2BG9E

Refined structure of the nicotinic acetylcholine receptor at 4a resolution.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
370
structure length
370
Chain Sequence
b'NEEGRLIEKLLGDYDKRIKPAKTLDHVIDVTLKLTLTNLISLNEKEEALTTNVWIEIQWNDYRLSWNTSEYEGIDLVRIPSELLWLPDVVLENNVDGQFEVAYYANVLVYNDGSMYWLPPAIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLSAEEGIDPEDFTENGEWTIRHRPAKKNYNWQLTKDDIDFQEIIFFLIIQRKPLFYIINIIAPCVLISSLVVLVYFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSLVIVTNCVIVLNVSLRTPNTHSCVEACNFIAKSTKEQNDSGSENENWVLIGKVIDKACFWIALLLFSLGTLAIFLTGHLNQVPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN
publication title Refined Structure of the Nicotinic Acetylcholine Receptor at 4A Resolution
pubmed doi rcsb
molecule tags Ion channel/receptor
total genus 87
structure length 370
sequence length 370
ec nomenclature
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
E PF02932 Neur_chan_memb Neurotransmitter-gated ion-channel transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2bg9E02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2bg9E01
3PEOA 4LMLA 4UM3P 4ILAA 4WV9A 4TNVA 3WTIA 4ILBA 4TWFA 4BFQA 1UW6A 2YN6A 2BYRA 2Y57A 2XQ9A 3WTHA 5JMEA 2M6BA 1UX2A 2BG9B 5CO5A 5HCMA 5LG3A 5HEUA 1OEDE 3UU4A 4ZR6A 3EHZA 3UU6A 3UQ4A 2YMDA 4UM3A 3U8LA 3EAMA 3WTLA 4QH1A 2XQ8A 5HEGA 2XNTA 4UM3S 2LKHA 3WTOA 5L47A 2BR7A 2X00D 3ZKRA 5HEJA 4Z91A 2BYPA 4LMJA 4HFCA 2WN9A 2BYQA 4HQPA 3TLUA 3ZDGA 4QACA 1OEDB 3SQ6A 4XHEA 5FJVA 4TWHA 2XZ5A 5J5FA 4TWDA 2XQ3A 4UXUA 4IL4A 2C9TA 3UU8A 4XK9A 5BRXA 2XQ5A 4ALXA 3TLWA 2UZ6A 4AFTA 4EZ1A 4COFA 4QAAA 4UM1A 2BG9C 4HFHA 3TLSA 1I9BA 2WZYA 2BJ0A 3U8NA 2YOEA 5J0ZA 2Y58A 4D01A 1OEDA 3P4WA 3TLTA 5LXBA 3EI0A 5AINA 3SQ9A 5AFHA 4HFDA 5AFMB 2XZ6A 2LLYA 3JADA 4A98A 2Y56A 3U8KA 5BP0A 2X00A 4ZJSA 3LSVA 2WNJA 2BYNA 4DBMA 2XYTA 4AFHA 5L4EA 5J5GA 1OEDC 3TLVA 3JAEA 3RI5A 3UU5A 5KE4A 1UV6A 2YMEA 2VL0A 2XQAA 4NPPA 5BW2A 5L4HA 5AFJA 2XQ7A 3C79A 3GUAA 4QH4A 4HFBA 4X5TA 3WTKA 3JAFA 4B5DA 3U8JA 2W8FA 2MAWA 3RIAA 5AFMA 4IL9A 4UY2A 5HEHA 4A97A 2QC1B 2KSRA 2XQ6A 2ZJUA 3UUBA 3WTJA 2LKGA 3WTMA 2XNUA 5TVCA 4ZK4A 4QABA 4ZZBA 2BR8A 2M6IA 2XQ4A 5HCJA 2PH9A 5SYOA 4ILCA 5CFBA 3U8MA 4HFEA 3UQ7A 4ZK1A 3IGQA 3RQUA 4AFGA 5AFNA 5HEOA 3P50A 2PGZA 4F8HA 3UU3A 3ZDHA 4ZRUA 3RIFA 3T4MA 3SIOA 4ZJTA 2ZJVA 3PMZA 4ZZCA 4IREA 5AFKA 2WNLA 5J5HA 3WTNA 4NZBA 2BYSA 4Z90A 3RQWA 5J5IA 4QH5A 4FRRA 2Y54A 3WIPA 5AFLA 3RHWA 2WNCA 4HFIA 2LM2A 2Y7YA 3C84A 2YKSA 4PIRA 4BQTA 2XNVA 5IUXA 4LMKA 5KZUA 2BG9E 3SH1A 2W8GA 2BG9A 4TNWA 2XYSA
chains in the Genus database with same CATH superfamily
3W15B 2K3WA 2XY8B 2PFVA 1KF6A 3UFEA 4ILBA 2V7JA 3C98B 4GYRA 3WTHA 1J5ET 3CQGB 5CO5A 3EAMA 3LG7A 4ANJA 2BYQA 4QACA 4XHEA 1BR4A 1YKHB 4MFRA 4OFZA 2WDRA 3C64A 2LE8A 3ZJ1A 3TLWA 4AKIA 4ZS3A 2H89A 4CXWA 5JDNA 5JH7E 3OPCA 3EI0A 1X9BA 4YHHT 4IDOA 5DQWA 1CUNA 3AE3A 5HYAA 4O2AE 4JEHB 1D0ZA 4E7SA 2XAQB 2EHOB 2XQ7A 5L3GB 4O4HE 4GKJT 5LYJE 1NAFA 3E08A 3Q5XA 1W09A 5LXTE 4OYJA 3B13A 2ZJVA 1UK5A 2WU2A 3FBZA 3QNUA 3FZLB 4WW0A 4DUYT 3CIRA 2VQFT 3LK3B 4JI6T 4TV8E 4JYAT 3FZMB 2XNVA 4NXMT 4OX9T 1XDOA 2DI4A 3CMLA 4IE6A 4EZ4A 4JUYA 3RH3A 2LT3A 3PUYF 1HFAA 3FZKB 4ZI3C 1NENA 1WYBA 2Y8DA 3Q5EA 3O1HA 4U33A 1X79A 3WTLA 3AE4A 4QH1A 1ZV4X 3F2EA 4MBQA 2X67A 2V6XA 4LMJA 5FY0A 3TLUA 2WAUA 2P9BA 3P4RA 3SWHA 3UU8A 3FXEB 5JTGA 4COFA 1N34T 2XQYA 4WNKA 3TLSA 3K3OA 2LM9A 5F5WA 1OEDA 2C5KT 4MLKA 2UXDT 3J7Yq 3RC3A 2LRKA 4AFHA 3VR9A 1UV6A 4IDZA 5AFJA 4GK5E 4QXBB 5AQOB 5DQVA 5EK3A 3WTJA 3EDVA 4TZ4C 2E2AA 2PJQA 3P4PA 1U4QA 3EUHA 3IGQA 2CRBA 5HEOA 3LDQB 2VKHA 4H9RC 4JEUB 3UT5E 4IE4A 2ZM8A 5LBQB 3PUAA 2WWVA 2HPJA 2Y54A 2H7OA 1ZP0A 3ETVA 3ZSSA 5HXCA 3QB5K 3EABA 5CA0E 5J5GA 3N9OA 4IDNA 1VCSA 2J47A 3KV6A 2BG9B 4AKGA 4U7IA 3AEAA 1OEDE 2D5UA 2NR4A 5H6RB 1KNRA 4I0UA 2UUCT 2NW7A 2J4GA 2UZ6A 4ZI2C 2V1DB 3ZCIA 1OXZA 4M1PA 5A1LA 2KINB 3CX8B 2RP4A 