2BGCA

Prfa-g145s, a constitutive active mutant of the transcriptional regulator in l.monocytogenes
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
235
structure length
234
Chain Sequence
AQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICSQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLAPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mutation G145S in Prfa, a Key Virulence Regulator of Listeria Monocytogenes, Increases DNA-Binding Affinity by Stabilizing the Hth Motif
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transcription
molecule keywords PRFA
total genus 77
structure length 234
sequence length 235
chains with identical sequence B, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2004-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2bgcA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bgcA01
3E6DA 3WTVC 2OZ6A 3U10A 4K2EA 5JSRA 2HFHA 1QXJA 3T1BA 1LDDA 3WTUC 2FEZA 2KRFA 5HVQC 1FPQA 1PUEE 2Q0AA 1FI2A 3KE2A 3ELNA 4P55A 5IT9Z 3I71A 5E16A 4L5JA 3KZYA 3RTRA 2GA2A 3ECOA 4RGRA 5D8KB 1SAXA 3JTHA 4BHCA 2HKOA 3H1MA 1Y0UA 2IXHA 3HUGA 5FPXA 3WW1A 3FZVA 3R6SA 2BYVE 4P9GA 2WC2A 3VFZA 4CICA 2FA5A 2QENA 4A0ZA 1DPRA 4KUMA 1IUYA 3CL1A 5J7MA 4AVAA 2O8XA 3F3XA 5LHIA 2R7FA 1TNTA 1CAVA 2AS5F 1E17A 4XEZA 1ZH5A 2DAOA 3DPTA 5E20A 1ZZCA 2H09A 3EYYA 1GVJA 5ICCA 3ETQA 4R1HA 4ORFA 2PAEA 1CAUB 5AIQA 3GLXA 3U9GA 1QY4A 1OI6A 5CADA 2XLFA 4I2OA 5J48A 2OA2A 2L4AA 3GWZA 5EFUA 5IT9K 4HSJA 1YW7A 2IW5A 4UNOA 3K9TA 4WF2A 2IXJA 3EBRA 4I7HA 1V70A 2OZUA 5ILVA 2QQAA 4GO1A 5L3DA 4MTEA 3T0YA 5FLJA 2FF4A 3E5XA 4FAHA 4XF0A 3DN7A 1W7PB 2HYGD 3E6MA 3HRSA 1J5YA 2PBIA 1KU2A 5K1YA 5BPIA 1BBYA 2VN2A 2FQPA 1TTYA 1SQ4A 4WCGA 1K7AA 4ZH4F 3QAHA 2GZWA 4HF2A 3O14A 1RUOA 1U2WA 5LEJA 1DZTA 2Q4SA 1Z1DA 3V7CA 4HSLA 4ZZDA 2EFQA 4RAYA 2ZNYA 1TW3A 3MFKA 2OYZA 4FHTA 4EM0B 5LGUA 5FO5A 1CX4A 3I5UA 3PQJA 2L02A 2EFWA 4KYWA 3GFIA 1BI0A 4F8AA 