2BG9E

Refined structure of the nicotinic acetylcholine receptor at 4a resolution.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
370
structure length
370
Chain Sequence
NEEGRLIEKLLGDYDKRIKPAKTLDHVIDVTLKLTLTNLISLNEKEEALTTNVWIEIQWNDYRLSWNTSEYEGIDLVRIPSELLWLPDVVLENNVDGQFEVAYYANVLVYNDGSMYWLPPAIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLSAEEGIDPEDFTENGEWTIRHRPAKKNYNWQLTKDDIDFQEIIFFLIIQRKPLFYIINIIAPCVLISSLVVLVYFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSLVIVTNCVIVLNVSLRTPNTHSCVEACNFIAKSTKEQNDSGSENENWVLIGKVIDKACFWIALLLFSLGTLAIFLTGHLNQVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
publication title Refined Structure of the Nicotinic Acetylcholine Receptor at 4A Resolution
pubmed doi rcsb
molecule tags Ion channel/receptor
total genus 87
structure length 370
sequence length 370
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
E PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2bg9E02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2bg9E01
5HEHA 4NZBA 2XQ5A 2XNVA 3PEOA 4QACA 1UX2A 2ZJVA 2XQ4A 3UQ4A 3WTHA 3UQ7A 4FRRA 3U8MA 2PGZA 3JAFA 3RIAA 5L4EA 2UZ6A 5CFBA 5AFHA 5KE4A 4A98A 4UM3P 2BG9A 2YOEA 2WNJA 4QABA 4HFCA 3UUBA 3JADA 4ZJSA 4LMLA 5KZUA 2XQ7A 5BP0A 2WNCA 4ILAA 3TLUA 3U8LA 3U8KA 4Z91A 4UM1A 4HQPA 2Y58A 2MAWA 5L4HA 2BYRA 3WTNA 5HEOA 4AFTA 1OEDC 2WZYA 4ZK1A 5J0ZA 4TNWA 3WTOA 5AFNA 2BYNA 4TNVA 2X00D 3TLVA 3U8NA 1OEDE 2Y54A 2ZJUA 2XZ6A 2XYTA 5IUXA 5HEJA 2C9TA 4EZ1A 5JMEA 4UM3S 4COFA 4XK9A 4NPPA 3ZDGA 2M6BA 3WTMA 2YKSA 2W8GA 4TWFA 3EI0A 3T4MA 2BG9C 2X00A 4ALXA 4F8HA 5AFLA 4WV9A 2XQ8A 4AFHA 5J5HA 1UV6A 4HFIA 4LMKA 5BRXA 3C79A 5AFMB 4ZZCA 2XQ6A 3SH1A 2BYSA 3P50A 4HFBA 4UM3A 4D01A 2XNUA 2Y57A 3UU3A 4HFEA 3TLSA 2XNTA 5HEUA 3WIPA 5SYOA 4X5TA 4UXUA 5CO5A 2WNLA 3RI5A 4ZRUA 2XQ9A 4HFHA 4XHEA 3WTLA 4QH4A 4ZR6A 4UY2A 4QAAA 5AFKA 4IL9A 2LKGA 2M6IA 4ILBA 2BR8A 2BJ0A 3IGQA 3SIOA 2XYSA 4TWHA 1I9BA 3P4WA 4IREA 4QH1A 5HCMA 2QC1B 5J5GA 2VL0A 3LSVA 2WN9A 3EHZA 3UU8A 3U8JA 4LMJA 3ZKRA 2YMDA 4IL4A 2PH9A 5AFMA 3ZDHA 4A97A 3RQWA 1OEDB 2W8FA 2YN6A 2BG9E 3RHWA 4B5DA 5BW2A 2Y7YA 3TLWA 3SQ6A 3PMZA 3WTKA 3SQ9A 4DBMA 3UU5A 4BQTA 3JAEA 2BYPA 3UU4A 5LXBA 5J5IA 5FJVA 2XQAA 4ILCA 1UW6A 3TLTA 2YMEA 4HFDA 3EAMA 3RIFA 2XQ3A 2BG9B 5HCJA 3GUAA 5TVCA 2LKHA 4Z90A 2XZ5A 3RQUA 2BR7A 5HEGA 4ZK4A 5L47A 2Y56A 2LM2A 4TWDA 3UU6A 2BYQA 3C84A 5AINA 5LG3A 5J5FA 4QH5A 4ZZBA 2KSRA 4BFQA 3WTIA 1OEDA 3WTJA 4AFGA 2LLYA 5AFJA 4PIRA 4ZJTA
chains in the Genus database with same CATH superfamily
3EDVA 4PFPA 3U3IA 3MXZA 2Q9QA 4CI3B 1XWMA 3RRWA 2I6HA 3KVAA 3AVSA 4GIWA 1SA0E 2RP4A 1BR0A 5FXVA 4PK6A 1J1JA 1MIWA 3FXEB 3UUBA 3HKDE 5F8PA 5L4HA 3KBUA 3T8OA 5AFNA 2FJAA 4JEHB 4CXXA 4COFA 2CMRA 4JI0T 2W8GA 3EI0A 5L2LA 2BG9C 2WWUA 4F8HA 1E1HB 2XQ6A 1V9DA 3PUYF 4DV7T 3ZCJA 4DBQA 2WP9A 4UY2A 2DCFA 4IL9A 5L3CB 2JJ9A 3E22E 1IJ6A 3ZN1B 3C4WA 5LBMA 5F3JA 3RQWA 2V1DB 3GA8A 1MNDA 5KXJA 3CMLA 2YDSA 4GOUA 4UEMA 1IBKT 4PFOA 4HFDA 2BKNA 3N9MA 2XAJB 2L3LA 1KNPA 4BJMA 3J9X1 4EEDA 3KV9A 2Y48B 3A5XA 4QH5A 3K1SA 3RYHE 4JI3T 1IBLT 5CGMA 4X62T 4EV6A 5JQGE 5ABHA 2DNXA 3IEEA 2V7KA 4PW8A 3QK6A 5JRCB 1HCIA 3QOFA 2HHHT 3JADA 4CQIA 1NAFA 4JI2T 2IDOB 3ZYKA 2FJBA 1IJ5A 3W15B 4JI8T 3WTOA 5IHYA 1HG2A 2CXLA 4EZ1A 2NW7A 3AE7A 3ZDGA 2M6BA 3P4RA 3WTMA 4N78D 5AQGB 4UVCB 3GN5A 5M4YA 4ZI3D 4QXHB 4IE4A 3I0QA 3ETUA 2X0YA 3AEFA 5HEUA 1MMDA 4OFZA 3DP7A 2E9XB 5AFKA 2M6IA 4PK5A 3SFEA 2XYSA 4P0BA 3P4WA 3V5SA 3E0ZA 3FBZA 4X20E 4TUYE 1ZHCA 1Z0PA 4DO0A 2W62A 2E5LT 2N9DA 2BG9E 1WRDA 2A2FX 5AQQB 2W2UA 2VL8A 3PJAA 4BQTA 4HTEA 2XASB 3MZKB 4IIJE 2IC6A 4A56A 3NRXA 4HEAA 4BAYB 5J5FA 3NWIA 2K5BB 2WS3A 1IBMT 3UTKA 2X66A 3PE0A 2W0GA 2H3RA 3JAFA 2XAHB 3AE3A 4UM3P 3UUMA 3UFEA 4IDQA 2WSSV 5BP0A 2BBJA 2X68A 4DMWA 1MIVA 2WBLA 1OEDC 4TNWA 3QNUA 3AE4A 3PUVF 4GKJT 3B5MA 5FMNA 2YINA 2WU2A 4JUYA 4NXNT 5LJNA 4QXBB 3ZEFB 4YJ2E 3C64A 