3RC8A 2WP9A 5L3BB 3LK2B 1ZOYA 3K1SA 4EGWA 3NKZA 1V9DA 2IUBA 4ISSA 5CB4E 2QRXA 3L39A 2WSSV 4HWDA 5FY7A 4DIDB 4KUMB 3PE0A 4A97A 4G63A 3PTRB 2X9XA 3UQ7A 1HNXT 2KLQA 4UVCB 4OYKA 1IBMT 5AQVB 3RIUA 4GOUA 3ZYLA 4DVDA 1YW0A 3MJXA 4UF0A 1O3XA 2EHOC 4AQYT 2PTFA 2LSIA 3RYFE 3VRBA 3B5MA 4FRRA 3B57A 5HXEA 4JLEA 1FJGT 3UUXB 3N9LA 4HE8A 1E1HB 3SH1A 2DWGA 4O4LE 2WCAA 2X9WA 1JNRA 2BYRA 5AQFB 2W63A 1Y64B 3BK9A 5FNVE 1MMGA 4I4TE 5L2LA 2L8KA 5KMGP 5JREA 3ZMUB 3K3NA 3ZN1B 2WN9A 1G73A 4ZHQE 4P1NA 2ZLYA 3P4SA 4QX8B 2BVMA 3I0OA 5KXJA 5EZYE 2K5BB 2HHHT 2MPKA 4P09A 2E9XD 2YDRA 2DHRA 3SFEA 3VKGA 4LFBT 3ZC0A 5FY1A 4F6RC 3ZT5A 3O1IA 3BQKA 3VHLA 3ZC1A 1HNWT 3ZT6A 2XM1A 4ISTA 4X5TA 4EAHA 1GQEA 5FP3A 3ZEFB 4ILCA 3OYXA 3I0QA 2BBHA 1D0XA 4F8HA 2XTLA 1UX4A 4I55E 1SE7A 4IREA 4PW8A 3IEEA 3FXDB 2NW9A 4X20E 1N36T 4NZBA 1HR0T 2CHOA 3RQWA 4N78D 3M65A 5HXHA 2Y7YA 1MMAA 1T98A 2Q9QD 1G8XA 3MZKB 5IUXA 5JR9A 2L9QA 2V7LA 3ZJ2A 1T7SA 5LHIB 2W2UA 4DV1T 4TX5A 5C8YE 3RLFF 2VKDA 4Z8XA 4JV5T 2LSJA 2V8SV 4U72A 1J1JA 2ZMAA 3UQ4A 5AQQB 3GA8A 4AXPA 2XNTA 3WTOA 4HTEA 1KK7A 4Z91A 1OEDB 2L3LA 2V6YA 5FJVA 2XQ3A 3BQIA 2J62A 1UUSA 2W66A 2BG9C 3VR8A 4YT0A 5C2TA 4AI6A 4L9IA 4DR3T 2XSAA 5HAXA 2ZM6T 3FHNA 2KZ7B 2W61A 4HFDA 3S4UA 3X1DA 2YEVC 3LBXA 2VL0A 3LJCA 3PV0F 3PU8A 3MACA 4YTMA 2WQYA 1MIYA 1OWAA 3UUBA 3HI2A 2E9XA 5JDGA 2XNUA 2XAFB 3AE8A 4HFEA 4LFCT 4ZRUA 4UVBB 1SHZC 4UELA 1YKEB 2OLTA 4AQFC 1SA0E 2WB5A 5EK2A 3RPUA 3HKCE 1SUMB 2WWUA 1QLBA 2YMDA 2LSGA 5LP6E 2XQ9A 4I50E 4QXHB 1YQ3A 5JMEA 2LHNA 5ABGA 3ZPOA 3AA6B 4DV3T 5JDHA 2Q9QA 5J5FA 4YSZA 2Y6XA 3V5SA 1XNRT 2HPLA 5BRXA 4WZXA 3G06A 5AQPB 2X0HA 4CI2B 4K0KT 4C90A 4A56A 2YOEA 1ZKEA 2UXXB 4WBOA 4YTNA 4ZI3D 1HG5A 1UCUA 3AAEB 1MIWA 2LJLA 4U2YA 3RI5A 3N9NA 5BW2A 5LG4A 5JRCA 4ERRA 2VASA 4KHPT 2C5JA 1XMOT 4KMCA 4DV2T 5CFBA 2HH7A 1NWMX 3UU3A 3PUQA 3T4MA 4X62T 4EXTA 5C3JA 4IIJE 3WTNA 5LHHB 5DABA 4KBMB 2I59A 2XSBA 5AQUB 4HFVA 5HWYA 3WIPA 3UUNA 5CJ5A 5JVDE 2MYSA 2JQKA 2LM2A 4YXDA 4PFOA 2RPAA 1BR1A 4CZZB 2XYSA 5BMVE 3CQXC 5FXZA 4BFQA 5AQGB 1XZYA 3IA3A 2X66A 3RKGA 1KNPA 2HN2A 5BR8T 5HEGA 4DV7T 4HKAA 5ABFA 2BR7A 4CQIA 5HEJA 3RGLA 4XAXB 4O8SA 4H9PC 2WU5A 1L0VA 4DV4T 1VOMA 3PU3A 3JC6C 5J1GA 1NEKA 2YDSA 4ZEYA 5ETWA 4DBRA 3ABVA 1S35A 5FL1A 4UM1A 2BBJA 3PUVF 3RYHE 4D01A 1UX5A 5FYMA 2AXDS 1M62A 4QXCB 4UIGA 2QVAA 4EB6E 4HN9A 2X68A 2YK0A 4GK0E 4PJMA 3AEGA 3Q5WA 1OEDC 2JQQA 3UU5A 3DP7A 2A9UA 5L4HA 4QH4A 3WI3A 3JAFA 2MAWA 2BS3A 2FJDA 3CX6B 4IL9A 3AVRA 1FMWA 5HEHA 5L3FB 5GONE 3L3PA 4QABA 4ZI2D 2UUBT 2XJ7A 4YJ3E 4HEAA 5LA6E 4YJ2E 4AISA 2V5DA 3UUMA 4NXNT 3PUXF 5E0OA 3CX7B 4ZS2A 3RRCA 2DNXA 1WFDA 2W67A 3CQCB 1VRBA 1AJ3A 3RX6A 1US7B 3ZLIA 2N2NA 3OYZA 3RF1A 2V6YB 4L0RA 4BAYB 5LJMA 2M6BA 3KFWX 5LG3A 4JI5T 3EVYA 4EYUA 4IHJE 4UM3A 3FBLA 2XPKA 5L47A 2JJ9A 2EHOD 2WY2A 2X51A 3I9WA 2BYPA 2CWYA 3KV9A 1MNDA 2XZ5A 2N1GA 4IL4A 4O4IE 3LBXB 2KXPB 2W00A 2BKPA 2WZYA 1Z8UA 3MKDA 2SPCA 3ZMZB 4UV9B 4PAGA 3PJAJ 3N9QA 3PUWF 5LHGB 5BP0A 2WZHA 4B3RT 1MNEA 2NWBA 1IAPA 2CXFA 4NPPA 3N2GE 2IHR1 1BR0A 4DV0T 2LEHA 4JBWF 5AQJB 3NRYA 4ZI7E 4DMWA 3RIAA 2OA5A 5IHYA 5FXWA 2ZJUA 3CKDA 1UGOA 5SYOA 2IDOB 4TV9E 3GN5A 5LCYA 4AFGA 4YFSA 2FJEA 1N33T 4E7ZA 2UU9T 4ZJTA 1DU2A 3DJBA 5J5HA 3P7IA 1KNZA 4XZCA 2VL8A 2WDQA 3OBVE 5AQKB 2JQ9A 3GMIA 4AKHA 4CI3B 4YTPA 1D0YA 1H7CA 2R6GF 2ZM0A 4BJNA 3SOLA 4IE5A 4DR1T 3UULA 3ANWA 2CXDA 3AAIA 1S94A 2PG8A 3C51A 4B3ST 3AEFA 4HQPA 2RA1A 1XMQT 1D1AA 4IGUA 1FEWA 3HKBE 4HFHA 1IBLT 2BJ0A 3ZN0B 2WMNA 1R8IA 3Q9DA 3T8OA 2E5VA 3N9PA 1IJ6A 2Y56A 2EHOA 3PJAA 4TUYE 1HTJF 4LF6T 3BQLA 3AEEA 3TLVA 4I43B 3I9YA 4HWHA 3CK6A 2DL1A 4HFBA 5AQLB 1E7PA 5TAOA 4PJLA 1XDPA 1WCRA 4ADZA 5LJNA 1MIVA 1HX1B 2E8IA 4DO0A 4ZZCA 4BA9A 2BZBA 4ASKA 3QC9A 3LK42 2QA7A 1T72A 2OV9A 5AFLA 3AE6A 1BR2A 3C50A 4PJJA 1LRZA 2KNDA 3HKEE 5ABEA 1I6ZA 1Y01A 5LB7B 2NTXA 4G2AA 2Y57A 1YXRA 5AQSB 4QKNA 2IW5B 5ABHA 4V1Av 2W4XA 4EZHA 2IAKA 3ETUA 5L3DB 4HFCA 