2BGCA

Prfa-g145s, a constitutive active mutant of the transcriptional regulator in l.monocytogenes
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
235
structure length
234
Chain Sequence
AQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICSQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLAPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRFA
publication title The Mutation G145S in Prfa, a Key Virulence Regulator of Listeria Monocytogenes, Increases DNA-Binding Affinity by Stabilizing the Hth Motif
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transcription
total genus 77
structure length 234
sequence length 235
chains with identical sequence B, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2004-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2bgcA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bgcA01
3F8FA 3GBFA 3FZ3A 4RAYA 1V4RA 4XF0A 3M3IA 2K86A 1ZH5A 3VHRA 2P6TA 2DCTA 1G3YA 2W25A 2OA2A 3WU0A 2ZKLA 1FY7A 1R58A 2CFXA 5LHHA 3HSEA 4MV2A 2NNYA 1OYYA 3U1DA 2GWRA 2A68F 4ESJA 2CAUA 4XF3A 1X7NA 5FD5A 4OIOF 4LK1F 4YG2F 2PBIA 1BM9A 3RI4A 4IEOA 5J3UA 1O3QA 2LF8A 4HAMA 4EM0B 4BH9A 2D2WA 1I5ZA 5L3GA 4WK8F 4EMSA 1PDNC 3CUQA 1P4XA 3PFIA 5CVRA 3R4KA 4B29A 2DW4A 4HBNA 1ON1A 4Q5SF 1ZN2A 1J59A 4I2OA 2VECA 4MX3A 3EYIA 5ICFA 3GXOA 2XL7A 1FBUA 4L5IA 3GFIA 1DUXC 1UCXA 3BJOA 4IEQA 1OR7A 4EJOA 5BQTA 1T38A 5JI6A 4XSXF 3CUQC 4KMUX 1KU2A 3KP4A 1ZZ9A 4IHTA 1JE8A 1ZREA 5L3CA 3I5UA 4P5OA 5HLIA 2QYOA 2PG4A 3RNSA 5BMZA 3ZPLA 1B1BA 3UKVA 1F1ZA 4EWEA 3UKNA 2Q0OA 2MLGA 1VTNC 2D45A 1SAXA 2MNGA 3MWMA 1CAWB 1QO0D 1XDUA 3HOTA 2XASA 2ESHA 3QP5A 3FHZA 3EQLF 4GYGA 4EM2A 3KGLA 3L9FA 3KSCA 1QXRA 1J5YA 5HDGA 1ZZ7A 2PEXA 1HW1A 2B5HA 4A6EA 1ZAOA 4HF2A 1IUYA 1G6NA 2GA2A 4LK0F 3DF8A 3RZZA 1YIOA 1IN8A 3IC7A 5DD8A 3HTSB 2YX7A 1T0FA 4E70A 4GO1A 5D6EA 3MZYA 4Z07A 2UWMA 5H20A 3IRQA 3JZVA 3CLPA 1G3WA 5TRDA 1IXRC 1FT9A 4RB2C 2HDCA 2Q30A 3IWFA 2IVMA 3ULQB 1W5TA 3B73A 3J80Z 2BBYA 2JPCA 2STWA 1FI2A 2O1QA 4WVZA 3OD0A 1EYBA 3EJKA 2ET1A 4M71A 1R1VA 3H7YA 1O7LA 2FNPA 5DCFA 4HLTA 2MBFA 4XETA 1KA8A 3R60A 4JVAA 5E8IA 5HS7A 3PVBB 3WTTC 4HN1A 2ISZA 1TTYA 2XAHA 4GXOA 3FF5A 5DUIA 2YSRA 1NZCA 2IJLA 3C3VA 5D8KB 4GCVA 1IN6A 2QNKA 1CAVA 4E2GA 2P5LC 1B9MA 4LB5A 3P7NA 4PGGA 1CAXB 3T0YA 2EAAA 2VXZA 2XAFA 4LEJA 1QXJA 1QGPA 2HKOA 5BUVA 4LUKA 2DQLA 1SFUA 4FX4A 4RGRA 4M9XA 5L3EA 3E97A 4ZYGA 5JR7B 5E1XA 4EROA 3ML6A 3NJZA 3H50A 2FXAA 1RTVA 1CF7A 4IPAA 1DZRA 4BHBA 4G6QA 2XIGA 1IN7A 1O4TA 2V6CA 2AXLA 1XSVA 4U88A 4WXDA 1U3EM 2R7FA 4QLCU 3HIFA 1QWRA 4XFIA 3SXYA 4HV5A 1XRUA 2O8XA 3U0ZA 2H0VA 4L0YB 1O7FA 5LLQA 3OTFA 2HEOA 1DGRA 2WV0A 1L0OC 3MAJA 3BB6A 1XMAA 4HN0A 3WTXC 4ENKA 3U11A 3H1MA 2X0LA 1YS7A 4K2EA 2ETHA 1SFEA 2EFPA 2RC4A 1EH6A 1F9NA 3DKWA 3F22A 1P4WA 3WTWC 2ATFA 4J1XA 3QPTA 1C0WA 4PIXA 2VONA 4HMZA 3KEQA 2MC3A 1U2WA 5KVRA 3NQOA 2EV6A 4WBBA 4ESBA 4GGGA 4OMZA 3I64A 1WQ2A 4L18B 3ZMZA 1PP8F 4Q4ZF 5LHIA 4LD5A 3HOSA 5I91A 1XSXA 1Y0UA 1SD7A 1UFMA 4BQAA 3MQ0A 4QM9A 3Q5FA 5KHGA 2HWVA 3GWZA 3BJ6A 1YW8A 2Y48A 3ERED 1LKNA 3LQRA 5HLGA 4I7HA 1HQCA 5FQ0A 1W5SA 2FMLA 4IJAA 4ZU5A 3JAMZ 5FD6A 3TOAA 1V70A 1Z05A 1FC3A 1ZRRA 1BIAA 2EA2A 4MEXF 2MD5A 2VODA 1O57A 1XCVA 4EQQA 1R00A 4D0PA 4AVCA 4UVBA 2OZJA 4PZJA 2DO7A 1HBXG 1YLFA 1LDJA 2M5WA 4FHTA 1YFHA 4HX8A 4HF0A 5LBQA 5KHHA 4Q47A 3NL1A 5DEQA 4MQVA 5FLXK 1VP6A 4KFCA 4IXAA 2P7CB 3T1BA 4B8XA 1SD5A 4IF4A 1RUNA 1IRFA 2V1UA 5HS9A 2QBYB 3BROA 4U0WA 1Z91A 1H9GA 4CGZA 2FBHA 5E20A 2XGXA 4FBFA 4G7ZF 1DPUA 1EY2A 4TV7A 1T98A 3GO5A 3DEUA 5K1YA 3RPUA 2IXIA 4JTNA 2GC3A 3ST7A 2XL9A 2LSOA 1GVJA 4HYEA 1FLIA 2DTRA 3M8FA 2A6HF 3GYHX 2ZJ2A 2PQ8A 3F21A 3FMSA 2K4BA 1ZRCA 1BIBA 2FA5A 3IHUA 1Q1HA 4UXAA 2PTMA 3FX3A 2P4WA 1ZZ6A 1FP1D 4LA3A 4G7HF 1MJBA 4YSFA 5FLXZ 2G7HA 4M9SA 1TQ5A 2D93A 3JSOA 1J1LA 4IEXA 4ZYHA 1MD0A 4A0ZA 2KKOA 2FF4A 3LAJA 5FO5A 3TQNA 2M87A 3SZTA 1L3JA 4RGUA 3WGIA 2L54A 2GH2A 2QM3A 4O3MA 1ZHFA 3OOPA 3E5QA 4EM1A 2P5VA 3E6BA 2E9QA 4MQ9F 2FRHA 2M45A 2QDRA 4KN4X 1YHFA 4PGHA 2BEOA 2G7UA 1J75A 3QACA 1NHAA 2F2EA 1K6OA 5K8SA 2PHDA 4UUVA 1U5TB 2ZFWA 1IN5A 2XHKA 4HQEA 4CICA 2TDXA 5EZWA 1DDNA 2BNNA 5FPXA 3WTYC 4IEYA 3GLXA 3TO6A 2O0YA 4OMYA 2J5OA 4O5VA 1U12A 3J81K 4N9IA 5HDKA 4UV8A 1QPMA 1VJ2A 1YG2A 4CXFA 3ISPA 1RIOH 1G3SA 5FPZA 3RKYA 2IRFG 2VC0A 4D7TA 1P6RA 2A6EF 4DINB 5I8YA 2EVXA 3RKXA 2KJCA 4JV4A 3KZYA 3OCPA 1JUHA 4N0BA 5F64A 2IXKA 5LGUA 1STZA 4RB3C 3MFKA 2F5DA 2B0LA 4L9TA 3H9AA 1TQMA 3KP3A 3CJNA 3E6CC 2YR2A 2DT5A 2CGPA 1EH7A 5D6FA 2QCSB 4AD9A 1ZG3A 4HBLA 1FYMA 2EV0A 4IRGA 5CU1A 4BNCA 4XEZA 2UZKA 1B9NA 2VE8A 3CO6C 3RIRA 3HT1A 4LLOA 2Z69A 4ONUA 2GC0A 1X8MA 1LVAA 3J81Z 3CUOA 4IETA 5ILVA 4MH0E 4MGKE 2D5FA 1IZ1A 3DPLC 3HSFA 2GA1A 1SMYF 1HKTA 5HOOA 5D5WB 1ZGJA 3ZN1A 4FX0A 2Q4SA 3N4MA 3W6KB 3D5LA 5F6FA 4KWLA 1YYVA 1RZ4A 3SHRA 3I54A 1B4AA 1YW7A 1K78A 1EV7A 1V3FA 4AWXB 1ZZBA 5J48A 4U0VA 1T6SA 1RL3A 4MTEA 1MDMB 4L5JA 2IC1A 3LA2A 1FXZA 1JXSA 1B59A 1OFNA 3V7CA 3ELKA 4M6YA 1XGSA 3O2PE 3C18A 1NE6A 1QZYA 4ENNA 3G7DA 3TKYA 3IDCB 4YFXF 1WSUA 2HTJA 3I59B 5DCMA 2Z2SB 1YFYA 1SD4A 5EEHA 2JTVA 2NNNA 1UW8A 2RKHA 