2BG9E

Refined structure of the nicotinic acetylcholine receptor at 4a resolution.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
370
structure length
370
Chain Sequence
NEEGRLIEKLLGDYDKRIKPAKTLDHVIDVTLKLTLTNLISLNEKEEALTTNVWIEIQWNDYRLSWNTSEYEGIDLVRIPSELLWLPDVVLENNVDGQFEVAYYANVLVYNDGSMYWLPPAIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLSAEEGIDPEDFTENGEWTIRHRPAKKNYNWQLTKDDIDFQEIIFFLIIQRKPLFYIINIIAPCVLISSLVVLVYFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSLVIVTNCVIVLNVSLRTPNTHSCVEACNFIAKSTKEQNDSGSENENWVLIGKVIDKACFWIALLLFSLGTLAIFLTGHLNQVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined Structure of the Nicotinic Acetylcholine Receptor at 4A Resolution
pubmed doi rcsb
molecule tags Ion channel/receptor
molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
total genus 87
structure length 370
sequence length 370
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
E PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2bg9E02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2bg9E01
2UZ6A 4AFGA 4COFA 3U8MA 3TLWA 2XYTA 4HQPA 5HEJA 4IL4A 4BFQA 3EHZA 4HFBA 1OEDE 2YN6A 2YKSA 2BG9C 4Z90A 4XHEA 5BRXA 1UV6A 2WNJA 2M6BA 3U8LA 2XZ6A 5L47A 4ZZCA 4ZR6A 2Y56A 3LSVA 4AFHA 3GUAA 3TLSA 3C79A 4IL9A 2LKHA 2BYPA 2ZJUA 2BJ0A 4EZ1A 3U8KA 2XQAA 5J5HA 5HEOA 3UU5A 3PEOA 3RQUA 5J0ZA 2YOEA 3P4WA 2PH9A 4ALXA 5JMEA 2KSRA 3WTKA 4XK9A 4ZZBA 4LMKA 4UM3P 2W8FA 5AFNA 3UUBA 1UX2A 2W8GA 2Y58A 4HFCA 3SIOA 3WTNA 4TNWA 5HCMA 3SQ9A 2XQ3A 2WNCA 4X5TA 2BG9E 4LMJA 4TWFA 4ZRUA 4B5DA 4ILBA 4A97A 2WNLA 3SH1A 2BG9B 4HFDA 2QC1B 5TVCA 4D01A 5IUXA 3TLVA 3JAFA 2XNVA 2X00A 2XQ8A 5HCJA 2M6IA 2PGZA 4QABA 3WTMA 2XYSA 3ZDGA 4UXUA 3U8NA 5LG3A 5J5FA 4TNVA 4QACA 4UM3S 5KZUA 4FRRA 3WTJA 5AFMA 2VL0A 4NPPA 3IGQA 2YMEA 2XQ7A 5AINA 2WN9A 2YMDA 4ILCA 5LXBA 3WTIA 4WV9A 4DBMA 2XNUA 2BR7A 3TLUA 3WIPA 1OEDB 5J5GA 3JAEA 3UQ7A 4HFHA 2XQ6A 4TWDA 5L4HA 4LMLA 5CFBA 4ZK4A 2XNTA 3WTLA 2XQ4A 3RIAA 3RQWA 3UU8A 4A98A 4ZK1A 3SQ6A 4ZJSA 4HFEA 4Z91A 4ILAA 2LM2A 3UU3A 3WTOA 3UU4A 2Y7YA 5SYOA 2C9TA 3WTHA 2XQ5A 5HEGA 4IREA 3PMZA 5KE4A 3EAMA 4QH1A 4UY2A 1OEDA 4QAAA 2BYNA 2ZJVA 2MAWA 3P50A 3UQ4A 5CO5A 5L4EA 4ZJTA 4AFTA 5HEHA 4BQTA 3RI5A 4QH5A 5AFKA 2LKGA 2Y54A 2BG9A 2XZ5A 2X00D 2LLYA 5AFMB 3JADA 4F8HA 3U8JA 2WZYA 2BR8A 4UM3A 3EI0A 1UW6A 3ZKRA 5J5IA 4NZBA 2BYQA 4HFIA 4PIRA 4TWHA 2BYSA 2BYRA 3C84A 5HEUA 1I9BA 3ZDHA 3T4MA 3RIFA 5AFHA 1OEDC 5BP0A 5FJVA 3UU6A 5BW2A 2XQ9A 5AFLA 3TLTA 4QH4A 3RHWA 2Y57A 4UM1A 5AFJA
chains in the Genus database with same CATH superfamily
3T8OA 4IT4A 4COFA 1XWMA 4UIGA 1XDOA 1OEDE 2IIUA 2W62A 2N2NA 2E9XB 4H9QC 5L47A 1QUUA 1KNZA 2KNDA 4KHPT 4Q25A 1XMOT 2IC6A 1E7PA 4HKAA 3B13A 3AE5A 4QXCB 1HG5A 4UVCB 2WZHA 3ONJA 5DQWA 4HFCA 2YDRA 4XZCA 5FYMA 3Q2MA 2GK9A 3SFEA 5L3EB 2I6HA 1T7SA 3K8PC 4AI6A 3O4XE 2CMRA 4P09A 1X9BA 3Q9DA 2Q9QA 4OFZA 2VL0A 2H3RA 4AQFA 4ZOLE 1BR4A 4JBWF 5J5GA 3VRBA 3Q5WA 3W15B 3AVSA 2SPCA 3FZMB 4IDPA 2W0GA 5LGTB 3AE7A 3ABVA 2VASA 1MMDA 4EZHA 4E7SA 1OWAA 5L3CB 4HGAA 4WYVA 2X0HA 4WNKA 3SWHA 5LBQB 5LYJE 4AFTA 2BDEA 1HNXT 5EK3A 1MMAA 4UV9B 1HNZT 1NENA 5AQMB 4UM3A 4IGUA 3NVOA 3A5XA 4OX9T 3T1HT 2V5CA 5LGUB 5FXWA 3EUHA 4QX8B 5AFHA 3DTOA 3HKEE 3C4XA 3AXJA 2PBIA 2LOSA 5AQJB 3PJAA 2XTLA 3TLWA 4HQPA 5IHYA 3Q5DA 4LF6T 3SRZA 4KX6A 4MBQA 2W00A 2W61A 3PEOA 4HTEA 5LBMA 1UX2A 4OHFA 3EDVA 4CI3B 1NEKA 1YKEB 2I59A 4NUUA 2UUAT 1XNQT 2XQ8A 3Q5EA 4IDQA 1FMVA 4QACA 3AXJB 1BR2A 2YMDA 3BQLA 4DBMA 1J1JA 3JC6C 5CFBA 4EEDA 1WR6A 1MNDA 3OTOT 3PDYA 3SQ6A 5J2TE 1HS7A 1ZKEA 3LK3B 2W66A 4NUVA 4WZXA 2A3DA 1EZ3A 3MZKB 3RC3A 1W0BA 4WBOA 5AQIB 5C3JA 3ANWB 2V5DA 1G8XA 5HEUA 4B3TT 3T4MA 3MACA 3UU6A 3RKOA 3RRCA 4CN4A 2ZMAA 3CKDA 4BFQA 2EHOD 2YKSA 3AE2A 4OYJA 2B76A 4H63V 5E0OA 1MIWA 4AKHA 2V7LA 1IBMT 4DV3T 4DR2T 3N5LA 4K0UA 5HEOA 3PUWF 4AKIA 1WCRA 5JTGA 2A2FX 2WB5A 3ESLA 4YT0A 2PGZA 4NXMT 2CEAA 3HKDE 