2BG9E

Refined structure of the nicotinic acetylcholine receptor at 4a resolution.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
370
structure length
370
Chain Sequence
NEEGRLIEKLLGDYDKRIKPAKTLDHVIDVTLKLTLTNLISLNEKEEALTTNVWIEIQWNDYRLSWNTSEYEGIDLVRIPSELLWLPDVVLENNVDGQFEVAYYANVLVYNDGSMYWLPPAIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLSAEEGIDPEDFTENGEWTIRHRPAKKNYNWQLTKDDIDFQEIIFFLIIQRKPLFYIINIIAPCVLISSLVVLVYFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSLVIVTNCVIVLNVSLRTPNTHSCVEACNFIAKSTKEQNDSGSENENWVLIGKVIDKACFWIALLLFSLGTLAIFLTGHLNQVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
publication title Refined Structure of the Nicotinic Acetylcholine Receptor at 4A Resolution
pubmed doi rcsb
molecule tags Ion channel/receptor
total genus 87
structure length 370
sequence length 370
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
E PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2bg9E02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2bg9E01
2W8GA 1OEDA 4HFCA 3TLTA 4UM3S 3U8JA 2BG9B 3LSVA 4LMLA 4TWDA 2W8FA 5J5HA 2UZ6A 3UU3A 4QAAA 4ZZBA 3U8LA 5J5IA 2BYNA 5J5FA 2BR8A 4NZBA 4UXUA 5HEHA 4ZJTA 2YOEA 5HEGA 3SQ9A 4ZZCA 3WTHA 4ZR6A 4A97A 3T4MA 2PGZA 3EAMA 2M6IA 2LKHA 3GUAA 3WTNA 3TLUA 1UX2A 2QC1B 2XQ5A 3ZDHA 2WNCA 2XNVA 4ZK1A 4Z90A 2WN9A 2Y57A 4NPPA 3P4WA 3UQ7A 2YMDA 2XQAA 5J5GA 4BQTA 4X5TA 3UU8A 4A98A 3IGQA 5AFLA 2BJ0A 5BP0A 4D01A 5J0ZA 4HFHA 5HEOA 3WIPA 2XNTA 2BG9A 4IL4A 4Z91A 5BW2A 2XQ9A 3TLWA 4EZ1A 3P50A 3SQ6A 2XQ4A 4BFQA 5BRXA 4ZRUA 4HFEA 4ILCA 4AFHA 4WV9A 5CFBA 5AFMB 5KE4A 1OEDE 2BYSA 2XNUA 4XK9A 5SYOA 4TWFA 2BR7A 4QH1A 2X00D 2BG9E 2XYTA 2VL0A 5AFNA 2X00A 2BYPA 4ILAA 2Y54A 3WTMA 5AFJA 5L47A 2XQ3A 4IREA 5FJVA 2Y56A 5AFHA 5AFKA 3UUBA 2WNJA 4QH4A 5HEJA 3SIOA 4UM1A 2XYSA 5KZUA 3EI0A 3WTLA 1UW6A 4HFBA 4HFDA 2ZJVA 2XQ7A 2YKSA 4AFGA 3UQ4A 4HQPA 3C84A 2LKGA 2MAWA 1OEDC 4TNWA 5TVCA 3U8KA 4AFTA 3WTJA 3RIAA 3WTKA 2BG9C 2LM2A 3TLVA 3RHWA 2YN6A 3UU4A 1UV6A 4IL9A 2M6BA 4UM3A 5CO5A 5HCMA 3U8NA 3WTOA 2WNLA 2Y58A 2PH9A 5AFMA 3UU5A 2YMEA 4ALXA 3SH1A 4B5DA 3RQWA 3EHZA 4DBMA 3JAEA 3TLSA 2XZ5A 4QABA 1OEDB 3RQUA 3UU6A 4F8HA 5L4EA 3RIFA 4ZJSA 4QH5A 4FRRA 3ZKRA 4LMKA 2BYRA 5HCJA 5L4HA 3ZDGA 2KSRA 5LXBA 3JADA 5LG3A 3C79A 3RI5A 2Y7YA 4ILBA 3PEOA 2BYQA 2XZ6A 4COFA 3U8MA 5JMEA 2XQ6A 4LMJA 4UY2A 2ZJUA 2LLYA 2WZYA 4ZK4A 3PMZA 4QACA 4HFIA 4TNVA 1I9BA 4XHEA 3WTIA 4UM3P 5HEUA 3JAFA 5IUXA 5AINA 4TWHA 4PIRA 2C9TA 2XQ8A
chains in the Genus database with same CATH superfamily
3P4PA 3Q5DA 4LF5T 2WU2A 5AQLB 3ZMUB 3ABVA 3UU3A 5J5IA 2CLYC 2K48A 3C4WA 3N9NA 1J5ET 4E7ZA 3QB5K 3OJAA 5LHGB 3R84B 5L2LA 1YKHB 4ERRA 2XSBA 3AEAA 3K8PC 3IGQA 5ABEA 2H88A 2BKNA 4IDOA 5AQRB 3FBLA 3ZSTA 5AFMB 4UELA 4TV8E 2VASA 4QH1A 3N2OA 2VL0A 2WZHA 3UUNA 1UK5A 1QUUA 4ZS2A 3J9X1 3M65A 3AEBA 3Q5EA 3DP7A 2C0SA 2MTQA 2MAWA 3U8KA 1T7SA 5CB4E 3HA4A 4XAXB 3WTKA 2LM2A 4H9OC 3NKZA 4DR3T 3T1YT 5FNVE 5LMUT 2X68A 5DQWA 4IE7A 3RQUA 1LVFA 4O4IE 5FMNA 2E2AA 3QK6A 4KUMB 1X79A 2JJ9A 4QXBB 4GKJT 3RKGA 1NENA 3SFEA 2Q9QB 4JYAT 2A3DA 3MKDA 4O4JE 4AQGA 3FXDB 3H37A 4IT4A 1BR0A 4H9SE 1LRZA 5AQNB 1U5PA 1VCSA 2XSAA 5ABHA 3PUXF 5HXRA 4P09A 4Q25A 2CCQA 3WTHA 5TAOA 2ZLYA 3EAMA 2JMKA 4JI3T 4I0UA 2JQHA 4HE8A 2WB5A 2CXLA 2NW9A 2OA5A 5DABA 5LGNB 3UULA 2BJ0A 1CHUA 2JRKA 3QOFA 2VQFT 2B76A 1IBKT 4AKGA 2I59A 4BFQA 3N9PA 3PUZF 3RX6A 4EYYR 1WR0A 2KXPB 2VKOA 2BYSA 1D0ZA 3F31A 4ILAA 2VK9A 4H9RC 2XYSA 4EEDA 2YEVC 4HFBA 1MIYA 4O4HE 3C51A 4WZXA 5LGUB 1T8BA 1KNPA 3RPUA 2QA7A 5CO5A 1EZ3A 4UM3A 3CX7B 4DR4T 3UU6A 4DV5T 1W09A 4LFBT 2KNDA 2A2FX 2KSRA 5LXBA 4P0BA 2LM9A 2CBJA 1N32T 4L0RA 5KMGP 2KT9A 4JI2T 4N78D 4ILUA 5FXWA 4F6RC 4PK4A 2C9TA 2HN2A 5HWYA 4HFCA 2V7MA 1FMWA 4LFAT 5AQGB 5ABGA 4UXUA 5AQJB 4TX5A 5HEHA 2BBJA 4G63A 4XBFB 4TV9E 4LF9T 3GUAA 5FVKA 2OV9A 3NZQA 4ZK1A 2YINA 2CHNA 3IBPA 2Y57A 4CI1B 4ANJA 4X5TA 2DCFA 