2Y75A 5CYVA 3V7RA 4M9ZA 5BV6A 1XE8A 2HZTA 2FBIA 2XVCA 2WWYA 4Y15A 1OD5A 1FP2A 3FHIB 1CX4A 1JGSA 1W7PA 4WCGA 1R1TA 2KRFA 4EGZA 3ZMVA 1I1GA 4AIJA 3L00A 1FSEA 3KMHA 3SCGA 3R0JA 2RQPA 3TGNA 5HLHA 2OYZA 2XAQA 5EFUA 1QNTA 2VBWA 3I7DA 5HI0A 3TNPB 3QU3A 2PI0A 1RGSA 4XF1A 2IXJA 4K8FA 1IRGA 2QLZA 4LFUA 3S7EA 2VBZA 3D0SA 2EFWA 2MLKA 1BI1A 1P4AA 2CAVA 3DN7A 2GIVA 1L3LA 2QZ8A 1I1SA 3LA7A 4AIKA 1IPKA 1OKRA 3G3ZA 2MH2A 2H27A 3MEXA 2PLYA 2Z9OA 2DK8A 2FNAA 5J6XA 1ZNPA 4P96A 3WTZA 1E17A 3WTSC 4A5NA 2GAUA 4BXUA 1U78A 4RB1A 1F5TA 4ORFA 5A2QK 5ICEA 4G9YA 2JPBA 5BXXA 3V8LA 4HLXA 5FFZA 1DGWA 2H6BA 2IXLA 3H7JA 4RGXA 1KGSA 3U2RA 4LLNA 4L11A 1MKMA 1R5HA 5ICGA 4XLNF 1FBQA 1T39A 1J3QA 3IBMA 4GYIA 4LJZF 1J58A 3NW4A 4ZU7A 2IA0A 2PFBA 3EYYA 4Y17A 1YTYA 1ZX5A 1S7AA 4JK1X 4ETSA 4F8AA 2JSCA 4LGWA 2Q1ZB 4MNUA 4CDGA 3USSA 3SCHA 3HHHA 4AQ6A 1ZRDA 4CYDA 2GU9A 3CTAA 5ERIA 4A5MA 3JTHA 2EJRA 3H8UA 4UBHA 3K2ZA 4BHCA 3M1EA 2PMUA 3VB2A 3FM3A 5TJJA 1REPC 3S0MA 4EWDA 2BE5F 3KEOA 3R0AA 1KU7A 3IDBB 1YFXA 3BWGA 2ZBKA 2IT0A 3BPXA 2GXGA 3DL3A 1I6XA 3OF1A 6PAXA 3RPQA 3LWFA 2AS5F 3I71A 3LZZA 4NHJA 2UXNA 2OZ6A 4RB0A 2CSOA 4P9UA 5C6CA 3F3XA 3KFWX 5L3FA 3EQEA 3WE2A 3CUQB 5DDGA 4MGRA 1YUDA 2L01A 4EJWA 2GC1A 5DD4A 3ABTA 2JT1A 3NRVA 3T8TA 1PMIA 3EO6A 2F5EA 3LAPA 1BJAA 3H3ZA 4L2NA 3V8JA 3QOPA 4QXKA 5FFXA 1FSHA 1A04A 4CZZA 3F8NA 2ZCWA 2ZNZA 1Z6TA 3D0JA 1BI0A 5E18F 1YFUA 3ELNA 2PAEA 2K4JA 4UV9A 3H1YA 3FJSA 1QBJA 1K79A 4UXNA 3T5XA 4YFNF 3DXJF 2FU4A 1S6LA 4HW0A 2K0GA 3ZMDA 5BOXA 2ELHA 1IXSB 4YRDA 4P9GA 4L9NA 4BAYA 3P9CA 3NEUA 5LGNA 2IW5A 1SD6A 1FX7A 4DNCA 1PUEE 5FCCA 4ENMA 5BY5A 3RDIA 1SFNA 1GXPA 2H6CA 2WFPA 4HV6A 3EUHA 4OIPF 3CLOA 1ZARA 3O3KA 2OAZA 4KIBA 2EFOA 3GZ6A 5BPIA 3FMQA 1UCRA 2M1BA 5AIQA 5E16A 3JTGA 2YU3A 4IEPA 3IRRA 3TDZC 1ZZ8A 3PQJA 1LJ9A 1ZZCA 4QM8A 1D8JA 1CAUA 5CVJA 5FDBA 4MHGA 5JR3A 3QAHA 4WXCA 5I0SA 3WTUC 3F8BA 4IEUA 3LSTA 4OLLA 4HVRA 2KIFA 4EGYA 1R5GA 5JCTA 1XCBA 5CADA 4AIHA 2EV5A 1YO5C 3OV8A 5J8CA 2XRNA 4XFFA 3HT2A 3M70A 3TNQA 1OYIA 4XBFA 1WKMA 3MZHA 4KUMA 4EJUA 2DFIA 1H9TA 4PJYA 1J2XA 5KHKA 4X6QB 4AVBA 3Q9VA 1TQPA 2Y0OA 5KBFA 4BIFA 3IL2A 4FAGA 3IWZA 4G8XA 4EVIA 1CAVB 2F5CA 1XE7A 3WW3A 4S04A 2XKOA 5JHUA 4OINF 4X6RB 3JSPA 1BOAA 3K1MA 1IW7F 3CF6E 3NKTA 1R23A 5IT9K 4DQ2A 1XMKA 3BJAA 1LQ1A 2EK5A 2OQGA 1QZZA 4O6JA 3GW2A 4BYYA 3E6DA 1FPQA 4ZYEA 2QQ9A 1CF7B 2A3SA 1ONVA 4WF2A 2F5FA 2O6GE 4EWAA 3HTUA 1BI3A 1RC6A 3GFLA 4MZUA 3RYKA 1P92A 4MEYF 2DK5A 3EDPA 2XAJA 1ZG1A 2HGCA 4U7DA 2PA7A 2KXLA 1MZBA 1HSTA 3HQXA 2HQNA 1UD1A 4HDVA 4O9GA 2QUFA 3E5XA 3UKTA 1YFWA 2RGVA 2Z5UA 2XAGA 1VR3A 1TNSA 4HOBA 1OMIA 2OU2A 5I93A 4HF1A 3NVCA 2NRAC 4QGNA 5D4RA 1UHWA 2K9ZA 1XGOA 1CGPA 1R1UA 1MJAA 3R61A 4HVOA 4AXOA 4JBAA 2A61A 3CO2A 2ZMEA 2MA3A 4YIFA 5D5XB 2WTEA 1XD7A 1LB2A 5I0UA 1LDDA 3GFMA 1HKSA 5HDNA 3JW4A 3VFZA 4QGMA 2MH9A 2NYXA 2KJBA 3KZZA 1WGPA 4ENJA 5CVUA 5C8WA 3QU6A 4AQ2A 2R3SA 2QJVA 1Q3EA 2O3FA 3F6OA 1PP7U 3GFJA 1OI6A 2NAZA 3KP7A 2EWNA 3TDUC 2RDPA 3LA3A 4HA8A 3WGHA 1HW2A 5ED4A 3K69A 5KK1A 3ZMSA 1Q5OA 5FQ0B 4XFHA 1SQ4A 4QGLA 1R22A 1OYWA 2C0ZA 2PAKA 4AVAA 1NYWA 3EETA 3FXRA 2A69F 4CHUA 2STTA 3C3WA 4A2UA 3ZN0A 4HX7A 5DYMA 4OOIA 3SFZA 2Q0AA 1FYLA 3IIAA 4FT8A 2G9WA 3J7AO 3ROUA 4YARA 1S29A 2VT2A 2EFQA 4Q0QA 2QVOA 3E3VA 4NVPA 4KIFA 3WW1A 3SMHA 2QQAA 2F4PA 2FQPA 3TO7A 1KQ0A 5K5RA 3GX4X 3LQQA 4L0ZB 4UVAA 2A07F 2LKPA 4OIQF 4R52A 5FLHA 3DQVC 1J0RA 4EJTA 5E17F 3FFQA 2L4MA 5I8SA 3RKWA 2W57A 4Q29A 1YW9A 2COMA 2J5PA 5J7MA 4KT5C 4F7ZA 4LG0A 2XKPA 3DP7A 4L9JA 5JSOA 2XROA 1ZRFA 2M30A 2L02A 3CEWA 3S2WA 4HSJA 1OPCA 2HOEA 2D5HA 3P9KA 4KA4A 2IXHA 1R7JA 2E7XA 3IKVA 3HRSA 1IF1A 4HDUA 1XDSA 3WW2A 4HQMA 2RVCA 5I0TA 1QQIA 4G6DA 2VT3A 3R6SA 1H1IA 2ACJA 2FBKA 2GC2A 3BPVA 3LFKA 3N97A 3FMRA 2Z3YA 2V9VA 4I01A 4MTDA 5KHJA 1KU3A 3ACLA 2VOPA 4LLLA 4XF4A 1Z6RA 1HKQA 5F1RA 2OA4A 5LRSA 2VPVA 4I3PA 3HRMA 3U10A 2O8QA 3K0LA 3V7SA 4M74A 3LOIA 3T8RA 1ZYRF 4H7LA 4KYWA 4I0AA 2Q8KA 4ON0A 3NSTA 2VN2A 3K9TA 2UXXA 3FXQA 1X82A 2IA2A 2P17A 2HTSA 3O6BB 2OZUA 2OD5A 3K1NA 3ZQ7A 1RUOA 2DPUA 3WU1B 1CAWA 2M8EA 2OQRA 2PN6A 1D5VA 1UIJA 2KIUA 4P9FA 3ZP5A 2HKXA 1EPZA 4UBGA 3ES1A 3SHFA 1ON2A 1RNLA 3KLOA 1ZLKA 2ESNA 3KP2A 2EA7A 3ES4A 2RV8A 2ET7A 1AOYA 4XRFA 5FGMA 1U8RA 3H1WA 1ZGAA 5DV5A 4I09A 3H92A 5E1RA 3FM5A 3QRFF 4Y13A 3F6VA 3L7WA 4QWQA 3M9AA 4NQWA 4KL1A 5FLIA 2FMYA 4LG0B 4OFGA 4HX4A 1BI2A 1S8NA 4YNIA 3BY6A 3M8EA 4IHSA 2V1XA 4YYOA 3BDDA 4U0YA 2K7LA 1FBSA 3VEPA 1Z1DA 3VODA 4RS8A 2ETEA 3SCFA 3PQKA 2VE9A 4KU8A 5CJ9A 3VOEA 4Q0VA 3I4PA 4XFCA 2DLLA 2DPDA 4HVQA 1UIKA 4META 5ILUA 1CAXA 3EHKA 4P55A 1O5LA 5LEKA 3RTRA 1HSJA 2VBYA 5D8LB 3PLQA 3HRUA 4XF9A 3SXWA 1W7PD 4UHTA 3LAGA 4TLFA 3DFGA 1AWCA 3SZPA 3HRTA 4M6XA 5CLSA 1K78B 1ZVFA 2FOKA 4QMAA 5AONA 1Y3TA 3MPBA 2VBXA 3SQNA 3DV8A 2HYFA 2HR3A 1Q43A 1MJ9A 3FXUA 4R8HA 1GHCA 3WW4A 3L2HA 2P5KA 3GUDA 2QVSB 5K5OA 2IP2A 3J80K 3C7JA 2UYAA 1BC7C 5JSRA 4MGYE 2VOOA 5DCMB 3WTVC 2DBBA 4KICA 2XLGA 4LA2A 2E1NA 4A12A 5ILSA 1O3RA 3BU7A 5JFRA 2ISYA 2RN7A 4IRHA 5LEJA 2BGCA 2PHLA 2CO5A 5A2QZ 5FB2A 1W7PB 3GEZA 2XLFA 3EBRA 4M72A 3Q9SA 4RAZA 1BN5A 3G73A 3FWEA 3ABUA 4KU7A 1IPJA 1X3UA 