1UGOA 4UXUA 4UM3S 2H7OA 5C8YE 4IE4A 4JV5T 2XQ7A 3PUQA 1E1HB 1M62A 2UU9T 5L4HA 5FVLA 2V7MA 3HR0A 2V6YA 1ZP0A 1T98A 4OYKA 5ABFA 4JI1T 2ZLYA 4ERRA 2QGSA 2CXLA 4TUYE 5KX5E 4GYSA 3KVBA 4AQGA 1N36T 2PFVA 1MMNA 1UUSA 1SUMB 4BQTA 2XZEA 3RI5A 4QH5A 5J2UE 2BG9A 3MK7C 4DO0A 2BKPA 2JMKA 2CWYA 1HCIA 2WAUA 3RLFF 4AKGA 2CXFA 5LG4A 3OYXA 1WLXA 2BG9C 3H37A 2L8KA 4ANJA 2UXNB 3N9PA 4UR9A 5LP6E 2BYPA 2K48A 4YTMA 3UTKA 1KNRA 3ZC1A 2W63A 5JMEA 5KXJA 4U2ZA 3SIOA 2W8GA 4EYYR 3FBLA 3E22E 2OLTA 4X1IE 3N9MA 4ADZA 4H9SE 3TKLB 4X66T 5FP3A 2QVAA 5TVCA 1WFDA 3U8NA 3N2GE 1UCUA 1IJ5A 4DR1T 4ILCA 4I0UA 3NBXX 2XJ7A 3ZLIA 5EK2A 3V5SA 4BA9A 3JAEA 4L5GA 3E0ZA 3KBTA 4EXTA 2NW8A 5EZYE 2VB6A 2WS3A 4QHOA 5BMVE 5HEGA 3PMZA 5ETWA 1VOMA 4ZJTA 2WMOA 4ZI7E 2XZ5A 2KWHA 4QX7B 2JQHA 3ZMUB 4YLHA 3U8JA 1UW6A 4TWHA 4B6XA 2DL1A 2VK9A 2OA5A 3O9XA 4O4HE 2XQ9A 2VWAA 3RHWA 2UZ6A 3PUZF 2CHOA 2WZIA 1DU2A 5BRXA 2MYSA 5KDMC 2XPKA 1X79A 2J4GA 2M6BA 4EGWA 5LHIB 3PU3A 3EVYA 3PUGA 4J2CA 4P0BA 2J62A 4JI2T 5AQKB 3P4QA 3L3PA 3N9NA 3UU5A 1LVKA 1IJ6A 2PH9A 4EYUA 3ZSSA 1YQ4A 2BKOA 4YTPA 3WTNA 2XAJB 4DV4T 3A8YC 4TNWA 5HCMA 2W4XA 4PFPA 5JH7E 5FY7A 4CI1B 4D01A 3B57A 4LF8T 1JNRA 2PJQA 3AAAB 2C5JA 3ZMZB 4I55E 1BR1A 2DLRA 4WV9A 4JI5T 3RYIE 1OEDB 3AE9A 5CJ5A 5F3JA 3UQ7A 3AEGA 5LNKA 3WTLA 5HXSA 2XQ4A 1D0YA 2D5UA 4YFSA 4YSZA 2FUPA 4O2AE 4LF9T 3CQCB 4O8SA 4NIQA 3QUJA 2VVNA 1MNEA 4BJNA 4QH1A 4QAAA 2N1GA 1NAFA 2IC9A 3JC6D 4ZS3A 1SE7A 3AE3A 2D2SA 2BR8A 5J5IA 3ZJ2A 3KINB 3CIRA 2XSBA 1MMGA 3HKCE 3ZDHA 3ZC0A 5HXCA 5FJVA 2VQET 2Y57A 4UM1A 3NZPA 5AQTB 3IBPA 2VKJA 1FMWA 2NOXA 4IL4A 2E2AA 3EHZA 2NW7A 3RH3A 3JCFA 5AQLB 4UVAB 3MA9A 4U2YA 3TLSA 3R6NA 2CA5A 3GN5B 3SOLA 2BJ0A 5LA6E 2CCQA 4DMVA 2FJDA 2X9WA 5LCYA 4LMKA 2UUBT 4KHZF 2CBJA 3ZN1B 3AAIA 1JNZA 2A72A 5DJQC 3IA3A 4DR4T 2JQKA 5FXVA 2EHOA 3KFWX 5JR9B 1ZOYA 2XYSA 4JI6T 4EZ4A 5LG3A 3AE8A 2JRKA 2WWUA 1B7TA 3WTJA 3UFGA 3PUAA 3P8CD 5LXBA 1WYBA 4PJLA 3HA4A 1AJ3A 2IDOB 4UELA 4IIJE 4ZK4A 3PTRB 3RQWA 3UU8A 2CE7A 5JDGA 4ZEYA 3N9OA 5F8PA 4X1YE 5L3DB 3AEBA 4A5XA 4PK4A 4ZXLA 2ZJVA 4EOZB 2LM9A 3ZYMA 4OK0A 3LBXA 3F31A 3C50A 5JDMA 2V8SV 5LHGB 2DNXA 3AEFA 3ZJ1A 3K3QC 3RIFA 1OEDC 1IAPA 2WQYA 2YU1A 1UV6A 4EAHA 3EDUA 2WU5A 2LSJA 2BBHA 2XUEA 4JI4T 5JRCB 2BZBA 5ABHA 4UM3P 4DV1T 4U7YA 2WNCA 4B5DA 4TX5A 3A7MA 2WNLA 2E5VA 4DR3T 2BG9B 3I0OA 3TLVA 1W0AA 4QABA 4HWIB 3ZDGA 4B3RT 3F57A 5KZUA 1W09A 3PUYF 4NPPA 4IHJE 2ZM0A 3WTIA 3C64A 5AQUB 4YJ3E 3ZYKA 5L3GB 3OJAA 3P4SA 4HFHA 4TWDA 5LOVE 1O3XA 2YDQA 4JI8T 3RYCE 4U3CA 2B1EA 1E2AA 5F5WA 1H7CA 3L8RA 4O4IE 2C9TA 5L3FB 3WTHA 3E08A 4PJNA 1D0XA 4HWDA 2OV9A 2WDQA 2K24A 2X0LB 2FJEA 5H6RB 2LLYA 4U31A 4LFAT 2XAFB 3ZEFB 5CA1E 2NWBA 2M67A 4UVBB 5BP0A 2WM9A 4QH4A 5AFJA 2CWOA 1HF8A 5AQPB 4IE0A 1Z8UA 3OYZA 2XY8B 3RIUA 3ZMTB 2N9DA 3FXEB 4ZR6A 4AKLA 4AFHA 4M1PA 2MPKA 2VVSA 2ZJUA 3U8KA 4AISA 4XK9A 2BS3A 2LRKA 3UUBA 3ETVA 2DHRA 5AQOB 5J1GA 3NRXA 2RP4A 2FJAA 3CK6A 3VR9A 2BKNA 2QC1B 5AQGB 3RGLA 2D0UA 3JAFA 3GMIA 3K3OA 3ZSTA 2KMFA 3OVUA 2UUCT 2XNUA 2BR7A 3KDSE 2V6XA 2E9XD 1KEYA 2A9UA 3N2KE 2XQ6A 3EABA 2IW5B 3GWHA 3RIAA 3AB3B 3AA0B 4CXYA 2XAGB 5AQFB 2LM2A 3K1SA 4UV8B 5SYOA 1QLBA 3KVAA 4PJJA 5AQQB 4ZHQE 2X9XA 5CO5A 4GK5E 3FZLB 2BVLA 3BQIA 3SFDA 4F8HA 3EI0A 4NZBA 2WDRA 4HFIA 4PIRA 2BYRA 4HWFA 3VRAA 5FKYA 4AFGA 3I9WA 4HWCA 2MTQA 2X67A 5HXRA 4PJMA 2KINB 3CX8B 1UK5A 2V7KA 3CQXC 3UT5E 3FXDB 3LK2B 1W9RA 2UXXB 5EK4A 2C5KT 2CPTA 1N34T 2XAQB 4NXNT 5IWAT 3QK6A 2JPFA 3M65A 1J5WA 3R84B 1HX1B 4JI7T 4X5TA 1WR0A 4LMJA 4A97A 2YK0A 1R8IA 3ONXA 5LGNB 2X00A 1IZNB 4QWNB 4H9PC 4IDNA 3KV4A 4DNDA 2X9YA 3WAJA 4YJ2E 2PTFA 4EB6E 1FIOA 4X62T 3QNUA 3C4ZA 2WBLA 2V6YB 3J9X1 5HXHA 2IUBA 4Z8XA 3OBVE 4MHCA 4DR7T 2MBGA 2BYNA 5AFKA 3RX6A 1VCSA 4YHJA 3CX6B 4XAXB 2DWKA 4LFCT 4GYRA 1U4QA 5JR9A 4GIWA 2ACZA 2ODVA 5LJMA 2LHNA 3S4UA 2YN6A 4Z90A 2Y8DA 2MOZA 3CQGB 2NTXA 3ZCJA 2XAHB 3LSVA 2I0MA 1XZYA 3PU8A 4CN1A 4ALXA 5J0ZA 2XASB 