4CXYA 2QYWA 2XNUA 3UU3A 4U33A 5SYOA 2V5CA 3RI5A 2Z6EA 1D0ZA 3P4QA 3V5UA 1I9BA 4IREA 4EYYR 4OK0A 2QC1B 3N5LA 4IGUA 5ETWA 2YMDA 3PUAA 2WMNA 2OLTA 2BS2A 4LF8T 4A97A 4CI2B 4ASKA 1J5WA 4JI1T 2YDRA 2VURA 2ZLYA 2VKDA 3ANWA 3H3AA 4MHCA 5FVKA 3SWHA 1JNZA 3TLTA 4B3TT 2X51A 4KHPT 2BG9B 4UV9B 2Y56A 4YSYA 3CWZB 3PUZF 4H9OC 3ZLIA 3N9QA 1L0VA 5AFJA 5FYMA 1ZKEA 5HXEA 4HWDA 1YW0A 4MALA 4DV4T 4DR6T 4ZS2A 2Y6XA 2CWYA 5BR8T 3N2KE 4E7ZA 4DR5T 3U8KA 5DQVA 2CCQA 2KINB 3HKEE 4O2BE 3B57A 3PU3A 3L8RA 2DLRA 2WY2A 2NP9A 4TV8E 4PK4A 3KV5A 2CRBA 4EZHA 4AKIA 3F2EA 2W66A 5HEJA 2HPLA 1LVKA 4OYJA 4KMCA 3M65A 5EK4A 2ZM2A 3AA6B 3P50A 1KNZA 3O1IA 2H7OA 1WYCA 4XHEA 1Z8UA 4CN6A 4QAAA 5ABGA 3AVRA 5JVDE 3AEDA 3CQGB 3AEBA 3ZC1A 5J5GA 1YD8G 3EHZA 3HKBE 4NUUA 2H88A 4WBNE 3ZDHA 5F5WA 2YDQA 1M7KA 3FBLA 2YU1A 3Q5XA 2V7IA 4YFSA 5AQPB 3AA7B 2QRXA 2LOPA 3EAMA 2L8KA 5EZYE 4IDOA 2DI4A 4NIQA 2IAKA 4UELA 3ZT7A 4IDZA 4WW0A 5HXRA 2J1DG 1WR6A 1W0AA 4AIUA 1JNRA 4DV6T 1LVFA 3BQIA 4YHHT 4K0UA 2XAQB 5KE4A 1G8XA 3C50A 2YOEA 5L3GB 1X79A 4DR4T 3RGLA 4LF5T 2Q9QD 4AFTA 2JQQA 4HKAA 1UURA 2CLYC 4TNVA 3EVYA 2CPTA 2ZJUA 2XZ6A 4WBOA 4P09A 2X9HA 2C5KT 3FB2A 4LF4T 2MOZA 2D0TA 5JRCA 3T4MA 2I0MA 5J5HA 5AFMB 2UXBT 2BYSA 3VRBA 4WNKA 4KBMB 3WIPA 2UXDT 5AQLB 4X5TA 3N9OA 5FNVE 4UXUA 4X65T 4HE8A 2YU2A 4ZR6A 4YTNA 1XMQT 1XZYA 4EB6E 2BBHA 4CXWA 3UUXB 1U5PA 2MPKA 5HXCA 2VL0A 4QXCB 2WN9A 4H63H 3F57A 5JDQA 2WDVA 3OKQA 1OEDB 2W8FA 3QUJA 4MBQA 4EXTA 1MMAA 4LF7T 3WTKA 3JC6D 4I55E 3AE5A 2E9XA 2YMEA 1N34T 4EYUA 3MA9A 3RIUC 4UXNB 4ZS3A 4DR3T 2LKHA 4V1Av 2YK0A 3FZKB 4ZK4A 2OA5A 2WWVA 4B6XA 5J2TE 2XSBA 3IF8B 3AE8A 2VVNA 4XAXB 5CA0E 3WAJA 2WNJA 5KZUA 3X1DA 4PJLA 3CX6B 5AQVB 1D1CA 2X9XA 5LA6E 4IT4A 3LDQB 2MYSA 2XM1A 5J0ZA 4JYAT 5FL0A 3O4XE 2V8SV 1D1AA 3UULA 2IHR1 3NVOA 3AE1A 4DIDB 3L3PA 4GKKT 3T1YT 4DV0T 1W0BA 1KK7A 3OJAA 1KFYA 4JV5T 4LFAT 2UU9T 3OPCA 4WV9A 2EHOC 3AECA 4ADZA 2A3DA 2DWGA 3AAAB 4D01A 2WDRA 4U31A 2XM2A 2BR8A 4GK0E 2DWKA 5HAXA 4Z8XA 1WR0A 4LMJA 2WM9A 2I59A 2NW9A 1HS7A 1KNRA 1QSDA 1D1BA 2XQAA 1N36T 3EABA 4Z90A 1MIYA 3RQUA 2CA5A 4HGAA 4E7SA 5LG3A 1BR4A 3KVBA 4PIRA 5JTGA 3AA1B 3UQ4A 1GQEA 3BQKA 2CEAA 2PGZA 5CFBA 1SE7A 1WLXA 2BG9A 2VASA 5DQWA 2AE9A 1H7CA 4QABA 2HPJA 3U8LA 4HQPA 2JIWA 3KBTA 3ZMZB 4XZCA 1QLBA 2LRKA 2PTFA 5L3DB 5JR9C 3QC9A 4EIWA 2V26A 3B13A 3ZSSA 1I6ZA 4NPPA 2J62A 4HFIA 3NZPA 2N2NA 4L5GA 1O3XA 1HNWT 2UXCT 3WTLA 4B3MT 2D0UA 3IGQA 4ZI2D 2WZIA 5LJMA 1VCSA 3RF1A 2FJEA 4JI5T 3TLWA 2CLYB 3SQ9A 3VR8A 3SS1A 4UIGA 4B3ST 4M1PA 4YSZA 5HEGA 1YQ4A 3KV4A 4EGWA 4AKRB 2LHNA 1X9BA 3I9YA 5FY0A 2N1GA 5DJQC 3WTJA 3K3OA 3RYFE 2CHNA 1VOMA 3OYZA 3U8MA 5L4EA 3P4SA 4Q25A 1T72A 4YTPA 2W00A 5CA1E 5CB4E 4ILAA 2VVSA 4QWNB 4Z91A 5ADXL 1T98A 5HWXA 2X00D 4AQFC 1DU2A 4PJJA 2LE8A 4XK9A 4ZHQE 3VR9A 5C3JA 1UV6A 4ZZCA 5LB7B 4I43B 2HH7A 4K0KT 4HFEA 2KWHA 5JDNA 2WAUA 3AEGA 4XBFB 2WNLA 4ZI3C 2XQ9A 4C91A 2FUPA 3ZMSB 4DR1T 2R6GF 2BJ0A 4UR9A 4TWHA 5HCMA 3I1AA 4HWCA 3UU8A 3U8JA 4YSXA 4LF6T 1NWMX 5AFMA 3SOLA 4JEUB 3UUNA 4I0UA 4IHJE 4B5DA 4O8SA 2ES0A 3CX8B 4DBMA 5J5IA 2KMFA 1Y01A 3GUAA 3J7Yq 2EHOB 5TAOA 3WI3A 4ZEYA 5JDMA 2K24A 4HFVA 2BS3A 1FJGT 4YHJA 3PUGA 1OEDA 4IDPA 2IIUA 5LXTE 4GYRA 5AQFB 4AKHA 2NTYA 4OHFA 3C4XA 3O1HA 1LKXA 3D0TA 4C90A 2CBJA 4ZXLA 3TLUA 2MAWA 5AQUB 3ABVA 4ILUA 1BR2A 4KP3C 2VKOA 4AKLA 3ZT5A 5IUXA 2ZM0A 5AQRB 5HXHA 4ALXA 2X00A 4KI0F 4LFBT 2JMHA 2CXDA 3LFMA 2WMOA 4MLKA 4DV5T 1KEYA 1HG5A 2K9AA 4I4TE 2LJLA 1FMWA 2X0LB 1HTJF 3TLSA 3UT5E 2WCAA 2ACZA 3CX7B 5CO5A 2XZEA 3NRYA 3AEEA 3P7IA 4ILBA 3O1JA 2DHRA 3AAIA 4WYVA 3LK42 2Y7YA 5AFUL 3JAEA 5JR9B 4HWFA 3UU4A 3KV6A 5LXBA 1W09A 2KXPB 4P0AA 2BR7A 4TWDA 2UUAT 3MJXA 3A7MA 2E9XD 4MFRA 2P9BA 5KDMC 2L9QA 3K3QC 3PEOA 3LK3B 3DTOA 4YJ3E 3RKGA 1WYBA 3G06A 3PJAJ 4LFCT 4IE5A 3RIAA 2LSIA 5H6QB 4ZOLE 5GONE 1US7B 3GWHA 4HFCA 2K48A 3NBXX 1UGOA 1ZOYA 3AXJB 2WQYA 2Y54A 5JDFA 4DV2T 3ZN0B 2XYTA 4ERRA 2J4GA 2YKSA 