2CG4A 3ZDSA 5JSPA 3WG9A 2E7WA 5D5VB 4I0BA 5FLJA 5H6QA 5HVQC 1JHHA 2BYVE 2YPRA 2PYTA 4IRIA 3KCCA 3U9GA 4UNOA 4LMYA 2Z99A 2P6SA 1XN7A 3GF2A 2XUBA 2OPKA 4IEWA 4M73A 3WODF 1G4DA 1O3TA 3ETQA 1W4MA 2XLAA 1NXMA 3WGGA 3BPZA 2QWWA 2EFNA 3GYDA 4XFAA 1G3TA 4IERA 1TLHB 4NB5A 1JHFA 1J7KA 5AIPA 4OIRF 1EP0A 1UPIA 5E1WA 4JQFA 3GZ5A 4Q48A 4XSZF 1QY4A 3RYRA 5JVTA 1FNNA 4MGZE 2ZO4A 3F8CA 3RYPA 1TQIA 4LB6B 2P8TA 1XGMA 4IEZA 4ZU4A 1WA4A 2O03A 2B9UA 2K27A 2LNBA 2QBYA 3TOBA 1NE4A 2ADUA 3QP6A 3KETA 2PQQA 1GXQA 1UHMA 3K1PA 2LF7A 4ZZLA 5J8FA 1WWXA 4XFBA 2BNMA 1O5UA 4ESFA 2H94A 4KNYA 3PNAA 4KN7X 4IEVA 1TNTA 2OBPA 1U6GA 2DQRA 2L4AA 4XFGA 1ODDA 4U7BA 5HS8A 2CV6A 4WZCA 1FYKA 4KDPA 2K02A 4QX5A 3JAMK 4A0XA 1S3JA 2QENA 4O9EA 4Q0UA 1D8KA 2BNOA 2CW0F 3ECHA 1J3PA 5AVPA 1GQHA 3OGJA 3B02A 4G7OF 5D5UB 2L3DA 2XV4S 1R36A 3W6JB 4XLPF 3KE2A 4OU0A 4B09A 1KU9A 1WRJA 1BC8C 1D3YA 4LTAA 4ZYDA 1KQ8A 2VQAA 1SFXA 4KMFA 5D1IA 3O14A 4MUVA 1DPRA 4I98B 1T2KA 2R7DA 2LDUA 4GULA 5IT3A 2HJIA 2BV6A 4D7SA 1I27A 1RI7A 2IA1A 4Q0PA 5KHIA 1J3RA 1SMTA 4CO8A 2ZKZA 3KP6A 1LDKB 4WWCA 5CVVA 3KP5A 4ZH4F 2GQQA 2V1DA 1U5TA 4PDKA 2IPQX 4Z2YA 5LHGA 3MDPA 4I02A 3ECOA 1GQGA 3AAFA 3L2CA 4EJVA 3CDHA 4AVPA 1Z7UA 3HSRA 2WC2A 5EEGA 2HQRA 2UY9A 2RNJA 4EV0A 5BS6A 3HHGA 2Z33A 1XB4A 4BHPA 1MGTA 2C6YA 4HZFA 1U5TC 2JRTA 2ZNYA 1TW2A 2CWEA 2DU9A 4LLGF 3BCWA 3GVAA 5L3BA 4Z82A 4G94A 2H09A 5IT9Z 1SEFA 1KQ9A 2PFWA 1XGNA 2NS0A 3WE3A 4ASNA 2QQBA 1J9IA 3RJPA 2GZWA 4KWJA 1FOKA 4N9HA 2IXCA 2DI3A 1CAUB 1S7OA 2P7VB 2D1VA 1F4KA 4PCQA 1EH8A 5JAXA 3CL1A 3CJXA 1DP7P 4S05A 2GXBA 3F8MA 3IKTA 4R1HA 2Y0MA 2DAOA 2MHFA 3BOQA 2PMHA 2O61A 3BALA 3KGZA 5CVIA 2FSWA 3D82A 2ZXJA 3MYXA 1USSA 4IVNA 4YIIA 1YLLA 1K7AA 1PM7A 3M7GA 3DPTA 1USTA 1WLTA 2W24A 1H0MA 2D1HA 2CYYA 1YS6A 2PAMA 2V09A 3ZMUA 3KLNA 4RD7A 2V79A 1LR5A 1H1MA 1MDMA 5I8TA 4A0YA 4UVCA 2JZYA 1LEBA 1E2XA 5DUKA 1ZG5A 2FEZA 2HFHA 3HYIA 2B8MA 3HUGA 3I58A 1BBYA 1XSDA 4MGIE 1LNWA 3I59A 5ICCA 4YFKF 4HSLA 3MCZA 3C1DA 2EB7A 4HLYA 4LULA 2N7GA 1UB9A 4WX9A 5BPDA 2CQKA 3F72A 1FZPB 1B6AA 5I0RA 1TBXA 2HYGD 4IESA 4PIZA 5E8GA 3BP8A 2Q2EA 4ZZDA 1Z9CA 2HS5A 3TO9A 2I45A 2MPFA 1HXDA 1WI9A 2FE3A 2UYBA 1IN4A 2PJPA 4KWKA 1P2FA 3S7IA 2UY8A 4JTOA 2FQ3A 5K5QA 5T3NA 5LGTA 3REOA 4Q0SA 4R79A 2ZMEB 4FAHA 3LWCA 2D40A 3I53A 3V8KA 4E2SA 3COAC 1IAWA 1DZTA 3H3UA 1Y9QA 2A5YB 1LEAA 4LUMA 4L9VA 1O3SA 4J1WA 1FWZA 4WXHA 1X8EA 3FE5A 2E1CA 1YQAA 5D4SA 2W85A 3QPHA 5L3DA 1TW3A 2W84A 1HW5A 4RGSA 2YX4A 3F23A 1ULYA 3V4GA 3P9IA 2VC1A 1IXCA 4H0EA 3L09A 3FZVA 1YWKA 3E6MA 2X4HA 3BZ6A 1KYZA 5E1ZB 3ZMTA 3E5UA 5H6RA 4PIYA 1KYWA 1ZLJA 3I0TA 2KIMA 4A6DA 4KIGA 1LRHA 5LRRA 4E2QA 3CO7C 5BPXA 2EA4A
chains in the Genus database with same CATH superfamily
4MADA 1A8DA 2PHRA 1NLQA 1R6RA 2DVAA 1NCQC 3FZ3A 4RAYA 2DDAA 1Y0NA 4QX1A 3HNMA 1QDOA 1MR5A 3N05A 2W25A 2OA2A 3DGTA 1U8BA 1T2XA 1VBB2 4OMCA 2ZKLA 4YWAA 1FY7A 2CFXA 4XM3A 3HSEA 3T2OA 4TZDA 4FPCA 1RUI2 3JREA 5FD5A 5B4NA 1HDPA 3NO8A 5J3UA 5T5OA 4QAWA 3WG4A 3V0AA 4EM0B 4K1YA 3LCPA 1LGBA 1UX6A 2VOVA 1JYNA 2DT7B 4EMSA 4QDSA 3R4KA 3S2DJ 5K7PA 4HBNA 2YFZA 1ZN2A 4I2OA 3G1LA 1W04A 3Q3SA 4AI2A 3WF3A 3GXOA 2BP6A 4JHZA 1PO23 1PK6B 2QQWA 4YZ3A 3GFIA 1OR7A 4CCLA 4EJOA 4MIMA 5BQTA 4KMUX 4IHTA 3HJRA 3ILRA 2BUKA 5L3CA 4P5OA 2JG8C 1YYNA 5HLIA 3RG0A 2QYOA 2PG4A 5LZ6A 1ETWA 5BMZA 5C9AC 1B1BA 3UKVA 2W91A 5EYYA 2Q0OA 1QJU1 1WJEA 1VTNC 2D45A 1ND2C 1QO0D 1XDUA 5C8CC 4PF5A 4N7IA 2DMQA 2GM4A 2BVBA 2QQOA 3WQ7A 4EM2A 2RNGA 3L9FA 1HOMA 3CLQA 3WP6A 2WYFA 1PYVA 1ZZ7A 2VULA 5BNNA 3NJXA 2KHMA 3UJQA 4AVTA 4AI1A 1PIV1 2LREA 4CUGA 1YIOA 2HOAA 3IC7A 3MD2A 4LQRA 4GO1A 3VHNA 5L7OA 3FFZA 2RR12 2JG9A 1PVC1 3CLPA 3MF9A 3DWLE 4NQWB 2QQUA 5J3LA 5TRDA 1FT9A 4RB2C 3IWFA 2BBYA 2L7ZA 2R7ZJ 1RVF2 4RR3B 3OYBA 3GTQJ 1JT6A 2YZ4A 1D4M1 3CMGA 2B7YA 2FNPA 2BRTA 5FROA 5DUIA 5A32A 3C3VA 4CDUC 4A3FJ 1G7YA 1X50A 1V5GA 1C57A 1CAVA 4E2GA 2CGNA 2XPJA 3V56A 5DUUA 4LB5A 3P7NA 2VM9A 1EF4A 5AFEA 1AR62 4PGGA 2NP0A 4SBVA 1CAXB 1UXZA 2EAAA 2VXZA 3WG7H 3U1KA 4LUKA 1TT0A 2XC7A 4RGRA 5L3EA 1S0IA 2VMDA 5JR7B 4EROA 2FXAA 1RTVA 3WUDA 4LO4B 1IKPA 3OGVA 2KR2A 1R093 2XOMA 1JOBA 4OQ9A 4GWJA 2VQGA 1RKWA 2R0FA 4ZY9A 1S7EA 2LG4A 4U88A 4WXDA 1U3EM 2E34A 1APNA 1QZEA 4DOUA 1Z7S2 3BZKA 5C3EJ 4XFIA 2LR8A 2D3SA 4LBQA 4UW3A 1WCDJ 4FPYA 4FI9A 3A0HC 2HEWF 4XKCA 3OTFA 5F8PA 2VBPA 1DGRA 3H1CA 2D6PA 4Q4V2 3NNGA 3BB6A 3U11A 3WTXC 1K5MB 2YDEA 2W94A 1UX7A 2DCKA 1DQ1A 3DKWA 3R0RA 3WTWC 2V4AA 2HBTA 2WN3A 4LPLA 3RSNA 2DN0A 2VQ0A 2OJED 1FAYA 3HOVJ 4UFIA 1ZBA3 3K48A 4CH7A 1RUJ3 5L9RA 2EV6A 5F7UA 5GPAA 3WP5A 3KT7A 3UL2A 3HOSA 3ZOBA 5I91A 3N7KA 2EZHA 1Y0UA 1DYPA 5CA6A 5DABA 2UU8A 5J4YA 1T8IA 2AHQA 4CDXB 5KHGA 1X4PA 4FPEA 3LQRA 3HR9A 1TWGJ 4YLZA 2D6KA 1XE0A 2R5YB 3JAMZ 1NA1A 2YBPA 3TOAA 1FPN2 1V70A 1FC3A 4YGBA 1YJKA 2HWF1 2SLIA 4WM7C 1EAH2 3PIOF 4XLFA 4EQQA 2XBO1 1R00A 4D0PA 4UVBA 2VZSA 5H9PA 3EPZA 2OZJA 3DCFA 1YLFA 2W87A 1YFHA 2WFF2 4HX8A 3I2OA 5FY1A 1H4HA 5LBQA 1XB9A 4Q47A 4GWNA 1VNDA 5DEQA 1SVOA 1B72A 5FLXK 1VP6A 5JMOA 4KFCA 3VHOA 3T1BA 5E79C 2V1UA 5HS9A 3BROA 1Z91A 5FKOA 2HWC3 3OYJA 2CUFA 2ZHKA 3MMYB 4C90A 3ZQHA 3ECQA 3DKQA 3GO5A 1A36A 