1BR0A 5KMGP 4AXPA 1D1BA 5AQNB 5AFNA 2ES0A 4K0KT 2R6GF 2D0TA 2BG9E 3D0TA 2W67A 2VKOA 3MXZA 3T1YT 2F4VT 4TZ4C 2XNVA 3WTMA 2M6IA 2P9BA 5HAXA 4LFBT 5DABA 2JQQA 4KUMB 3N9QA 5J5FA 4YTNA 4I50E 1GQEA 2XM2A 4UF0A 4CXXA 5FVKA 3N2OA 2VL8A 2KZ7B 2DWGA 3UULA 3I9YA 2BS4A 4ZJSA 3FHNA 3U78A 3MKDA 3LJCA 2Y7YA 4HWHA 5JDHA 3VR8A 4JI3T 3Q5XA 3EAMA 3UQ4A 2WSSV 5FXZA 5ABGA 1FJGT 2Y48B 4UEMA 4IDOA 2CHNA 2KT9A 1KFYA 4DV6T 2X9HA 4UF0B 2WCAA 4A56A 3CWZB 1ZEEA 3LDQB 1D1CA 2XYTA 3B5MA 3CX7B 3QB5A 1YKHB 1ZHCA 4WW0A 2Y56A 4DMWA 3GUAA 4JUYA 4IL9A 2BBJA 4EZ1A 2XQAA 3AA7B 4V1Av 3P4WA 5AQVB 4TN7B 5JDFA 2JIWA 1UX5A 2JMHA 4ILBA 4IE6A 1WYCA 3AEEA 2LOPA 4YY3T 3BK9A 2X66A 4KMCA 4H63H 3KV6A 4UXNB 4FRRA 5AFMA 4H9OC 4ASKA 5FY0A 2L3LA 3TLUA 5JDQA 3GN5A 4BAYB 2LJLA 4DIDB 4LMLA 4DUZT 3PURA 3IHRA 4HFEA 4Z91A 3RYFE 1KK7A 1IBLT 2D9DA 3RPUA 1HFAA 4UY2A 4WBNE 3AA6B 2WU2A 3AEAA 2XHEB 3P50A 2E9XC 1YQ3A 3IEEA 4ZI3D 2X00D 2LRLA 2CLYB 5ABFB 4DBRA 4X64T 1ZV4X 4IE7A 3OPCA 2YINA 1Y01A 1YXRA 4CZZB 2LSYA 2BS2A 2VURA 2Q9QB 5L2LA 3RKGA 4F6RC 4XHEA 4H9NC 3K3NA 2WNJA 3J7Yq 3U3IA 2Y6XA 2IAKA 4QXHB 1NWMX 1MIYA 2YOEA 3ZN0B 2Q9QD 2J47A 4EIWA 3NRYA 3LG7A 1G73A 3SQ9A 3FBZA 2XQ3A 4CN6A 4ZRUA 3V5UA 4U74A 5JREA 4PAGA 3UUNA 3SH1A 2RA1A 4ISTA 4L9IA 3ZCIA 3ZMVB 3VKHA 2LSKA 2FJBA 2XM1A 3ZYLA 2BVMA 4L0RA 1LKXA 2DI4A 3IGQA 1YW0A 5AINA 4GK0E 4JEHB 3WIPA 2K3WA 2K5BB 3AE6A 4FJOA 4PFOA 4X20E 3GA8A 3VKGA 3ZT6A 1U5PA 3HI2A 1I94T 4I4TE 1HNWT 3VU7H 2XSAA 5KE4A 5LJNA 2QRXA 2CM0A 4P0AA 5L4EA 2XQYA 3NKZA 2YU2A 2YDSA 2HN2A 2LKGA 3ZMSB 5AFMB 4KI0F 5JDLA 4DR6T 4U33A 3KBUA 2BYSA 1HX8A 1CUNA 1XNRT 4JYAT 5JRCA 4PK6A 1KF6A 4JLEA 4YXDA 4YHHT 3P7IA 3FZFB 4HFBA 4MFRA 2QYWA 5A1LA 2H89A 5GONE 2AE9A 4PW8A 3U8LA 3LBXB 3O1IA 3C79A 3PE0A 5FXXA 3RQUA 4X1KE 2HHHT 2W2UA 5CB4E 2Z6EA 4CQIA 3I1AA 2E8IA 2J1DG 3IF8B 3QC9A 2V1DB 4FI5A 4ZI2C 5HCJA 2ODUA 5FMNA 3F2EA 2K9AA 2H88A 3KV9A 3UUMA 3N9LA 4MALA 3RYHE 2ZM2A 4CXWA 2WDVA 2ZM8A 4A98A 4GKJT 2UXDT 5LB7B 1Z0PA 2X0YA 4ILAA 3UU3A 3WTOA 1CHUA 3H3AA 3G06A 5FL0A 2LHRA 4O4JE 2FBWA 3UFEA 2NP9A 2WWVA 4EEBA 3ZKRA 3P4RA 2LT3A 3O1HA 4YSYA 2HPJA 3MJXA 5HYAA 3WAKA 3ZT5A 2YEVC 3QB5K 4AIUA 2WMNA 4DUYT 4HFVA 5CA0E 2C5IT 3RRWA 3C51A 2WY2A 1S94A 3QOFA 3PUXF 3UUXB 5IYZE 3NZQA 2CRBA 5FNVE 2W8FA 2DCFA 2EHOC 2JJ9A 5ABEA 4H9RC 4AKRB 4HEAA 5HXEA 5IUXA 2VKDA 2UXCT 4GKKT 4TNVA 2UXBT 4JEUB 1QSDA 2CBIA 4BJMA 2WP9A 2WN9A 1WRDA 4LF5T 1T8BA 2PG8A 1VCTA 1HG2A 5HWYA 5H6QB 3AE1A 4DV0T 5JR9C 4PNIA 2IMLA 3CVRA 2XNTA 3M3ZB 4PK5A 1XDPA 2L9QA 3NWIA 3X1DA 4IE5A 1XMQT 5LMUT 4O4LE 2G0UA 3AE4A 3I0QA 5CGMA 4DV7T 4C91A 2HN1A 2QA7A 2MAWA 2KWIB 1KNPA 5ADXL 3AECA 5BR8T 2JQ9A 5TAOA 1UURA 3FB2A 3C84A 4GOUA 3FZHB 4DVDA 4B3ST 3PV0F 5AFLA 1J5ET 5JDNA 2VQFT 4EV6A 3ANWA 5L3BB 4ZI3C 1M7KA 3L09A 2E9XA 4O2BE 3PUSA 2LKHA 2KXPB 1SHZC 1Y64B 3C98B 3H3MA 4ZZBA 3KV5A 3PJAJ 1D1AA 2E5LT 3BQKA 4TV8E 5C2TA 4HN9A 4TWFA 3WI3A 1VRBA 3LK42 4HFDA 1I6ZA 1SA0E 4DV5T 2NR4A 4LF4T 1UX4A 3AVRA 2LSIA 4IDZA 2YMEA 2Q9QC 4U72A 4E7ZA 1OXZA 4G63A 3ZPOA 1IBKT 4YSXA 5JVDE 4B3MT 5AQRB 2KLQA 4U7IA 2CLYC 3UU4A 1S35A 3VHLA 1YD8G 5LXTE 4IREA 3AAEB 4QXBB 2NTYA 4DBQA 3HL6A 2HH7A 3RIUC 1FEWA 3JADA 2WZYA 3P4PA 4JI0T 2BYQA 1MIVA 3ONLC 2CXDA 1N33T 3DP7A 2NW9A 2ACXA 5JQGE 3TLTA 3OKQA 2LEHA 3DJBA 3U8MA 5HEJA 5HWXA 4G2AA 2XZ6A 4P1NA 3C4WA 3O1JA 4ZZCA 3AA1B 4ILUA 3HKBE 5AFUL 4AQFC 5J5HA 3RF1A 2X51A 2HPLA 3FZKB 3PUVF 2KSRA 5LMNT 3WTKA 3AEDA 1L0VA 1HTJF 2Y58A 1T72A 2IHR1 5AQHB 1V9DA 2X68A 5DQVA 2H7VC 4KBMB 4AQYT 1HR0T 1LRZA 2C0SA 2V7IA 4KP3C 4QKNA 3CMLA 4ZK1A 4XBFB 2ZM6T 1LVFA 4X65T 4HE8A 4ZI2D 3LFMA 2LSGA 4CI2B 2EHOB 2V26A 3L39A 2VKHA 2V7JA 3RC8A 2XQ5A 3CPZA 4N78D 4I43B 5FL1A 1D0ZA 1OEDA 1US7B 5M4YA 4TV9E 4LF7T 4ZS2A 4ISSA 4DV2T 2RPAA 3ETUA 5HEHA 4C90A 5AQSB 2Y54A 2AXDS 4DR5T 2LE8A 1N32T 5LHHB 1I9BA 4MLKA 3SS1A 5BW2A 5FY1A 3ZT7A
chains in the Genus database with same CATH topology