2CCQA 2VQET 3ZCJA 3R6NA 4CI1B 2C9TA 1T8BA 2B76A 5L3EB 2A72A 2VKJA 3NRXA 4X64T 2AE9A 1I9BA 4EV6A 5J0ZA 2Y58A 3TLTA 3H3AA 3FB2A 2NTYA 4DBQA 4GYSA 2WNJA 2BYNA 3ZYKA 3N9MA 3KVAA 2XYTA 3JAEA 2QGSA 3ONXA 2XQAA 2XHEB 3IHRA 3I1AA 3WTKA 2GK9A 5AFMA 2V7KA 2KSRA 2XQ6A 1LVFA 3AXJA 3U8MA 2PH9A 3C4ZA 2V7IA 4MHCA 2FJBA 2WMOA 3VU7H 3SIOA 3ZMSB 4TN7B 3R84B 2VB6A 5AFUL 3F31A 4QH5A 3T1YT 2LOSA 1HF8A 4ZOLE 4O2BE 1I94T 3C84A 4Q25A 5CGMA 1D1BA 4LMKA 5KZUA 3CPZA 4PK4A 1CHUA 2BG9A 4TNWA 4LMLA 3HR0A 4YLHA 1FMVA 5L3CB 4UM3P 3N2OA 1UW6A 5IWAT 4DR6T 1YD8G 4NUVA 2XASB 3HA4A 5HEUA 3UU4A 3U8LA 4LF8T 2KWIB 2LKHA 5IYZE 1LKXA 1W0AA 4PNIA 2Y48B 4CXYA 5JDLA 2MTQA 4LFAT 2IC6A 3E0ZA 5AINA 3SQ9A 3E22E 1W9RA 4ZJSA 1UURA 2Z6EA 2CWOA 5M4YA 3KV5A 4AQFA 5L4EA 3SS1A 2J1DG 2D2SA 2XAGB 2XAHB 5FXVA 3C79A 1WLXA 3MK7C 2FJAA 4DR5T 2K9AA 3U8JA 5FVLA 3Q5DA 5AQMB 3JC6D 2QC1B 5KX5E 2YU1A 4ZK4A 3DTOA 3PUGA 2BR8A 3P50A 2W0GA 2C5IT 5FVKA 4IT4A 4AIUA 5AQHB 3KV4A 4ZXLA 4FJOA 1XWMA 4UF0B 4QWNB 3U3IA 3ANWB 3ZSTA 2LHRA 4UR9A 4CXXA 2CHNA 3H3MA 1E2AA 3WTIA 4TWFA 4IDPA 1UX2A 2CBIA 2H3RA 1W0BA 4KI0F 2A2FX 3SFDA 3C4WA 2UXNB 2XQ8A 2ACXA 3RYCE 3HKDE 3AEBA 1IZNB 5KDMC 4QAAA 1IBKT 3U8NA 2CPTA 5LMUT 2CM0A 2LLYA 1WYCA 4ILUA 4EEDA 4OK0A 1Z0PA 3J9X1 2IMLA 2B1EA 2CMRA 2KT9A 4EOZB 2KWHA 1FIOA 3ONJA 2LKGA 5HXRA 2NW8A 2BDEA 5JDQA 5CA1E 4DV5T 4O4JE 3ONLC 4L5GA 4P0BA 4AQGA 3PMZA 4WYVA 1ZEEA 2FUPA 4LF5T 3KINB 3AECA 4U3CA 2CE7A 3RHWA 2WNCA 2V5CA 1N32T 4IE0A 4HFIA 4AKRB 4BQTA 4GKKT 1MMDA 4HWIB 2K24A 2UUAT 2BKNA 3V5UA 2JMKA 3A5XA 4XBFB 2UXCT 5JR9B 4X1YE 2UXBT 2F4VT 2JIWA 4QX7B 3AE7A 3N5LA 3FZFB 4H9QC 3ZT7A 3AEDA 4EYYR 3PUSA 1JNZA 3NVOA 5HXSA 3HL6A 4TWHA 2DWKA 4MALA 1U5PA 2XQ5A 3WAJA 2ZM2A 4EZ1A 5AQTB 3QUJA 4C91A 4PK6A 3P4WA 5AFHA 1HCIA 5AFMB 2VWAA 3UFGA 4DBMA 3AXJB 5KE4A 5LGNB 4YHJA 1IJ5A 1LVKA 2KMFA 3VKHA 2CBJA 5LOVE 5JQGE 3OTOT 2LSKA 1XNQT 3AA7B 3KBUA 4EIWA 5LBMA 2VVSA 4QHOA 3WTMA 1WRDA 4H9NC 4KP3C 3IBPA 4U74A 3A7MA 4ZK1A 5AFNA 2YINA 3RYIE 2PGZA 2E9XB 3MA9A 3PUZF 3ZYMA 2X9HA 2IIUA 3O1JA 4H63H 2WS3A 4U2ZA 4JI8T 1YQ4A 2LOPA 2QYWA 5AQNB 4BJMA 5AQIB 2I6HA 5J2UE 2FBWA 4WV9A 4TNVA 4X1KE 2YN6A 2LSYA 4UXNB 1HG2A 3UU6A 3EHZA 3RIUC 2XAJB 5LGUB 2ES0A 2X00D 3A8YC 4DR7T 3AE2A 2W62A 2IC9A 4U31A 4XK9A 2X9YA 2Q9QB 3SRZA 3MXZA 3CVRA 2XM2A 2YU2A 3O9XA 1WR6A 2CLYB 2CXLA 2D9DA 4WBNE 4A98A 2D0TA 3LSVA 3P4QA 2X0YA 2NOXA 2WDVA 2ODVA 4B5DA 3CWZB 3AB3B 3U78A 3PDYA 2H7VC 2CEAA 3UTKA 2VURA 3PURA 3OVUA 4IDQA 3F57A 2BS2A 3T1HT 5F3JA 3AA1B 2D0UA 4DNDA 2XQ4A 2M6IA 5JRCB 3H37A 2H88A 3AE9A 3P8CD 4NIQA 4JI2T 3L09A 4B3MT 2BYSA 2ACZA 3RKOA 4Z90A 4HWFA 3Q2MA 5EK4A 3ZMTB 1KEYA 4UEMA 4FI5A 4DUZT 1WR0A 2ODUA 4LF4T 4PIRA 4KHZF 5ADXL 2BKOA 2W8GA 4X1IE 3PEOA 2E5LT 3EDUA 4DR2T 4B6XA 4U7YA 1J5WA 5HCMA 2XZEA 3QK6A 5DJQC 4ZR6A 5LNKA 2JRKA 2VKOA 5LGTB 2DLRA 3QB5A 3M3ZB 3ZKRA 3N2KE 3ZDGA 3OKQA 4HGAA 3NZQA 4DMVA 4TWDA 5J2TE 5ABFB 3AE5A 2JQHA 5JR9C 4X65T 4JI3T 4H9SE 4PJNA 3AVSA 3KBTA 2YDQA 4PK5A 1QUUA 4UVAB 4JI0T 4YSYA 2WBLA 1KFYA 1B7TA 4AKLA 2N9DA 3NZPA 1HX8A 2BVLA 2VK9A 4OHFA 4UV8B 2X00A 4X66T 2YMEA 2MOZA 4KX6A 3JCFA 3QOFA 2G0UA 4UY2A 5H6QB 2V26A 2WZIA 2XUEA 2MBGA 4H9OC 1HNZT 2PBIA 4CN4A 5JDMA 3ZDHA 3RIFA 4J2CA 5FKYA 5FL0A 5AFKA 2X0LB 5AQRB 3O4XE 4YSXA 5J5IA 4YY3T 4HWCA 2BS4A 3LFMA 3NBXX 1QSDA 3KDSE 2E9XC 4ILAA 4CN1A 1VCTA 4K0UA 3ZMVB 5LMNT 3IF8B 2DCFA 3RRWA 4UM3S 3WAKA 4JI7T 4P0AA 3SQ6A 4CN6A 4UXUA 1M7KA 1D1CA 4ALXA 2I0MA 3FZHB 4AFTA 4B3TT 5F8PA 4DR4T 5LXBA 2A3DA 2XZ6A 3JADA 3KVBA 3U8KA 4H63V 2K48A 2V7MA 4JI1T 4NUUA 3OJAA 5JDFA 3GUAA 2Q9QC 4DV6T 2W8FA 2VVNA 4EEBA 2M67A 2JMHA 5HWXA 2CLYC 4A5XA 2NP9A 5TVCA 2WM9A 4ZZBA 5HCJA 2HN1A 3AE1A 4IE7A 3TKLB 4JI4T 3RQUA 3GWHA 3AAAB 2LRLA 2JPFA 3K8PC 2WNLA 3GN5B 3AA0B 1HS7A 5FXXA 4LF9T 4GIWA 3D0TA 2C0SA 4LF7T 1MMNA 3NWIA 4PFPA 2YKSA 3C4XA 2BG9E 1EZ3A 1ZHCA 3ESLA 3VRAA 2CA5A 3L8RA 5FMNA 3K3QC
chains in the Genus database with same CATH topology