3QB5A 2HN2A 3C79A 5HYAA 1XMOT 3Q2MA 1Y64B 4O2AE 3ZJ1A 1J5ET 2BVLA 4P1NA 4AQYT 3ONLC 4PNIA 4DR7T 3MK7C 4IDNA 5CJ5A 4QHOA 1S94A 1AJ3A 2PH9A 1HNXT 2LSJA 3IHRA 5LGUB 2JMKA 2YN6A 5BW2A 2JQHA 3SQ6A 2F4VT 1MMNA 5L3FB 3ZMTB 3JCFA 4JI4T 2YEVC 2HN1A 4CZZB 2BS4A 2XJ7A 4AISA 4UVBB 5FJVA 3AE9A 2XQ3A 5HCJA 3ZPOA 4X64T 5H6RB 5LMNT 4FJOA 4UF0B 2NOXA 5AQHB 4ZZBA 5AQKB 3HI2A 3SFDA 3M3ZB 4KUMB 3KFWX 4NZBA 4X1KE 3F31A 4QACA 1T7SA 2ZJVA 4CN4A 1HX1B 5EK3A 4FRRA 1U4QA 3ZMVB 2JRKA 5AFHA 4YT0A 5LGNB 4A98A 2Y8DA 4H9SE 4O4LE 2V5DA 4ZJSA 3VU7H 2NW8A 2KT9A 2ZM6T 2Y58A 3ZT6A 3OTOT 4DBRA 4O4IE 5FKYA 2WZYA 3HL6A 3CQXC 4I50E 2BYNA 1B7TA 5C2TA 4B3RT 4QKNA 3OYXA 2Q9QC 4AI6A 4H9NC 5JDGA 4FI5A 4U2ZA 2A72A 4GYSA 3PUSA 2ZMAA 3IA3A 4O4JE 3PURA 5FP3A 1I94T 2WDQA 1ZEEA 2CM0A 4IE0A 4X1YE 1NEKA 4U7IA 5L3EB 3VRAA 3NKZA 5LP6E 2LM9A 5FXXA 2W61A 3RIUA 2X9YA 3ZSTA 3LG7A 1R8IA 1UX5A 2JQ9A 2IUBA 4AKGA 2VKHA 1E2AA 2IW5B 2OV9A 3U78A 3EUHA 4NXMT 3BQLA 1YKHB 4JBWF 3A8YC 5LG4A 1XDPA 2VQET 2DL1A 3JC6C 5TVCA 5L47A 4ZI7E 3C98B 3C84A 1WFDA 4EZ4A 3N9LA 2XQ4A 3FXDB 3C51A 3LBXB 4J2CA 2BDEA 1UX4A 5AQJB 2EHOA 4A5XA 2ODVA 5LHGB 2XQ7A 2V7LA 5JH7E 2CWOA 3AEAA 3CK6A 4UM1A 4CI1B 1HF8A 2H7VC 3Q5WA 5JDLA 3WAKA 3U8NA 2ZM8A 2LOSA 4U3CA 2JQKA 5AQNB 3RYCE 1W9RA 4JI7T 2NTXA 4O4HE 2XHEB 5HXSA 2XQ8A 3FHNA 3CVRA 1N32T 4AFHA 4BA9A 4LMKA 5BRXA 2V6XA 2QVAA 5LNKA 2XPKA 1E7PA 2RPAA 1FEWA 4OX9T 3OBVE 4YXDA 2J47A 1MMGA 5L3BB 2LSKA 4ZRUA 2LT3A 2GK9A 3ZYLA 1HFAA 3SIOA 5ABFB 4DV1T 5FVLA 4QH1A 4JI6T 3L09A 4F6RC 3QB5K 3HKCE 2XUEA 3MKDA 2AXDS 3PMZA 5ABEA 4H9PC 5FXZA 5IYZE 3AE6A 2JPFA 5AQOB 3E08A 3UU6A 2BYQA 3N9NA 4AFGA 2LLYA 1D0XA 2XQ5A 3HA4A 5JR9A 2BVMA 3WTHA 1MNEA 3FZMB 4IE6A 1G73A 2PG8A 4H63V 3LK2B 1NENA 1WCRA 2XTLA 3CQCB 1VRBA 3KDSE 1YKEB 1ZP0A 4CN1A 4HN9A 2BYRA 3WTNA 3PDYA 4ZK1A 1SUMB 5KX5E 3RKOA 4OYKA 2A9UA 1IAPA 3PU8A 2CHOA 4TWFA 2BKOA 4WZXA 2NR4A 5JREA 5LHHB 3VKGA 5AQMB 3FZHB 4UM3A 2Y57A 1XDOA 2CBIA 2H89A 3AXJA 2VWAA 2K3WA 2B76A 3P8CD 2LKGA 1S35A 5A1LA 3L39A 4NUVA 5FXWA 4IL4A 1D0YA 2B1EA 4ZI2C 4YY3T 2V6YB 4HWHA 3O9XA 3PUQA 1FMVA 4EAHA 2X0HA 4LF9T 4X1IE 3ZC0A 2Q9QB 2RA1A 5E0OA 2D2SA 4G2AA 1UW6A 3RIFA 3Q5DA 5LOVE 2VQFT 2V7JA 2KNDA 1HX8A 3WTIA 2IC9A 5FL1A 5AFLA 2XNVA 2ODUA 1UX2A 2VKJA 4AQFA 2WU5A 5J1GA 3K8PC 4L9IA 4DNDA 2UZ6A 3VHLA 1OWAA 3RC8A 5LYJE 5AQSB 2D5UA 3AB3B 2C5IT 2KLQA 4UF0A 1QUUA 4QX7B 1XNQT 2W67A 5HEOA 4PAGA 4KX6A 4H9RC 4PJMA 2E8IA 4YTMA 3FZFB 4JLEA 3MACA 3RRCA 3DJBA 5LCYA 3SH1A 4X66T 3GMIA 2XSAA 4HFBA 4PJNA 4BJNA 1XNRT 2MBGA 3ZJ2A 1KF6A 4GK5E 3I9WA 2SPCA 3PUWF 1HR0T 3PV0F 3ZKRA 4L0RA 2X67A 3PTRB 4DR2T 3KINB 3UU5A 2QA7A 3R84B 3CKDA 1EZ3A 2LHRA 2XQYA 5BMVE 1VCTA 4IE7A 2ACXA 1UUSA 5AINA 3ESLA 3ONJA 4U7YA 2IMLA 2PBIA 4U74A 4AQGA 3FZLB 2E5VA 1LRZA 4TV9E 2UXNB 2LEHA 3ZCIA 3EDUA 2C5JA 3GN5B 3BK9A 3H3MA 5J2UE 2WNCA 3RH3A 4TN7B 5HWYA 3RPUA 5LBQB 4UV8B 2W63A 1IZNB 3RYIE 3TLVA 1OXZA 1OEDE 2FBWA 4AXPA 2CXFA 2C9TA 1FIOA 3AAEB 4UM3S 2KWIB 3N2OA 3LBXA 2E2AA 3N2GE 2UUBT 3Q9DA 2NWBA 2LSYA 2BKPA 2MTQA 4G63A 4ISTA 4HFHA 5LMUT 2X9WA 2VB6A 4QH4A 2BZBA 2CE7A 2VK9A 1T8BA 5FY7A 2G0UA 1UK5A 3LSVA 3SRZA 4DUYT 3UFGA 1N33T 3AE2A 3NZQA 1YXRA 2XAGB 3CIRA 3OVUA 1BR1A 5JDHA 4ANJA 4U2YA 3P4PA 3H37A 2FJDA 4ILCA 4DUZT 3HR0A 3I0OA 3R6NA 5ABFA 3LJCA 5AQIB 2KSRA 4BFQA 2UUCT 1UCUA 2LRLA 4ZJTA 5HEHA 5IWAT 5LGTB 4EOZB 3UQ7A 2E9XC 3Q5EA 4QX8B 2KZ7B 1CHUA 3ONXA 2WB5A 3K3NA 4HWIB 4LMLA 5C8YE 3T1HT 1SHZC 1HNZT 4TZ4C 5EK2A 3AA0B 5DABA 4U72A 2EHOD 3TKLB 3ETVA 4H9QC 5JMEA 4EEBA 3RC3A 3CPZA 2XAFB 5AQTB 2PFVA 1M62A 2W4XA 2WZHA 2XNTA 2M67A 3ZMUB 3PUXF 3ANWB 1ZV4X 3C4ZA 4YLHA 4DMVA 3S4UA 2D9DA 4DV3T 5FY1A 3RHWA 4TX5A 5LHIB 3N9PA 1YQ3A 2BYPA 1CUNA 4ISSA 2C0SA 5KMGP 2UXXB 3ZYMA 4DVDA 2XY8B 2V7MA 3RX6A 3RLFF 2XZ5A 2QGSA 3IBPA 2LM2A 2PJQA 3VKHA 2LSGA 2V6YA 4KHZF 4UVAB
chains in the Genus database with same CATH topology