2UZ6A 4AFGA 4COFA 3U8MA 3TLWA 2XYTA 4HQPA 5HEJA 4IL4A 4BFQA 3EHZA 4HFBA 1OEDE 2YN6A 2YKSA 2BG9C 4Z90A 4XHEA 5BRXA 1UV6A 2WNJA 2M6BA 3U8LA 2XZ6A 5L47A 4ZZCA 4ZR6A 2Y56A 3LSVA 4AFHA 3GUAA 3TLSA 3C79A 4IL9A 2LKHA 2BYPA 2ZJUA 2BJ0A 4EZ1A 3U8KA 2XQAA 5J5HA 5HEOA 3UU5A 3PEOA 3RQUA 5J0ZA 2YOEA 3P4WA 2PH9A 4ALXA 5JMEA 2KSRA 3WTKA 4XK9A 4ZZBA 4LMKA 4UM3P 2W8FA 5AFNA 3UUBA 1UX2A 2W8GA 2Y58A 4HFCA 3SIOA 3WTNA 4TNWA 5HCMA 3SQ9A 2XQ3A 2WNCA 4X5TA 2BG9E 4LMJA 4TWFA 4ZRUA 4B5DA 4ILBA 4A97A 2WNLA 3SH1A 2BG9B 4HFDA 2QC1B 5TVCA 4D01A 5IUXA 3TLVA 3JAFA 2XNVA 2X00A 2XQ8A 5HCJA 2M6IA 2PGZA 4QABA 3WTMA 2XYSA 3ZDGA 4UXUA 3U8NA 5LG3A 5J5FA 4TNVA 4QACA 4UM3S 5KZUA 4FRRA 3WTJA 5AFMA 2VL0A 4NPPA 3IGQA 2YMEA 2XQ7A 5AINA 2WN9A 2YMDA 4ILCA 5LXBA 3WTIA 4WV9A 4DBMA 2XNUA 2BR7A 3TLUA 3WIPA 1OEDB 5J5GA 3JAEA 3UQ7A 4HFHA 2XQ6A 4TWDA 5L4HA 4LMLA 5CFBA 4ZK4A 2XNTA 3WTLA 2XQ4A 3RIAA 3RQWA 3UU8A 4A98A 4ZK1A 3SQ6A 4ZJSA 4HFEA 4Z91A 4ILAA 2LM2A 3UU3A 3WTOA 3UU4A 2Y7YA 5SYOA 2C9TA 3WTHA 2XQ5A 5HEGA 4IREA 3PMZA 5KE4A 3EAMA 4QH1A 4UY2A 1OEDA 4QAAA 2BYNA 2ZJVA 2MAWA 3P50A 3UQ4A 5CO5A 5L4EA 4ZJTA 4AFTA 5HEHA 4BQTA 3RI5A 4QH5A 5AFKA 2LKGA 2Y54A 2BG9A 2XZ5A 2X00D 2LLYA 5AFMB 3JADA 4F8HA 3U8JA 2WZYA 2BR8A 4UM3A 3EI0A 1UW6A 3ZKRA 5J5IA 4NZBA 2BYQA 4HFIA 4PIRA 4TWHA 2BYSA 2BYRA 3C84A 5HEUA 1I9BA 3ZDHA 3T4MA 3RIFA 5AFHA 1OEDC 5BP0A 5FJVA 3UU6A 5BW2A 2XQ9A 5AFLA 3TLTA 4QH4A 3RHWA 2Y57A 4UM1A 5AFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZ6 A;  4AFG A;  4COF A;  3U8M A;  3TLW A;  2XYT A;  4HQP A;  5HEJ A;  4IL4 A;  4BFQ A;  3EHZ A;  4HFB A;  1OED E;  2YN6 A;  2YKS A;  2BG9 C;  4Z90 A;  4XHE A;  5BRX A;  1UV6 A;  2WNJ A;  2M6B A;  3U8L A;  2XZ6 A;  5L47 A;  4ZZC A;  4ZR6 A;  2Y56 A;  3LSV A;  4AFH A;  3GUA A;  3TLS A;  3C79 A;  4IL9 A;  2LKH A;  2BYP A;  2ZJU A;  2BJ0 A;  4EZ1 A;  3U8K A;  2XQA A;  5J5H A;  5HEO A;  3UU5 A;  3PEO A;  3RQU A;  5J0Z A;  2YOE A;  3P4W A;  2PH9 A;  4ALX A;  5JME A;  2KSR A;  3WTK A;  4XK9 A;  4ZZB A;  4LMK A;  4UM3 P;  2W8F A;  5AFN A;  3UUB A;  1UX2 A;  2W8G A;  2Y58 A;  4HFC A;  3SIO A;  3WTN A;  4TNW A;  5HCM A;  3SQ9 A;  2XQ3 A;  2WNC A;  4X5T A;  2BG9 E;  4LMJ A;  4TWF A;  4ZRU A;  4B5D A;  4ILB A;  4A97 A;  2WNL A;  3SH1 A;  2BG9 B;  4HFD A;  2QC1 B;  5TVC A;  4D01 A;  5IUX A;  3TLV A;  3JAF A;  2XNV A;  2X00 A;  2XQ8 A;  5HCJ A;  2M6I A;  2PGZ A;  4QAB A;  3WTM A;  2XYS A;  3ZDG A;  4UXU A;  3U8N A;  5LG3 A;  5J5F A;  4TNV A;  4QAC A;  4UM3 S;  5KZU A;  4FRR A;  3WTJ A;  5AFM A;  2VL0 A;  4NPP A;  3IGQ A;  2YME A;  2XQ7 A;  5AIN A;  2WN9 A;  2YMD A;  4ILC A;  5LXB A;  3WTI A;  4WV9 A;  4DBM A;  2XNU A;  2BR7 A;  3TLU A;  3WIP A;  1OED B;  5J5G A;  3JAE A;  3UQ7 A;  4HFH A;  2XQ6 A;  4TWD A;  5L4H A;  4LML A;  5CFB A;  4ZK4 A;  2XNT A;  3WTL A;  2XQ4 A;  3RIA A;  3RQW A;  3UU8 A;  4A98 A;  4ZK1 A;  3SQ6 A;  4ZJS A;  4HFE A;  4Z91 A;  4ILA A;  2LM2 A;  3UU3 A;  3WTO A;  3UU4 A;  2Y7Y A;  5SYO A;  2C9T A;  3WTH A;  2XQ5 A;  5HEG A;  4IRE A;  3PMZ A;  5KE4 A;  3EAM A;  4QH1 A;  4UY2 A;  1OED A;  4QAA A;  2BYN A;  2ZJV A;  2MAW A;  3P50 A;  3UQ4 A;  5CO5 A;  5L4E A;  4ZJT A;  4AFT A;  5HEH A;  4BQT A;  3RI5 A;  4QH5 A;  5AFK A;  2LKG A;  2Y54 A;  2BG9 A;  2XZ5 A;  2X00 D;  2LLY A;  5AFM B;  3JAD A;  4F8H A;  3U8J A;  2WZY A;  2BR8 A;  4UM3 A;  3EI0 A;  1UW6 A;  3ZKR A;  5J5I A;  4NZB A;  2BYQ A;  4HFI A;  4PIR A;  4TWH A;  2BYS A;  2BYR A;  3C84 A;  5HEU A;  1I9B A;  3ZDH A;  3T4M A;  3RIF A;  5AFH A;  1OED C;  5BP0 A;  5FJV A;  3UU6 A;  5BW2 A;  2XQ9 A;  5AFL A;  3TLT A;  4QH4 A;  3RHW A;  2Y57 A;  4UM1 A;  5AFJ A; 
#chains in the Genus database with same CATH topology