3PEOA 4LMLA 4UM3P 4ILAA 4WV9A 4TNVA 3WTIA 4ILBA 4TWFA 4BFQA 1UW6A 2YN6A 2BYRA 2Y57A 2XQ9A 3WTHA 5JMEA 2M6BA 1UX2A 2BG9B 5CO5A 5HCMA 5LG3A 5HEUA 1OEDE 3UU4A 4ZR6A 3EHZA 3UU6A 3UQ4A 2YMDA 4UM3A 3U8LA 3EAMA 3WTLA 4QH1A 2XQ8A 5HEGA 2XNTA 4UM3S 2LKHA 3WTOA 5L47A 2BR7A 2X00D 3ZKRA 5HEJA 4Z91A 2BYPA 4LMJA 4HFCA 2WN9A 2BYQA 4HQPA 3TLUA 3ZDGA 4QACA 1OEDB 3SQ6A 4XHEA 5FJVA 4TWHA 2XZ5A 5J5FA 4TWDA 2XQ3A 4UXUA 4IL4A 2C9TA 3UU8A 4XK9A 5BRXA 2XQ5A 4ALXA 3TLWA 2UZ6A 4AFTA 4EZ1A 4COFA 4QAAA 4UM1A 2BG9C 4HFHA 3TLSA 1I9BA 2WZYA 2BJ0A 3U8NA 2YOEA 5J0ZA 2Y58A 4D01A 1OEDA 3P4WA 3TLTA 5LXBA 3EI0A 5AINA 3SQ9A 5AFHA 4HFDA 5AFMB 2XZ6A 2LLYA 3JADA 4A98A 2Y56A 3U8KA 5BP0A 2X00A 4ZJSA 3LSVA 2WNJA 2BYNA 4DBMA 2XYTA 4AFHA 5L4EA 5J5GA 1OEDC 3TLVA 3JAEA 3RI5A 3UU5A 5KE4A 1UV6A 2YMEA 2VL0A 2XQAA 4NPPA 5BW2A 5L4HA 5AFJA 2XQ7A 3C79A 3GUAA 4QH4A 4HFBA 4X5TA 3WTKA 3JAFA 4B5DA 3U8JA 2W8FA 2MAWA 3RIAA 5AFMA 4IL9A 4UY2A 5HEHA 4A97A 2QC1B 2KSRA 2XQ6A 2ZJUA 3UUBA 3WTJA 2LKGA 3WTMA 2XNUA 5TVCA 4ZK4A 4QABA 4ZZBA 2BR8A 2M6IA 2XQ4A 5HCJA 2PH9A 5SYOA 4ILCA 5CFBA 3U8MA 4HFEA 3UQ7A 4ZK1A 3IGQA 3RQUA 4AFGA 5AFNA 5HEOA 3P50A 2PGZA 4F8HA 3UU3A 3ZDHA 4ZRUA 3RIFA 3T4MA 3SIOA 4ZJTA 2ZJVA 3PMZA 4ZZCA 4IREA 5AFKA 2WNLA 5J5HA 3WTNA 4NZBA 2BYSA 4Z90A 3RQWA 5J5IA 4QH5A 4FRRA 2Y54A 3WIPA 5AFLA 3RHWA 2WNCA 4HFIA 2LM2A 2Y7YA 3C84A 2YKSA 4PIRA 4BQTA 2XNVA 5IUXA 4LMKA 5KZUA 2BG9E 3SH1A 2W8GA 2BG9A 4TNWA 2XYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PEO A;  4LML A;  4UM3 P;  4ILA A;  4WV9 A;  4TNV A;  3WTI A;  4ILB A;  4TWF A;  4BFQ A;  1UW6 A;  2YN6 A;  2BYR A;  2Y57 A;  2XQ9 A;  3WTH A;  5JME A;  2M6B A;  1UX2 A;  2BG9 B;  5CO5 A;  5HCM A;  5LG3 A;  5HEU A;  1OED E;  3UU4 A;  4ZR6 A;  3EHZ A;  3UU6 A;  3UQ4 A;  2YMD A;  4UM3 A;  3U8L A;  3EAM A;  3WTL A;  4QH1 A;  2XQ8 A;  5HEG A;  2XNT A;  4UM3 S;  2LKH A;  3WTO A;  5L47 A;  2BR7 A;  2X00 D;  3ZKR A;  5HEJ A;  4Z91 A;  2BYP A;  4LMJ A;  4HFC A;  2WN9 A;  2BYQ A;  4HQP A;  3TLU A;  3ZDG A;  4QAC A;  1OED B;  3SQ6 A;  4XHE A;  5FJV A;  4TWH A;  2XZ5 A;  5J5F A;  4TWD A;  2XQ3 A;  4UXU A;  4IL4 A;  2C9T A;  3UU8 A;  4XK9 A;  5BRX A;  2XQ5 A;  4ALX A;  3TLW A;  2UZ6 A;  4AFT A;  4EZ1 A;  4COF A;  4QAA A;  4UM1 A;  2BG9 C;  4HFH A;  3TLS A;  1I9B A;  2WZY A;  2BJ0 A;  3U8N A;  2YOE A;  5J0Z A;  2Y58 A;  4D01 A;  1OED A;  3P4W A;  3TLT A;  5LXB A;  3EI0 A;  5AIN A;  3SQ9 A;  5AFH A;  4HFD A;  5AFM B;  2XZ6 A;  2LLY A;  3JAD A;  4A98 A;  2Y56 A;  3U8K A;  5BP0 A;  2X00 A;  4ZJS A;  3LSV A;  2WNJ A;  2BYN A;  4DBM A;  2XYT A;  4AFH A;  5L4E A;  5J5G A;  1OED C;  3TLV A;  3JAE A;  3RI5 A;  3UU5 A;  5KE4 A;  1UV6 A;  2YME A;  2VL0 A;  2XQA A;  4NPP A;  5BW2 A;  5L4H A;  5AFJ A;  2XQ7 A;  3C79 A;  3GUA A;  4QH4 A;  4HFB A;  4X5T A;  3WTK A;  3JAF A;  4B5D A;  3U8J A;  2W8F A;  2MAW A;  3RIA A;  5AFM A;  4IL9 A;  4UY2 A;  5HEH A;  4A97 A;  2QC1 B;  2KSR A;  2XQ6 A;  2ZJU A;  3UUB A;  3WTJ A;  2LKG A;  3WTM A;  2XNU A;  5TVC A;  4ZK4 A;  4QAB A;  4ZZB A;  2BR8 A;  2M6I A;  2XQ4 A;  5HCJ A;  2PH9 A;  5SYO A;  4ILC A;  5CFB A;  3U8M A;  4HFE A;  3UQ7 A;  4ZK1 A;  3IGQ A;  3RQU A;  4AFG A;  5AFN A;  5HEO A;  3P50 A;  2PGZ A;  4F8H A;  3UU3 A;  3ZDH A;  4ZRU A;  3RIF A;  3T4M A;  3SIO A;  4ZJT A;  2ZJV A;  3PMZ A;  4ZZC A;  4IRE A;  5AFK A;  2WNL A;  5J5H A;  3WTN A;  4NZB A;  2BYS A;  4Z90 A;  3RQW A;  5J5I A;  4QH5 A;  4FRR A;  2Y54 A;  3WIP A;  5AFL A;  3RHW A;  2WNC A;  4HFI A;  2LM2 A;  2Y7Y A;  3C84 A;  2YKS A;  4PIR A;  4BQT A;  2XNV A;  5IUX A;  4LMK A;  5KZU A;  2BG9 E;  3SH1 A;  2W8G A;  2BG9 A;  4TNW A;  2XYS A; 
#chains in the Genus database with same CATH topology