1J9IA 2UXXA 4YARA 1IN7A 3I58A 4CZZA 4YRDA 1XGOA 4YFNF 1EPZA 5I8TA 4LB5A 4L18B 2F5EA 2ZBKA 3FMSA 4YFKF 1SFXA 3EYIA 5ICFA 4U0VA 1G4DA 3DV8A 3KP6A 4H7LA 4KMUX 2OZJA 3L2HA 4AVBA 3U1DA 2Z5UA 3WG9A 3WGHA 3LQRA 1XDSA 3HQXA 1R00A 2HZTA 4B09A 2KXLA 3WTXC 4XF4A 2L4MA 2F5FA 4IHTA 2GXGA 2D93A 2XIGA 3R60A 4IEPA 3SCFA 3GFLA 3T5XA 2PN6A 2A5YB 4B29A 2ESNA 3FE5A 3RIRA 2VE9A 4L9NA 1ZRCA 4PIXA 4D7SA 3IBMA 3IRQA 2L3DA 1NYWA 1ZRFA 3I7DA 1F1ZA 1XSXA 3BZ6A 4XFBA 2X4HA 4I0AA 5I0RA 2VBZA 5EZWA 1JE8A 1XCVA 1T98A 2A3SA 2Y0OA 3E6CC 1R5HA 4CHUA 1FYLA 4L5IA 1K78B 4HBLA 1VTNC 2EB7A 4HAMA 1PMIA 4E2QA 4LGWA 1F4KA 2PAKA 2V9VA 4UXAA 2O8QA 4A12A 1NE4A 4RB3C 1S7AA 1Z6TA 2NNYA 3E6BA 2DO7A 1JHHA 1RTVA 1YWKA 3BY6A 2VT3A 1XD7A 3TO7A 1YFYA 2XAQA 2M5WA 4ENKA 3LQQA 5D5VB 1R1TA 3FF5A 1J3PA 5FD6A 1YS7A 3ABUA 2IPQX 1R7JA 3EDPA 2JZYA 1P2FA 1U6GA 4QM8A 1I27A 5KK1A 4ZZLA 4META 5H6RA 2MHFA 2YX7A 1ZAOA 1MJAA 3GFMA 3L7WA 4EQQA 1XGMA 2YX4A 3NQOA 5L3GA 2XL7A 3HOTA 4HQMA 1A04A 2GC1A 4KN4X 2CQKA 4Q0PA 5BUVA 4KA4A 1Y9QA 1ZGAA 4ZU7A 3LA3A 2P4WA 3EETA 2ZKLA 5FDBA 1KGSA 1H9GA 2HR3A 4PIYA 1U8RA 1Z6RA 1DPUA 1L3JA 4HX7A 5BPXA 1WGPA 1HW1A 1ZZ7A 2XGXA 2DQRA 1XMAA 4WXCA 5FQ0A 1O7LA 2HGCA 3KLOA 3WODF 1DGRA 3BROA 2RNJA 2VQAA 1FT9A 4KMFA 2P17A 2PHLA 4X6QB 1P6RA 1YHFA 4UBGA 5C8WA 3FWEA 2XAJA 1O7FA 4PDKA 1HKSA 3LA7A 2PHDA 2XHKA 4MHGA 4OOIA 1K78A 2XAFA 5LRRA 3KP2A 5AVPA 3T8RA 3IIAA 5FLXZ 4YYOA 3I53A 4ESBA 2C6YA 2X0LA 4OMYA 2O1QA 3JW4A 2GIVA 3H3UA 1G3YA 3EQLF 2IXKA 3BALA 2P5KA 5E17F 5IT3A 4A6EA 2GU9A 3K1NA 3ZQ7A 1FWZA 5HS7A 1HSJA 2EFOA 1YFWA 2FBKA 2Q0OA 1V4RA 1UFMA 3WW2A 3ZPLA 1W5SA 3QP5A 3VHRA 2ZKZA 1J3RA 2UXNA 1U3EM 1J1LA 3J80Z 4CXFA 3ELKA 2XRNA 3E5QA 2ZCWA 4XSXF 2UY9A 1K6OA 3SFZA 4S04A 1J58A 1Q1HA 5E1WA 5D1IA 5DD8A 2ACJA 1H1IA 1O3QA 3ZMZA 2QQ9A 2K02A 1YTYA 5E1RA 2M1BA 5JHUA 4Q0SA 5FLXK 2HDCA 4JQFA 4BHPA 3KEOA 4JBAA 5I91A 2ISYA 2EJRA 3GX4X 2XUBA 2P6TA 2W85A 3RKWA 2CAUA 5FB2A 3F6OA 3ERED 