 3T8O A;  4IT4 A;  4COF A;  1XWM A;  4UIG A;  1XDO A;  1OED E;  2IIU A;  2W62 A;  2N2N A;  2E9X B;  4H9Q C;  5L47 A;  1QUU A;  1KNZ A;  2KND A;  4KHP T;  4Q25 A;  1XMO T;  2IC6 A;  1E7P A;  4HKA A;  3B13 A;  3AE5 A;  4QXC B;  1HG5 A;  4UVC B;  2WZH A;  3ONJ A;  5DQW A;  4HFC A;  2YDR A;  4XZC A;  5FYM A;  3Q2M A;  2GK9 A;  3SFE A;  5L3E B;  2I6H A;  1T7S A;  3K8P C;  4AI6 A;  3O4X E;  2CMR A;  4P09 A;  1X9B A;  3Q9D A;  2Q9Q A;  4OFZ A;  2VL0 A;  2H3R A;  4AQF A;  4ZOL E;  1BR4 A;  4JBW F;  5J5G A;  3VRB A;  3Q5W A;  3W15 B;  3AVS A;  2SPC A;  3FZM B;  4IDP A;  2W0G A;  5LGT B;  3AE7 A;  3ABV A;  2VAS A;  1MMD A;  4EZH A;  4E7S A;  1OWA A;  5L3C B;  4HGA A;  4WYV A;  2X0H A;  4WNK A;  3SWH A;  5LBQ B;  5LYJ E;  4AFT A;  2BDE A;  1HNX T;  5EK3 A;  1MMA A;  4UV9 B;  1HNZ T;  1NEN A;  5AQM B;  4UM3 A;  4IGU A;  3NVO A;  3A5X A;  4OX9 T;  3T1H T;  2V5C A;  5LGU B;  5FXW A;  3EUH A;  4QX8 B;  5AFH A;  3DTO A;  3HKE E;  3C4X A;  3AXJ A;  2PBI A;  2LOS A;  5AQJ B;  3PJA A;  2XTL A;  3TLW A;  4HQP A;  5IHY A;  3Q5D A;  4LF6 T;  3SRZ A;  4KX6 A;  4MBQ A;  2W00 A;  2W61 A;  3PEO A;  4HTE A;  5LBM A;  1UX2 A;  4OHF A;  3EDV A;  4CI3 B;  1NEK A;  1YKE B;  2I59 A;  4NUU A;  2UUA T;  1XNQ T;  2XQ8 A;  3Q5E A;  4IDQ A;  1FMV A;  4QAC A;  3AXJ B;  1BR2 A;  2YMD A;  3BQL A;  4DBM A;  1J1J A;  3JC6 C;  5CFB A;  4EED A;  1WR6 A;  1MND A;  3OTO T;  3PDY A;  3SQ6 A;  5J2T E;  1HS7 A;  1ZKE A;  3LK3 B;  2W66 A;  4NUV A;  4WZX A;  2A3D A;  1EZ3 A;  3MZK B;  3RC3 A;  1W0B A;  4WBO A;  5AQI B;  5C3J A;  3ANW B;  2V5D A;  1G8X A;  5HEU A;  4B3T T;  3T4M A;  3MAC A;  3UU6 A;  3RKO A;  3RRC A;  4CN4 A;  2ZMA A;  3CKD A;  4BFQ A;  2EHO D;  2YKS A;  3AE2 A;  4OYJ A;  2B76 A;  4H63 V;  5E0O A;  1MIW A;  4AKH A;  2V7L A;  1IBM T;  4DV3 T;  4DR2 T;  3N5L A;  4K0U A;  5HEO A;  3PUW F;  4AKI A;  1WCR A;  5JTG A;  2A2F X;  2WB5 A;  3ESL A;  4YT0 A;  2PGZ A;  4NXM T;  2CEA A;  3HKD E;  1UGO A;  4UXU A;  4UM3 S;  2H7O A;  5C8Y E;  4IE4 A;  4JV5 T;  2XQ7 A;  3PUQ A;  1E1H B;  1M62 A;  2UU9 T;  5L4H A;  5FVL A;  2V7M A;  3HR0 A;  2V6Y A;  1ZP0 A;  1T98 A;  4OYK A;  5ABF A;  4JI1 T;  2ZLY A;  4ERR A;  2QGS A;  2CXL A;  4TUY E;  5KX5 E;  4GYS A;  3KVB A;  4AQG A;  1N36 T;  2PFV A;  1MMN A;  1UUS A;  1SUM B;  4BQT A;  2XZE A;  3RI5 A;  4QH5 A;  5J2U E;  2BG9 A;  3MK7 C;  4DO0 A;  2BKP A;  2JMK A;  2CWY A;  1HCI A;  2WAU A;  3RLF F;  4AKG A;  2CXF A;  5LG4 A;  3OYX A;  1WLX A;  2BG9 C;  3H37 A;  2L8K A;  4ANJ A;  2UXN B;  3N9P A;  4UR9 A;  5LP6 E;  2BYP A;  2K48 A;  4YTM A;  3UTK A;  1KNR A;  3ZC1 A;  2W63 A;  5JME A;  5KXJ A;  4U2Z A;  3SIO A;  2W8G A;  4EYY R;  3FBL A;  3E22 E;  2OLT A;  4X1I E;  3N9M A;  4ADZ A;  4H9S E;  3TKL B;  4X66 T;  5FP3 A;  2QVA A;  5TVC A;  1WFD A;  3U8N A;  3N2G E;  1UCU A;  1IJ5 A;  4DR1 T;  4ILC A;  4I0U A;  3NBX X;  2XJ7 A;  3ZLI A;  5EK2 A;  3V5S A;  4BA9 A;  3JAE A;  4L5G A;  3E0Z A;  3KBT A;  4EXT A;  2NW8 A;  5EZY E;  2VB6 A;  2WS3 A;  4QHO A;  5BMV E;  5HEG A;  3PMZ A;  5ETW A;  1VOM A;  4ZJT A;  2WMO A;  4ZI7 E;  2XZ5 A;  2KWH A;  4QX7 B;  2JQH A;  3ZMU B;  4YLH A;  3U8J A;  1UW6 A;  4TWH A;  4B6X A;  2DL1 A;  2VK9 A;  2OA5 A;  3O9X A;  4O4H E;  2XQ9 A;  2VWA A;  3RHW A;  2UZ6 A;  3PUZ F;  2CHO A;  2WZI A;  1DU2 A;  5BRX A;  2MYS A;  5KDM C;  2XPK A;  1X79 A;  2J4G A;  2M6B A;  4EGW A;  5LHI B;  3PU3 A;  3EVY A;  3PUG A;  4J2C A;  4P0B A;  2J62 A;  4JI2 T;  5AQK B;  3P4Q A;  3L3P A;  3N9N A;  3UU5 A;  1LVK A;  1IJ6 A;  2PH9 A;  4EYU A;  3ZSS A;  1YQ4 A;  2BKO A;  4YTP A;  3WTN A;  2XAJ B;  4DV4 T;  3A8Y C;  4TNW A;  5HCM A;  2W4X A;  4PFP A;  5JH7 E;  5FY7 A;  4CI1 B;  4D01 A;  3B57 A;  4LF8 T;  1JNR A;  2PJQ A;  3AAA B;  2C5J A;  3ZMZ B;  4I55 E;  1BR1 A;  2DLR A;  4WV9 A;  4JI5 T;  3RYI E;  1OED B;  3AE9 A;  5CJ5 A;  5F3J A;  3UQ7 A;  3AEG A;  5LNK A;  3WTL A;  5HXS A;  2XQ4 A;  1D0Y A;  2D5U A;  4YFS A;  4YSZ A;  2FUP A;  4O2A E;  4LF9 T;  3CQC B;  4O8S A;  4NIQ A;  3QUJ A;  2VVN A;  1MNE A;  4BJN A;  4QH1 A;  4QAA A;  2N1G A;  1NAF A;  2IC9 A;  3JC6 