 3W15 B;  2K3W A;  2XY8 B;  2PFV A;  1KF6 A;  3UFE A;  4ILB A;  2V7J A;  3C98 B;  4GYR A;  3WTH A;  1J5E T;  3CQG B;  5CO5 A;  3EAM A;  3LG7 A;  4ANJ A;  2BYQ A;  4QAC A;  4XHE A;  1BR4 A;  1YKH B;  4MFR A;  4OFZ A;  2WDR A;  3C64 A;  2LE8 A;  3ZJ1 A;  3TLW A;  4AKI A;  4ZS3 A;  2H89 A;  4CXW A;  5JDN A;  5JH7 E;  3OPC A;  3EI0 A;  1X9B A;  4YHH T;  4IDO A;  5DQW A;  1CUN A;  3AE3 A;  5HYA A;  4O2A E;  4JEH B;  1D0Z A;  4E7S A;  2XAQ B;  2EHO B;  2XQ7 A;  5L3G B;  4O4H E;  4GKJ T;  5LYJ E;  1NAF A;  3E08 A;  3Q5X A;  1W09 A;  5LXT E;  4OYJ A;  3B13 A;  2ZJV A;  1UK5 A;  2WU2 A;  3FBZ A;  3QNU A;  3FZL B;  4WW0 A;  4DUY T;  3CIR A;  2VQF T;  3LK3 B;  4JI6 T;  4TV8 E;  4JYA T;  3FZM B;  2XNV A;  4NXM T;  4OX9 T;  1XDO A;  2DI4 A;  3CML A;  4IE6 A;  4EZ4 A;  4JUY A;  3RH3 A;  2LT3 A;  3PUY F;  1HFA A;  3FZK B;  4ZI3 C;  1NEN A;  1WYB A;  2Y8D A;  3Q5E A;  3O1H A;  4U33 A;  1X79 A;  3WTL A;  3AE4 A;  4QH1 A;  1ZV4 X;  3F2E A;  4MBQ A;  2X67 A;  2V6X A;  4LMJ A;  5FY0 A;  3TLU A;  2WAU A;  2P9B A;  3P4R A;  3SWH A;  3UU8 A;  3FXE B;  5JTG A;  4COF A;  1N34 T;  2XQY A;  4WNK A;  3TLS A;  3K3O A;  2LM9 A;  5F5W A;  1OED A;  2C5K T;  4MLK A;  2UXD T;  3J7Y q;  3RC3 A;  2LRK A;  4AFH A;  3VR9 A;  1UV6 A;  4IDZ A;  5AFJ A;  4GK5 E;  4QXB B;  5AQO B;  5DQV A;  5EK3 A;  3WTJ A;  3EDV A;  4TZ4 C;  2E2A A;  2PJQ A;  3P4P A;  1U4Q A;  3EUH A;  3IGQ A;  2CRB A;  5HEO A;  3LDQ B;  2VKH A;  4H9R C;  4JEU B;  3UT5 E;  4IE4 A;  2ZM8 A;  5LBQ B;  3PUA A;  2WWV A;  2HPJ A;  2Y54 A;  2H7O A;  1ZP0 A;  3ETV A;  3ZSS A;  5HXC A;  3QB5 K;  3EAB A;  5CA0 E;  5J5G A;  3N9O A;  4IDN A;  1VCS A;  2J47 A;  3KV6 A;  2BG9 B;  4AKG A;  4U7I A;  3AEA A;  1OED E;  2D5U A;  2NR4 A;  5H6R B;  1KNR A;  4I0U A;  2UUC T;  2NW7 A;  2J4G A;  2UZ6 A;  4ZI2 C;  2V1D B;  3ZCI A;  1OXZ A;  4M1P A;  5A1L A;  2KIN B;  3CX8 B;  2RP4 A;  3RC8 A;  2WP9 A;  5L3B B;  3LK2 B;  1ZOY A;  3K1S A;  4EGW A;  3NKZ A;  1V9D A;  2IUB A;  4ISS A;  5CB4 E;  2QRX A;  3L39 A;  2WSS V;  4HWD A;  5FY7 A;  4DID B;  4KUM B;  3PE0 A;  4A97 A;  4G63 A;  3PTR B;  2X9X A;  3UQ7 A;  1HNX T;  2KLQ A;  4UVC B;  4OYK A;  1IBM T;  5AQV B;  3RIU A;  4GOU A;  3ZYL A;  4DVD A;  1YW0 A;  3MJX A;  4UF0 A;  1O3X A;  2EHO C;  4AQY T;  2PTF A;  2LSI A;  3RYF E;  3VRB A;  3B5M A;  4FRR A;  3B57 A;  5HXE A;  4JLE A;  1FJG T;  3UUX B;  3N9L A;  4HE8 A;  1E1H B;  3SH1 A;  2DWG A;  4O4L E;  2WCA A;  2X9W A;  1JNR A;  2BYR A;  5AQF B;  2W63 A;  1Y64 B;  3BK9 A;  5FNV E;  1MMG A;  4I4T E;  5L2L A;  2L8K A;  5KMG P;  5JRE A;  3ZMU B;  3K3N A;  3ZN1 B;  2WN9 A;  1G73 A;  4ZHQ E;  4P1N A;  2ZLY A;  3P4S A;  4QX8 B;  2BVM A;  3I0O A;  5KXJ A;  5EZY E;  2K5B B;  2HHH T;  2MPK A;  4P09 A;  2E9X D;  2YDR A;  2DHR A;  3SFE A;  3VKG A;  4LFB T;  3ZC0 A;  5FY1 A;  4F6R C;  3ZT5 A;  3O1I A;  3BQK A;  3VHL A;  3ZC1 A;  1HNW T;  3ZT6 A;  2XM1 A;  4IST A;  4X5T A;  4EAH A;  1GQE A;  5FP3 A;  3ZEF B;  4ILC A;  3OYX A;  3I0Q A;  2BBH A;  1D0X A;  4F8H A;  2XTL A;  1UX4 A;  4I55 E;  1SE7 A;  4IRE A;  4PW8 A;  3IEE A;  3FXD B;  2NW9 A;  4X20 E;  1N36 T;  4NZB A;  1HR0 T;  2CHO A;  3RQW A;  4N78 D;  3M65 A;  5HXH A;  2Y7Y A;  1MMA A;  1T98 A;  2Q9Q D;  1G8X A;  3MZK B;  5IUX A;  5JR9 A;  2L9Q A;  2V7L A;  3ZJ2 A;  1T7S A;  5LHI B;  2W2U A;  4DV1 T;  4TX5 A;  5C8Y E;  3RLF F;  2VKD A;  4Z8X A;  4JV5 T;  2LSJ A;  2V8S V;  4U72 A;  1J1J A;  2ZMA A;  3UQ4 A;  5AQQ B;  3GA8 A;  4AXP A;  2XNT A;  3WTO A;  4HTE A;  1KK7 A;  4Z91 A;  1OED B;  2L3L A;  2V6Y A;  5FJV A;  2XQ3 A;  3BQI A;  2J62 A;  1UUS A;  2W66 A;  2BG9 C;  3VR8 A;  4YT0 A;  5C2T A;  4AI6 A;  4L9I A;  4DR3 T;  2XSA A;  5HAX A;  2ZM6 T;  3FHN A;  2KZ7 B;  2W61 A;  4HFD A;  3S4U A;  3X1D A;  2YEV C;  3LBX A;  2VL0 A;  3LJC A;  3PV0 F;  3PU8 A;  3MAC A;  4YTM A;  2WQY A;  1MIY A;  1OWA A;  3UUB A;  3HI2 A;  2E9X A;  5JDG A;  2XNU A;  2XAF B;  3AE8 A;  4HFE A;  4LFC T;  4ZRU A;  4UVB B;  1SHZ C;  4UEL A;  1YKE B;  2OLT A;  4AQF C;  1SA0 E;  2WB5 A;  5EK2 A;  3RPU A;  3HKC E;  1SUM B;  2WWU