3L00A 2RQPA 1IRGA 1RUNA 1LVAA 1TQMA 4OMZA 1OMIA 4I98B 4QGNA 3TO6A 3C3VA 2GC2A 3CJXA 3SZPA 2O6GE 4J1XA 3Q9VA 1H1MA 4GYIA 1O5UA 1DDNA 2VXZA 3LWCA 3UKVA 2R7DA 4G6DA 1IRFA 4CYDA 1TQPA 3OD0A 4JTOA 1ZRDA 1KYWA 4L0ZB 4IF4A 3C18A 1IN8A 1O3TA 4KWLA 5CVVA 4M9SA 3KP5A 1B4AA 4M6YA 2VOPA 2NRAC 4X6RB 2IA1A 1CF7B 3WGGA 2RDPA 4IEUA 2QZ8A 2QBYB 4ON0A 3CJNA 1CAWB 3NSTA 1VR3A 2CG4A 3BB6A 3H1YA 1Z05A 3WE2A 4KNYA 4IHSA 4G8XA 3I59A 1RL3A 1G6NA 2QYOA 4PGHA 4YNIA 3V7SA 2JRTA 4HX4A 1U5TB 1LDJA 4MUVA 2IJLA 1T38A 1EYBA 1XE8A 4I3PA 1ZX5A 4XFFA 3KZZA 3FJSA 4OIQF 4FT8A 4HN1A 1MGTA 3F8MA 3WTTC 1BC7C 3DEUA 1IPJA 5DCFA 5JVTA 1J3QA 3D0JA 2V09A 2K27A 2E9QA 1WQ2A 2DI3A 2VC1A 2GAUA 2F4PA 2NS0A 3TNPB 1Q5OA 2Z99A 5K5QA 1T2KA 2FU4A 4EM1A 3DF8A 2QUFA 2MC3A 2KIUA 3NEUA 4GCVA 4LK0F 1O57A 3MYXA 1ULYA 3QU6A 2Q2EA 1KU3A 3SHRA 4EWDA 3CUQC 1HW2A 3CO6C 2EK5A 4XBFA 2NYXA 4LFUA 2HKXA 2HTJA 3Q9SA 3VB2A 1HSTA 2STWA 4IPAA 4ESJA 4MGKE 4UUVA 2XROA 4IESA 3ZN1A 1D8KA 1ZLJA 3COAC 2IXLA 1BI1A 1USTA 1P4XA 2DK8A 5FD5A 4Z07A 3KEQA 3GEZA 4IEWA 2EAAA 4ZYDA 3KMHA 1QGPA 1U5TC 4F7ZA 1GQGA 3KGZA 1HW5A 1UIKA 3GYHX 3RYRA 2KKOA 1UB9A 1FBSA 3HTUA 3K1MA 5DYMA 1RI7A 1YO5C 4EM2A 4QXKA 4MGZE 4NHJA 2IXCA 4ZU4A 2H94A 4RS8A 3IDBB 1FNNA 3S7IA 2K9ZA 5E1XA 1FXZA 4R79A 1SFUA 5BV6A 3CO2A 4IEVA 3ES4A 1IPKA 2OQRA 2DK5A 1SFNA 1SD7A 3BJ6A 3K0LA 3QACA 1STZA 1YYVA 2M8EA 3TOAA 1USSA 4BAYA 3PVBB 2PLYA 1D5VA 2PJPA 4EWEA 5FFZA 2E1CA 3J7AO 1NZCA 3B02A 1RC6A 4EWAA 3DP7A 3Q5FA 1XB4A 2EV6A 1S7OA 3QRFF 2EWNA 3CUQB 1YLFA 4H0EA 5ILUA 3EJKA 1F5TA 1JUHA 1NHAA 4LMYA 3ZP5A 3D5LA 3D82A 2E7XA 4S05A 1FP2A 3S2WA 3HIFA 1EH6A 2DBBA 4KWJA 3FX3A 4RB2C 3O3KA 1Z91A 2O03A 5KHHA 5I0UA 3NW4A 1FBUA 1AOYA 2XAHA 4GYGA 4LLNA 3EQEA 3FHIB 3NL1A 1YG2A 3IKTA 3ZMSA 3H8UA 5D5UB 1DP7P 4WWCA 3LAJA 2W57A 4MNUA 1J7KA 2Q1ZB 2STTA 1ON2A 2BNOA 4QMAA 3V8JA 3MPBA 4IERA 2G7HA 3ACLA 4WXHA 5DV5A 3I54A 2KIMA 3M70A 2FOKA 1S6LA 1LKNA 1B9NA 1UPIA 5I8SA 2YR2A 