4AIUA 4IL4A 5JR9B 3G06A 4GKKT 5JH7E 1X9BA 4PJNA 5AQOB 4TWFA 5AQQB 2X00A 2H7VC 3RRCA 1HG2A 3VRBA 3V5SA 3N5LA 4DVDA 4GK0E 1CUNA 5GONE 3UU4A 2E9XB 1Z0PA 2K24A 3GA8A 2YK0A 4B5DA 2EHOA 1XNRT 4AKHA 5KX5E 2DWGA 4F8HA 4DV6T 2V5DA 3F2EA 3AA0B 2LSJA 1ZEEA 2J62A 1E2AA 4H9QC 3AE2A 3NRXA 3LK3B 4OYKA 5LMNT 4JUYA 3LK42 4KHPT 3AA7B 5LCYA 2AE9A 2D5UA 2FJDA 3AE6A 2WWUA 3SS1A 2DI4A 2VURA 2E5VA 3RIUA 4UVAB 5EK3A 1IZNB 4O2BE 4PAGA 4QX8B 2WN9A 4AQYT 2CXFA 5FY7A 4BQTA 3ZPOA 2XAQB 3N9LA 4UVBB 2Z6EA 2BR7A 2MOZA 2BG9E 3N2KE 2NTYA 5HEJA 3PU8A 4J2CA 2XASB 2XQ7A 2WWVA 3CX6B 3VR9A 3WTJA 1HCIA 5ADXL 5LB7B 3RHWA 1BR2A 3FZLB 3MACA 5L3GB 4YSXA 2VB6A 4FJOA 4BJNA 3PTRB 1LKXA 3KFWX 4ZI7E 4ZJSA 3PUSA 3U78A 3Q5XA 4X1KE 3LBXA 4COFA 1MIWA 2KMFA 2V6YB 3PMZA 3ZT6A 3PURA 1I9BA 3A5XA 4CI3B 3ZN1B 5E0OA 3LFMA 5JRCA 3S4UA 3AB3B 5JDHA 5AQTB 3CX8B 5LJMA 3KV9A 2KWHA 5LG4A 2W8FA 5J5HA 4ZZBA 2H89A 2BR8A 2KWIB 4X1YE 5JDLA 5HEGA 3AAAB 4YY3T 2UXBT 1KNRA 3HKEE 3C4XA 3PJAJ 3CPZA 3UTKA 4O8SA 3P4WA 4AKLA 2CBIA 2M67A 3O4XE 2FUPA 2LRKA 4UF0A 2LHNA 2IHR1 4DBQA 5AQPB 2YDQA 2LHRA 1D0XA 5LHHB 2Y56A 5J2TE 5DJQC 4A56A 4DBRA 4MLKA 3IF8B 4IE4A 4PJLA 4U72A 4AFTA 2LOSA 4PK5A 2LSGA 4UEMA 2X51A 1MIVA 5AQFB 4ISTA 1BR4A 2AXDS 2Y58A 3B5MA 3WI3A 4OHFA 4DBMA 2XZ5A 3B13A 3RF1A 5FY0A 4DUYT 4B3TT 4PJJA 2V7LA 4ZI3D 4UR9A 2X0YA 3PDYA 1HFAA 2QRXA 3K3QC 4X65T 4LMJA 3HL6A 4YHJA 3MZKB 2WS3A 5L3FB 4HFIA 1I6ZA 1HTJF 3I0OA 3JAFA 4CN6A 4TWHA 5L3CB 3KV6A 1XDPA 2WP9A 3RLFF 4QAAA 1NWMX 2BYNA 2J47A 3PE0A 4ZJTA 2K3WA 4IGUA 4YT0A 3T4MA 3EDUA 1Z8UA 3AECA 4YFSA 1WRDA 3ZDHA 4QWNB 1D1AA 4A98A 4ZI2D 5AQSB 2XNTA 2BG9A 4U3CA 2X67A 5AQIB 2D0UA 5FXVA 4DR2T 1MNEA 2UXNB 2L3LA 5AFNA 3K3OA 4CZZB 1HG5A 3FXEB 3RGLA 3QUJA 1FEWA 4QH4A 3PUGA 3O9XA 4AFGA 5AFUL 1OEDC 3CK6A 4DR5T 2WBLA 3K3NA 2BS2A 3U8NA 3ZYLA 2W66A 4KMCA 3UU5A 3EHZA 4C91A 2BVMA 3RYHE 2ZM2A 2W00A 5CGMA 5AQKB 1UURA 2V6XA 2XQ6A 3ONJA 4AQFC 4ZK4A 1US7B 3KBUA 4ADZA 3VRAA 4ZHQE 2WCAA 1HX8A 2VKHA 5L3BB 1XMOT 3ZEFB 4PNIA 4CXWA 4IDNA 3U8JA 2BBHA 3LG7A 1VCTA 2OLTA 3GWHA 2CMRA 4WW0A 5JREA 2LJLA 1QSDA 3ZMTB 2V7KA 1UX5A 3SQ9A 3N2GE 2B1EA 5EK4A 3ONXA 3TLUA 3JC6D 3O1IA 2X0HA 4DR1T 4Z90A 3EUHA 5BP0A 4NIQA 3VKGA 3WAKA 1SUMB 2W4XA 3L8RA 3L39A 1D0YA 2WM9A 4PK6A 2RP4A 2IUBA 3GN5A 3R6NA 3ZCIA 3TLWA 3SQ6A 1YQ4A 4TN7B 2C5IT 2FJAA 2KZ7B 3KBTA 2XY8B 3SRZA 3F57A 2X00D 4HEAA 1WYCA 4BJMA 2XQ3A 3Q2MA 5JDFA 3P8CD 2MPKA 2YKSA 3KINB 3UT5E 3BQLA 5JTGA 3LK2B 4HWDA 4ASKA 2CA5A 4IL9A 2M6BA 3A7MA 2EHOD 3Q9DA 2PH9A 5JVDE 4QABA 3ESLA 1E1HB 2Q9QC 4LF6T 5IWAT 2PG8A 3UUXB 5C2TA 4U2YA 2IW5B 2W63A 3AXJA 2JQQA 4GOUA 3PUYF 4CN4A 3HR0A 2X0LB 2V26A 2WU5A 1UX4A 4ZS3A 1S94A 4DV0T 4H9NC 1MMGA 4JBWF 5J5FA 3RC3A 4P0AA 4M1PA 4DV1T 5IHYA 2XUEA 4JI1T 2XZEA 4L5GA 1KEYA 2CWOA 2IMLA 3E08A 3ZC0A 2A9UA 4YTMA 2I0MA 2V7IA 2XQAA 3UFGA 5HEOA 3CQGB 1D1BA 1N33T 4OYJA 2FJBA 1SHZC 4IIJE 5EZYE 2XNUA 2X66A 5ABFA 5FL1A 1VRBA 3EVYA 2DLRA 2WZIA 4JEHB 1UCUA 4EYUA 3CMLA 2ZJVA 2V8SV 3I9YA 3PJAA 3UUMA 4DO0A 2NW7A 2YN6A 2W67A 4DR6T 5HCMA 3AE4A 2LEHA 4OFZA 4ALXA 1T72A 3OVUA 4HWCA 3ZYKA 1J1JA 2WMNA 1HF8A 3AA1B 4X1IE 3ZJ1A 4CI2B 5EK2A 2XZ6A 4UY2A 2NP9A 2ZJUA 1HNZT 4NUUA 3I1AA 2XTLA 3T1HT 2N9DA 2ACXA 2UXDT 4DV3T 2HPJA 2W8GA 4UVCB 4KI0F 4JI7T 4X20E 2UZ6A 1IBMT 1ZP0A 2K5BB 4U7IA 2BDEA 4ZR6A 1SE7A 4E7SA 5JR9C 4DV4T 2ODUA 2FBWA 4AXPA 1OWAA 3AEDA 3C98B 4D01A 3IHRA 1WYBA 4B3MT 2PFVA 3ETVA 2Y48B 4EZ1A 3PUAA 4IE0A 3CWZB 5FVLA 2BYPA 5LNKA 3NWIA 2E9XC 5FP3A 2CXDA 3EI0A 3WTLA 4EOZB 3UQ4A 5LBQB 3NVOA 4EXTA 1UV6A 4DUZT 1E7PA 3PUQA 2YMEA 4DMVA 2ZMAA 1KNZA 2VWAA 1XNQT 3TKLB 4O4LE 1I94T 4FRRA 2CHOA 2BS4A 2QYWA 3JADA 3PV0F 3C79A 2ZM0A 4U2ZA 1U4QA 3NZPA 2WZYA 1HS7A 4XHEA 3GMIA 2H3RA 4P1NA 3P4RA 5IUXA 3OYXA 5C3JA 2XQ8A 1OEDA 3OTOT 3PUVF 2VVNA 2ZM6T 3ANWA 4HN9A 3ZYMA 2D2SA 4A5XA 4X64T 2PGZA 1SA0E 2CEAA 4YTNA 2KINB 2BS3A 4QXHB 2WNCA 4U7YA 5LHIB 4NXNT 4KHZF 4AQFA 5J5GA 4G2AA 4JI8T 5J0ZA 4HFHA 