4EN9B 4AEDB 2IXIA 1RPWA 2QQIA 1PNFA 1Y6IA 3ST7A 1GVJA 3P3PA 2KT0A 3GM8A 1AHDP 2VBBA 3GYHX 2J1TA 2ZJ2A 3ZYBA 5C3RA 2E26A 3BTZA 1ZRCA 3LQCA 3FXLA 2FA5A 4UXAA 1FP1D 3VKNA 3ZSJA 3UYJA 2G7HA 3GHMA 1J1LA 2IS1A 4ZYHA 2JDUA 4Q1RA 3E1F1 3AMPA 4PDWB 5FO5A 3TQNA 3SZTA 2FQ4A 2HWD1 3NWKA 1IO2A 3GTJJ 3KS7A 1NG6A 2R1BA 1SLTA 1ZHFA 3OOPA 2X6OA 2P5VA 3TRSB 1MH4A 4LITA 4RN5A 3WDTA 5JIUA 1VMJA 3VZJA 1JUIA 2ZXWH 5FZGA 4MOAA 1UZYA 3OYAA 2NOJB 2RREA 3B93A 1J75A 3N3HA 2LKXA 4LE3A 2DT6A 5J1UA 2PHDA 4D9JA 4KH9A 2ZFWA 1IN5A 1QEXA 1DU6A 4XQ4A 2DCEA 4CICA 3BKZA 3QH7A 1XPWA 2XSJC 2BOLA 3WTYC 1U12A 5HDKA 2PQSA 3BYWA 5JXGA 1VJ2A 1N1SA 4GJYA 1YG2A 4RA0A 1RIOH 4FTBA 1MMDA 3BR6A 4S0HB 3BQYA 4UT5A 2NVUB 3NAPB 3TW6A 5IYCJ 1J84A 2H1LA 2Y26A 1W6OA 2ZJCA 2A6EF 5I8YA 2NOGA 3I2HA 4A69C 5GLZA 4NIDA 2KJCA 1RUG2 1D0XA 3ALQA 1QHHD 4N0BA 5LGUA 4RB3C 3MFKA 1RMU1 1I6HJ 3H9AA 3ZXFA 3OBTA 3KVBA 2DT5A 1EH7A 2W9XA 1ZG3A 1FYMA 4IRGA 2MABA 4X1EA 3TOJA 1WA6X 3CO6C 2WAQA 4E7SA 3C2BA 1X8MA 4V2WA 3J81Z 3USUB 3CUOA 4U2AA 1U5XA 1PZ8A 1W9TA 4TSVA 3BGAA 4BQ2A 1QJY1 4ATEA 4KWLA 1YYVA 4M6VA 4P14A 1CR7A 1K78A 1EV7A 4Q4Y2 1IC8A 4MTEA 1S2KA 4DIQA 3LOCA 1OFNA 1QIQA 4OUMA 5GLTA 2D6OX 3O2PE 3WNXA 3G7DA 5F04A 3IDCB 4YFXF 3LL7A 1YFYA 5EEHA 3QH6A 5DDJ3 1UW8A 3ZFEB 4IQPA 3W5NA 5KCMA 1XE8A 4RHV3 2XVCA 2ZEXA 3N9QA 1OD5A 4Y22B 5F37A 1N75A 1UMZA 1W7PA 1FMWA 5B3SH 2C24A 3D5OA 4B44A 2Y8KA 3LIHA 1LFUP 2DMTA 1AYN2 5FY9A 3KHBA 2DFFA 3WDUA 4NPMA 3GLLA 2L9LA 2RQPA 4BQNA 2OYZA 5EFUA 5FKNA 4XHBA 5C3OA 1QNTA 5HI0A 1N25A 2V4VA 4JCKA 2IXJA 3MIEA 1GDTA 1IRGA 1V6MA 2JG8A 4GDFA 2VBZA 2Q8DA 1BI1A 1P4AA 2Z4FA 5FYTA 2GIVA 2RS13 4HXCA 4RAGA 3HM5A 3LSGA 2VXRA 5KXBA 1OOPB 1UYXA 3LEIA 2H27A 5EHDA 3MEXA 1B09A 2X29A 2YUEA 4K1ZA 5JZGC 2PLV3 4NAOA 1IDYA 3WTSC 2JE9A 4RB1A 1G2HA 5A2QK 2XF7A 2LTNA 4KITB 4XJ9A 2JVHA 4HLXA 2RAEA 4JDNA 4RGXA 3I2JA 3JB8A 4L11A 1SPPB 4A3MJ 4XOPA 2ZGNA 4Y17A 1YTYA 3B9IA 4XRSA 2EXHA 3BQZA 3B3QE 4JK1X 5F5QA 3HVDA 2Q1ZB 2BGOA 3SCHA 3ZXJA 2K9MA 3I4NJ 4Q2FA 4HANA 3OR2C 4AQ6A 5CFDC 4FPOB 5C33A 4DEQA 2K5CA 3HGYA 4MSVA 2J1VA 1BKZA 4UBHA 4CEYC 4QB6A 4B4CA 5T54A 2H8RA 4HT1T 1OCPA 1H2NA 3VB2A 3FM3A 4X8PA 1MACA 2KZVA 2BE5F 3BWGA 2ZBKA 3B5LB 5FMBA 3PU8A 3I71A 4NHJA 5L73A 5AC92 4A6SA 3L2YA 2CSOA 3IMMA 5C6CA 3F3XA 3KFWX 2GC1A 5FZ6A 3FXJA 1N1TA 1C4RA 3NRVA 2VY0A 3EO6A 1BJAA 2JENA 5FFXA 1FSHA 4ITCA 2P0WA 1Y9GA 3AMMA 3DECA 1Z6TA 5AVAA 5E18F 1QBJA 3AP6A 2X9DA 3T5XA 4NIIA 2FU4A 3BTIA 3ENRA 1VQNI 3G4SI 2VVEA 4QWNA 5BOXA 2Y31A 4RS5C 4L9NA 1HDDC 5EPAA 1W8HA 1EUTA 2WQ8A 3FKJA 2GN3A 4DNCA 2OT7A 5FCCA 3WR0A 5FMDA 2CNAA 4XUQA 4CZSA 4KIBA 2D43A 4UB6C 2DCJA 1SBFA 3BR0A 5AIQA 5F6KA 5BNNB 2MGQA 4XE9A 5LASA 2V26A 2E71A 4IEPA 3Q8AA 3M3YJ 1JYWA 4DYQA 2GH8A 1D8JA 3HAGA 5L7OB 2JG9B 5A3TA 5I0SA 4IEUA 4OLLA 4EGYA 1T95A 4NHMA 1R5GA 4YGEA 2KRCA 4YFWA 5JCTA 5JI9A 5CADA 5IVJA 5DM6F 3VPRA 3OV8A 3MUY1 3ZXKA 1N1VA 1G9FA 3OUHA 3PUQA 1OYIA 1W2AX 4XBFA 3ZFGC 4KUMA 3A0NA 1YX3A 1R082 3U1XA 4I3GA 4BACA 2EICA 5A32B 3WQ0A 4UOJA 3OIPA 4G8XA 1O91A 4LBQD 1CAVB 1BOBA 3ZVXA 1CIYA 2BW3A 2XKOA 1CJDA 3JSPA 1Z78A 3K1MA 3VZOA 1RUH1 1VBC2 3W20A 4IGPA 3I2DA 4COWA 5IOZA 3G6EI 1LQ1A 4Q27A 2OQGA 3GW2A 2ZX1A 5LK5A 3W21A 4ZYEA 3BN6A 3K7AJ 1D1AA 4EWAA 5L19A 1D0GA 2AO9A 1I1EA 1P92A 4FQ4A 3PUFA 1XS9A 1LJ7A 1KRIA 4NE9A 3S1NJ 4LG3A 4LBQB 4DS0A 3VYUB 4A6OA 4QX3A 2ZMKA 2VOWA 3LKJA 2Z5UA 1VRH2 2XAGA 5K7FA 3M07A 1TNSA 4HOBA 1TMF3 5FR3A 4HF1A 4URTA 4IL6C 2NRAC 3GTMJ 1UHWA 4E7KA 4Z6YA 1MJAA 3TWIA 4AXOA 2PXJA 1ULGA 3CO2A 4C30A 3WOGA 1W36C 3N9MA 4ZHNA 3I3DA 1LB2A 5DZFA 5HDNA 3JW4A 1K4TA 2KJBA 1V9U2 2R042 2AC1A 3KF3A 4RAFA 2ZGTA 4AEMA 2WN2A 3QU6A 1QHGA 1VBE2 2O3FA 1VBA1 1PP7U 1WMDA 1OI6A 2RDSA 5EIYB 1MSEC 2RDPA 2DVGA 1GWLA 4K8RB 2A6TA 1T56A 4BQ4A 1KFUL 2Y64A 2DTWA 3KM5A 4XFHA 1SQ4A 3ZPYA 1NA1B 3B6CA 4D7YA 3BOWA 2STTA 5FRNA 1C1FA 5F08A 4M3GA 3GZUC 1RC9A 5A3UA 3IIAA 1CD3G 4YARA 1MBEA 3CJIA 4Q0QA 3E3VA 1GP4A 5GZDA 4W65A 1B72B 4W97A 2F4PA 4GMP1 3WF2A 3OUJA 3ZDVA 2HWB3 2IEKA 4UVAA 2LKPA 2IWGB 4BK4A 3DQVC 4B47A 1J0RA 2BDRA 4S2GA 1DQ6A 4EJTA 1PVXA 1HA8A 5E17F 3JBG1 4E4SA 2M9HA 1TWHJ 4DO0A 4GH4A 3J8F1 4P08A 2J5PA 3OL4A 4F7ZA 1NAEA 2RM23 4QPGC 3DP7A 1F4AA 5FYZA 4CDQA 3M3CA 3CEWA 1FOD2 4E4DX 4IL7A 4KA4A 2IXHA 3KEYA 3CCVI 3NQHA 3O1SA 2ID3A 5DUXA 2VT3A 1VBD2 4GB31 3BPVA 3QYEA 3LFKA 3FMRA 4Q4X1 2Z3YA 1HRI2 4ZXKA 3GTPJ 4E9KA 4BB3A 3ACLA 3C2GA 1UELB 2OXBA 2D3RA 1PGL1 1H2MA 1TWFJ 2Y6GA 4OI1A 3ATGA 3KV4A 4XOTA 4M74A 2ZJPF 2ZX4A 4H7LA 3WNKA 1COV2 1FMD1 4BE0A 3NSTA 3URFA 2ZEZA 2VN2A 5IFPA 1G86A 2K9NA 2WZEA 3KYLA 5IHRA 4FFIA 3O6BB 3IDEA 5JR2A 2ENRA 3K1NA 3ZQ7A 2BXYA 3LPFA 3WU1B 2Y6KA 1CAWA 2PN6A 3WNLA 3RQ0A 3UGFA 3CCLI 4IZZA 4UBGA 3SHFA 1QPIA 1ON2A 3IB3A 2EQRA 3KLOA 5ACA2 2X1DA 3KP2A 2EA7A 1OISA 2W08A 2YU2A 3AG1H 3TP0A 4Q1PA 1GBGA 5IVCA 1E5RA 1U8RA 1R1A2 4XCBA 3PVNA 4XDPA 5DV5A 1W6OB 4NPLA 1S0DA 3L7WA 4ZDPA 1JGGA 4LKSA 2L7KA 2E6VA 3CCRI 4LG0B 1ASJ3 1WJAA 2R061 1QQP3 2W0XA 5JZGA 3M8EA 5JI7A 1WD4A 2ZX2A 3DKXA 2X48A 2K7LA 5FY4A 1FBSA 5KR7A 3SJMA 5A7PA 3AP5A 4LO7A 4Y3OA 1UO9A 3SCFA 3OEBA 4WM8A 1MNEA 4Q0VA 4BJ6C 3G1OA 1LNSA 2GMMA 2G9ZA 4PBOA 5F3CA 