A;  1QLB A;  2YMD A;  2LSG A;  5LP6 E;  2XQ9 A;  4I50 E;  4QXH B;  1YQ3 A;  5JME A;  2LHN A;  5ABG A;  3ZPO A;  3AA6 B;  4DV3 T;  5JDH A;  2Q9Q A;  5J5F A;  4YSZ A;  2Y6X A;  3V5S A;  1XNR T;  2HPL A;  5BRX A;  4WZX A;  3G06 A;  5AQP B;  2X0H A;  4CI2 B;  4K0K T;  4C90 A;  4A56 A;  2YOE A;  1ZKE A;  2UXX B;  4WBO A;  4YTN A;  4ZI3 D;  1HG5 A;  1UCU A;  3AAE B;  1MIW A;  2LJL A;  4U2Y A;  3RI5 A;  3N9N A;  5BW2 A;  5LG4 A;  5JRC A;  4ERR A;  2VAS A;  4KHP T;  2C5J A;  1XMO T;  4KMC A;  4DV2 T;  5CFB A;  2HH7 A;  1NWM X;  3UU3 A;  3PUQ A;  3T4M A;  4X62 T;  4EXT A;  5C3J A;  4IIJ E;  3WTN A;  5LHH B;  5DAB A;  4KBM B;  2I59 A;  2XSB A;  5AQU B;  4HFV A;  5HWY A;  3WIP A;  3UUN A;  5CJ5 A;  5JVD E;  2MYS A;  2JQK A;  2LM2 A;  4YXD A;  4PFO A;  2RPA A;  1BR1 A;  4CZZ B;  2XYS A;  5BMV E;  3CQX C;  5FXZ A;  4BFQ A;  5AQG B;  1XZY A;  3IA3 A;  2X66 A;  3RKG A;  1KNP A;  2HN2 A;  5BR8 T;  5HEG A;  4DV7 T;  4HKA A;  5ABF A;  2BR7 A;  4CQI A;  5HEJ A;  3RGL A;  4XAX B;  4O8S A;  4H9P C;  2WU5 A;  1L0V A;  4DV4 T;  1VOM A;  3PU3 A;  3JC6 C;  5J1G A;  1NEK A;  2YDS A;  4ZEY A;  5ETW A;  4DBR A;  3ABV A;  1S35 A;  5FL1 A;  4UM1 A;  2BBJ A;  3PUV F;  3RYH E;  4D01 A;  1UX5 A;  5FYM A;  2AXD S;  1M62 A;  4QXC B;  4UIG A;  2QVA A;  4EB6 E;  4HN9 A;  2X68 A;  2YK0 A;  4GK0 E;  4PJM A;  3AEG A;  3Q5W A;  1OED C;  2JQQ A;  3UU5 A;  3DP7 A;  2A9U A;  5L4H A;  4QH4 A;  3WI3 A;  3JAF A;  2MAW A;  2BS3 A;  2FJD A;  3CX6 B;  4IL9 A;  3AVR A;  1FMW A;  5HEH A;  5L3F B;  5GON E;  3L3P A;  4QAB A;  4ZI2 D;  2UUB T;  2XJ7 A;  4YJ3 E;  4HEA A;  5LA6 E;  4YJ2 E;  4AIS A;  2V5D A;  3UUM A;  4NXN T;  3PUX F;  5E0O A;  3CX7 B;  4ZS2 A;  3RRC A;  2DNX A;  1WFD A;  2W67 A;  3CQC B;  1VRB A;  1AJ3 A;  3RX6 A;  1US7 B;  3ZLI A;  2N2N A;  3OYZ A;  3RF1 A;  2V6Y B;  4L0R A;  4BAY B;  5LJM A;  2M6B A;  3KFW X;  5LG3 A;  4JI5 T;  3EVY A;  4EYU A;  4IHJ E;  4UM3 A;  3FBL A;  2XPK A;  5L47 A;  2JJ9 A;  2EHO D;  2WY2 A;  2X51 A;  3I9W A;  2BYP A;  2CWY A;  3KV9 A;  1MND A;  2XZ5 A;  2N1G A;  4IL4 A;  4O4I E;  3LBX B;  2KXP B;  2W00 A;  2BKP A;  2WZY A;  1Z8U A;  3MKD A;  2SPC A;  3ZMZ B;  4UV9 B;  4PAG A;  3PJA J;  3N9Q A;  3PUW F;  5LHG B;  5BP0 A;  2WZH A;  4B3R T;  1MNE A;  2NWB A;  1IAP A;  2CXF A;  4NPP A;  3N2G E;  2IHR 1;  1BR0 A;  4DV0 T;  2LEH A;  4JBW F;  5AQJ B;  3NRY A;  4ZI7 E;  4DMW A;  3RIA A;  2OA5 A;  5IHY A;  5FXW A;  2ZJU A;  3CKD A;  1UGO A;  5SYO A;  2IDO B;  4TV9 E;  3GN5 A;  5LCY A;  4AFG A;  4YFS A;  2FJE A;  1N33 T;  4E7Z A;  2UU9 T;  4ZJT A;  1DU2 A;  3DJB A;  5J5H A;  3P7I A;  1KNZ A;  4XZC A;  2VL8 A;  2WDQ A;  3OBV E;  5AQK B;  2JQ9 A;  3GMI A;  4AKH A;  4CI3 B;  4YTP A;  1D0Y A;  1H7C A;  2R6G F;  2ZM0 A;  4BJN A;  3SOL A;  4IE5 A;  4DR1 T;  3UUL A;  3ANW A;  2CXD A;  3AAI A;  1S94 A;  2PG8 A;  3C51 A;  4B3S T;  3AEF A;  4HQP A;  2RA1 A;  1XMQ T;  1D1A A;  4IGU A;  1FEW A;  3HKB E;  4HFH A;  1IBL T;  2BJ0 A;  3ZN0 B;  2WMN A;  1R8I A;  3Q9D A;  3T8O A;  2E5V A;  3N9P A;  1IJ6 A;  2Y56 A;  2EHO A;  3PJA A;  4TUY E;  1HTJ F;  4LF6 T;  3BQL A;  3AEE A;  3TLV A;  4I43 B;  3I9Y A;  4HWH A;  3CK6 A;  2DL1 A;  4HFB A;  5AQL B;  1E7P A;  5TAO A;  4PJL A;  1XDP A;  1WCR A;  4ADZ A;  5LJN A;  1MIV A;  1HX1 B;  2E8I A;  4DO0 A;  4ZZC A;  4BA9 A;  2BZB A;  4ASK A;  3QC9 A;  3LK4 2;  2QA7 A;  1T72 A;  2OV9 A;  5AFL A;  3AE6 A;  1BR2 A;  3C50 A;  4PJJ A;  1LRZ A;  2KND A;  3HKE E;  5ABE A;  1I6Z A;  1Y01 A;  5LB7 B;  2NTX A;  4G2A A;  2Y57 A;  1YXR A;  5AQS B;  4QKN A;  2IW5 B;  5ABH A;  4V1A v;  2W4X A;  4EZH A;  2IAK A;  3ETU A;  5L3D B;  4HFC A;  2CCQ A;  2VQE T;  3ZCJ A;  3R6N A;  4CI1 B;  2C9T A;  1T8B A;  2B76 A;  5L3E B;  2A72 A;  2VKJ A;  3NRX A;  4X64 T;  2AE9 A;  1I9B A;  4EV6 A;  5J0Z A;  2Y58 A;  3TLT A;  3H3A A;  3FB2 A;  2NTY A;  4DBQ A;  4GYS A;  2WNJ A;  