5BR8T 3AE1A 3ZSSA 5BW2A 3D0TA 3AEGA 5H6QB 2DHRA 4AFHA 3AEEA 2EHOB 2XPKA 5CA1E 4UV8B 3FZFB 5AFJA 4HWFA 2PJQA 3UUBA 2VVSA 5KZUA 3JC6C 2LE8A 3C64A 4IE6A 4DV7T 2WDQA 1MMDA 1WR6A 3C4ZA 1G8XA 5FYMA 5AFMA 1KK7A 3UFEA 2YU2A 4HTEA 4LMKA 2LSIA 2QGSA 4TNVA 2HHHT 3MK7C 2YU1A 3LDQB 5HWXA 3K1SA 5FKYA 2JQ9A 2IC6A 2MBGA 1HR0T 3U3IA 2D0TA 3TLTA 1V9DA 2EHOC 4GYRA 2L9QA 3MXZA 3BQKA 1M7KA 3P4SA 3H3AA 4GK5E 2I6HA 4A97A 2Q9QA 2CLYB 3L3PA 2QC1B 2SPCA 3OKQA 4QX7B 2YMDA 2NTXA 2XAJB 4H63V 4ZOLE 5H6RB 4X66T 1IBLT 1L0VA 4EB6E 4HFEA 3HI2A 1N34T 3AVSA 2IC9A 2NOXA 5HXSA 2WNJA 4JI0T 3ONLC 3LBXB 4JI5T 4MFRA 5LP6E 2N1GA 3ZMSB 4AKRB 5F3JA 5F5WA 5J2UE 5JRCB 3ZLIA 3A8YC 2PTFA 5LXTE 5A1LA 5L4HA 1MMAA 4DIDB 5HAXA 5KXJA 3ZN0B 2DL1A 2J1DG 4QACA 3VU7H 3MJXA 1YQ3A 3I9WA 3IA3A 1O3XA 3P7IA 4HGAA 1FJGT 2D9DA 2WDVA 4UF0B 2VL8A 2Y6XA 4H9PC 4CXXA 2XM1A 1WFDA 2NW8A 2WY2A 4HWIB 4V1Av 4PW8A 1MNDA 2YOEA 2V7JA 1XWMA 2HN1A 1XDOA 3L09A 3QB5A 2WSSV 1IJ5A 2ES0A 3B57A 1T98A 2L8KA 5KDMC 5AFLA 2UUBT 4Z91A 2XQ9A 3MA9A 3P50A 2XQ4A 5FXZA 4WV9A 5KE4A 4XK9A 2XYTA 4WNKA 3AVRA 4HWHA 3VHLA 5FJVA 4K0KT 5AFHA 2R6GF 3SIOA 4UM1A 4QKNA 2BKPA 2LKGA 5TVCA 5JR9A 1JNZA 1YXRA 3RIAA 1UUSA 3PU3A 3RH3A 3ZT7A 2RPAA 4GYSA 4YJ3E 3JAEA 1Y64B 3ZJ2A 4YXDA 1IJ6A 3RIFA 3OBVE 5HYAA 3ZKRA 5HCJA 3ZDGA 2CE7A 3PEOA 5JQGE 3SOLA 4ZXLA 4JEUB 1ZHCA 3RKOA 3AE9A 3CVRA 3LJCA 2E9XA 1YKEB 4PJMA 1S35A 4MALA 2UU9T 3E22E 2K9AA 2XAGB 3AEFA 2BG9B 3LSVA 1KF6A 3BQIA 3FBZA 4LF7T 1XMQT 3WAJA 5C8YE 4Z8XA 2E8IA 4YLHA 2BVLA 2LRLA 2JMHA 2BZBA 2LKHA 4PFOA 2CPTA 3J7Yq 4C90A 3RC8A 1R8IA 2X9WA 2NR4A 4EEBA 4L9IA 1ZV4X 3AA6B 4JI4T 4ZRUA 5CFBA 1OEDE 4YSZA 1W0BA 3O1HA 4AI6A 2XM2A 3NBXX 3ETUA 4MHCA 2Y54A 1M62A 4B3RT 1BR1A 4IHJE 3FZHB 3N9MA 4HQPA 3C84A 2CWYA 4DR7T 3NRYA 2VKDA 4UIGA 2BG9C 3AAIA 2Y8DA 2X9HA 2GK9A 3VR8A 3SH1A 3V5UA 1FMVA 1QLBA 4U31A 2BYRA 5CA0E 2JPFA 5LBMA 3ZT5A 5AQUB 2E5LT 4LF4T 2Y7YA 3AE5A 1N36T 5JMEA 3CQXC 4NXMT 4UV9B 3QNUA 3QC9A 2BKOA 4TUYE 4I55E 4BA9A 5F8PA 4UM3P 4PFPA 4CN1A 4KBMB 5AINA 4PIRA 4QHOA 4U74A 2ACZA 4BAYB 2HH7A 3GN5B 3U8LA 1NAFA 5LA6E 3C50A 3I0QA 4JV5T 3N9QA 4ZZCA 2W61A 4OK0A 3PUWF 2V6YA 1LVKA 1JNRA 2LT3A 2XAFB 2M6IA 4KX6A 3HKCE 3WTNA 2XQ5A 3CQCB 4LFCT 2XJ7A 4NPPA 3UQ7A 2X9YA 3BK9A 3SWHA 4ZEYA 1AJ3A 4ISSA 1WCRA 2V5CA 4ZI3C 5BRXA 2KLQA 4ILCA 5SYOA 2QVAA 4U33A 3EDVA 2UUCT 3RYFE 1GQEA 3EABA 2H7OA 5AFKA 1HNWT 3RYIE 4OX9T 1B7TA 4HFDA 4IE5A 3AXJB 1YW0A 4EZHA 4HKAA 4TZ4C 3ZMZB 3WTOA 4QXCB 3AE7A 2VQET 2IIUA 5LJNA 3RQWA 4DMWA 2YDSA 4H63H 4QH5A 5HXCA 2A72A 2DNXA 5ETWA 4B6XA 3FHNA 3RI5A 4GIWA 4ILBA 3CKDA 4CXYA 1DU2A 1D1CA 3P4QA 3HKDE 4JI6T 2N2NA 4ZI2C 2W62A 3WTIA 3KVAA 2X9XA 2WAUA 4KP3C 2RA1A 5J1GA 4AKIA 2UXCT 4TWDA 4LMLA 2HPLA 3VKHA 5M4YA 2UXXB 4NZBA 2JQKA 3CIRA 5ABFB 2Q9QD 3OPCA 3M3ZB 2VKJA 1UX2A 5DQVA 4X62T 2XNVA 1MMNA 2V1DB 3FZKB 3X1DA 3DTOA 3E0ZA 4IDZA 3UU8A 4AISA 3WIPA 1VOMA 2C5JA 1HX1B 1W9RA 3T8OA 5LGTB 2XAHB 3RYCE 2MYSA 1NEKA 5FL0A 2XHEB 3WTMA 3IEEA 5L47A 4IREA 2J4GA 5BMVE 3Q5WA 4YTPA 4YJ2E 1UW6A 1W0AA 4WYVA 5AQVB 1IAPA 4TNWA 3KDSE 2WDRA 4CQIA 5LYJE 2WNLA 3H3MA 4I4TE 4EIWA 2C5KT 1HNXT 1KFYA 5L4EA 5AQHB 3SFDA 4B3ST 2FJEA 3FZMB 1H7CA 1YD8G 2W2UA 5LG3A 3HKBE 3U8MA 1UGOA 1ZKEA 5JDQA 4K0UA 5FXXA 2ZM8A 3AE3A 2YDRA 5LOVE 2DWKA 4I50E 2WMOA 3O1JA 2LOPA 4I43B 4YSYA 3RRWA 4UM3S 2CM0A 3AE8A 1Y01A 2CRBA 3KV5A 2LSYA 2G0UA 3N9OA 3JCFA 1WLXA 2W0GA 4UXNB 4JLEA 5L3EB 4DNDA 5FY1A 4HFVA 2XQYA 3ZMVB 3ZCJA 4EZ4A 4IDPA 2ODVA 5IYZE 5HXHA 3W15B 4MBQA 5AQMB 4YHHT 5JDMA 5CJ5A 2WQYA 3FB2A 5HXEA 2PBIA 4EAHA 2LSKA 3KV4A 2UUAT 2P9BA 4LF8T 4DV2T 4EV6A 4WBOA 3TLVA 5JDNA 4XZCA 4O2AE 3RIUC 2JIWA 4FI5A 4IDQA 2NWBA 1FIOA 1ZOYA 1G73A 3TLSA 4EGWA 1OEDB 1XZYA 3ANWB 2BYQA 5JDGA 3OYZA 3KVBA 2LLYA 3AAEB 4NUVA 2IAKA 2E9XD 1OXZA 2F4VT 2IDOB 5HEUA 4WBNE 5L3DB 1J5WA 3DJBA 3ZC1A
chains in the Genus database with same CATH topology