4BBRJ 3O1MA 1UIKA 5ILUA 2F6BA 3FDYA 3AL0B 1UKRA 5FP7A 3H3VK 4EN0A 1W2UA 1HSJA 1AX0A 1JZ3A 4AE2A 2VBYA 1W7PD 3SEEA 1GNZA 1AWCA 3N9LA 4M6XA 1A35A 1K78B 2QBXA 4CU7A 4D6RA 3L2UA 3OSGA 1Y3TA 5LA0A 2HLEA 1LKXA 3DV8A 2HYFA 3GUDA 2QVSB 4AVSA 1MBHA 5HCFA 3I2FA 1ZTRA 3J4UH 5K5OA 4DQAA 3C7JA 1PO21 2DA5A 2Z42A 4QQ2A 3PHMA 4MGYE 2DBBA 3ZXAC 5FYHA 2FX0A 2KQRA 4IRHA 2KZGA 4Q4W3 5FPLA 1FATA 2PHLA 5FB2A 3DPRA 2DJIA 1W7PB 3OGGA 4CUCA 5GTHC 2P2KA 3EBRA 5CIRA 1BN5A 3D1NI 2V72A 1A34A 3R05A 5FYVA 5G05L 4NC7A 3LNQA 1DU0A 2ZGMA 2CG4A 2VTFA 3WG9A 5D5VB 4I0BA 1SC7A 5FLJA 4XILA 3KYDB 4ZTJA 4X6AJ 2PYTA 4ABZA 4YZ5A 2BW8A 4Z8BA 2A6WA 1BW5A 3RZGA 1ZR4A 2JIGA 3CC7I 2JKXA 3GF2A 1UY1A 2E1MC 5T5JA 1CQTA 2QZ2A 4BZ4A 4V2GA 4BMBA 4M73A 1G4DA 3OJBA 4RSUA 2XLAA 1DYKA 3VBRC 1NXMA 3PFYA 2VO5A 4E7HA 3RZOJ 4LE4A 5IVBA 5FKLA 4HK8A 5BNGA 2EFNA 3O1PA 3NNJA 3ZPOA 1C3HA 1US2A 4N90A 3PUBA 4IERA 1TLHB 3HOUJ 4A7YA 3CZUA 5AIPA 4OIRF 4MYEA 1EP0A 2ZX0A 5E1WA 1LHOA 4COZA 2JWTA 1HJFA 5FKCA 5DZEA 1ZA7A 3RYRA 3NARA 1X1PA 3F8CA 3A02A 3CCEI 3RYPA 3KD4A 1XGMA 2HI3A 2QCOA 2CV0A 2EZLA 2B9UA 2K27A 1NE4A 1UJ8A 2TRTA 4XIDA 2PQQA 1GXQA 2JSPA 2LF7A 1B8IA 1TWCJ 3MIGA 4D8MA 5F5IA 1R71A 1O5UA 2BNMA 3PU3A 4CA0A 3JRIA 4FQZA 4IEVA 3TEXA 3JCUC 3QODA 4QXHA 5H9SA 1RESA 2X6WA 1U6GA 2DQRA 2L4AA 2WAOA 4YW2A 1H0BA 1HB3A 2Y38A 5FY5A 2RS33 1R091 3I2GA 3PVEA 1BMV2 5LFAA 4Q0UA 3H42B 3SEQA 1D8KA 1HQNA 2CW0F 1MBKA 3ECHA 2A3YA 5FBZA 5IP6A 3FBMA 3K3NA 4IV1A 1TP4A 2YV8A 5K7ZA 1R36A 4LHNA 3W6JB 4XLPF 3G1MA 4LTAA 1SFXA 4Z2AA 1YJLA 2YPDA 3O14A 3LSIA 3BVCA 4I98B 2C6SA 4GULA 3SH5A 2ECBA 1UG2A 4C3IJ 2HJIA 2NQYA 3DTIA 2XR4A 1I27A 1VAMA 4JKKA 4R4XA 2RDNA 4Q0PA 1CWPA 4CYCB 1WJ5A 2ERFA 2NVTJ 1ZBA1 2BERA 1RUJ1 1RUE2 3SLIA 4WWCA 5ANQA 3I56I 5G04L 2GQQA 1KGYA 1LAJA 2IPQX 2UWBA 2EINH 1JYXA 2RR13 3BODA 1Z7LA 2NMNA 4AVPA 3M4OJ 3BZCA 3CBNA 2QFEA 3NV4A 2LUWA 4GZ9A 4Z1VA 4EV0A 4LBOA 2DYRH 2WL1A 4BHPA 1K6YA 2C6YA 1U5TC 2QZ3A 4YZ4A 1TW2A 1URXA 4LLGF 1BVP1 4FOVA 4AM3A 5F0CA 2IS4A 4X8NA 3KV9A 2O7OA 1XGNA 3K4AA 2Z16A 2WUHA 3LD8A 2QQBA 1J9IA 5GPCA 2DI3A 1AR63 4MVTA 3T1LA 3ZR8X 1UPSA 5JAXA 1UN1A 4S05A 2FJ1A 3ZLIA 3F8MA 3IKTA 4IOCF 4R1HA 2DAOA 1K45A 1T6GC 2MHFA 5A7NA 2HWC1 2R7EB 4R9BA 3PJRA 4M3DA 1ETVA 3BOQA 4D3WA 2PMHA 5CVIA 2JRMA 4HFSA 4DZJA 2O8KA 1JOPA 4BQOA 1K7AA 2QA4I 2COBA 4IX7A 1WLTA 3HQUA 3ZIXA 3WHUA 1Z7S3 4UY8I 3RVHA 4F3JA 2Y0SN 2L9RA 1YS6A 2KPMA 2ZZQA 2BW3B 4UUSA 2V79A 1LR5A 3P6BA 1MDMA 1QJU2 2ZMNA 2KP6A 4YVWA 1LEBA 1E2XA 3AZYA 4Q5OA 2B8MA 1G9AA 2ES3A 2XH6A 5J4VA 1NKGA 5ANNA 4BXFA 5FWJA 4M3FA 4YFKF 2JDMA 3MCZA 3C1DA 2EB7A 4CXYA 4LULA 4R9DA 3IP4B 1Z3YA 2VMFA 1PIV2 4J01A 2BZDA 5LWBA 4EZ4A 1B6AA 1UU5A 2HYGD 4IESA 4PIZA 4ZZDA 4PI2A 1PVC2 2HS5A 2VOKA 4FPHA 4RM3A 1WI9A 1OLTA 4O65A 4F55A 2DV9A 3UV9A 2ECCA 1D4M2 4JTOA 5LGTA 3S17J 4JOMA 3UNPA 4FAHA 1AL23 1RB8G 4W1UA 3ABZA 4E7IA 4CVUA 3DBLB 4E2SA 1DZTA 2WFF3 3ZSMA 2ZBJA 5JVVA 2XVLA 3IZOA 4QT6A 4LUMA 4WXHA 1X8EA 1GNYA 2A5WA 2JKBA 2VXJA 4S2HA 1YQAA 1W6NA 1TG7A 3F95A 2ARXA 4MHUA 1ENHA 1HW5A 2YX4A 3F23A 1ULYA 1L7LA 3CDLA 4N4OB 1MS9A 3FZVA 3E6MA 1RUC1 4FPLA 3BZ6A 4J00A 1GICA 1PO12 3HN1A 3KV5A 1OCOH 1KYWA 5T5PA 2XF6A 2XF5A 2KIMA 4KIGA 1LRHA 3CJIB 5LRRA 1LFPA 3AL6A 3CO7C 2NVXJ 5CNAA 2FDHA 2W1QA 3AYDA 2EA4A 3GBFA 4DJAA 4YM0A 3WF1A 5FY7A 3M3IA 2K86A 4XJUA 3VWBA 1YIFA 1W0PA 1ZH5A 3MW2A 5FYUA 2P6TA 1DDLA 1S55A 3GTOJ 1OCTC 1HXS3 3BTXA 1G3YA 1RETA 1MQTC 4GH4B 1P7IA 4NAMA 3IUOA 1TE1B 3BT9A 4MV2A 5J09A 1OYYA 2A68F 4ESJA 4XF3A 4CDQB 1X7NA 2V5YA 4IEOA 3J7YJ 3PIJA 1O3QA 4C3HJ 2HU9A 2HEYF 2WZPP 1GKBA 3K51A 2OQ7A 5DDJ1 4LKDA 4R9CA 2HZDA 4RHV1 1D4VB 1P4XA 1UXXX 4XUOA 3OIQA 4PJJA 2R7OA 1XC6A 2X1CA 4Q5SF 3ZQGA 1UKGA 3FHQA 5ICFA 2VVDA 2XL7A 2OX0A 3A01A 4L5IA 1DUXC 2HWF2 2ZEYA 3J26N 4IEQA 4HK9A 3PL8A 2JA5J 2XBO2 5JI6A 2P3JA 1ULEA 3CUQC 5FZ1A 1ZZ9A 1JE8A 3TW7A 2E2HJ 3ZYRA 2BJSA 3SISA 1UYYA 3RNSA 1ULDA 1IS3A 1RIRA 3B7MA 3VBHC 3MV01 2XWJB 1RUG3 3UKNA 3KZ4C 3KWVA 2JB8A 1F5JA 1LEMA 2VPRA 2RS11 1CAWB 4CP2A 1OUSA 5FO8B 1OPOA 3OYGA 2XASA 2ESHA 3QP5A 1IS4A 2GIZA 3GCWA 4MGTA 4NOTA 4D5CA 4Q8LA 4CDWC 3WVJA 2JVGA 3DBRB 1SBEA 1XJAA 5HDGA 4D7MA 1ULOA 4QX7A 2PLV1 1HW1A 2B5HA 4A6EA 5HBAA 3O0XA 2W95A 4OUSA 1MW7A 3DF8A 2WABA 3RZZA 4OCTA 1IN8A 2MFZA 2YX7A 1AUYA 4XJ8A 5D6EA 4Z07A 3VSLA 1VB4A 2C1FA 5H20A 5M3MJ 2IVMA 3ULQB 1LU1A 2B9SA 2R7QA 2RMU2 5C5UA 4XDOA 2JPCA 2JDYA 5FPAA 1D0HA 4WVZA 4BKXA 2A71A 1EYBA 2ET1A 2HWD2 5CFCC 4NHXA 3H7YA 1YITI 2LC2A 4UYBA 4IGOA 1IV6A 2WNVC 1MMGA 3AX4A 5DCFA 5ABJA 5FZMA 1T0FC 3L9JT 1I3QJ 2VMGA 2WNEA 5HS7A 3PVBB 3BG6A 1GZCA 3AVSA 2XAHA 4GXOA 4WM8B 1QMJA 4GCVA 4A3XA 1IN6A 3VKLA 2R7WA 2QNKA 2FUG2 4A3JJ 2P5LC 1B9MA 1IKQA 4LK6A 1XBFA 4LEJA 3O8GA 2P5BA 4URAA 4H3WA 3F2ZA 1ONAA 4FX4A 1N3PA 4C2TA 3E97A 4CEWA 1JT0A 1Y8QB 2VUCA 2ZKNA 3ML6A 1HN0A 5HCAA 1OQ1A 4IPAA 3KCXA 3RWKX 2XIGA 4G6QA 1F35A 1YNAA 1IN7A 1ENQA 4BQWA 1HRV3 1O4TA 4D6QA 3D5SC 1FTTA 4IHYA 2VZ3A 4QLCU 3HIFA 2WNOA 4L0PA 2O8XA 3S14J 4DBQA 4WVMA 4B4PA 3U0ZA 1R4MB 3M2MA 2DXIA 2XHNA 4L0YB 4LXLA 3GF6A 3UGHA 1GT0C 1UF2C 1Q8OA 3MAJA 1BHGA 1XMAA 4XXPA 3H1MA 3DPRB 3CMEI 5ERLA 1V6IA 2BY1A 4ZJZA 1F9NA 1P4WA 