D;  4ZS3 A;  1SE7 A;  3AE3 A;  2D2S A;  2BR8 A;  5J5I A;  3ZJ2 A;  3KIN B;  3CIR A;  2XSB A;  1MMG A;  3HKC E;  3ZDH A;  3ZC0 A;  5HXC A;  5FJV A;  2VQE T;  2Y57 A;  4UM1 A;  3NZP A;  5AQT B;  3IBP A;  2VKJ A;  1FMW A;  2NOX A;  4IL4 A;  2E2A A;  3EHZ A;  2NW7 A;  3RH3 A;  3JCF A;  5AQL B;  4UVA B;  3MA9 A;  4U2Y A;  3TLS A;  3R6N A;  2CA5 A;  3GN5 B;  3SOL A;  2BJ0 A;  5LA6 E;  2CCQ A;  4DMV A;  2FJD A;  2X9W A;  5LCY A;  4LMK A;  2UUB T;  4KHZ F;  2CBJ A;  3ZN1 B;  3AAI A;  1JNZ A;  2A72 A;  5DJQ C;  3IA3 A;  4DR4 T;  2JQK A;  5FXV A;  2EHO A;  3KFW X;  5JR9 B;  1ZOY A;  2XYS A;  4JI6 T;  4EZ4 A;  5LG3 A;  3AE8 A;  2JRK A;  2WWU A;  1B7T A;  3WTJ A;  3UFG A;  3PUA A;  3P8C D;  5LXB A;  1WYB A;  4PJL A;  3HA4 A;  1AJ3 A;  2IDO B;  4UEL A;  4IIJ E;  4ZK4 A;  3PTR B;  3RQW A;  3UU8 A;  2CE7 A;  5JDG A;  4ZEY A;  3N9O A;  5F8P A;  4X1Y E;  5L3D B;  3AEB A;  4A5X A;  4PK4 A;  4ZXL A;  2ZJV A;  4EOZ B;  2LM9 A;  3ZYM A;  4OK0 A;  3LBX A;  3F31 A;  3C50 A;  5JDM A;  2V8S V;  5LHG B;  2DNX A;  3AEF A;  3ZJ1 A;  3K3Q C;  3RIF A;  1OED C;  1IAP A;  2WQY A;  2YU1 A;  1UV6 A;  4EAH A;  3EDU A;  2WU5 A;  2LSJ A;  2BBH A;  2XUE A;  4JI4 T;  5JRC B;  2BZB A;  5ABH A;  4UM3 P;  4DV1 T;  4U7Y A;  2WNC A;  4B5D A;  4TX5 A;  3A7M A;  2WNL A;  2E5V A;  4DR3 T;  2BG9 B;  3I0O A;  3TLV A;  1W0A A;  4QAB A;  4HWI B;  3ZDG A;  4B3R T;  3F57 A;  5KZU A;  1W09 A;  3PUY F;  4NPP A;  4IHJ E;  2ZM0 A;  3WTI A;  3C64 A;  5AQU B;  4YJ3 E;  3ZYK A;  5L3G B;  3OJA A;  3P4S A;  4HFH A;  4TWD A;  5LOV E;  1O3X A;  2YDQ A;  4JI8 T;  3RYC E;  4U3C A;  2B1E A;  1E2A A;  5F5W A;  1H7C A;  3L8R A;  4O4I E;  2C9T A;  5L3F B;  3WTH A;  3E08 A;  4PJN A;  1D0X A;  4HWD A;  2OV9 A;  2WDQ A;  2K24 A;  2X0L B;  2FJE A;  5H6R B;  2LLY A;  4U31 A;  4LFA T;  2XAF B;  3ZEF B;  5CA1 E;  2NWB A;  2M67 A;  4UVB B;  5BP0 A;  2WM9 A;  4QH4 A;  5AFJ A;  2CWO A;  1HF8 A;  5AQP B;  4IE0 A;  1Z8U A;  3OYZ A;  2XY8 B;  3RIU A;  3ZMT B;  2N9D A;  3FXE B;  4ZR6 A;  4AKL A;  4AFH A;  4M1P A;  2MPK A;  2VVS A;  2ZJU A;  3U8K A;  4AIS A;  4XK9 A;  2BS3 A;  2LRK A;  3UUB A;  3ETV A;  2DHR A;  5AQO B;  5J1G A;  3NRX A;  2RP4 A;  2FJA A;  3CK6 A;  3VR9 A;  2BKN A;  2QC1 B;  5AQG B;  3RGL A;  2D0U A;  3JAF A;  3GMI A;  3K3O A;  3ZST A;  2KMF A;  3OVU A;  2UUC T;  2XNU A;  2BR7 A;  3KDS E;  2V6X A;  2E9X D;  1KEY A;  2A9U A;  3N2K E;  2XQ6 A;  3EAB A;  2IW5 B;  3GWH A;  3RIA A;  3AB3 B;  3AA0 B;  4CXY A;  2XAG B;  5AQF B;  2LM2 A;  3K1S A;  4UV8 B;  5SYO A;  1QLB A;  3KVA A;  4PJJ A;  5AQQ B;  4ZHQ E;  2X9X A;  5CO5 A;  4GK5 E;  3FZL B;  2BVL A;  3BQI A;  3SFD A;  4F8H A;  3EI0 A;  4NZB A;  2WDR A;  4HFI A;  4PIR A;  2BYR A;  4HWF A;  3VRA A;  5FKY A;  4AFG A;  3I9W A;  4HWC A;  2MTQ A;  2X67 A;  5HXR A;  4PJM A;  2KIN B;  3CX8 B;  1UK5 A;  2V7K A;  3CQX C;  3UT5 E;  3FXD B;  3LK2 B;  1W9R A;  2UXX B;  5EK4 A;  2C5K T;  2CPT A;  1N34 T;  2XAQ B;  4NXN T;  5IWA T;  3QK6 A;  2JPF A;  3M65 A;  1J5W A;  3R84 B;  1HX1 B;  4JI7 T;  4X5T A;  1WR0 A;  4LMJ A;  4A97 A;  2YK0 A;  1R8I A;  3ONX A;  5LGN B;  2X00 A;  1IZN B;  4QWN B;  4H9P C;  4IDN A;  3KV4 A;  4DND A;  2X9Y A;  3WAJ A;  4YJ2 E;  2PTF A;  4EB6 E;  1FIO A;  4X62 T;  3QNU A;  3C4Z A;  2WBL A;  2V6Y B;  3J9X 1;  5HXH A;  2IUB A;  4Z8X A;  3OBV E;  4MHC A;  4DR7 T;  2MBG A;  2BYN A;  5AFK A;  3RX6 A;  1VCS A;  4YHJ A;  3CX6 B;  4XAX B;  2DWK A;  4LFC T;  4GYR A;  1U4Q A;  5JR9 A;  4GIW A;  2ACZ A;  2ODV A;  5LJM A;  2LHN A;  3S4U A;  2YN6 A;  4Z90 A;  2Y8D A;  2MOZ A;  3CQG B;  2NTX A;  3ZCJ A;  2XAH B;  3LSV A;  2I0M A;  1XZY A;  3PU8 A;  4CN1 A;  4ALX A;  5J0Z A;  2XAS B;  1BR0 A;  5KMG P;  4AXP A;  1D1B A;  5AQN B;  5AFN A;  2ES0 A;  4K0K T;  2R6G F;  2D0T A;  2BG9 E;  3D0T A;  2W67 A;  2VKO A;  3MXZ A;  3T1Y T;  2F4V T;  4TZ4 C;  2XNV A;  3WTM A;  2M6I