2BYN A;  3ZYK A;  3N9M A;  3KVA A;  2XYT A;  3JAE A;  2QGS A;  3ONX A;  2XQA A;  2XHE B;  3IHR A;  3I1A A;  3WTK A;  2GK9 A;  5AFM A;  2V7K A;  2KSR A;  2XQ6 A;  1LVF A;  3AXJ A;  3U8M A;  2PH9 A;  3C4Z A;  2V7I A;  4MHC A;  2FJB A;  2WMO A;  3VU7 H;  3SIO A;  3ZMS B;  4TN7 B;  3R84 B;  2VB6 A;  5AFU L;  3F31 A;  4QH5 A;  3T1Y T;  2LOS A;  1HF8 A;  4ZOL E;  4O2B E;  1I94 T;  3C84 A;  4Q25 A;  5CGM A;  1D1B A;  4LMK A;  5KZU A;  3CPZ A;  4PK4 A;  1CHU A;  2BG9 A;  4TNW A;  4LML A;  3HR0 A;  4YLH A;  1FMV A;  5L3C B;  4UM3 P;  3N2O A;  1UW6 A;  5IWA T;  4DR6 T;  1YD8 G;  4NUV A;  2XAS B;  3HA4 A;  5HEU A;  3UU4 A;  3U8L A;  4LF8 T;  2KWI B;  2LKH A;  5IYZ E;  1LKX A;  1W0A A;  4PNI A;  2Y48 B;  4CXY A;  5JDL A;  2MTQ A;  4LFA T;  2IC6 A;  3E0Z A;  5AIN A;  3SQ9 A;  3E22 E;  1W9R A;  4ZJS A;  1UUR A;  2Z6E A;  2CWO A;  5M4Y A;  3KV5 A;  4AQF A;  5L4E A;  3SS1 A;  2J1D G;  2D2S A;  2XAG B;  2XAH B;  5FXV A;  3C79 A;  1WLX A;  3MK7 C;  2FJA A;  4DR5 T;  2K9A A;  3U8J A;  5FVL A;  3Q5D A;  5AQM B;  3JC6 D;  2QC1 B;  5KX5 E;  2YU1 A;  4ZK4 A;  3DTO A;  3PUG A;  2BR8 A;  3P50 A;  2W0G A;  2C5I T;  5FVK A;  4IT4 A;  4AIU A;  5AQH B;  3KV4 A;  4ZXL A;  4FJO A;  1XWM A;  4UF0 B;  4QWN B;  3U3I A;  3ANW B;  3ZST A;  2LHR A;  4UR9 A;  4CXX A;  2CHN A;  3H3M A;  1E2A A;  3WTI A;  4TWF A;  4IDP A;  1UX2 A;  2CBI A;  2H3R A;  1W0B A;  4KI0 F;  2A2F X;  3SFD A;  3C4W A;  2UXN B;  2XQ8 A;  2ACX A;  3RYC E;  3HKD E;  3AEB A;  1IZN B;  5KDM C;  4QAA A;  1IBK T;  3U8N A;  2CPT A;  5LMU T;  2CM0 A;  2LLY A;  1WYC A;  4ILU A;  4EED A;  4OK0 A;  1Z0P A;  3J9X 1;  2IML A;  2B1E A;  2CMR A;  2KT9 A;  4EOZ B;  2KWH A;  1FIO A;  3ONJ A;  2LKG A;  5HXR A;  2NW8 A;  2BDE A;  5JDQ A;  5CA1 E;  4DV5 T;  4O4J E;  3ONL C;  4L5G A;  4P0B A;  4AQG A;  3PMZ A;  4WYV A;  1ZEE A;  2FUP A;  4LF5 T;  3KIN B;  3AEC A;  4U3C A;  2CE7 A;  3RHW A;  2WNC A;  2V5C A;  1N32 T;  4IE0 A;  4HFI A;  4AKR B;  4BQT A;  4GKK T;  1MMD A;  4HWI B;  2K24 A;  2UUA T;  2BKN A;  3V5U A;  2JMK A;  3A5X A;  4XBF B;  2UXC T;  5JR9 B;  4X1Y E;  2UXB T;  2F4V T;  2JIW A;  4QX7 B;  3AE7 A;  3N5L A;  3FZF B;  4H9Q C;  3ZT7 A;  3AED A;  4EYY R;  3PUS A;  1JNZ A;  3NVO A;  5HXS A;  3HL6 A;  4TWH A;  2DWK A;  4MAL A;  1U5P A;  2XQ5 A;  3WAJ A;  2ZM2 A;  4EZ1 A;  5AQT B;  3QUJ A;  4C91 A;  4PK6 A;  3P4W A;  5AFH A;  1HCI A;  5AFM B;  2VWA A;  3UFG A;  4DBM A;  3AXJ B;  5KE4 A;  5LGN B;  4YHJ A;  1IJ5 A;  1LVK A;  2KMF A;  3VKH A;  2CBJ A;  5LOV E;  5JQG E;  3OTO T;  2LSK A;  1XNQ T;  3AA7 B;  3KBU A;  4EIW A;  5LBM A;  2VVS A;  4QHO A;  3WTM A;  1WRD A;  4H9N C;  4KP3 C;  3IBP A;  4U74 A;  3A7M A;  4ZK1 A;  5AFN A;  2YIN A;  3RYI E;  2PGZ A;  2E9X B;  3MA9 A;  3PUZ F;  3ZYM A;  2X9H A;  2IIU A;  3O1J A;  4H63 H;  2WS3 A;  4U2Z A;  4JI8 T;  1YQ4 A;  2LOP A;  2QYW A;  5AQN B;  4BJM A;  5AQI B;  2I6H A;  5J2U E;  2FBW A;  4WV9 A;  4TNV A;  4X1K E;  2YN6 A;  2LSY A;  4UXN B;  1HG2 A;  3UU6 A;  3EHZ A;  3RIU C;  2XAJ B;  5LGU B;  2ES0 A;  2X00 D;  3A8Y C;  4DR7 T;  3AE2 A;  2W62 A;  2IC9 A;  4U31 A;  4XK9 A;  2X9Y A;  2Q9Q B;  3SRZ A;  3MXZ A;  3CVR A;  2XM2 A;  2YU2 A;  3O9X A;  1WR6 A;  2CLY B;  2CXL A;  2D9D A;  4WBN E;  4A98 A;  2D0T A;  3LSV A;  3P4Q A;  2X0Y A;  2NOX A;  2WDV A;  2ODV A;  4B5D A;  3CWZ B;  3AB3 B;  3U78 A;  3PDY A;  2H7V C;  2CEA A;  3UTK A;  2VUR A;  3PUR A;  3OVU A;  4IDQ A;  3F57 A;  2BS2 A;  3T1H T;  5F3J A;  3AA1 B;  2D0U A;  4DND A;  2XQ4 A;  2M6I A;  5JRC B;  3H37 A;  2H88 A;  3AE9 A;  3P8C D;  4NIQ A;  4JI2 T;  3L09 A;  4B3M T;  2BYS A;  2ACZ A;  3RKO A;  4Z90 A;  4HWF A;  3Q2M A;  5EK4 A;  3ZMT B;  1KEY A;  4UEM A;  4FI5 A;  4DUZ T;  1WR0 A;  2ODU A;  4LF4 T;  4PIR A;  4KHZ F;  5ADX L;  2BKO A;  2W8G A;  4X1I E;  3PEO A;  2E5L T;  3EDU A;  4DR2 T;  4B6X A;  4U7Y A;  1J5W A;  5HCM A;  2XZE A;  