3IH4A 2WNVB 1Y9MA 4PIXA 2OCCH 4HMZA 1ETOA 2J1EA 3SH4A 5FZFA 2R32A 1MMSA 1U2WA 5KVRA 1CVNA 1W9YA 1YQ5A 3NV1A 4FQGA 4GGGA 1WQ2A 3ZMZA 1SACA 1ND3A 1HB4A 3NNMA 3AYAA 1SD7A 4G9SB 4L97A 4ZS2A 2HOSA 5BNPA 2E5NA 3U4SA 3MQ0A 4ZONA 3APBA 2WAFA 3GWZA 3BJ6A 2Y48A 4S2FA 1LKNA 2VNVA 1QJY2 2OCEA 3I9V2 5HLGA 1HQCA 1W5SA 4ISRA 3CDZB 1MSFC 4ZU5A 3H0GJ 1Z05A 1ERDA 1BCXA 1ZRRA 4PK4A 1BIAA 2EA2A 4MEXF 2MD5A 2WBKA 3AKQA 1O57A 3INAA 2RE9A 2OF7A 4LIVA 4P02B 3B01A 2JB4A 5FJ8J 1R1ZA 1LDJA 3VD9A 4TTGA 2DA3A 5IYBJ 1BR1A 4MQVA 1AYM3 4TWTA 2P7CB 4B8XA 1SD5A 4IF4A 1RUNA 1IRFA 3M1CA 4U0WA 2JA8J 3ETPA 4CGZA 2FBHA 5E20A 3OOXA 2EIKH 1OCCH 2XGXA 1MNDA 2E36A 4G7ZF 3U07A 1B8IB 3AMQA 5K7HA 3ASOH 2Y6JA 4TV7A 3PURA 3SYTA 3DEUA 1D2SA 3KCYA 4XACA 3RPUA 1Y56A 4JTNA 3CESA 2XL9A 3P5JA 5B66C 1FLIA 2WADA 2DTRA 2PQ8A 2VW1A 3THPA 3VBUA 5GP9A 1F5FA 4FTEA 4I0WB 2FDGA 3Q8BA 2PTMA 3FX3A 2P4WA 2VZOA 3H5AA 1MJBA 1VQOI 2D93A 3JSOA 4D0QA 4AG4A 2NVYJ 4IEXA 2WWSA 4PQQA 2KKOA 4IV1B 4AHYA 4BJTA 3WNNA 4UI9L 5EZGA 3ZFFA 2BY2A 1L3JA 1QF3A 3WDYA 3OYCA 4RGUA 3WGIA 5FAXA 2WB1A 2CQXA 1TMF1 3OWTA 2G1MA 2WT1A 1RKTA 4XVHA 5DAPA 5T55A 2B9VA 5A6XA 1WVRA 3SITA 2WS93 5JPNB 2VJJA 2BFUS 3AKSA 4KN4X 4PGHA 3KHCA 4YW1A 2BEOA 1X9TA 3ESWB 1XU1A 5K8SA 4LORA 3K3OA 4UUVA 1CONA 2XHKA 4RQPA 4IXLA 5J47A 4L99A 5C4JJ 4XUPA 5EZWA 2BNNA 5FPXA 2O0YA 2J5OA 1Z67A 4O5VA 3J81K 1A8MA 5C4WC 3K4KA 1DF0A 3RGBA 1FOXA 1G3SA 5FPZA 2R4GA 5A7WA 5F2SA 2VC0A 4GWIA 4Y1XA 1XQNA 3ZN5A 3RKQA 2W68A 4L92A 2WNUA 2EVXA 1JZ8A 2VB6A 3RKXA 3RZDJ 2ZJRF 3N9PA 2GLOA 4DUXA 1C5IA 1STZA 2R49A 1W6QA 4L9TA 4K3UA 3CJNA 2BGPA 2YR2A 1AU7A 4AL9A 1LOCA 1VBC3 2QCSB 2HWB1 3M3QA 4BCUA 4LLFA 4YW3A 5CU1A 4NRMA 1W8OA 2VE8A 2CTVA 2Z69A 4ONUA 9ANTA 2GP3A 5D8AC 3HEIA 1NXD1 5K0UC 1FTZA 5SV5A 1TT5B 2V9PA 5ILVA 1OA2A 2RM21 2D5FA 2J1RA 1PJRA 3MV11 1OJLA 2PHFA 1HKTA 1HQWA 2W39A 4XZUG 4P9WA 2Q4SA 3N4MA 2Y33A 5F6FA 4C2MJ 4COVA 1RZ4A 3SHRA 2IS2A 1YW7A 4UUSB 4AWXB 5J48A 1MS8A 2CUJA 1B35C 5FJKA 3A03A 4AK3A 1MDMB 4P9JA 2VD7A 4YVWB 2N8GA 3LA2A 4MGSA 2TEPA 2VCMA 1P8JA 2VW0A 3C18A 2DTZA 5FK7A 2K3PA 4ENNA 1POGA 4AR2A 3AB0A 5DCMA 2Z2SB 4AFDA 5BYNA 1GOHA 2JTVA 2NNNA 4A3EJ 3ERMA 2IGOA 1Y43B 2WWYA 1KZHA 2WB1N 2VUMJ 1CX4A 1DIWA 1GFF2 2WBMA 3ZQCA 4GKXA 3BR2A 2CV1A 3ABMH 2BTVC 1WMXA 4M3CA 4EGZA 3WNOA 1WHUA 3ZMVA 3IAS2 2R073 4AIJA 3L00A 3TMOA 4YW7A 1LVKA 1MS4A 2XJRA 2XJVA 5HLHA 2OUMA 2VBWA 2AZ5A 4G4FA 1RGSA 4XF1A 2BXZA 1DGWX 4XLAA 2JX9A 3RS6A 5KC6A 3C7HA 2EFWA 1JKRC 2MLKA 2MW8A 2A75A 4W6WA 2CAVA 1UOGA 5LA1A 1L3LA 5GZFA 4R9AA 2GDFA 3ILFA 2XB0X 4AEKA 4AIKA 2W1WA 1OKRA 2EIMH 2MH2A 3G3ZA 2YC2A 5AFBA 1RUH2 5SV8A 1ASJ1 2Z9OA 2NMOA 2DK8A 4CP9A 1QQP1 1ZNPA 4P96A 3WTZA 5DS9A 3GZNB 3AG2H 2VKHA 2GAUA 4G9YA 4NIAA 4W6YA 2JPBA 2A70A 1UMQA 2B45X 3V8LA 1MBGA 5FFZA 1DGWA 1BLZA 3M4FA 2F17A 4ZC3A 4LLNA 5FZLA 2OV7A 5ICGA 1H8TA 2DVBA 2AUYA 3HKZA 4XLNF 1FBQA 1J3QA 3IBMA 1AF9A 4LJZF 1J58A 4ZU7A 4BQXA 2PFBA 3B6AA 3K2OA 4BGDA 3I49A 2E2JJ 2YB7A 3LSKA 3C8XA 4ETSA 3AKTA 4F8AA 5FLVA 2I74A 3OSFA 3T4HB 1ZRDA 4CYDA 4P9LA 1POV0 2GU9A 3WCSA 4A5MA 3H8UA 2EJRA 3IN9A 4BHCA 3DXUA 2WIIB 5JIAA 5TJJA 4EWDA 2M3AA 1KU7A 1YFXA 1S1AA 1I6XA 4I76A 3LWFA 4N53C 3LF7A 5HNFA 2OZ6A 4P9UA 1VBA2 5L3FA 3EQEA 3VKFC 1FYUA 2ZGPA 1YUDA 2B39A 4ASKA 2L01A 4Y33A 3SDBA 4Q4W1 3MKWB 1PMIA 3CP8A 4FVVA 3VDDB 3LAPA 3H3ZA 4L2NA 3QOPA 4EE2A 3ZN6A 4QXKA 4YFZA 2VZTA 1GWKA 4CZZA 3A01B 3F8NA 5A7QA 3SH3A 4HKLA 5C5TA 3AXEA 1YFUA 2X6XA 4UV9A 5TISC 4RLQA 3BG7A 1K79A 4E7LA 3BR5A 4YFNF 3DXJF 4PJMA 5FRAA 2YYOA 4DZGA 2L7MP 2NXNB 4YVSA 4N43A 2ELHA 4B1LA 3P9CA 1GUUA 3NEUA 5LGNA 1SD6A 4BPZA 5BY5A 3ZRGA 1GXPA 2H6CA 2WFPA 1DG6A 3W5MA 3CLOA 4E8DA 3JBG2 2XPVA 4CCCA 3GZ6A 5BPIA 3J8F2 2LBFA 2QUOA 2R7SA 2V73A 4JC1A 2KIQA 4KG8A 4N7UA 3IRRA 3ON7A 3ZXLA 4IV3A 1G9DA 2PX9A 3PQJA 2DURA 1U5YA 4LBJA 5CEHA 3RQIA 4QM8A 1CAUA 3EUHC 3NNFA 3QAHA 4NIGA 4PLOA 2VASA 3WTUC 2XUEA 3LSTA 4HVRA 2KIFA 4MFEA 1YQCA 2VNRA 2LKSA 4Q4X2 3BU0A 1H9WA 4EATA 3T09A 5EJCA 1ULPA 2YBSA 1E3OC 3TNQA 2DODA 1NCRA 1C5HA 3MZHA 5ABJB 1RITA 3HOXJ 1PGL2 4PJYA 1ALYA 2CUEA 5FXVA 3Q9VA 1UOJA 1PM4A 4FAGA 3IWZA 1FMD2 2RS31 2Y60A 4EVIA 3GTGJ 3WW3A 2DYSH 3LOBA 3PUIA 4BLJA 1BOAA 1IW7F 2IFWA 5IT9K 1XMXA 1NZIA 4DQ2A 3D4KA 1XMKA 1JI6A 3OYEA 3WY6A 1GNHA 4QU1A 2OUJA 1RJ7A 2LALA 4O6JA 4BYYA 4WZFA 2WA0A 1NOVA 2A3WA 3OIOA 1IOAA 1GVDA 2F5FA 2HYXA 1W0OA 1RC6A 4YIRX 2LH9A 3NWTA 3GFLA 4MZUA 2RDQA 2KM2A 4MEYF 4BQ3A 3WXPA 2PN5A 1BW6A 4U7DA 4BY1J 4CSWA 4U87A 2KXLA 3Q9OA 1V54H 3HQXA 2HQNA 4WVMB 3M7AA 3UKTA 1ZR2A 1X2NA 4MFDA 1VR3A 2IVIB 3RQ4A 2R062 1GP6A 4GJZA 5I93A 2JA6J 3DYPA 5F3GA 3NVCA 2PMZA 2NYYA 5FFOC 5KC5A 3V0BA 3WU2C 5D4RA 3R4UA 2RR11 1O4ZA 2D6NA 3WF4A 1GV9A 2ZXQA 2ZMEA 4CU9A 4PHZA 2GNTA 5D5XB 5IVYA 3GFMA 1ND3B 3KZZA 2R3SA 4BE1A 5CKNA 5BNPB 3CCYA 1W6MA 3GFJA 2DBIA 1OH4A 2EWNA 2OTLI 4QPIA 3SC7X 2MYSA 4AHXA 1YJNI 4KI5M 3LA3A 3WGHA 3J7AY 4HOOA 4M3BA 5ED4A 1DQ4A 3ZMSA 1AR61 1I9RA 1MZFA 3AP4A 2K9SA 1QOTA 1R22A 3BR3A 1R5ID 2C0ZA 2WAEA 1DBNA 4AVAA 3ZM8A 1NYWA 3RPUD 2W52A 4CHUA 1BEV2 4NBQA 4CU8A 2D6LX 4TXWA 2Q0AA 1FYLA 5CQGA 4FT8A 1PO22 3ROUA 3PJYA 1STMA 1XNAA 1TL8A 3W2VA 3HOYJ 1UU6A 