2W8GA 1OEDA 4HFCA 3TLTA 4UM3S 3U8JA 2BG9B 3LSVA 4LMLA 4TWDA 2W8FA 5J5HA 2UZ6A 3UU3A 4QAAA 4ZZBA 3U8LA 5J5IA 2BYNA 5J5FA 2BR8A 4NZBA 4UXUA 5HEHA 4ZJTA 2YOEA 5HEGA 3SQ9A 4ZZCA 3WTHA 4ZR6A 4A97A 3T4MA 2PGZA 3EAMA 2M6IA 2LKHA 3GUAA 3WTNA 3TLUA 1UX2A 2QC1B 2XQ5A 3ZDHA 2WNCA 2XNVA 4ZK1A 4Z90A 2WN9A 2Y57A 4NPPA 3P4WA 3UQ7A 2YMDA 2XQAA 5J5GA 4BQTA 4X5TA 3UU8A 4A98A 3IGQA 5AFLA 2BJ0A 5BP0A 4D01A 5J0ZA 4HFHA 5HEOA 3WIPA 2XNTA 2BG9A 4IL4A 4Z91A 5BW2A 2XQ9A 3TLWA 4EZ1A 3P50A 3SQ6A 2XQ4A 4BFQA 5BRXA 4ZRUA 4HFEA 4ILCA 4AFHA 4WV9A 5CFBA 5AFMB 5KE4A 1OEDE 2BYSA 2XNUA 4XK9A 5SYOA 4TWFA 2BR7A 4QH1A 2X00D 2BG9E 2XYTA 2VL0A 5AFNA 2X00A 2BYPA 4ILAA 2Y54A 3WTMA 5AFJA 5L47A 2XQ3A 4IREA 5FJVA 2Y56A 5AFHA 5AFKA 3UUBA 2WNJA 4QH4A 5HEJA 3SIOA 4UM1A 2XYSA 5KZUA 3EI0A 3WTLA 1UW6A 4HFBA 4HFDA 2ZJVA 2XQ7A 2YKSA 4AFGA 3UQ4A 4HQPA 3C84A 2LKGA 2MAWA 1OEDC 4TNWA 5TVCA 3U8KA 4AFTA 3WTJA 3RIAA 3WTKA 2BG9C 2LM2A 3TLVA 3RHWA 2YN6A 3UU4A 1UV6A 4IL9A 2M6BA 4UM3A 5CO5A 5HCMA 3U8NA 3WTOA 2WNLA 2Y58A 2PH9A 5AFMA 3UU5A 2YMEA 4ALXA 3SH1A 4B5DA 3RQWA 3EHZA 4DBMA 3JAEA 3TLSA 2XZ5A 4QABA 1OEDB 3RQUA 3UU6A 4F8HA 5L4EA 3RIFA 4ZJSA 4QH5A 4FRRA 3ZKRA 4LMKA 2BYRA 5HCJA 5L4HA 3ZDGA 2KSRA 5LXBA 3JADA 5LG3A 3C79A 3RI5A 2Y7YA 4ILBA 3PEOA 2BYQA 2XZ6A 4COFA 3U8MA 5JMEA 2XQ6A 4LMJA 4UY2A 2ZJUA 2LLYA 2WZYA 4ZK4A 3PMZA 4QACA 4HFIA 4TNVA 1I9BA 4XHEA 3WTIA 4UM3P 5HEUA 3JAFA 5IUXA 5AINA 4TWHA 4PIRA 2C9TA 2XQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W8G A;  1OED A;  4HFC A;  3TLT A;  4UM3 S;  3U8J A;  2BG9 B;  3LSV A;  4LML A;  4TWD A;  2W8F A;  5J5H A;  2UZ6 A;  3UU3 A;  4QAA A;  4ZZB A;  3U8L A;  5J5I A;  2BYN A;  5J5F A;  2BR8 A;  4NZB A;  4UXU A;  5HEH A;  4ZJT A;  2YOE A;  5HEG A;  3SQ9 A;  4ZZC A;  3WTH A;  4ZR6 A;  4A97 A;  3T4M A;  2PGZ A;  3EAM A;  2M6I A;  2LKH A;  3GUA A;  3WTN A;  3TLU A;  1UX2 A;  2QC1 B;  2XQ5 A;  3ZDH A;  2WNC A;  2XNV A;  4ZK1 A;  4Z90 A;  2WN9 A;  2Y57 A;  4NPP A;  3P4W A;  3UQ7 A;  2YMD A;  2XQA A;  5J5G A;  4BQT A;  4X5T A;  3UU8 A;  4A98 A;  3IGQ A;  5AFL A;  2BJ0 A;  5BP0 A;  4D01 A;  5J0Z A;  4HFH A;  5HEO A;  3WIP A;  2XNT A;  2BG9 A;  4IL4 A;  4Z91 A;  5BW2 A;  2XQ9 A;  3TLW A;  4EZ1 A;  3P50 A;  3SQ6 A;  2XQ4 A;  4BFQ A;  5BRX A;  4ZRU A;  4HFE A;  4ILC A;  4AFH A;  4WV9 A;  5CFB A;  5AFM B;  5KE4 A;  1OED E;  2BYS A;  2XNU A;  4XK9 A;  5SYO A;  4TWF A;  2BR7 A;  4QH1 A;  2X00 D;  2BG9 E;  2XYT A;  2VL0 A;  5AFN A;  2X00 A;  2BYP A;  4ILA A;  2Y54 A;  3WTM A;  5AFJ A;  5L47 A;  2XQ3 A;  4IRE A;  5FJV A;  2Y56 A;  5AFH A;  5AFK A;  3UUB A;  2WNJ A;  4QH4 A;  5HEJ A;  3SIO A;  4UM1 A;  2XYS A;  5KZU A;  3EI0 A;  3WTL A;  1UW6 A;  4HFB A;  4HFD A;  2ZJV A;  2XQ7 A;  2YKS A;  4AFG A;  3UQ4 A;  4HQP A;  3C84 A;  2LKG A;  2MAW A;  1OED C;  4TNW A;  5TVC A;  3U8K A;  4AFT A;  3WTJ A;  3RIA A;  3WTK A;  2BG9 C;  2LM2 A;  3TLV A;  3RHW A;  2YN6 A;  3UU4 A;  1UV6 A;  4IL9 A;  2M6B A;  4UM3 A;  5CO5 A;  5HCM A;  3U8N A;  3WTO A;  2WNL A;  2Y58 A;  2PH9 A;  5AFM A;  3UU5 A;  2YME A;  4ALX A;  3SH1 A;  4B5D A;  3RQW A;  3EHZ A;  4DBM A;  3JAE A;  3TLS A;  2XZ5 A;  4QAB A;  1OED B;  3RQU A;  3UU6 A;  4F8H A;  5L4E A;  3RIF A;  4ZJS A;  4QH5 A;  4FRR A;  3ZKR A;  4LMK A;  2BYR A;  5HCJ A;  5L4H A;  3ZDG A;  2KSR A;  5LXB A;  3JAD A;  5LG3 A;  3C79 A;  3RI5 A;  2Y7Y A;  4ILB A;  3PEO A;  2BYQ A;  2XZ6 A;  4COF A;  3U8M A;  5JME A;  2XQ6 A;  4LMJ A;  4UY2 A;  2ZJU A;  2LLY A;  2WZY A;  4ZK4 A;  3PMZ A;  4QAC A;  4HFI A;  4TNV A;  1I9B A;  4XHE A;  3WTI A;  4UM3 P;  5HEU A;  3JAF A;  5IUX A;  5AIN A;  4TWH A;  4PIR A;  2C9T A;  2XQ8 A; 
#chains in the Genus database with same CATH topology