3QK6 A;  5DJQ C;  4ZR6 A;  5LNK A;  2JRK A;  2VKO A;  5LGT B;  2DLR A;  3QB5 A;  3M3Z B;  3ZKR A;  3N2K E;  3ZDG A;  3OKQ A;  4HGA A;  3NZQ A;  4DMV A;  4TWD A;  5J2T E;  5ABF B;  3AE5 A;  2JQH A;  5JR9 C;  4X65 T;  4JI3 T;  4H9S E;  4PJN A;  3AVS A;  3KBT A;  2YDQ A;  4PK5 A;  1QUU A;  4UVA B;  4JI0 T;  4YSY A;  2WBL A;  1KFY A;  1B7T A;  4AKL A;  2N9D A;  3NZP A;  1HX8 A;  2BVL A;  2VK9 A;  4OHF A;  4UV8 B;  2X00 A;  4X66 T;  2YME A;  2MOZ A;  4KX6 A;  3JCF A;  3QOF A;  2G0U A;  4UY2 A;  5H6Q B;  2V26 A;  2WZI A;  2XUE A;  2MBG A;  4H9O C;  1HNZ T;  2PBI A;  4CN4 A;  5JDM A;  3ZDH A;  3RIF A;  4J2C A;  5FKY A;  5FL0 A;  5AFK A;  2X0L B;  5AQR B;  3O4X E;  4YSX A;  5J5I A;  4YY3 T;  4HWC A;  2BS4 A;  3LFM A;  3NBX X;  1QSD A;  3KDS E;  2E9X C;  4ILA A;  4CN1 A;  1VCT A;  4K0U A;  3ZMV B;  5LMN T;  3IF8 B;  2DCF A;  3RRW A;  4UM3 S;  3WAK A;  4JI7 T;  4P0A A;  3SQ6 A;  4CN6 A;  4UXU A;  1M7K A;  1D1C A;  4ALX A;  2I0M A;  3FZH B;  4AFT A;  4B3T T;  5F8P A;  4DR4 T;  5LXB A;  2A3D A;  2XZ6 A;  3JAD A;  3KVB A;  3U8K A;  4H63 V;  2K48 A;  2V7M A;  4JI1 T;  4NUU A;  3OJA A;  5JDF A;  3GUA A;  2Q9Q C;  4DV6 T;  2W8F A;  2VVN A;  4EEB A;  2M67 A;  2JMH A;  5HWX A;  2CLY C;  4A5X A;  2NP9 A;  5TVC A;  2WM9 A;  4ZZB A;  5HCJ A;  2HN1 A;  3AE1 A;  4IE7 A;  3TKL B;  4JI4 T;  3RQU A;  3GWH A;  3AAA B;  2LRL A;  2JPF A;  3K8P C;  2WNL A;  3GN5 B;  3AA0 B;  1HS7 A;  5FXX A;  4LF9 T;  4GIW A;  3D0T A;  2C0S A;  4LF7 T;  1MMN A;  3NWI A;  4PFP A;  2YKS A;  3C4X A;  2BG9 E;  1EZ3 A;  1ZHC A;  3ESL A;  3VRA A;  2CA5 A;  3L8R A;  5FMN A;  3K3Q C; 
#chains in the Genus database with same CATH homology
 3PEO A;  4LML A;  4UM3 P;  4ILA A;  4WV9 A;  4TNV A;  3WTI A;  4ILB A;  4TWF A;  4BFQ A;  1UW6 A;  2YN6 A;  2BYR A;  2Y57 A;  2XQ9 A;  3WTH A;  5JME A;  2M6B A;  1UX2 A;  2BG9 B;  5CO5 A;  5HCM A;  5LG3 A;  5HEU A;  1OED E;  3UU4 A;  4ZR6 A;  3EHZ A;  3UU6 A;  3UQ4 A;  2YMD A;  4UM3 A;  3U8L A;  3EAM A;  3WTL A;  4QH1 A;  2XQ8 A;  5HEG A;  2XNT A;  4UM3 S;  2LKH A;  3WTO A;  5L47 A;  2BR7 A;  2X00 D;  3ZKR A;  5HEJ A;  4Z91 A;  2BYP A;  4LMJ A;  4HFC A;  2WN9 A;  2BYQ A;  4HQP A;  3TLU A;  3ZDG A;  4QAC A;  1OED B;  3SQ6 A;  4XHE A;  5FJV A;  4TWH A;  2XZ5 A;  5J5F A;  4TWD A;  2XQ3 A;  4UXU A;  4IL4 A;  2C9T A;  3UU8 A;  4XK9 A;  5BRX A;  2XQ5 A;  4ALX A;  3TLW A;  2UZ6 A;  4AFT A;  4EZ1 A;  4COF A;  4QAA A;  4UM1 A;  2BG9 C;  4HFH A;  3TLS A;  1I9B A;  2WZY A;  2BJ0 A;  3U8N A;  2YOE A;  5J0Z A;  2Y58 A;  4D01 A;  1OED A;  3P4W A;  3TLT A;  5LXB A;  3EI0 A;  5AIN A;  3SQ9 A;  5AFH A;  4HFD A;  5AFM B;  2XZ6 A;  2LLY A;  3JAD A;  4A98 A;  2Y56 A;  3U8K A;  5BP0 A;  2X00 A;  4ZJS A;  3LSV A;  2WNJ A;  2BYN A;  4DBM A;  2XYT A;  4AFH A;  5L4E A;  5J5G A;  1OED C;  3TLV A;  3JAE A;  3RI5 A;  3UU5 A;  5KE4 A;  1UV6 A;  2YME A;  2VL0 A;  2XQA A;  4NPP A;  5BW2 A;  5L4H A;  5AFJ A;  2XQ7 A;  3C79 A;  3GUA A;  4QH4 A;  4HFB A;  4X5T A;  3WTK A;  3JAF A;  4B5D A;  3U8J A;  2W8F A;  2MAW A;  3RIA A;  5AFM A;  4IL9 A;  4UY2 A;  5HEH A;  4A97 A;  2QC1 B;  2KSR A;  2XQ6 A;  2ZJU A;  3UUB A;  3WTJ A;  2LKG A;  3WTM A;  2XNU A;  5TVC A;  4ZK4 A;  4QAB A;  4ZZB A;  2BR8 A;  2M6I A;  2XQ4 A;  5HCJ A;  2PH9 A;  5SYO A;  4ILC A;  5CFB A;  3U8M A;  4HFE A;  3UQ7 A;  4ZK1 A;  3IGQ A;  3RQU A;  4AFG A;  5AFN A;  5HEO A;  3P50 A;  2PGZ A;  4F8H A;  3UU3 A;  3ZDH A;  4ZRU A;  3RIF A;  3T4M A;  3SIO A;  4ZJT A;  2ZJV A;  3PMZ A;  4ZZC A;  4IRE A;  5AFK A;  2WNL A;  5J5H A;  3WTN A;  4NZB A;  2BYS A;  4Z90 A;  3RQW A;  5J5I A;  4QH5 A;  4FRR A;  2Y54 A;  3WIP A;  5AFL A;  3RHW A;  2WNC A;  4HFI A;  2LM2 A;  2Y7Y A;  3C84 A;  2YKS A;  4PIR A;  4BQT A;  2XNV A;  5IUX A;  4LMK A;  5KZU A;  2BG9 E;  3SH1 A;  2W8G A;  2BG9 A;  4TNW A;  2XYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...