5HEHA 4NZBA 2XQ5A 2XNVA 3PEOA 4QACA 1UX2A 2ZJVA 2XQ4A 3UQ4A 3WTHA 3UQ7A 4FRRA 3U8MA 2PGZA 3JAFA 3RIAA 5L4EA 2UZ6A 5CFBA 5AFHA 5KE4A 4A98A 4UM3P 2BG9A 2YOEA 2WNJA 4QABA 4HFCA 3UUBA 3JADA 4ZJSA 4LMLA 5KZUA 2XQ7A 5BP0A 2WNCA 4ILAA 3TLUA 3U8LA 3U8KA 4Z91A 4UM1A 4HQPA 2Y58A 2MAWA 5L4HA 2BYRA 3WTNA 5HEOA 4AFTA 1OEDC 2WZYA 4ZK1A 5J0ZA 4TNWA 3WTOA 5AFNA 2BYNA 4TNVA 2X00D 3TLVA 3U8NA 1OEDE 2Y54A 2ZJUA 2XZ6A 2XYTA 5IUXA 5HEJA 2C9TA 4EZ1A 5JMEA 4UM3S 4COFA 4XK9A 4NPPA 3ZDGA 2M6BA 3WTMA 2YKSA 2W8GA 4TWFA 3EI0A 3T4MA 2BG9C 2X00A 4ALXA 4F8HA 5AFLA 4WV9A 2XQ8A 4AFHA 5J5HA 1UV6A 4HFIA 4LMKA 5BRXA 3C79A 5AFMB 4ZZCA 2XQ6A 3SH1A 2BYSA 3P50A 4HFBA 4UM3A 4D01A 2XNUA 2Y57A 3UU3A 4HFEA 3TLSA 2XNTA 5HEUA 3WIPA 5SYOA 4X5TA 4UXUA 5CO5A 2WNLA 3RI5A 4ZRUA 2XQ9A 4HFHA 4XHEA 3WTLA 4QH4A 4ZR6A 4UY2A 4QAAA 5AFKA 4IL9A 2LKGA 2M6IA 4ILBA 2BR8A 2BJ0A 3IGQA 3SIOA 2XYSA 4TWHA 1I9BA 3P4WA 4IREA 4QH1A 5HCMA 2QC1B 5J5GA 2VL0A 3LSVA 2WN9A 3EHZA 3UU8A 3U8JA 4LMJA 3ZKRA 2YMDA 4IL4A 2PH9A 5AFMA 3ZDHA 4A97A 3RQWA 1OEDB 2W8FA 2YN6A 2BG9E 3RHWA 4B5DA 5BW2A 2Y7YA 3TLWA 3SQ6A 3PMZA 3WTKA 3SQ9A 4DBMA 3UU5A 4BQTA 3JAEA 2BYPA 3UU4A 5LXBA 5J5IA 5FJVA 2XQAA 4ILCA 1UW6A 3TLTA 2YMEA 4HFDA 3EAMA 3RIFA 2XQ3A 2BG9B 5HCJA 3GUAA 5TVCA 2LKHA 4Z90A 2XZ5A 3RQUA 2BR7A 5HEGA 4ZK4A 5L47A 2Y56A 2LM2A 4TWDA 3UU6A 2BYQA 3C84A 5AINA 5LG3A 5J5FA 4QH5A 4ZZBA 2KSRA 4BFQA 3WTIA 1OEDA 3WTJA 4AFGA 2LLYA 5AFJA 4PIRA 4ZJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEH A;  4NZB A;  2XQ5 A;  2XNV A;  3PEO A;  4QAC A;  1UX2 A;  2ZJV A;  2XQ4 A;  3UQ4 A;  3WTH A;  3UQ7 A;  4FRR A;  3U8M A;  2PGZ A;  3JAF A;  3RIA A;  5L4E A;  2UZ6 A;  5CFB A;  5AFH A;  5KE4 A;  4A98 A;  4UM3 P;  2BG9 A;  2YOE A;  2WNJ A;  4QAB A;  4HFC A;  3UUB A;  3JAD A;  4ZJS A;  4LML A;  5KZU A;  2XQ7 A;  5BP0 A;  2WNC A;  4ILA A;  3TLU A;  3U8L A;  3U8K A;  4Z91 A;  4UM1 A;  4HQP A;  2Y58 A;  2MAW A;  5L4H A;  2BYR A;  3WTN A;  5HEO A;  4AFT A;  1OED C;  2WZY A;  4ZK1 A;  5J0Z A;  4TNW A;  3WTO A;  5AFN A;  2BYN A;  4TNV A;  2X00 D;  3TLV A;  3U8N A;  1OED E;  2Y54 A;  2ZJU A;  2XZ6 A;  2XYT A;  5IUX A;  5HEJ A;  2C9T A;  4EZ1 A;  5JME A;  4UM3 S;  4COF A;  4XK9 A;  4NPP A;  3ZDG A;  2M6B A;  3WTM A;  2YKS A;  2W8G A;  4TWF A;  3EI0 A;  3T4M A;  2BG9 C;  2X00 A;  4ALX A;  4F8H A;  5AFL A;  4WV9 A;  2XQ8 A;  4AFH A;  5J5H A;  1UV6 A;  4HFI A;  4LMK A;  5BRX A;  3C79 A;  5AFM B;  4ZZC A;  2XQ6 A;  3SH1 A;  2BYS A;  3P50 A;  4HFB A;  4UM3 A;  4D01 A;  2XNU A;  2Y57 A;  3UU3 A;  4HFE A;  3TLS A;  2XNT A;  5HEU A;  3WIP A;  5SYO A;  4X5T A;  4UXU A;  5CO5 A;  2WNL A;  3RI5 A;  4ZRU A;  2XQ9 A;  4HFH A;  4XHE A;  3WTL A;  4QH4 A;  4ZR6 A;  4UY2 A;  4QAA A;  5AFK A;  4IL9 A;  2LKG A;  2M6I A;  4ILB A;  2BR8 A;  2BJ0 A;  3IGQ A;  3SIO A;  2XYS A;  4TWH A;  1I9B A;  3P4W A;  4IRE A;  4QH1 A;  5HCM A;  2QC1 B;  5J5G A;  2VL0 A;  3LSV A;  2WN9 A;  3EHZ A;  3UU8 A;  3U8J A;  4LMJ A;  3ZKR A;  2YMD A;  4IL4 A;  2PH9 A;  5AFM A;  3ZDH A;  4A97 A;  3RQW A;  1OED B;  2W8F A;  2YN6 A;  2BG9 E;  3RHW A;  4B5D A;  5BW2 A;  2Y7Y A;  3TLW A;  3SQ6 A;  3PMZ A;  3WTK A;  3SQ9 A;  4DBM A;  3UU5 A;  4BQT A;  3JAE A;  2BYP A;  3UU4 A;  5LXB A;  5J5I A;  5FJV A;  2XQA A;  4ILC A;  1UW6 A;  3TLT A;  2YME A;  4HFD A;  3EAM A;  3RIF A;  2XQ3 A;  2BG9 B;  5HCJ A;  3GUA A;  5TVC A;  2LKH A;  4Z90 A;  2XZ5 A;  3RQU A;  2BR7 A;  5HEG A;  4ZK4 A;  5L47 A;  2Y56 A;  2LM2 A;  4TWD A;  3UU6 A;  2BYQ A;  3C84 A;  5AIN A;  5LG3 A;  5J5F A;  4QH5 A;  4ZZB A;  2KSR A;  4BFQ A;  3WTI A;  1OED A;  3WTJ A;  4AFG A;  2LLY A;  5AFJ A;  4PIR A;  4ZJT A; 
#chains in the Genus database with same CATH topology