 3P4P A;  3Q5D A;  4LF5 T;  2WU2 A;  5AQL B;  3ZMU B;  3ABV A;  3UU3 A;  5J5I A;  2CLY C;  2K48 A;  3C4W A;  3N9N A;  1J5E T;  4E7Z A;  3QB5 K;  3OJA A;  5LHG B;  3R84 B;  5L2L A;  1YKH B;  4ERR A;  2XSB A;  3AEA A;  3K8P C;  3IGQ A;  5ABE A;  2H88 A;  2BKN A;  4IDO A;  5AQR B;  3FBL A;  3ZST A;  5AFM B;  4UEL A;  4TV8 E;  2VAS A;  4QH1 A;  3N2O A;  2VL0 A;  2WZH A;  3UUN A;  1UK5 A;  1QUU A;  4ZS2 A;  3J9X 1;  3M65 A;  3AEB A;  3Q5E A;  3DP7 A;  2C0S A;  2MTQ A;  2MAW A;  3U8K A;  1T7S A;  5CB4 E;  3HA4 A;  4XAX B;  3WTK A;  2LM2 A;  4H9O C;  3NKZ A;  4DR3 T;  3T1Y T;  5FNV E;  5LMU T;  2X68 A;  5DQW A;  4IE7 A;  3RQU A;  1LVF A;  4O4I E;  5FMN A;  2E2A A;  3QK6 A;  4KUM B;  1X79 A;  2JJ9 A;  4QXB B;  4GKJ T;  3RKG A;  1NEN A;  3SFE A;  2Q9Q B;  4JYA T;  2A3D A;  3MKD A;  4O4J E;  4AQG A;  3FXD B;  3H37 A;  4IT4 A;  1BR0 A;  4H9S E;  1LRZ A;  5AQN B;  1U5P A;  1VCS A;  2XSA A;  5ABH A;  3PUX F;  5HXR A;  4P09 A;  4Q25 A;  2CCQ A;  3WTH A;  5TAO A;  2ZLY A;  3EAM A;  2JMK A;  4JI3 T;  4I0U A;  2JQH A;  4HE8 A;  2WB5 A;  2CXL A;  2NW9 A;  2OA5 A;  5DAB A;  5LGN B;  3UUL A;  2BJ0 A;  1CHU A;  2JRK A;  3QOF A;  2VQF T;  2B76 A;  1IBK T;  4AKG A;  2I59 A;  4BFQ A;  3N9P A;  3PUZ F;  3RX6 A;  4EYY R;  1WR0 A;  2KXP B;  2VKO A;  2BYS A;  1D0Z A;  3F31 A;  4ILA A;  2VK9 A;  4H9R C;  2XYS A;  4EED A;  2YEV C;  4HFB A;  1MIY A;  4O4H E;  3C51 A;  4WZX A;  5LGU B;  1T8B A;  1KNP A;  3RPU A;  2QA7 A;  5CO5 A;  1EZ3 A;  4UM3 A;  3CX7 B;  4DR4 T;  3UU6 A;  4DV5 T;  1W09 A;  4LFB T;  2KND A;  2A2F X;  2KSR A;  5LXB A;  4P0B A;  2LM9 A;  2CBJ A;  1N32 T;  4L0R A;  5KMG P;  2KT9 A;  4JI2 T;  4N78 D;  4ILU A;  5FXW A;  4F6R C;  4PK4 A;  2C9T A;  2HN2 A;  5HWY A;  4HFC A;  2V7M A;  1FMW A;  4LFA T;  5AQG B;  5ABG A;  4UXU A;  5AQJ B;  4TX5 A;  5HEH A;  2BBJ A;  4G63 A;  4XBF B;  4TV9 E;  4LF9 T;  3GUA A;  5FVK A;  2OV9 A;  3NZQ A;  4ZK1 A;  2YIN A;  2CHN A;  3IBP A;  2Y57 A;  4CI1 B;  4ANJ A;  4X5T A;  2DCF A;  4AIU A;  4IL4 A;  5JR9 B;  3G06 A;  4GKK T;  5JH7 E;  1X9B A;  4PJN A;  5AQO B;  4TWF A;  5AQQ B;  2X00 A;  2H7V C;  3RRC A;  1HG2 A;  3VRB A;  3V5S A;  3N5L A;  4DVD A;  4GK0 E;  1CUN A;  5GON E;  3UU4 A;  2E9X B;  1Z0P A;  2K24 A;  3GA8 A;  2YK0 A;  4B5D A;  2EHO A;  1XNR T;  4AKH A;  5KX5 E;  2DWG A;  4F8H A;  4DV6 T;  2V5D A;  3F2E A;  3AA0 B;  2LSJ A;  1ZEE A;  2J62 A;  1E2A A;  4H9Q C;  3AE2 A;  3NRX A;  3LK3 B;  4OYK A;  5LMN T;  4JUY A;  3LK4 2;  4KHP T;  3AA7 B;  5LCY A;  2AE9 A;  2D5U A;  2FJD A;  3AE6 A;  2WWU A;  3SS1 A;  2DI4 A;  2VUR A;  2E5V A;  3RIU A;  4UVA B;  5EK3 A;  1IZN B;  4O2B E;  4PAG A;  4QX8 B;  2WN9 A;  4AQY T;  2CXF A;  5FY7 A;  4BQT A;  3ZPO A;  2XAQ B;  3N9L A;  4UVB B;  2Z6E A;  2BR7 A;  2MOZ A;  2BG9 E;  3N2K E;  2NTY A;  5HEJ A;  3PU8 A;  4J2C A;  2XAS B;  2XQ7 A;  2WWV A;  3CX6 B;  3VR9 A;  3WTJ A;  1HCI A;  5ADX L;  5LB7 B;  3RHW A;  1BR2 A;  3FZL B;  3MAC A;  5L3G B;  4YSX A;  2VB6 A;  4FJO A;  4BJN A;  3PTR B;  1LKX A;  3KFW X;  4ZI7 E;  4ZJS A;  3PUS A;  3U78 A;  3Q5X A;  4X1K E;  3LBX A;  4COF A;  1MIW A;  2KMF A;  2V6Y B;  3PMZ A;  3ZT6 A;  3PUR A;  1I9B A;  3A5X A;  4CI3 B;  3ZN1 B;  5E0O A;  3LFM A;  5JRC A;  3S4U A;  3AB3 B;  5JDH A;  5AQT B;  3CX8 B;  5LJM A;  3KV9 A;  2KWH A;  5LG4 A;  2W8F A;  5J5H A;  4ZZB A;  2H89 A;  2BR8 A;  2KWI B;  4X1Y E;  5JDL A;  5HEG A;  3AAA B;  4YY3 T;  2UXB T;  1KNR A;  3HKE E;  3C4X A;  3PJA J;  3CPZ A;  3UTK A;  4O8S A;  3P4W A;  4AKL A;  2CBI A;  2M67 A;  3O4X E;  2FUP A;  2LRK A;  4UF0 A;  2LHN A;  2IHR 1;  4DBQ A;  5AQP B;  2YDQ A;  2LHR A;  1D0X A;  5LHH B;  2Y56 A;  5J2T E;  5DJQ C;  4A56 A;  4DBR A;  4MLK A;  3IF8 B;  4IE4 A;  4PJL A;  4U72 A;  4AFT A;  2LOS A;  4PK5 A;  2LSG A;  4UEM A;  2X51 A;  1MIV A;  5AQF B;  4IST A;  1BR4 A;  2AXD S;  2Y58 A;  3B5M A;  3WI3 A;  4OHF A;  4DBM A;  2XZ5 A;  3B13 A;  3RF1 A;  5FY0 A;  4DUY T;  4B3T T;  4PJJ A;  2V7L A;  4ZI3 D;  4UR9 A;  2X0Y A;  3PDY A;  1HFA A;  2QRX A;  3K3Q C;  4X65 T;  4LMJ A;  3HL6 A;  4YHJ A;  3MZK B;  2WS3 A;  5L3F B;  4HFI A;  