2VT2A 1CAUA 5A2QK 3JSOA 1HKTA 1O3RA 2O61A 3G7DA 4Q4ZF 1S8NA 2DTRA 3KGLA 1U5TA 3BCWA 3J80K 4BHBA 3VOEA 2PTMA 3WTWC 3HOSA 1B9MA 3AAFA 4A0XA 2K4BA 2MBFA 3K1PA 5E8GA 4Q0UA 2IA0A 3R4KA 3H9AA 3IDCB 1ZLKA 5DUIA 1RZ4A 5F1RA 3SQNA 1B59A 1BIAA 3O2PE 4XLPF 3HHHA 4HVOA 3E3VA 3TGNA 5KHKA 3FXUA 2HTSA 4FAGA 5L3BA 4N0BA 3WW4A 2PQ8A 3CDHA 2PFBA 2VBWA 4KFCA 1FZPB 2MH2A 1ON1A 5DDGA 2H0VA 1ZGJA 2E1NA 3T8TA 3J81K 1O5LA 2RN7A 3R0JA 1EH7A 4HBNA 3CEWA 4U7DA 3FM5A 2D1VA 3WU1B 1B1BA 2QNKA 3JZVA 4IXAA 3ES1A 4UVBA 1OKRA 2PMUA 1IN5A 4L0YB 1XSDA 4ETSA 4OFGA 3ABTA 1IN4A 1L3LA 3PQKA 4EGZA 4EJWA 2GA1A 2IC1A 2KJCA 1SD4A 3MAJA 3IHUA 3HT2A 5D6EA 4EJOA 2J5OA 5D5WB 2HQRA 2FNPA 2DLLA 4MV2A 1YFXA 3SZTA 3V4GA 1R5GA 5JSOA 2PI0A 2QVSB 3GZ5A 1TBXA 2H6CA 5DCMB 5CVUA 1X8MA 4KT5C 2Y48A 1CAVB 4CO8A 3CLOA 3P9CA 2OBPA 2Y75A 2ATFA 4LULA 2A61A 2FBHA 3BPVA 3OF1A 4D7TA 1R36A 2A6EF 2ZMEB 3HSRA 1JHFA 3LOIA 4YIIA 4UVCA 4XLNF 1WI9A 1BJAA 2K7LA 1ZG1A 2JSCA 3W6KB 2FBIA 1P92A 1KYZA 2M45A 2PG4A 1WLTA 3H1WA 2D2WA 4HF0A 5HLGA 2V6CA 6PAXA 2IA2A 1EV7A 3SMHA 4U7BA 2XL9A 2VE8A 4XFHA 2QVOA 2JPBA 4ENMA 2NAZA 4G6QA 2MLGA 5D8LB 2MLKA 2FE3A 2R3SA 4EVIA 1BC8C 5JCTA 2Z9OA 4IJAA 4DQ2A 4N9HA 1TNSA 2LF7A 2UY8A 2GQQA 3GYDA 1TQ5A 1R23A 2FMYA 4YFXF 2ET7A 2Q30A 4EROA 4DNCA 1PM7A 4IEQA 3LAPA 4LG0B 2Z2SB 1XE7A 3FHZA 5KHJA 1WKMA 1FYMA 3FXRA 1YIOA 1Q3EA 3HYIA 4QGLA 4L9VA 1ZG5A 2V1DA 1D8JA 2QWWA 5ICEA 1NE6A 4O9EA 5E18F 2FNAA 4AQ6A 1R22A 5HLIA 3KFWX 3O6BB 2F2EA 3RYKA 4Z82A 4HV6A 4LG0A 5H6QA 2A07F 2ZJ2A 4MQ9F 4P5OA 3IWZA 1IW7F 1ODDA 1D3YA 5F64A 2CGPA 2YU3A 2M30A 1DUXC 1X82A 2VODA 2LKPA 4ZYGA 4RGSA 1I5ZA 4M71A 4JVAA 2COMA 1BI2A 3MZHA 4M9ZA 2RKHA 1XRUA 1QO0D 4EJVA 4Q0VA 1PDNC 1LEAA 3NVCA 1S29A 1IAWA 1TW2A 2CV6A 2ETEA 4AIJA 4KICA 2ZO4A 4ONUA 1T0FA 1KQ8A 2EA7A 4TV7A 3KP7A 4OIRF 2UZKA 1FSHA 1ZREA 5D4RA 4WBBA 4B8XA 3TDUC 3QPHA 3GUDA 5JFRA 4PZJA 3L2CA 1OYIA 1F9NA 1KQ9A 3UKNA 1VJ2A 3RJPA 2YSRA 3RYPA 5FPZA 5BPDA 