 3EDV A;  4PFP A;  3U3I A;  3MXZ A;  2Q9Q A;  4CI3 B;  1XWM A;  3RRW A;  2I6H A;  3KVA A;  3AVS A;  4GIW A;  1SA0 E;  2RP4 A;  1BR0 A;  5FXV A;  4PK6 A;  1J1J A;  1MIW A;  3FXE B;  3UUB A;  3HKD E;  5F8P A;  5L4H A;  3KBU A;  3T8O A;  5AFN A;  2FJA A;  4JEH B;  4CXX A;  4COF A;  2CMR A;  4JI0 T;  2W8G A;  3EI0 A;  5L2L A;  2BG9 C;  2WWU A;  4F8H A;  1E1H B;  2XQ6 A;  1V9D A;  3PUY F;  4DV7 T;  3ZCJ A;  4DBQ A;  2WP9 A;  4UY2 A;  2DCF A;  4IL9 A;  5L3C B;  2JJ9 A;  3E22 E;  1IJ6 A;  3ZN1 B;  3C4W A;  5LBM A;  5F3J A;  3RQW A;  2V1D B;  3GA8 A;  1MND A;  5KXJ A;  3CML A;  2YDS A;  4GOU A;  4UEM A;  1IBK T;  4PFO A;  4HFD A;  2BKN A;  3N9M A;  2XAJ B;  2L3L A;  1KNP A;  4BJM A;  3J9X 1;  4EED A;  3KV9 A;  2Y48 B;  3A5X A;  4QH5 A;  3K1S A;  3RYH E;  4JI3 T;  1IBL T;  5CGM A;  4X62 T;  4EV6 A;  5JQG E;  5ABH A;  2DNX A;  3IEE A;  2V7K A;  4PW8 A;  3QK6 A;  5JRC B;  1HCI A;  3QOF A;  2HHH T;  3JAD A;  4CQI A;  1NAF A;  4JI2 T;  2IDO B;  3ZYK A;  2FJB A;  1IJ5 A;  3W15 B;  4JI8 T;  3WTO A;  5IHY A;  1HG2 A;  2CXL A;  4EZ1 A;  2NW7 A;  3AE7 A;  3ZDG A;  2M6B A;  3P4R A;  3WTM A;  4N78 D;  5AQG B;  4UVC B;  3GN5 A;  5M4Y A;  4ZI3 D;  4QXH B;  4IE4 A;  3I0Q A;  3ETU A;  2X0Y A;  3AEF A;  5HEU A;  1MMD A;  4OFZ A;  3DP7 A;  2E9X B;  5AFK A;  2M6I A;  4PK5 A;  3SFE A;  2XYS A;  4P0B A;  3P4W A;  3V5S A;  3E0Z A;  3FBZ A;  4X20 E;  4TUY E;  1ZHC A;  1Z0P A;  4DO0 A;  2W62 A;  2E5L T;  2N9D A;  2BG9 E;  1WRD A;  2A2F X;  5AQQ B;  2W2U A;  2VL8 A;  3PJA A;  4BQT A;  4HTE A;  2XAS B;  3MZK B;  4IIJ E;  2IC6 A;  4A56 A;  3NRX A;  4HEA A;  4BAY B;  5J5F A;  3NWI A;  2K5B B;  2WS3 A;  1IBM T;  3UTK A;  2X66 A;  3PE0 A;  2W0G A;  2H3R A;  3JAF A;  2XAH B;  3AE3 A;  4UM3 P;  3UUM A;  3UFE A;  4IDQ A;  2WSS V;  5BP0 A;  2BBJ A;  2X68 A;  4DMW A;  1MIV A;  2WBL A;  1OED C;  4TNW A;  3QNU A;  3AE4 A;  3PUV F;  4GKJ T;  3B5M A;  5FMN A;  2YIN A;  2WU2 A;  4JUY A;  4NXN T;  5LJN A;  4QXB B;  3ZEF B;  4YJ2 E;  3C64 A;  4CXY A;  2QYW A;  2XNU A;  3UU3 A;  4U33 A;  5SYO A;  2V5C A;  3RI5 A;  2Z6E A;  1D0Z A;  3P4Q A;  3V5U A;  1I9B A;  4IRE A;  4EYY R;  4OK0 A;  2QC1 B;  3N5L A;  4IGU A;  5ETW A;  2YMD A;  3PUA A;  2WMN A;  2OLT A;  2BS2 A;  4LF8 T;  4A97 A;  4CI2 B;  4ASK A;  1J5W A;  4JI1 T;  2YDR A;  2VUR A;  2ZLY A;  2VKD A;  3ANW A;  3H3A A;  4MHC A;  5FVK A;  3SWH A;  1JNZ A;  3TLT A;  4B3T T;  2X51 A;  4KHP T;  2BG9 B;  4UV9 B;  2Y56 A;  4YSY A;  3CWZ B;  3PUZ F;  4H9O C;  3ZLI A;  3N9Q A;  1L0V A;  5AFJ A;  5FYM A;  1ZKE A;  5HXE A;  4HWD A;  1YW0 A;  4MAL A;  4DV4 T;  4DR6 T;  4ZS2 A;  2Y6X A;  2CWY A;  5BR8 T;  3N2K E;  4E7Z A;  4DR5 T;  3U8K A;  5DQV A;  2CCQ A;  2KIN B;  3HKE E;  4O2B E;  3B57 A;  3PU3 A;  3L8R A;  2DLR A;  2WY2 A;  2NP9 A;  4TV8 E;  4PK4 A;  3KV5 A;  2CRB A;  4EZH A;  4AKI A;  3F2E A;  2W66 A;  5HEJ A;  2HPL A;  1LVK A;  4OYJ A;  4KMC A;  3M65 A;  5EK4 A;  2ZM2 A;  3AA6 B;  3P50 A;  1KNZ A;  3O1I A;  2H7O A;  1WYC A;  4XHE A;  1Z8U A;  4CN6 A;  4QAA A;  5ABG A;  3AVR A;  5JVD E;  3AED A;  3CQG B;  3AEB A;  3ZC1 A;  5J5G A;  1YD8 G;  3EHZ A;  3HKB E;  4NUU A;  2H88 A;  4WBN E;  3ZDH A;  5F5W A;  2YDQ A;  1M7K A;  3FBL A;  2YU1 A;  3Q5X A;  2V7I A;  4YFS A;  5AQP B;  3AA7 B;  2QRX A;  2LOP A;  3EAM A;  2L8K A;  5EZY E;  4IDO A;  2DI4 A;  4NIQ A;  2IAK A;  4UEL A;  3ZT7 A;  4IDZ A;  4WW0 A;  5HXR A;  2J1D G;  1WR6 A;  1W0A A;  4AIU A;  1JNR A;  4DV6 T;  1LVF A;  3BQI A;  4YHH T;  4K0U A;  2XAQ B;  5KE4 A;  1G8X A;  3C50 A;  2YOE A;  5L3G B;  1X79 A;  4DR4 T;  3RGL A;  4LF5 T;  2Q9Q D;  4AFT A;  2JQQ A;  4HKA A;  1UUR A;  2CLY C;  4TNV A;  3EVY A;  2CPT A;  2ZJU A;  2XZ6 A;  4WBO A;  4P09 A;  2X9H A;  2C5K T;  3FB2 A;  4LF4 T;  2MOZ A;  2D0T A;  5JRC A;  3T4M A;  2I0M A;  5J5H A;  5AFM B;  2UXB T;  2BYS A;  3VRB A;  4WNK A;  4KBM B;  3WIP A;  2UXD T;  5AQL B;  4X5T A;  3N9O A;  5FNV E;  4UXU A;  4X65 T;  4HE8 A;  2YU2 A;  4ZR6 A;  4YTN A;  1XMQ T;  1XZY A;  4EB6 E;  2BBH A;  4CXW A;  3UUX B;  1U5P A;  2MPK A;  5HXC A;  2VL0 A;  4QXC B;  2WN9 A;  4H63 H;  3F57 A;  