1I6Z A;  1HTJ F;  3I0O A;  3JAF A;  4CN6 A;  4TWH A;  5L3C B;  3KV6 A;  1XDP A;  2WP9 A;  3RLF F;  4QAA A;  1NWM X;  2BYN A;  2J47 A;  3PE0 A;  4ZJT A;  2K3W A;  4IGU A;  4YT0 A;  3T4M A;  3EDU A;  1Z8U A;  3AEC A;  4YFS A;  1WRD A;  3ZDH A;  4QWN B;  1D1A A;  4A98 A;  4ZI2 D;  5AQS B;  2XNT A;  2BG9 A;  4U3C A;  2X67 A;  5AQI B;  2D0U A;  5FXV A;  4DR2 T;  1MNE A;  2UXN B;  2L3L A;  5AFN A;  3K3O A;  4CZZ B;  1HG5 A;  3FXE B;  3RGL A;  3QUJ A;  1FEW A;  4QH4 A;  3PUG A;  3O9X A;  4AFG A;  5AFU L;  1OED C;  3CK6 A;  4DR5 T;  2WBL A;  3K3N A;  2BS2 A;  3U8N A;  3ZYL A;  2W66 A;  4KMC A;  3UU5 A;  3EHZ A;  4C91 A;  2BVM A;  3RYH E;  2ZM2 A;  2W00 A;  5CGM A;  5AQK B;  1UUR A;  2V6X A;  2XQ6 A;  3ONJ A;  4AQF C;  4ZK4 A;  1US7 B;  3KBU A;  4ADZ A;  3VRA A;  4ZHQ E;  2WCA A;  1HX8 A;  2VKH A;  5L3B B;  1XMO T;  3ZEF B;  4PNI A;  4CXW A;  4IDN A;  3U8J A;  2BBH A;  3LG7 A;  1VCT A;  2OLT A;  3GWH A;  2CMR A;  4WW0 A;  5JRE A;  2LJL A;  1QSD A;  3ZMT B;  2V7K A;  1UX5 A;  3SQ9 A;  3N2G E;  2B1E A;  5EK4 A;  3ONX A;  3TLU A;  3JC6 D;  3O1I A;  2X0H A;  4DR1 T;  4Z90 A;  3EUH A;  5BP0 A;  4NIQ A;  3VKG A;  3WAK A;  1SUM B;  2W4X A;  3L8R A;  3L39 A;  1D0Y A;  2WM9 A;  4PK6 A;  2RP4 A;  2IUB A;  3GN5 A;  3R6N A;  3ZCI A;  3TLW A;  3SQ6 A;  1YQ4 A;  4TN7 B;  2C5I T;  2FJA A;  2KZ7 B;  3KBT A;  2XY8 B;  3SRZ A;  3F57 A;  2X00 D;  4HEA A;  1WYC A;  4BJM A;  2XQ3 A;  3Q2M A;  5JDF A;  3P8C D;  2MPK A;  2YKS A;  3KIN B;  3UT5 E;  3BQL A;  5JTG A;  3LK2 B;  4HWD A;  4ASK A;  2CA5 A;  4IL9 A;  2M6B A;  3A7M A;  2EHO D;  3Q9D A;  2PH9 A;  5JVD E;  4QAB A;  3ESL A;  1E1H B;  2Q9Q C;  4LF6 T;  5IWA T;  2PG8 A;  3UUX B;  5C2T A;  4U2Y A;  2IW5 B;  2W63 A;  3AXJ A;  2JQQ A;  4GOU A;  3PUY F;  4CN4 A;  3HR0 A;  2X0L B;  2V26 A;  2WU5 A;  1UX4 A;  4ZS3 A;  1S94 A;  4DV0 T;  4H9N C;  1MMG A;  4JBW F;  5J5F A;  3RC3 A;  4P0A A;  4M1P A;  4DV1 T;  5IHY A;  2XUE A;  4JI1 T;  2XZE A;  4L5G A;  1KEY A;  2CWO A;  2IML A;  3E08 A;  3ZC0 A;  2A9U A;  4YTM A;  2I0M A;  2V7I A;  2XQA A;  3UFG A;  5HEO A;  3CQG B;  1D1B A;  1N33 T;  4OYJ A;  2FJB A;  1SHZ C;  4IIJ E;  5EZY E;  2XNU A;  2X66 A;  5ABF A;  5FL1 A;  1VRB A;  3EVY A;  2DLR A;  2WZI A;  4JEH B;  1UCU A;  4EYU A;  3CML A;  2ZJV A;  2V8S V;  3I9Y A;  3PJA A;  3UUM A;  4DO0 A;  2NW7 A;  2YN6 A;  2W67 A;  4DR6 T;  5HCM A;  3AE4 A;  2LEH A;  4OFZ A;  4ALX A;  1T72 A;  3OVU A;  4HWC A;  3ZYK A;  1J1J A;  2WMN A;  1HF8 A;  3AA1 B;  4X1I E;  3ZJ1 A;  4CI2 B;  5EK2 A;  2XZ6 A;  4UY2 A;  2NP9 A;  2ZJU A;  1HNZ T;  4NUU A;  3I1A A;  2XTL A;  3T1H T;  2N9D A;  2ACX A;  2UXD T;  4DV3 T;  2HPJ A;  2W8G A;  4UVC B;  4KI0 F;  4JI7 T;  4X20 E;  2UZ6 A;  1IBM T;  1ZP0 A;  2K5B B;  4U7I A;  2BDE A;  4ZR6 A;  1SE7 A;  4E7S A;  5JR9 C;  4DV4 T;  2ODU A;  2FBW A;  4AXP A;  1OWA A;  3AED A;  3C98 B;  4D01 A;  3IHR A;  1WYB A;  4B3M T;  2PFV A;  3ETV A;  2Y48 B;  4EZ1 A;  3PUA A;  4IE0 A;  3CWZ B;  5FVL A;  2BYP A;  5LNK A;  3NWI A;  2E9X C;  5FP3 A;  2CXD A;  3EI0 A;  3WTL A;  4EOZ B;  3UQ4 A;  5LBQ B;  3NVO A;  4EXT A;  1UV6 A;  4DUZ T;  1E7P A;  3PUQ A;  2YME A;  4DMV A;  2ZMA A;  1KNZ A;  2VWA A;  1XNQ T;  3TKL B;  4O4L E;  1I94 T;  4FRR A;  2CHO A;  2BS4 A;  2QYW A;  3JAD A;  3PV0 F;  3C79 A;  2ZM0 A;  4U2Z A;  1U4Q A;  3NZP A;  2WZY A;  1HS7 A;  4XHE A;  3GMI A;  2H3R A;  4P1N A;  3P4R A;  5IUX A;  3OYX A;  5C3J A;  2XQ8 A;  1OED A;  3OTO T;  3PUV F;  2VVN A;  2ZM6 T;  3ANW A;  4HN9 A;  3ZYM A;  2D2S A;  4A5X A;  4X64 T;  2PGZ A;  1SA0 E;  2CEA A;  4YTN A;  2KIN B;  2BS3 A;  4QXH B;  2WNC A;  4U7Y A;  5LHI B;  4NXN T;  4KHZ F;  4AQF A;  5J5G A;  4G2A A;  4JI8 T;  5J0Z A;  4HFH A;  5BR8 T;  3AE1 A;  3ZSS A;  5BW2 A;  3D0T A;  3AEG A;  5H6Q B;  2DHR A;  4AFH A;  3AEE A;  2EHO B;  2XPK A;  5CA1 E;  4UV8 B;  3FZF B;  5AFJ A;  4HWF