A;  2P9B A;  5HAX A;  4LFB T;  5DAB A;  2JQQ A;  4KUM B;  3N9Q A;  5J5F A;  4YTN A;  4I50 E;  1GQE A;  2XM2 A;  4UF0 A;  4CXX A;  5FVK A;  3N2O A;  2VL8 A;  2KZ7 B;  2DWG A;  3UUL A;  3I9Y A;  2BS4 A;  4ZJS A;  3FHN A;  3U78 A;  3MKD A;  3LJC A;  2Y7Y A;  4HWH A;  5JDH A;  3VR8 A;  4JI3 T;  3Q5X A;  3EAM A;  3UQ4 A;  2WSS V;  5FXZ A;  5ABG A;  1FJG T;  2Y48 B;  4UEM A;  4IDO A;  2CHN A;  2KT9 A;  1KFY A;  4DV6 T;  2X9H A;  4UF0 B;  2WCA A;  4A56 A;  3CWZ B;  1ZEE A;  3LDQ B;  1D1C A;  2XYT A;  3B5M A;  3CX7 B;  3QB5 A;  1YKH B;  1ZHC A;  4WW0 A;  2Y56 A;  4DMW A;  3GUA A;  4JUY A;  4IL9 A;  2BBJ A;  4EZ1 A;  2XQA A;  3AA7 B;  4V1A v;  3P4W A;  5AQV B;  4TN7 B;  5JDF A;  2JIW A;  1UX5 A;  2JMH A;  4ILB A;  4IE6 A;  1WYC A;  3AEE A;  2LOP A;  4YY3 T;  3BK9 A;  2X66 A;  4KMC A;  4H63 H;  3KV6 A;  4UXN B;  4FRR A;  5AFM A;  4H9O C;  4ASK A;  5FY0 A;  2L3L A;  3TLU A;  5JDQ A;  3GN5 A;  4BAY B;  2LJL A;  4DID B;  4LML A;  4DUZ T;  3PUR A;  3IHR A;  4HFE A;  4Z91 A;  3RYF E;  1KK7 A;  1IBL T;  2D9D A;  3RPU A;  1HFA A;  4UY2 A;  4WBN E;  3AA6 B;  2WU2 A;  3AEA A;  2XHE B;  3P50 A;  2E9X C;  1YQ3 A;  3IEE A;  4ZI3 D;  2X00 D;  2LRL A;  2CLY B;  5ABF B;  4DBR A;  4X64 T;  1ZV4 X;  4IE7 A;  3OPC A;  2YIN A;  1Y01 A;  1YXR A;  4CZZ B;  2LSY A;  2BS2 A;  2VUR A;  2Q9Q B;  5L2L A;  3RKG A;  4F6R C;  4XHE A;  4H9N C;  3K3N A;  2WNJ A;  3J7Y q;  3U3I A;  2Y6X A;  2IAK A;  4QXH B;  1NWM X;  1MIY A;  2YOE A;  3ZN0 B;  2Q9Q D;  2J47 A;  4EIW A;  3NRY A;  3LG7 A;  1G73 A;  3SQ9 A;  3FBZ A;  2XQ3 A;  4CN6 A;  4ZRU A;  3V5U A;  4U74 A;  5JRE A;  4PAG A;  3UUN A;  3SH1 A;  2RA1 A;  4IST A;  4L9I A;  3ZCI A;  3ZMV B;  3VKH A;  2LSK A;  2FJB A;  2XM1 A;  3ZYL A;  2BVM A;  4L0R A;  1LKX A;  2DI4 A;  3IGQ A;  1YW0 A;  5AIN A;  4GK0 E;  4JEH B;  3WIP A;  2K3W A;  2K5B B;  3AE6 A;  4FJO A;  4PFO A;  4X20 E;  3GA8 A;  3VKG A;  3ZT6 A;  1U5P A;  3HI2 A;  1I94 T;  4I4T E;  1HNW T;  3VU7 H;  2XSA A;  5KE4 A;  5LJN A;  2QRX A;  2CM0 A;  4P0A A;  5L4E A;  2XQY A;  3NKZ A;  2YU2 A;  2YDS A;  2HN2 A;  2LKG A;  3ZMS B;  5AFM B;  4KI0 F;  5JDL A;  4DR6 T;  4U33 A;  3KBU A;  2BYS A;  1HX8 A;  1CUN A;  1XNR T;  4JYA T;  5JRC A;  4PK6 A;  1KF6 A;  4JLE A;  4YXD A;  4YHH T;  3P7I A;  3FZF B;  4HFB A;  4MFR A;  2QYW A;  5A1L A;  2H89 A;  5GON E;  2AE9 A;  4PW8 A;  3U8L A;  3LBX B;  3O1I A;  3C79 A;  3PE0 A;  5FXX A;  3RQU A;  4X1K E;  2HHH T;  2W2U A;  5CB4 E;  2Z6E A;  4CQI A;  3I1A A;  2E8I A;  2J1D G;  3IF8 B;  3QC9 A;  2V1D B;  4FI5 A;  4ZI2 C;  5HCJ A;  2ODU A;  5FMN A;  3F2E A;  2K9A A;  2H88 A;  3KV9 A;  3UUM A;  3N9L A;  4MAL A;  3RYH E;  2ZM2 A;  4CXW A;  2WDV A;  2ZM8 A;  4A98 A;  4GKJ T;  2UXD T;  5LB7 B;  1Z0P A;  2X0Y A;  4ILA A;  3UU3 A;  3WTO A;  1CHU A;  3H3A A;  3G06 A;  5FL0 A;  2LHR A;  4O4J E;  2FBW A;  3UFE A;  2NP9 A;  2WWV A;  4EEB A;  3ZKR A;  3P4R A;  2LT3 A;  3O1H A;  4YSY A;  2HPJ A;  3MJX A;  5HYA A;  3WAK A;  3ZT5 A;  2YEV C;  3QB5 K;  4AIU A;  2WMN A;  4DUY T;  4HFV A;  5CA0 E;  2C5I T;  3RRW A;  3C51 A;  2WY2 A;  1S94 A;  3QOF A;  3PUX F;  3UUX B;  5IYZ E;  3NZQ A;  2CRB A;  5FNV E;  2W8F A;  2DCF A;  2EHO C;  2JJ9 A;  5ABE A;  4H9R C;  4AKR B;  4HEA A;  5HXE A;  5IUX A;  2VKD A;  2UXC T;  4GKK T;  4TNV A;  2UXB T;  4JEU B;  1QSD A;  2CBI A;  4BJM A;  2WP9 A;  2WN9 A;  1WRD A;  4LF5 T;  1T8B A;  2PG8 A;  1VCT A;  1HG2 A;  5HWY A;  5H6Q B;  3AE1 A;  4DV0 T;  5JR9 C;  4PNI A;  2IML A;  3CVR A;  2XNT A;  3M3Z B;  4PK5 A;  1XDP A;  2L9Q A;  3NWI A;  3X1D A;  4IE5 A;  1XMQ T;  5LMU T;  4O4L E;  2G0U A;  3AE4 A;  3I0Q A;  5CGM A;  4DV7 T;  4C91 A;  2HN1 A;  2QA7 A;  2MAW A;  2KWI B;  1KNP A;  5ADX L;  3AEC A;  5BR8 T;  2JQ9 A;  5TAO A;  1UUR A;  3FB2 A;  3C84 A;  4GOU A;  3FZH B;  4DVD A;  4B3S T;  3PV0 F;  5AFL A;  1J5E T;  5JDN A;  2VQF T;  4EV6 A;  3ANW