5JDQ A;  2WDV A;  3OKQ A;  1OED B;  2W8F A;  3QUJ A;  4MBQ A;  4EXT A;  1MMA A;  4LF7 T;  3WTK A;  3JC6 D;  4I55 E;  3AE5 A;  2E9X A;  2YME A;  1N34 T;  4EYU A;  3MA9 A;  3RIU C;  4UXN B;  4ZS3 A;  4DR3 T;  2LKH A;  4V1A v;  2YK0 A;  3FZK B;  4ZK4 A;  2OA5 A;  2WWV A;  4B6X A;  5J2T E;  2XSB A;  3IF8 B;  3AE8 A;  2VVN A;  4XAX B;  5CA0 E;  3WAJ A;  2WNJ A;  5KZU A;  3X1D A;  4PJL A;  3CX6 B;  5AQV B;  1D1C A;  2X9X A;  5LA6 E;  4IT4 A;  3LDQ B;  2MYS A;  2XM1 A;  5J0Z A;  4JYA T;  5FL0 A;  3O4X E;  2V8S V;  1D1A A;  3UUL A;  2IHR 1;  3NVO A;  3AE1 A;  4DID B;  3L3P A;  4GKK T;  3T1Y T;  4DV0 T;  1W0B A;  1KK7 A;  3OJA A;  1KFY A;  4JV5 T;  4LFA T;  2UU9 T;  3OPC A;  4WV9 A;  2EHO C;  3AEC A;  4ADZ A;  2A3D A;  2DWG A;  3AAA B;  4D01 A;  2WDR A;  4U31 A;  2XM2 A;  2BR8 A;  4GK0 E;  2DWK A;  5HAX A;  4Z8X A;  1WR0 A;  4LMJ A;  2WM9 A;  2I59 A;  2NW9 A;  1HS7 A;  1KNR A;  1QSD A;  1D1B A;  2XQA A;  1N36 T;  3EAB A;  4Z90 A;  1MIY A;  3RQU A;  2CA5 A;  4HGA A;  4E7S A;  5LG3 A;  1BR4 A;  3KVB A;  4PIR A;  5JTG A;  3AA1 B;  3UQ4 A;  1GQE A;  3BQK A;  2CEA A;  2PGZ A;  5CFB A;  1SE7 A;  1WLX A;  2BG9 A;  2VAS A;  5DQW A;  2AE9 A;  1H7C A;  4QAB A;  2HPJ A;  3U8L A;  4HQP A;  2JIW A;  3KBT A;  3ZMZ B;  4XZC A;  1QLB A;  2LRK A;  2PTF A;  5L3D B;  5JR9 C;  3QC9 A;  4EIW A;  2V26 A;  3B13 A;  3ZSS A;  1I6Z A;  4NPP A;  2J62 A;  4HFI A;  3NZP A;  2N2N A;  4L5G A;  1O3X A;  1HNW T;  2UXC T;  3WTL A;  4B3M T;  2D0U A;  3IGQ A;  4ZI2 D;  2WZI A;  5LJM A;  1VCS A;  3RF1 A;  2FJE A;  4JI5 T;  3TLW A;  2CLY B;  3SQ9 A;  3VR8 A;  3SS1 A;  4UIG A;  4B3S T;  4M1P A;  4YSZ A;  5HEG A;  1YQ4 A;  3KV4 A;  4EGW A;  4AKR B;  2LHN A;  1X9B A;  3I9Y A;  5FY0 A;  2N1G A;  5DJQ C;  3WTJ A;  3K3O A;  3RYF E;  2CHN A;  1VOM A;  3OYZ A;  3U8M A;  5L4E A;  3P4S A;  4Q25 A;  1T72 A;  4YTP A;  2W00 A;  5CA1 E;  5CB4 E;  4ILA A;  2VVS A;  4QWN B;  4Z91 A;  5ADX L;  1T98 A;  5HWX A;  2X00 D;  4AQF C;  1DU2 A;  4PJJ A;  2LE8 A;  4XK9 A;  4ZHQ E;  3VR9 A;  5C3J A;  1UV6 A;  4ZZC A;  5LB7 B;  4I43 B;  2HH7 A;  4K0K T;  4HFE A;  2KWH A;  5JDN A;  2WAU A;  3AEG A;  4XBF B;  2WNL A;  4ZI3 C;  2XQ9 A;  4C91 A;  2FUP A;  3ZMS B;  4DR1 T;  2R6G F;  2BJ0 A;  4UR9 A;  4TWH A;  5HCM A;  3I1A A;  4HWC A;  3UU8 A;  3U8J A;  4YSX A;  4LF6 T;  1NWM X;  5AFM A;  3SOL A;  4JEU B;  3UUN A;  4I0U A;  4IHJ E;  4B5D A;  4O8S A;  2ES0 A;  3CX8 B;  4DBM A;  5J5I A;  2KMF A;  1Y01 A;  3GUA A;  3J7Y q;  2EHO B;  5TAO A;  3WI3 A;  4ZEY A;  5JDM A;  2K24 A;  4HFV A;  2BS3 A;  1FJG T;  4YHJ A;  3PUG A;  1OED A;  4IDP A;  2IIU A;  5LXT E;  4GYR A;  5AQF B;  4AKH A;  2NTY A;  4OHF A;  3C4X A;  3O1H A;  1LKX A;  3D0T A;  4C90 A;  2CBJ A;  4ZXL A;  3TLU A;  2MAW A;  5AQU B;  3ABV A;  4ILU A;  1BR2 A;  4KP3 C;  2VKO A;  4AKL A;  3ZT5 A;  5IUX A;  2ZM0 A;  5AQR B;  5HXH A;  4ALX A;  2X00 A;  4KI0 F;  4LFB T;  2JMH A;  2CXD A;  3LFM A;  2WMO A;  4MLK A;  4DV5 T;  1KEY A;  1HG5 A;  2K9A A;  4I4T E;  2LJL A;  1FMW A;  2X0L B;  1HTJ F;  3TLS A;  3UT5 E;  2WCA A;  2ACZ A;  3CX7 B;  5CO5 A;  2XZE A;  3NRY A;  3AEE A;  3P7I A;  4ILB A;  3O1J A;  2DHR A;  3AAI A;  4WYV A;  3LK4 2;  2Y7Y A;  5AFU L;  3JAE A;  5JR9 B;  4HWF A;  3UU4 A;  3KV6 A;  5LXB A;  1W09 A;  2KXP B;  4P0A A;  2BR7 A;  4TWD A;  2UUA T;  3MJX A;  3A7M A;  2E9X D;  4MFR A;  2P9B A;  5KDM C;  2L9Q A;  3K3Q C;  3PEO A;  3LK3 B;  3DTO A;  4YJ3 E;  3RKG A;  1WYB A;  3G06 A;  3PJA J;  4LFC T;  4IE5 A;  3RIA A;  2LSI A;  5H6Q B;  4ZOL E;  5GON E;  1US7 B;  3GWH A;  4HFC A;  2K48 A;  3NBX X;  1UGO A;  1ZOY A;  3AXJ B;  2WQY A;  2Y54 A;  5JDF A;  4DV2 T;  3ZN0 B;  2XYT A;  4ERR A;  2J4G A;  2YKS A;  3QB5 A;  2HN2 A;  3C79 A;  5HYA A;  1XMO T;  3Q2M A;  1Y64 B;  4O2A E;  3ZJ1 A;  1J5E T;  2BVL A;  4P1N A;  4AQY T;  3ONL C;  4PNI A;  4DR7 T;  3MK7 C;  4IDN