A;  2PJQ A;  3UUB A;  2VVS A;  5KZU A;  3JC6 C;  2LE8 A;  3C64 A;  4IE6 A;  4DV7 T;  2WDQ A;  1MMD A;  1WR6 A;  3C4Z A;  1G8X A;  5FYM A;  5AFM A;  1KK7 A;  3UFE A;  2YU2 A;  4HTE A;  4LMK A;  2LSI A;  2QGS A;  4TNV A;  2HHH T;  3MK7 C;  2YU1 A;  3LDQ B;  5HWX A;  3K1S A;  5FKY A;  2JQ9 A;  2IC6 A;  2MBG A;  1HR0 T;  3U3I A;  2D0T A;  3TLT A;  1V9D A;  2EHO C;  4GYR A;  2L9Q A;  3MXZ A;  3BQK A;  1M7K A;  3P4S A;  3H3A A;  4GK5 E;  2I6H A;  4A97 A;  2Q9Q A;  2CLY B;  3L3P A;  2QC1 B;  2SPC A;  3OKQ A;  4QX7 B;  2YMD A;  2NTX A;  2XAJ B;  4H63 V;  4ZOL E;  5H6R B;  4X66 T;  1IBL T;  1L0V A;  4EB6 E;  4HFE A;  3HI2 A;  1N34 T;  3AVS A;  2IC9 A;  2NOX A;  5HXS A;  2WNJ A;  4JI0 T;  3ONL C;  3LBX B;  4JI5 T;  4MFR A;  5LP6 E;  2N1G A;  3ZMS B;  4AKR B;  5F3J A;  5F5W A;  5J2U E;  5JRC B;  3ZLI A;  3A8Y C;  2PTF A;  5LXT E;  5A1L A;  5L4H A;  1MMA A;  4DID B;  5HAX A;  5KXJ A;  3ZN0 B;  2DL1 A;  2J1D G;  4QAC A;  3VU7 H;  3MJX A;  1YQ3 A;  3I9W A;  3IA3 A;  1O3X A;  3P7I A;  4HGA A;  1FJG T;  2D9D A;  2WDV A;  4UF0 B;  2VL8 A;  2Y6X A;  4H9P C;  4CXX A;  2XM1 A;  1WFD A;  2NW8 A;  2WY2 A;  4HWI B;  4V1A v;  4PW8 A;  1MND A;  2YOE A;  2V7J A;  1XWM A;  2HN1 A;  1XDO A;  3L09 A;  3QB5 A;  2WSS V;  1IJ5 A;  2ES0 A;  3B57 A;  1T98 A;  2L8K A;  5KDM C;  5AFL A;  2UUB T;  4Z91 A;  2XQ9 A;  3MA9 A;  3P50 A;  2XQ4 A;  5FXZ A;  4WV9 A;  5KE4 A;  4XK9 A;  2XYT A;  4WNK A;  3AVR A;  4HWH A;  3VHL A;  5FJV A;  4K0K T;  5AFH A;  2R6G F;  3SIO A;  4UM1 A;  4QKN A;  2BKP A;  2LKG A;  5TVC A;  5JR9 A;  1JNZ A;  1YXR A;  3RIA A;  1UUS A;  3PU3 A;  3RH3 A;  3ZT7 A;  2RPA A;  4GYS A;  4YJ3 E;  3JAE A;  1Y64 B;  3ZJ2 A;  4YXD A;  1IJ6 A;  3RIF A;  3OBV E;  5HYA A;  3ZKR A;  5HCJ A;  3ZDG A;  2CE7 A;  3PEO A;  5JQG E;  3SOL A;  4ZXL A;  4JEU B;  1ZHC A;  3RKO A;  3AE9 A;  3CVR A;  3LJC A;  2E9X A;  1YKE B;  4PJM A;  1S35 A;  4MAL A;  2UU9 T;  3E22 E;  2K9A A;  2XAG B;  3AEF A;  2BG9 B;  3LSV A;  1KF6 A;  3BQI A;  3FBZ A;  4LF7 T;  1XMQ T;  3WAJ A;  5C8Y E;  4Z8X A;  2E8I A;  4YLH A;  2BVL A;  2LRL A;  2JMH A;  2BZB A;  2LKH A;  4PFO A;  2CPT A;  3J7Y q;  4C90 A;  3RC8 A;  1R8I A;  2X9W A;  2NR4 A;  4EEB A;  4L9I A;  1ZV4 X;  3AA6 B;  4JI4 T;  4ZRU A;  5CFB A;  1OED E;  4YSZ A;  1W0B A;  3O1H A;  4AI6 A;  2XM2 A;  3NBX X;  3ETU A;  4MHC A;  2Y54 A;  1M62 A;  4B3R T;  1BR1 A;  4IHJ E;  3FZH B;  3N9M A;  4HQP A;  3C84 A;  2CWY A;  4DR7 T;  3NRY A;  2VKD A;  4UIG A;  2BG9 C;  3AAI A;  2Y8D A;  2X9H A;  2GK9 A;  3VR8 A;  3SH1 A;  3V5U A;  1FMV A;  1QLB A;  4U31 A;  2BYR A;  5CA0 E;  2JPF A;  5LBM A;  3ZT5 A;  5AQU B;  2E5L T;  4LF4 T;  2Y7Y A;  3AE5 A;  1N36 T;  5JME A;  3CQX C;  4NXM T;  4UV9 B;  3QNU A;  3QC9 A;  2BKO A;  4TUY E;  4I55 E;  4BA9 A;  5F8P A;  4UM3 P;  4PFP A;  4CN1 A;  4KBM B;  5AIN A;  4PIR A;  4QHO A;  4U74 A;  2ACZ A;  4BAY B;  2HH7 A;  3GN5 B;  3U8L A;  1NAF A;  5LA6 E;  3C50 A;  3I0Q A;  4JV5 T;  3N9Q A;  4ZZC A;  2W61 A;  4OK0 A;  3PUW F;  2V6Y A;  1LVK A;  1JNR A;  2LT3 A;  2XAF B;  2M6I A;  4KX6 A;  3HKC E;  3WTN A;  2XQ5 A;  3CQC B;  4LFC T;  2XJ7 A;  4NPP A;  3UQ7 A;  2X9Y A;  3BK9 A;  3SWH A;  4ZEY A;  1AJ3 A;  4ISS A;  1WCR A;  2V5C A;  4ZI3 C;  5BRX A;  2KLQ A;  4ILC A;  5SYO A;  2QVA A;  4U33 A;  3EDV A;  2UUC T;  3RYF E;  1GQE A;  3EAB A;  2H7O A;  5AFK A;  1HNW T;  3RYI E;  4OX9 T;  1B7T A;  4HFD A;  4IE5 A;  3AXJ B;  1YW0 A;  4EZH A;  4HKA A;  4TZ4 C;  3ZMZ B;  3WTO A;  4QXC B;  3AE7 A;  2VQE T;  2IIU A;  5LJN A;  3RQW A;  4DMW A;  2YDS A;  4H63 H;  4QH5 A;  5HXC A;  2A72 A;  2DNX A;  5ETW A;  4B6X A;  3FHN A;  3RI5 A;  4GIW A;  4ILB A;  3CKD A;  4CXY A;  1DU2 A;  1D1C A;  3P4Q A;  3HKD E;  4JI6 T;  2N2N A;  4ZI2 C;  2W62 A;  3WTI A;  3KVA A;  2X9X A;  2WAU A;  4KP3 C;  2RA1 A;  5J1G A;  4AKI A;  2UXC T;  4TWD A;  4LML A;  2HPL A;  