A;  5L3B B;  4ZI3 C;  1M7K A;  3L09 A;  2E9X A;  4O2B E;  3PUS A;  2LKH A;  2KXP B;  1SHZ C;  1Y64 B;  3C98 B;  3H3M A;  4ZZB A;  3KV5 A;  3PJA J;  1D1A A;  2E5L T;  3BQK A;  4TV8 E;  5C2T A;  4HN9 A;  4TWF A;  3WI3 A;  1VRB A;  3LK4 2;  4HFD A;  1I6Z A;  1SA0 E;  4DV5 T;  2NR4 A;  4LF4 T;  1UX4 A;  3AVR A;  2LSI A;  4IDZ A;  2YME A;  2Q9Q C;  4U72 A;  4E7Z A;  1OXZ A;  4G63 A;  3ZPO A;  1IBK T;  4YSX A;  5JVD E;  4B3M T;  5AQR B;  2KLQ A;  4U7I A;  2CLY C;  3UU4 A;  1S35 A;  3VHL A;  1YD8 G;  5LXT E;  4IRE A;  3AAE B;  4QXB B;  2NTY A;  4DBQ A;  3HL6 A;  2HH7 A;  3RIU C;  1FEW A;  3JAD A;  2WZY A;  3P4P A;  4JI0 T;  2BYQ A;  1MIV A;  3ONL C;  2CXD A;  1N33 T;  3DP7 A;  2NW9 A;  2ACX A;  5JQG E;  3TLT A;  3OKQ A;  2LEH A;  3DJB A;  3U8M A;  5HEJ A;  5HWX A;  4G2A A;  2XZ6 A;  4P1N A;  3C4W A;  3O1J A;  4ZZC A;  3AA1 B;  4ILU A;  3HKB E;  5AFU L;  4AQF C;  5J5H A;  3RF1 A;  2X51 A;  2HPL A;  3FZK B;  3PUV F;  2KSR A;  5LMN T;  3WTK A;  3AED A;  1L0V A;  1HTJ F;  2Y58 A;  1T72 A;  2IHR 1;  5AQH B;  1V9D A;  2X68 A;  5DQV A;  2H7V C;  4KBM B;  4AQY T;  1HR0 T;  1LRZ A;  2C0S A;  2V7I A;  4KP3 C;  4QKN A;  3CML A;  4ZK1 A;  4XBF B;  2ZM6 T;  1LVF A;  4X65 T;  4HE8 A;  4ZI2 D;  3LFM A;  2LSG A;  4CI2 B;  2EHO B;  2V26 A;  3L39 A;  2VKH A;  2V7J A;  3RC8 A;  2XQ5 A;  3CPZ A;  4N78 D;  4I43 B;  5FL1 A;  1D0Z A;  1OED A;  1US7 B;  5M4Y A;  4TV9 E;  4LF7 T;  4ZS2 A;  4ISS A;  4DV2 T;  2RPA A;  3ETU A;  5HEH A;  4C90 A;  5AQS B;  2Y54 A;  2AXD S;  4DR5 T;  2LE8 A;  1N32 T;  5LHH B;  1I9B A;  4MLK A;  3SS1 A;  5BW2 A;  5FY1 A;  3ZT7 A; 
#chains in the Genus database with same CATH homology
 2UZ6 A;  4AFG A;  4COF A;  3U8M A;  3TLW A;  2XYT A;  4HQP A;  5HEJ A;  4IL4 A;  4BFQ A;  3EHZ A;  4HFB A;  1OED E;  2YN6 A;  2YKS A;  2BG9 C;  4Z90 A;  4XHE A;  5BRX A;  1UV6 A;  2WNJ A;  2M6B A;  3U8L A;  2XZ6 A;  5L47 A;  4ZZC A;  4ZR6 A;  2Y56 A;  3LSV A;  4AFH A;  3GUA A;  3TLS A;  3C79 A;  4IL9 A;  2LKH A;  2BYP A;  2ZJU A;  2BJ0 A;  4EZ1 A;  3U8K A;  2XQA A;  5J5H A;  5HEO A;  3UU5 A;  3PEO A;  3RQU A;  5J0Z A;  2YOE A;  3P4W A;  2PH9 A;  4ALX A;  5JME A;  2KSR A;  3WTK A;  4XK9 A;  4ZZB A;  4LMK A;  4UM3 P;  2W8F A;  5AFN A;  3UUB A;  1UX2 A;  2W8G A;  2Y58 A;  4HFC A;  3SIO A;  3WTN A;  4TNW A;  5HCM A;  3SQ9 A;  2XQ3 A;  2WNC A;  4X5T A;  2BG9 E;  4LMJ A;  4TWF A;  4ZRU A;  4B5D A;  4ILB A;  4A97 A;  2WNL A;  3SH1 A;  2BG9 B;  4HFD A;  2QC1 B;  5TVC A;  4D01 A;  5IUX A;  3TLV A;  3JAF A;  2XNV A;  2X00 A;  2XQ8 A;  5HCJ A;  2M6I A;  2PGZ A;  4QAB A;  3WTM A;  2XYS A;  3ZDG A;  4UXU A;  3U8N A;  5LG3 A;  5J5F A;  4TNV A;  4QAC A;  4UM3 S;  5KZU A;  4FRR A;  3WTJ A;  5AFM A;  2VL0 A;  4NPP A;  3IGQ A;  2YME A;  2XQ7 A;  5AIN A;  2WN9 A;  2YMD A;  4ILC A;  5LXB A;  3WTI A;  4WV9 A;  4DBM A;  2XNU A;  2BR7 A;  3TLU A;  3WIP A;  1OED B;  5J5G A;  3JAE A;  3UQ7 A;  4HFH A;  2XQ6 A;  4TWD A;  5L4H A;  4LML A;  5CFB A;  4ZK4 A;  2XNT A;  3WTL A;  2XQ4 A;  3RIA A;  3RQW A;  3UU8 A;  4A98 A;  4ZK1 A;  3SQ6 A;  4ZJS A;  4HFE A;  4Z91 A;  4ILA A;  2LM2 A;  3UU3 A;  3WTO A;  3UU4 A;  2Y7Y A;  5SYO A;  2C9T A;  3WTH A;  2XQ5 A;  5HEG A;  4IRE A;  3PMZ A;  5KE4 A;  3EAM A;  4QH1 A;  4UY2 A;  1OED A;  4QAA A;  2BYN A;  2ZJV A;  2MAW A;  3P50 A;  3UQ4 A;  5CO5 A;  5L4E A;  4ZJT A;  4AFT A;  5HEH A;  4BQT A;  3RI5 A;  4QH5 A;  5AFK A;  2LKG A;  2Y54 A;  2BG9 A;  2XZ5 A;  2X00 D;  2LLY A;  5AFM B;  3JAD A;  4F8H A;  3U8J A;  2WZY A;  2BR8 A;  4UM3 A;  3EI0 A;  1UW6 A;  3ZKR A;  5J5I A;  4NZB A;  2BYQ A;  4HFI A;  4PIR A;  4TWH A;  2BYS A;  2BYR A;  3C84 A;  5HEU A;  1I9B A;  3ZDH A;  3T4M A;  3RIF A;  5AFH A;  1OED C;  5BP0 A;  5FJV A;  3UU6 A;  5BW2 A;  2XQ9 A;  5AFL A;  3TLT A;  4QH4 A;  3RHW A;  2Y57 A;  4UM1 A;  5AFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...