A;  5CJ5 A;  4QHO A;  1S94 A;  1AJ3 A;  2PH9 A;  1HNX T;  2LSJ A;  3IHR A;  5LGU B;  2JMK A;  2YN6 A;  5BW2 A;  2JQH A;  3SQ6 A;  2F4V T;  1MMN A;  5L3F B;  3ZMT B;  3JCF A;  4JI4 T;  2YEV C;  2HN1 A;  4CZZ B;  2BS4 A;  2XJ7 A;  4AIS A;  4UVB B;  5FJV A;  3AE9 A;  2XQ3 A;  5HCJ A;  3ZPO A;  4X64 T;  5H6R B;  5LMN T;  4FJO A;  4UF0 B;  2NOX A;  5AQH B;  4ZZB A;  5AQK B;  3HI2 A;  3SFD A;  3M3Z B;  4KUM B;  3KFW X;  4NZB A;  4X1K E;  3F31 A;  4QAC A;  1T7S A;  2ZJV A;  4CN4 A;  1HX1 B;  5EK3 A;  4FRR A;  1U4Q A;  3ZMV B;  2JRK A;  5AFH A;  4YT0 A;  5LGN B;  4A98 A;  2Y8D A;  4H9S E;  4O4L E;  2V5D A;  4ZJS A;  3VU7 H;  2NW8 A;  2KT9 A;  2ZM6 T;  2Y58 A;  3ZT6 A;  3OTO T;  4DBR A;  4O4I E;  5FKY A;  2WZY A;  3HL6 A;  3CQX C;  4I50 E;  2BYN A;  1B7T A;  5C2T A;  4B3R T;  4QKN A;  3OYX A;  2Q9Q C;  4AI6 A;  4H9N C;  5JDG A;  4FI5 A;  4U2Z A;  2A72 A;  4GYS A;  3PUS A;  2ZMA A;  3IA3 A;  4O4J E;  3PUR A;  5FP3 A;  1I94 T;  2WDQ A;  1ZEE A;  2CM0 A;  4IE0 A;  4X1Y E;  1NEK A;  4U7I A;  5L3E B;  3VRA A;  3NKZ A;  5LP6 E;  2LM9 A;  5FXX A;  2W61 A;  3RIU A;  2X9Y A;  3ZST A;  3LG7 A;  1R8I A;  1UX5 A;  2JQ9 A;  2IUB A;  4AKG A;  2VKH A;  1E2A A;  2IW5 B;  2OV9 A;  3U78 A;  3EUH A;  4NXM T;  3BQL A;  1YKH B;  4JBW F;  3A8Y C;  5LG4 A;  1XDP A;  2VQE T;  2DL1 A;  3JC6 C;  5TVC A;  5L47 A;  4ZI7 E;  3C98 B;  3C84 A;  1WFD A;  4EZ4 A;  3N9L A;  2XQ4 A;  3FXD B;  3C51 A;  3LBX B;  4J2C A;  2BDE A;  1UX4 A;  5AQJ B;  2EHO A;  4A5X A;  2ODV A;  5LHG B;  2XQ7 A;  2V7L A;  5JH7 E;  2CWO A;  3AEA A;  3CK6 A;  4UM1 A;  4CI1 B;  1HF8 A;  2H7V C;  3Q5W A;  5JDL A;  3WAK A;  3U8N A;  2ZM8 A;  2LOS A;  4U3C A;  2JQK A;  5AQN B;  3RYC E;  1W9R A;  4JI7 T;  2NTX A;  4O4H E;  2XHE B;  5HXS A;  2XQ8 A;  3FHN A;  3CVR A;  1N32 T;  4AFH A;  4BA9 A;  4LMK A;  5BRX A;  2V6X A;  2QVA A;  5LNK A;  2XPK A;  1E7P A;  2RPA A;  1FEW A;  4OX9 T;  3OBV E;  4YXD A;  2J47 A;  1MMG A;  5L3B B;  2LSK A;  4ZRU A;  2LT3 A;  2GK9 A;  3ZYL A;  1HFA A;  3SIO A;  5ABF B;  4DV1 T;  5FVL A;  4QH1 A;  4JI6 T;  3L09 A;  4F6R C;  3QB5 K;  3HKC E;  2XUE A;  3MKD A;  2AXD S;  3PMZ A;  5ABE A;  4H9P C;  5FXZ A;  5IYZ E;  3AE6 A;  2JPF A;  5AQO B;  3E08 A;  3UU6 A;  2BYQ A;  3N9N A;  4AFG A;  2LLY A;  1D0X A;  2XQ5 A;  3HA4 A;  5JR9 A;  2BVM A;  3WTH A;  1MNE A;  3FZM B;  4IE6 A;  1G73 A;  2PG8 A;  4H63 V;  3LK2 B;  1NEN A;  1WCR A;  2XTL A;  3CQC B;  1VRB A;  3KDS E;  1YKE B;  1ZP0 A;  4CN1 A;  4HN9 A;  2BYR A;  3WTN A;  3PDY A;  4ZK1 A;  1SUM B;  5KX5 E;  3RKO A;  4OYK A;  2A9U A;  1IAP A;  3PU8 A;  2CHO A;  4TWF A;  2BKO A;  4WZX A;  2NR4 A;  5JRE A;  5LHH B;  3VKG A;  5AQM B;  3FZH B;  4UM3 A;  2Y57 A;  1XDO A;  2CBI A;  2H89 A;  3AXJ A;  2VWA A;  2K3W A;  2B76 A;  3P8C D;  2LKG A;  1S35 A;  5A1L A;  3L39 A;  4NUV A;  5FXW A;  4IL4 A;  1D0Y A;  2B1E A;  4ZI2 C;  4YY3 T;  2V6Y B;  4HWH A;  3O9X A;  3PUQ A;  1FMV A;  4EAH A;  2X0H A;  4LF9 T;  4X1I E;  3ZC0 A;  2Q9Q B;  2RA1 A;  5E0O A;  2D2S A;  4G2A A;  1UW6 A;  3RIF A;  3Q5D A;  5LOV E;  2VQF T;  2V7J A;  2KND A;  1HX8 A;  3WTI A;  2IC9 A;  5FL1 A;  5AFL A;  2XNV A;  2ODU A;  1UX2 A;  2VKJ A;  4AQF A;  2WU5 A;  5J1G A;  3K8P C;  4L9I A;  4DND A;  2UZ6 A;  3VHL A;  1OWA A;  3RC8 A;  5LYJ E;  5AQS B;  2D5U A;  3AB3 B;  2C5I T;  2KLQ A;  4UF0 A;  1QUU A;  4QX7 B;  1XNQ T;  2W67 A;  5HEO A;  4PAG A;  4KX6 A;  4H9R C;  4PJM A;  2E8I A;  4YTM A;  3FZF B;  4JLE A;  3MAC A;  3RRC A;  3DJB A;  5LCY A;  3SH1 A;  4X66 T;  3GMI A;  2XSA A;  4HFB A;  4PJN A;  4BJN A;  1XNR T;  2MBG A;  3ZJ2 A;  1KF6 A;  4GK5 E;  3I9W A;  2SPC A;  3PUW F;  1HR0 T;  3PV0 F;  3ZKR A;  4L0R A;  2X67 A;  3PTR B;  4DR2 T;  3KIN B;  3UU5 A;  2QA7 A;  3R84 B;  3CKD A;  1EZ3 A;  2LHR A;  2XQY A;  5BMV E;  1VCT A;  4IE7 A;  2ACX A;  1UUS A;  5AIN A;  3ESL A;  3ONJ A;  4U7Y A;  