2X6YA 4IE4A 4QB2A 3O1TA 3TO7A 5A6ZA 3LQQA 4EN6B 2P3IA 2DUPA 1S72I 3S6PA 5IY5H 1AR93 2DMUA 3FFQA 5I8SA 2X5IA 4NR1A 5LBFA 2W57A 3IIIA 4P00B 3H8RA 4XK4A 3TB0A 3VBOC 2XROA 1H2KA 1OLRA 2M30A 2B46X 3S2WA 4HSJA 1OPCA 2B7EA 1EPWA 1X36A 3K70C 3O5SA 1DGRM 4QKDA 3VBUB 1CN1A 1XDSA 4D6SA 1AR73 3ZYPA 5I0TA 2QTWB 4XICA 1RUE3 3G71I 4ET7A 2GC2A 2FBKA 3N97A 2RS53 1GQPA 2L9NA 2ADEA 2C5DA 2BVMA 1ZQ3P 5KHJA 4YZ1A 1OQDA 3T2PA 3ZFFB 4XF4A 1JKQC 1EV11 4UWDA 4XLEA 2LLKA 3HBKA 4BOWA 2VJIA 3U10A 2O8QA 3VYRB 2OKXA 5EP9A 5T50A 5H9QA 1HV0A 4KYWA 4I0AA 3B94A 4IUGA 1W3VA 3FXQA 2M7AA 4AOCA 1X82A 2IA2A 2PMZN 2VL8A 2OD5A 1AL21 2DUQA 1T33A 2DPUA 1PK6C 1O6UA 2WFF1 2OQRA 3GJBA 2K2SA 4FFGA 4IE6A 1D5VA 2ME0A 1UIJA 2YBKA 2JDNA 2KIUA 4BM8A 2CU5A 3LFUA 1RNLA 3AKRA 5IK5A 1ACIA 2ET7A 1R49A 1AOYA 1BXHA 2JA7J 2IGKA 1R092 5A7WB 4I09A 1RHI3 3FM5A 2WNUB 1S5LC 1HB2A 1ZGWA 1MZEA 2DU1A 4CP1A 2FMYA 1BI2A 4RFT0 1S8NA 4JHTA 4YNIA 3BY6A 3NNLA 1W6QB 4DBRA 2MEV3 2NN8A 3BDDA 4U0YA 1SCSA 1FV2A 5FZEA 1U9NA 1PGW1 3LDKA 5ISLA 1HX6A 1Z1DA 3QLQA 2ETEA 1HXS1 4P5HA 2FZ1A 4KU8A 3VOEA 3AP7A 3I3MA 3I4PA 4ARXA 2DPDA 1F36A 2ID6A 1W8ZA 1S0EA 5GAEJ 4RR3C 3EHKA 4P55A 4X0GA 1O5LA 1ZBA2 2VZVA 5LEKA 1IS5A 1QNWA 2IUWA 2W00A 5D8LB 1QH7A 3IH2A 3OYHA 1TME2 2J7MA 4DW6A 3LAGA 3DFGA 4HG2A 2AR6A 1RUD1 2FOKA 4QMAA 5AONA 1PVC3 3DLLF 1ODNA 3MPBA 3SQNA 3JQWA 2HR3A 5JMCA 1GHCA 1S0JA 2P5KA 4OVEA 3K4CA 3ITQA 4DB5A 1LUJB 3J80K 5IK4A 1VRBA 2UYAA 4AI8A 3NJYA 1RUF3 5FUPA 5JSRA 5DCMB 3WTVC 2D44A 2VKDA 3AJYA 3BU7A 2ISYA 2RN7A 5LEJA 4XKBA 3OYLA 2CO5A 5A2QZ 2G9FA 4M72A 3Q9SA 5J96B 1U0AA 1KONA 5BNOA 4M3CB 4PJNA 1WCUA 2P6HA 3WSOA 4OI0A 3ZDSA 5GAHJ 2O14A 1IGOA 3ZSEA 3ME2A 2DU0A 5H6QA 1X3ZB 3O1VA 2YPRA 3P5BA 4TYSA 3KCCA 3VKOA 4UNOA 1K5MC 1U9OA 1LHUA 4LMYA 5LBBA 5EF6A 2KDOA 1PO13 1OF3A 4XW3A 2DOEA 3H9QA 2JIJA 2XUBA 2RV9A 3WG2A 2CUZA 3WODF 4M0HA 4IHXA 4B7KA 5F32A 3JD73 1VB2A 5CYYA 1X2MA 1ZKGA 2VQLA 1VE0A 1MVQA 4XFAA 4IE7A 4CP9B 2P81A 1JUSA 4BBSJ 1BBT2 3C7FA 3W9AA 1J7KA 1LOFC 4CDXC 2Y6HA 2VC9A 2LOOA 4CCMA 4JQFA 4E4HA 4MHRA 4Q48A 4XSZF 3EYPA 1YX5A 2GNMA 3OYNA 1VAKA 5JVTA 4Y20A 4YPJA 2ZO4A 1PUFA 1TQIA 4LB6B 4OAZA 5KHDA 3I3BA 4ZU4A 1H8TB 1W8NA 1WCKA 4AGRA 2QBYA 3QP6A 5A33B 1S0CA 4DPNA 1FIAA 2OIIA 3UKGA 1UHMA 2CY6A 4BDZA 5J8FA 4IQ4A 4FTSA 4XFBA 2HQ5A 4ESFA 3LDBA 2WJSA 3EXUA 4XFGA 1ODDA 4U7BA 3ILNA 3VBFA 3KVAA 4C1WA 4QX5A 3N36A 5EV7A 1HRV1 3WDVA 4BEHA 1S3JA 3N7JA 4AFAA 1JJ8C 1MMAA 4O9EA 2YC4A 2BNOA 5FREA 4ZDOA 3RZJA 1W8TA 2ZGSA 4P9IA 4AEDC 1V5EA 1UZ0A 3OGJA 3VBSC 2GBYA 2R5ZA 3HJEA 2ZPXA 2ARAA 1UWWA 2XV4S 1S0FA 4OMDA 1D3YA 2QKMB 4FPKA 1FOYA 3HG9A 1KQ8A 5D1IA 1X4OA 2GNBA 1XC5A 3HOBA 1EJ9A 2BV4A 5IT3A 4AQTA 3GBGA 2ZSHB 3ZN6B 3QOEA 4OULA 1VQMI 3MPPG 4C0BA 3NWSA 3HPHA 4BJ5C 1RUC2 3MLJA 1VQ7I 4GKYA 4PDWC 1LDKB 1XNBA 2V1DA 4PDKA 4WVWA 4YVSB 4Z2YA 4N43B 4MGQA 4XMYA 4JDOA 3ECOA 3AAFA 2ELKA 5DXDA 3I97A 4ES8A 3CDHA 1MEC3 4II3A 1Z7UA 2WC2A 5EEGA 5J1YA 2HQRA 1BA5A 2RMU3 2VBDA 5FBJA 2EAKA 3HWJA 3UJOA 3MVPA 4CZCA 1IG0A 3N7MA 2Z33A 2X8KA 4AFMA 3I3LA 2LBFB 4HZFA 2CWEA 5F0FA 2WZR3 3BCWA 2VNGA 3HPNA 1DU3D 2C9KA 5L3BA 4G94A 3D8CA 1SEFA 1PNGA 4JGZA 3WE3A 2DVDA 5K9YA 5DM7F 4IV3B 4ASNA 3VBSB 2WQ4A 1ENSA 1CAUB 4QKNA 2P7VB 5DDJ2 3O1OA 5L36A 1AYM1 4RHV2 3CJXA 3NAPC 4UF0A 5IVFA 3PUAA 1D2QA 3HZJA 1ZBE3 2DBNA 4QPYA 3BALA 4YM1A 3MYXA 1NCRB 2BVLA 1YLLA 5A3NA 1QJX2 4PQ9A 5FRMA 4YW5A 1LGCA 2K46A 3AZWA 1Z0HA 1H0MA 5M0TA 3OYIA 3ZOIA 3K4DA 5B4XA 5HV0A 3DBHB 2JD9A 5FKMA 2WA4A 2CH0A 2MD0A 3AVRA 3CP2A 2QE3A 3THTA 3POGA 1DGRN 1S0BA 4DUVA 3S1RJ 4V1PA 2JJ7A 2RS12 5DUKA 1S2BA 3HPGA 5HODA 2J22A 3HYIA 3HN3A 3HUGA 1MZ6A 3OR1C 3UNGC 5LA9A 3ZXSA 5ICCA 4JGYA 1LU2A 4BA6A 5GKAC 4XYXA 2FZ2A 4BQYA 2YG0A 4II2A 4RL7A 5BPDA 2WS91 1GP5A 2CQKA 3S32A 5E8GA 3JR9A 2Q2EA 1DQ5A 3VD3A 4ES9A 4LO6B 4LR4A 5FZOB 2E33A 3ZFEC 3V0BB 2KLOA 4BE2A 2UYBA 4Y24A 2XB5A 4UFMA 2Q8EA 2D7FA 5K5QA 2AYHA 2NS8A 3RCOA 5IFTA 2VMHA 2ZMEB 2JDPA 3LWCA 1OA3A 2KFDA 3I53A 3POYA 3V8KA 5KNLA 3MIBA 2EIGA 3IAQA 1JYIA 5DG1A 3C7EA 1Y9QA 3PUHA 2F4IA 4L9VA 1W6MB 4J1WA 1FWZA 2IBDA 3ONQA 3RSJA 4QPIB 3MW4A 3BIWE 4ASMB 2VCCA 3QPHA 1W9FA 3ZYGA 1DLCA 1W0UA 3KV6A 5GZCA 3FMGA 3V4GA 4BWOA 4RBOA 3I4IA 1NCQA 2D98A 1J1TA 2XWBB 2PHXA 1YWKA 3J9SA 2X4HA 1MBJA 1KYZA 4AYBA 2ZGOA 1OOPC 3WQBA 3O8HA 5FMOS 1OD3A 1NQDA 3A1YA 3ZYHA 5BPXA 5CZKA 3AZVA 4XQDA 4XIKA 4HSTA 3F8FA 2I2SA 5FYCA 4XBQA 1V4RA 4XF0A 3MFCA 2CFOA 4H14A 1YIPA 1XU2A 5CAZA 4A3DJ 3ACIA 3WU0A 2Y9ZA 2X5IB 4Y1YA 3K77A 1R58A 1IZ3A 2KMUA 1YJ9I 1KS4A 1Z21A 2NNYA 3U1DA 2QSHX 2GWRA 3RMYA 3RI4A 3LPGA 4XLCA 1HKDA 4YG3A 1WW7A 1XYOA 2XQRA 1GOFA 3HL2A 1TZLA 1NY71 2D2WA 2FDKA 1I5ZA 5L3GA 4WK8F 1PMJX 2ZHNA 3AM2A 1FOWA 2EZKA 3PFIA 4B29A 2DW4A 3S5AA 1OBNA 3NMBA 2M0CA 1ON1A 4JZRA 1UMIA 5BNQA 4MX3A 4XAAA 5C9AA 3AYCA 5IPAA 4XUNA 1FBUA 1WWYA 3VN4A 2R071 1K4SA 1ND2A 1FNZA 1IRZA 1OPMA 3S16J 5C8CA 2ZZJA 5E3NA 3O1UA 3RRDA 2V9KA 3B00A 4XSXF 4B48A 2VW2A 4J6GA 2VZPA 4LKFA 1KU2A 3KP4A 3A23A 3AXDA 5J36A 1OKQA 2JDAA 1H8VA 3ZPLA 4YRVA 1F1ZA 4XUTA 4NROA 2WY8Q 1SAXA 4W6XA 1WH7A 4BE3A 1GV5A 3L2VA 3HD8B 1OR7C 1OLMA 2LRPA 3C7GA 4XIOA 3FHZA 3ZXEA 3EQLF 3KSCA 1QXRA 1J5YA 