS4C 2VH5R 2D54A 2VP3A 2FSSA 1CETA 1CIVA 1MF7A 2JW5A 3K05A 4LYJA 3QVTA 5C31A 1E5LA 5KIAA 4I55F 2IYVA 2YXBA 3QM1A 2CKMA 1M76A 2PG3A 3MS7A 5HUQA 2O8CA 3O5AA 4Z4CA 2QKYA 3DFIA 4M76B 2CUZA 1E79A 2WF9A 4IV5A 4E07A 4HUJA 1PL8A 4OQPA 2QX8A 4ARIA 1MFZA 1JRLA 1Q5PA 1TT5A 3LXRA 1Z38A 3CKKA 4AS2A 4L22A 1RRPA 4F21A 3VJMA 3CIFA 2PEZA 3BM5A 1LB1B 2DFPA 4HLQB