2IML A;  2PBI A;  4U74 A;  4AQG A;  3FZL B;  2E5V A;  1LRZ A;  4TV9 E;  2UXN B;  2LEH A;  3ZCI A;  3EDU A;  2C5J A;  3GN5 B;  3BK9 A;  3H3M A;  5J2U E;  2WNC A;  3RH3 A;  4TN7 B;  5HWY A;  3RPU A;  5LBQ B;  4UV8 B;  2W63 A;  1IZN B;  3RYI E;  3TLV A;  1OXZ A;  1OED E;  2FBW A;  4AXP A;  2CXF A;  2C9T A;  1FIO A;  3AAE B;  4UM3 S;  2KWI B;  3N2O A;  3LBX A;  2E2A A;  3N2G E;  2UUB T;  3Q9D A;  2NWB A;  2LSY A;  2BKP A;  2MTQ A;  4G63 A;  4IST A;  4HFH A;  5LMU T;  2X9W A;  2VB6 A;  4QH4 A;  2BZB A;  2CE7 A;  2VK9 A;  1T8B A;  5FY7 A;  2G0U A;  1UK5 A;  3LSV A;  3SRZ A;  4DUY T;  3UFG A;  1N33 T;  3AE2 A;  3NZQ A;  1YXR A;  2XAG B;  3CIR A;  3OVU A;  1BR1 A;  5JDH A;  4ANJ A;  4U2Y A;  3P4P A;  3H37 A;  2FJD A;  4ILC A;  4DUZ T;  3HR0 A;  3I0O A;  3R6N A;  5ABF A;  3LJC A;  5AQI B;  2KSR A;  4BFQ A;  2UUC T;  1UCU A;  2LRL A;  4ZJT A;  5HEH A;  5IWA T;  5LGT B;  4EOZ B;  3UQ7 A;  2E9X C;  3Q5E A;  4QX8 B;  2KZ7 B;  1CHU A;  3ONX A;  2WB5 A;  3K3N A;  4HWI B;  4LML A;  5C8Y E;  3T1H T;  1SHZ C;  1HNZ T;  4TZ4 C;  5EK2 A;  3AA0 B;  5DAB A;  4U72 A;  2EHO D;  3TKL B;  3ETV A;  4H9Q C;  5JME A;  4EEB A;  3RC3 A;  3CPZ A;  2XAF B;  5AQT B;  2PFV A;  1M62 A;  2W4X A;  2WZH A;  2XNT A;  2M67 A;  3ZMU B;  3PUX F;  3ANW B;  1ZV4 X;  3C4Z A;  4YLH A;  4DMV A;  3S4U A;  2D9D A;  4DV3 T;  5FY1 A;  3RHW A;  4TX5 A;  5LHI B;  3N9P A;  1YQ3 A;  2BYP A;  1CUN A;  4ISS A;  2C0S A;  5KMG P;  2UXX B;  3ZYM A;  4DVD A;  2XY8 B;  2V7M A;  3RX6 A;  3RLF F;  2XZ5 A;  2QGS A;  3IBP A;  2LM2 A;  2PJQ A;  3VKH A;  2LSG A;  2V6Y A;  4KHZ F;  4UVA B; 
#chains in the Genus database with same CATH homology
 5HEH A;  4NZB A;  2XQ5 A;  2XNV A;  3PEO A;  4QAC A;  1UX2 A;  2ZJV A;  2XQ4 A;  3UQ4 A;  3WTH A;  3UQ7 A;  4FRR A;  3U8M A;  2PGZ A;  3JAF A;  3RIA A;  5L4E A;  2UZ6 A;  5CFB A;  5AFH A;  5KE4 A;  4A98 A;  4UM3 P;  2BG9 A;  2YOE A;  2WNJ A;  4QAB A;  4HFC A;  3UUB A;  3JAD A;  4ZJS A;  4LML A;  5KZU A;  2XQ7 A;  5BP0 A;  2WNC A;  4ILA A;  3TLU A;  3U8L A;  3U8K A;  4Z91 A;  4UM1 A;  4HQP A;  2Y58 A;  2MAW A;  5L4H A;  2BYR A;  3WTN A;  5HEO A;  4AFT A;  1OED C;  2WZY A;  4ZK1 A;  5J0Z A;  4TNW A;  3WTO A;  5AFN A;  2BYN A;  4TNV A;  2X00 D;  3TLV A;  3U8N A;  1OED E;  2Y54 A;  2ZJU A;  2XZ6 A;  2XYT A;  5IUX A;  5HEJ A;  2C9T A;  4EZ1 A;  5JME A;  4UM3 S;  4COF A;  4XK9 A;  4NPP A;  3ZDG A;  2M6B A;  3WTM A;  2YKS A;  2W8G A;  4TWF A;  3EI0 A;  3T4M A;  2BG9 C;  2X00 A;  4ALX A;  4F8H A;  5AFL A;  4WV9 A;  2XQ8 A;  4AFH A;  5J5H A;  1UV6 A;  4HFI A;  4LMK A;  5BRX A;  3C79 A;  5AFM B;  4ZZC A;  2XQ6 A;  3SH1 A;  2BYS A;  3P50 A;  4HFB A;  4UM3 A;  4D01 A;  2XNU A;  2Y57 A;  3UU3 A;  4HFE A;  3TLS A;  2XNT A;  5HEU A;  3WIP A;  5SYO A;  4X5T A;  4UXU A;  5CO5 A;  2WNL A;  3RI5 A;  4ZRU A;  2XQ9 A;  4HFH A;  4XHE A;  3WTL A;  4QH4 A;  4ZR6 A;  4UY2 A;  4QAA A;  5AFK A;  4IL9 A;  2LKG A;  2M6I A;  4ILB A;  2BR8 A;  2BJ0 A;  3IGQ A;  3SIO A;  2XYS A;  4TWH A;  1I9B A;  3P4W A;  4IRE A;  4QH1 A;  5HCM A;  2QC1 B;  5J5G A;  2VL0 A;  3LSV A;  2WN9 A;  3EHZ A;  3UU8 A;  3U8J A;  4LMJ A;  3ZKR A;  2YMD A;  4IL4 A;  2PH9 A;  5AFM A;  3ZDH A;  4A97 A;  3RQW A;  1OED B;  2W8F A;  2YN6 A;  2BG9 E;  3RHW A;  4B5D A;  5BW2 A;  2Y7Y A;  3TLW A;  3SQ6 A;  3PMZ A;  3WTK A;  3SQ9 A;  4DBM A;  3UU5 A;  4BQT A;  3JAE A;  2BYP A;  3UU4 A;  5LXB A;  5J5I A;  5FJV A;  2XQA A;  4ILC A;  1UW6 A;  3TLT A;  2YME A;  4HFD A;  3EAM A;  3RIF A;  2XQ3 A;  2BG9 B;  5HCJ A;  3GUA A;  5TVC A;  2LKH A;  4Z90 A;  2XZ5 A;  3RQU A;  2BR7 A;  5HEG A;  4ZK4 A;  5L47 A;  2Y56 A;  2LM2 A;  4TWD A;  3UU6 A;  2BYQ A;  3C84 A;  5AIN A;  5LG3 A;  5J5F A;  4QH5 A;  4ZZB A;  2KSR A;  4BFQ A;  3WTI A;  1OED A;  3WTJ A;  4AFG A;  2LLY A;  5AFJ A;  4PIR A;  4ZJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...