2PEXA 2KDZA 1IG3A 2WAQN 1F31A 2D3PA 4I6ZA 3ZQFA 1IUYA 1G6NA 2GA2A 2RG4A 3NV3A 4LK0F 2OS2A 3LSPA 5DD8A 3HTSB 4OZOA 2LFBA 2JUCA 1X9PA 2HNHA 5FOJB 1HLCA 3IRQA 2E35A 4CDUA 1A31A 1IXRC 4QX0A 2Q30A 4XKWA 3LEMA 5BNNC 4AYBN 5C44J 2STWA 1FI2A 2O1QA 3HBLA 2QSFX 1JMUB 1OVSA 1TWAJ 2I10A 3AG3H 4M71A 4Y7NJ 3V0AB 1VZ0A 4IE0A 1TMF2 4XETA 5L7OC 1KA8A 1O8SA 2QQPA 2JG9C 4HN1A 2ISZA 2QDNA 2IJLA 5D8KB 3IM0A 3S3NA 1JTXA 5LCWL 1T08B 3EB7A 5A3PA 2WV1A 2A6ZA 4A3IJ 2BPA2 1POV3 3T0YA 2XAFA 3MICA 2HKOA 5BUVA 4Z92B 2ARCA 1SFUA 1H2LA 2XSDC 3H0DA 4M9XA 3H5NA 4ZYGA 5E1XA 4QQPA 4AFBA 3NJZA 3H50A 2V7FA 3S8PA 1CF7A 4XOGA 1NQJA 1W9WA 3I4MJ 4MO7A 2GMEA 4F92B 1OCRH 1XSVA 2JXAA 4KJZA 4Y4YA 3D3AA 3PTRB 3PNYA 2AREA 3OYMA 3SXYA 4HV5A 1XRUA 3H9JA 4AEJA 2H0VA 2PHTA 1ETKA 4DFSA 4A4AA 1IV8A 2WV0A 4ENKA 4IHWA 2XJPA 4D1QA 4L5EA 1YS7A 3K4JA 3TP3A 1SFEA 2EFPA 2RC4A 5BNOB 3F22A 3W2WA 5FP9A 4EQVA 5DZGA 3QPTA 2L2OA 3OOUA 1WKYA 3GTLJ 4GQ7A 1C8M3 1Y7BA 1YQ8A 3ACFA 4WBBA 1H89C 1K83J 5FZ9A 4XRMA 4QD2A 2M4GA 5LHIA 2NM1A 2RM22 4WM7A 1XSXA 1SMVA 1UFMA 3JXSA 3KPHA 4BQAA 1SDDB 2F4MB 1UYZA 3Q5FA 1ODMA 4CA9A 2HWVA 1YW8A 1I3AA 5JHFA 1OQYA 4DNYA 3S93A 2CHHA 1UZZA 4I7HA 5KAIC 3GHNA 5FQ0A 2QF7A 2W47A 5A6YA 1KJRA 3QCWA 1CX1A 1LECA 2VODA 2ZX3A 3UESA 5FP4A 3AG4H 2QQLA 2DO7A 1HBXG 3P3NA 2HWE3 1O8PA 2VI6A 5FO9B 2GP5A 4HF0A 5KHHA 2VJ4A 4Y20B 1GR3A 2ORZA 4O7XA 1PUFB 1XSRA 2IZWA 1NA1C 1C1LA 1KDKA 1SLIA 3J7ZI 3WCRA 1UZVA 2WT2A 3AZXA 2QBYB 3K4ZA 5CKTA 1W05A 3OPTA 2YXSA 4FXGB 4AZZA 4ZDLA 1TZOA 1T98A 2XUMA 5K1YA 3ZQLA 3X2QH 2LSOA 3MEPA 5E3MA 5J98B 3TYJA 3CKHA 3RWNA 2BHYA 4CXWA 3M8FA 3VBFB 3F21A 5FJHA 3FMSA 2K4BA 3BI3A 2V4JC 4BEHB 4HRIA 1IQDC 1BIBA 3H8XA 3BTAA 3IHUA 4LA3A 1OH3A 4YSFA 4M9SA 1TQ5A 4YGDA 4A0ZA 3M8JA 2R5ZB 3LAJA 3OYFA 2L54A 1ASJ2 2GH2A 2QM3A 5EQUA 2VJXA 3E5QA 1QQP2 2E9QA 3E6BA 4MQ9F 5HXVA 2M45A 1PVEA 2QDRA 3J8F3 1VAVA 2ILMA 2R6QA 3IV5A 1YHFA 2EILH 1JJ6C 1WPKA 2EZIA 2BHZA 2G7UA 4QPQA 1WCSA 3WF0A 1ETQA 3S15J 3W59A 2K3FA 1LOGA 2WRAA 3ZFEA 2TDXA 2ZGKA 5M5XJ 1DDNA 4IEYA 5M5WJ 2V5DA 3MLKA 2JDKA 3ASIA 5FV3A 4AHWA 5JLXA 1QNYA 2ID4A 4KBBA 1QPMA 4CXFA 3ISPA 2CW7A 3RKYA 2IRFG 4B8EA 5A7OA 4DINB 4C1XA 1RRJA 3KZYA 1JUHA 4JGZB 2CDPA 2HVRA 3WHTA 5F64A 1UNBA 2F5DA 5IVVA 2B0LA 2ZA9A 3OUIA 2KD7A 3T0DA 1E3PA 1OF4A 4CCOA 3E6CC 4GIQA 1TNFA 2CGPA 2YFUA 3ZKUA 4F83A 2XQXA 4AD9A 2WAAA 1CPMA 4UF0B 4HBLA 2EV0A 4HNTA 4Q4W2 4BNCA 4LLOA 1AR91 1UAIA 4XBLA 2H8WA 4M0NA 1LVAA 5CPRB 1V6KA 4MH0E 2Y6FA 1AJKA 3HSFA 1S4CA 4MXVA 2ZMLA 2VNOA 1V0AA 4FX0A 1R9TJ 3JRHA 3I54A 1B4AA 1AR71 1WH5A 2DFBA 2F48A 3O0WA 1ZZBA 5FY8A 4U0VA 1T6SA 1RL3A 2X09A 4C9YA 1HIXA 4A7ZA 1YJWI 2RS51 5EXOA 2C9AA 2EIBA 1CIWA 3AL0C 3V7CA 4M6YA 1XGSA 2UWAA 5L9VA 4CCJA 2XJUA 1Q8QA 3HUGB 2E7AA 1F4HA 1WSUA 2HTJA 4JGYB 5KXCA 1W0NA 2XONA 1NG7A 3BTLA 2RKHA 1JKPC 5C3QA 1UAAA 3V7RA 5BV6A 4BQQA 2R0QC 2Y34A 2YPJA 1A6QA 4AHZA 4Y15A 1FP2A 1UY2A 1JGSA 3ZX7A 4WCGA 3TBIA 4UW6A 3W3CA 2Q2EB 4PT6A 4DOZA 1IPSA 3FIWA 1L7QA 1I1GA 1GMMA 1YI2I 5IYYA 3KMHA 4DGWB 1MS5A 1QU0A 3SCGA 1NUKA 3R0JA 3TGNA 3JUUA 5B1AH 4IDZA 3I7DA 1KITA 1JUMA 5FUIA 3BCBA 2PI0A 2H1KA 1WJDA 4K8FA 5IP7J 3J7LA 1BEV3 3Q8EA 4J19A 5KXEA 1WFXA 3FL7A 2QZ8A 1RR8C 2RS32 3FN9A 5FPUA 3OBAA 1I1SA 1RHI1 3AK0A 1IPKA 1W03A 3WX5A 1SCRA 1YQ6A 2PLYA 2LY1A 4E7JA 1E17A 3BOPA 3U21A 4A5NA 1RXGA 3LMMA 1U78A 2WY7Q 1F5TA 4ORFA 3BUCA 4RA2A 5ICEA 4RM2A 2QKLB 2MEV1 1NCQB 5BXXA 3LSHA 4FISA 1I5PA 2IXLA 5CFDA 1KGSA 2WKKA 4LOTA 3TN93 5FZ0A 3A4UA 1MKMA 1R5HA 4CEYA 4AVZA 1T39A 1YIJI 4GYIA 5K4LA 1UU4A 2IA0A 4NWVA 3LIGA 5F3IA 1ZX5A 4LGWA 4A3ZA 1IRXA 4GRIA 5JPMB 1HCRA 2E32A 3WDWA 1XXNA 3CTAA 5ERIA 2P3YA 3K2ZA 1A5JA 4OHYA 2ARBA 1OC1A 4QIWN 3I3QA 1WMEA 4CRQA 3M1EA 1JS9A 2PMUA 2M8GX 5EZHA 3MIHA 3KEOA 3R0AA 2GXGA 1RUF1 3OF1A 6PAXA 3RPQA 2AS5F 3LZZA 2C26A 2OQ6A 2W1OA 2M7BA 2UXNA 2E53A 4LHKA 4RB0A 3EUAA 5DDGA 1SHWB 2Y6LA 1QOOA 1ETXA 5DD4A 2JT1A 2JG8B 3T8TA 1AR83 4A44A 4KGGA 5C9AB 1WCMJ 4TLGA 4QU2A 4RS5A 4FOWA 3S1QJ 1RXFA 1A04A 2ZNZA 1ND2B 3D0JA 4BUPA 4XTMA 2PAEA 5EDNA 5C8CB 1O4YA 1WCQA 3DEWA 3H1YA 2AENA 3POBA 3SQOA 1ZK8A 3OYDA 1SLAA 1S6LA 2JE7A 2LRDA 2VUAA 2WYSA 5JXHA 4JKLA 1VBB3 4AI9A 3S3OA 1PO11 3MUZ1 3ZYJB 4BAYA 1PMHX 1J09A 3Q8CA 1FX7A 1VLNA 3VD5A 1PUEE 3CIHA 4ENMA 3S2HJ 1RUI3 3RDIA 1SFNA 5DG2A 3JD71 1BZWA 5A80A 2EFOA 4ZS3A 1MNMC 2WSUA 1NK3P 2BBVA 1BJQA 5IYDJ 2D6MA 5E16A 1D1CA 2YU3A 3PDQA 3T4VA 1ST8A 3TDZC 2CYFA 3ZFGA 4N4NB 5JLWA 5CVJA 5FDBA 2BOIA 3IT8A 4MHGA 4FO9A 3L2QA 1XNKA 3F8BA 4NNJA 4XORA 2GALA 4CDUB 2A73B 1XPXA 4QX2A 3IDAA 1TME3 3FBIB 4AIHA 2E60A 2EV5A 2UUZA 4IKFA 3M70A 4GFBA 4CCNA 4M3CE 3BR1A 1EV12 3FC0A 5IOYA 5GZEA 1H9TA 4JRLA 4YZ2A 4UUTA 2VZUA 1TQPA 2CW8A 3A0BC 1PX3A 3SFIA 1QXPA 3BTYA 3T2QA 2F5CA 2R7UA 1XE7A 4CCDA 2EPFA 2VOXA 1AL22 2CWSA 1QKQA 3NKTA 5FP8A 1R23A 3O7OA 3H8OA 2TCTA 4D7NA 1ORKA 4HONA 2EK5A 4KNCA 4IGQA 3E6DA 3FXKA 2QQ9A 4UB8C 1CF7B 3A7QA 1ETYA 1ONVA 2A3SA 3AMNA 4WF2A 2O6GE 1WW5A 3PNVA 1BI3A 4FOQA 2ZC2A 1Y4WA 4NMIA 4CU6A 3CD6I 2ZAHA 1ZG1A 2HGCA 4QQOA 4HEA2 3DXTA 3ZSLA 4L8QA 4H4KC 4A3CJ 1RVF3 2QUFA 2CQ7A 3E5XA 3PIPF 3DYMA 1VQ9I 4QGNA 1VQ8I 2FDIA 4QHBA 1CGPA 3R61A 4HVOA 3CC4I