3VKH A;  5M4Y A;  2UXX B;  4NZB A;  2JQK A;  3CIR A;  5ABF B;  2Q9Q D;  3OPC A;  3M3Z B;  2VKJ A;  1UX2 A;  5DQV A;  4X62 T;  2XNV A;  1MMN A;  2V1D B;  3FZK B;  3X1D A;  3DTO A;  3E0Z A;  4IDZ A;  3UU8 A;  4AIS A;  3WIP A;  1VOM A;  2C5J A;  1HX1 B;  1W9R A;  3T8O A;  5LGT B;  2XAH B;  3RYC E;  2MYS A;  1NEK A;  5FL0 A;  2XHE B;  3WTM A;  3IEE A;  5L47 A;  4IRE A;  2J4G A;  5BMV E;  3Q5W A;  4YTP A;  4YJ2 E;  1UW6 A;  1W0A A;  4WYV A;  5AQV B;  1IAP A;  4TNW A;  3KDS E;  2WDR A;  4CQI A;  5LYJ E;  2WNL A;  3H3M A;  4I4T E;  4EIW A;  2C5K T;  1HNX T;  1KFY A;  5L4E A;  5AQH B;  3SFD A;  4B3S T;  2FJE A;  3FZM B;  1H7C A;  1YD8 G;  2W2U A;  5LG3 A;  3HKB E;  3U8M A;  1UGO A;  1ZKE A;  5JDQ A;  4K0U A;  5FXX A;  2ZM8 A;  3AE3 A;  2YDR A;  5LOV E;  2DWK A;  4I50 E;  2WMO A;  3O1J A;  2LOP A;  4I43 B;  4YSY A;  3RRW A;  4UM3 S;  2CM0 A;  3AE8 A;  1Y01 A;  2CRB A;  3KV5 A;  2LSY A;  2G0U A;  3N9O A;  3JCF A;  1WLX A;  2W0G A;  4UXN B;  4JLE A;  5L3E B;  4DND A;  5FY1 A;  4HFV A;  2XQY A;  3ZMV B;  3ZCJ A;  4EZ4 A;  4IDP A;  2ODV A;  5IYZ E;  5HXH A;  3W15 B;  4MBQ A;  5AQM B;  4YHH T;  5JDM A;  5CJ5 A;  2WQY A;  3FB2 A;  5HXE A;  2PBI A;  4EAH A;  2LSK A;  3KV4 A;  2UUA T;  2P9B A;  4LF8 T;  4DV2 T;  4EV6 A;  4WBO A;  3TLV A;  5JDN A;  4XZC A;  4O2A E;  3RIU C;  2JIW A;  4FI5 A;  4IDQ A;  2NWB A;  1FIO A;  1ZOY A;  1G73 A;  3TLS A;  4EGW A;  1OED B;  1XZY A;  3ANW B;  2BYQ A;  5JDG A;  3OYZ A;  3KVB A;  2LLY A;  3AAE B;  4NUV A;  2IAK A;  2E9X D;  1OXZ A;  2F4V T;  2IDO B;  5HEU A;  4WBN E;  5L3D B;  1J5W A;  3DJB A;  3ZC1 A; 
#chains in the Genus database with same CATH homology
 2W8G A;  1OED A;  4HFC A;  3TLT A;  4UM3 S;  3U8J A;  2BG9 B;  3LSV A;  4LML A;  4TWD A;  2W8F A;  5J5H A;  2UZ6 A;  3UU3 A;  4QAA A;  4ZZB A;  3U8L A;  5J5I A;  2BYN A;  5J5F A;  2BR8 A;  4NZB A;  4UXU A;  5HEH A;  4ZJT A;  2YOE A;  5HEG A;  3SQ9 A;  4ZZC A;  3WTH A;  4ZR6 A;  4A97 A;  3T4M A;  2PGZ A;  3EAM A;  2M6I A;  2LKH A;  3GUA A;  3WTN A;  3TLU A;  1UX2 A;  2QC1 B;  2XQ5 A;  3ZDH A;  2WNC A;  2XNV A;  4ZK1 A;  4Z90 A;  2WN9 A;  2Y57 A;  4NPP A;  3P4W A;  3UQ7 A;  2YMD A;  2XQA A;  5J5G A;  4BQT A;  4X5T A;  3UU8 A;  4A98 A;  3IGQ A;  5AFL A;  2BJ0 A;  5BP0 A;  4D01 A;  5J0Z A;  4HFH A;  5HEO A;  3WIP A;  2XNT A;  2BG9 A;  4IL4 A;  4Z91 A;  5BW2 A;  2XQ9 A;  3TLW A;  4EZ1 A;  3P50 A;  3SQ6 A;  2XQ4 A;  4BFQ A;  5BRX A;  4ZRU A;  4HFE A;  4ILC A;  4AFH A;  4WV9 A;  5CFB A;  5AFM B;  5KE4 A;  1OED E;  2BYS A;  2XNU A;  4XK9 A;  5SYO A;  4TWF A;  2BR7 A;  4QH1 A;  2X00 D;  2BG9 E;  2XYT A;  2VL0 A;  5AFN A;  2X00 A;  2BYP A;  4ILA A;  2Y54 A;  3WTM A;  5AFJ A;  5L47 A;  2XQ3 A;  4IRE A;  5FJV A;  2Y56 A;  5AFH A;  5AFK A;  3UUB A;  2WNJ A;  4QH4 A;  5HEJ A;  3SIO A;  4UM1 A;  2XYS A;  5KZU A;  3EI0 A;  3WTL A;  1UW6 A;  4HFB A;  4HFD A;  2ZJV A;  2XQ7 A;  2YKS A;  4AFG A;  3UQ4 A;  4HQP A;  3C84 A;  2LKG A;  2MAW A;  1OED C;  4TNW A;  5TVC A;  3U8K A;  4AFT A;  3WTJ A;  3RIA A;  3WTK A;  2BG9 C;  2LM2 A;  3TLV A;  3RHW A;  2YN6 A;  3UU4 A;  1UV6 A;  4IL9 A;  2M6B A;  4UM3 A;  5CO5 A;  5HCM A;  3U8N A;  3WTO A;  2WNL A;  2Y58 A;  2PH9 A;  5AFM A;  3UU5 A;  2YME A;  4ALX A;  3SH1 A;  4B5D A;  3RQW A;  3EHZ A;  4DBM A;  3JAE A;  3TLS A;  2XZ5 A;  4QAB A;  1OED B;  3RQU A;  3UU6 A;  4F8H A;  5L4E A;  3RIF A;  4ZJS A;  4QH5 A;  4FRR A;  3ZKR A;  4LMK A;  2BYR A;  5HCJ A;  5L4H A;  3ZDG A;  2KSR A;  5LXB A;  3JAD A;  5LG3 A;  3C79 A;  3RI5 A;  2Y7Y A;  4ILB A;  3PEO A;  2BYQ A;  2XZ6 A;  4COF A;  3U8M A;  5JME A;  2XQ6 A;  4LMJ A;  4UY2 A;  2ZJU A;  2LLY A;  2WZY A;  4ZK4 A;  3PMZ A;  4QAC A;  4HFI A;  4TNV A;  1I9B A;  4XHE A;  3WTI A;  4UM3 P;  5HEU A;  3JAF A;  5IUX A;  5AIN A;  4TWH A;  4PIR A;  2C9T A;  2XQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...