3LAGA 1IZ1A 3N4MA 4RGXA 2VPVA 4GGGA 4NQWA 2MH9A 1ZARA 4NB5A 3JTGA 1UIJA 2DU9A 3QOPA 3JSPA 5HI0A 1BI3A 1W4MA 1LB2A 3WGIA 2H6BA 4A0YA 3N97A 4J1WA 4RGUA 1J75A 3ZMTA 2PMHA 5DEQA 4LLGF 1QBJA 2IP2A 3CUQA 2HYFA 3RPUA 1FLIA 1FX7A 3OCPA 2ELHA 3ZMUA 4YSFA 1ZZ8A 2KJBA 4XSZF 4XETA 2TDXA 3JAMK 2XKPA 4MGRA 3RI4A 4PGGA 4UV8A 3P7NA 2QBYA 3EHKA 3B73A 3GXOA 2IXIA 2Z3YA 1QZZA 3H3ZA 1FP1D 3USSA 4G7HF 5K8SA 2A68F 3FMQA 4QWQA 3ZDSA 5JAXA 3ZN0A 3RNSA 2L54A 4UXNA 2FMLA 2HEOA 1IF1A 2G9WA 1J0RA 4U0WA 4Y15A 1YFHA 2N7GA 2UYBA 3ZMVA 4IRGA 2ESHA 2H27A 1W5TA 3KP3A 2EFPA 5KHGA 3KP4A 1AWCA 2QJVA 2W25A 1W7PA 1Z9CA 4O9GA 2XVCA 2D5HA 1LDKB 4EJUA 5CVIA 3H92A 3BWGA 2EV5A 2JT1A 3BP8A 5L3FA 1IXRC 1H0MA 4D0PA 4HLYA 2ADUA 1DZRA 4BH9A 5LRSA 3LZZA 2BGCA 4LA3A 3TKYA 5JR3A 3SXWA 1OR7A 2HS5A 4EJTA 3IKVA 3V7RA 3BPXA 2IRFG 3M1EA 3IWFA 4M73A 4HOBA 5FLHA 2ZMEA 5AONA 1XGNA 1JGSA 5BS6A 1GXPA 3IL2A 4LD5A 4PCQA 1XGSA 4WVZA 2OA4A 4OIPF 2CFXA 2IT0A 2BV6A 1OPCA 4P9FA 1PP7U 3L09A 3WTSC 5C6CA 2E7WA 5FCCA 5LGTA 2FQ3A 2XLAA 1X3UA 4HVQA 1QPMA 2LSOA 2VECA 3NJZA 2QCSB 2DT5A 4MGIE 2OAZA 3CO7C 5BMZA 5E8IA 1QXRA 3H50A 3TOBA 2P7VB 2P5LC 2D5FA 1REPC 4TLFA 4MQVA 5KBFA 3PLQA 2RGVA 2QM3A 1XCBA 5DCMA 1KA8A 2K0GA 4NVPA 5I8YA 2V1UA 3F8BA 3F21A 2DW4A 3V8LA 4HQEA 4KIGA 4YG2F 1R58A 5FLIA 1QZYA 5I0SA 1ZG3A 4WZCA 3BPZA 3VODA 1G3TA 3FM3A 3RKXA 2GXBA 2CSOA 5I0TA 3LFKA 1OYWA 4ZYHA 1JXSA 3CLPA 4HVRA 1L0OC 4LB6B 4HLXA 2XAGA 1HQCA 2WFPA 1RNLA 4FX0A 3UKTA 4AVPA 2GC3A 4UHTA 3WTZA 4O5VA 4L11A 3RDIA 3D0SA 4KU7A 1E2XA 3F6VA 4GULA 1WA4A 5JSPA 3OTFA 3P9KA 3WW3A 1Z7UA 4UVAA 4JV4A 4LLOA 2D40A 4A5MA 1VP6A 2P6SA 1BIBA 1IXCA 3E97A 4M72A 1MJ9A 4ZYEA 3CTAA 1IXSB 1T39A 4KWKA 3M3IA 1EH8A 5BXXA 2VBXA 5ED4A 3GVAA 4P96A 2W84A 4KDPA 1SMTA 2PA7A 3GF2A 2WTEA 2CYYA 3HSFA 4AWXB 3I59B 2IVMA 4IRIA 2CWEA 1LNWA 5EEHA 3WU0A 3U0ZA 1LRHA 5H20A 1EP0A 3ECHA 4Z2YA 5J8CA 5ICGA 3LWFA 2CO5A 1FY7A 4LA2A 3F23A 3IRRA 3C7JA 2AXLA 1UD1A 3SCGA 3C1DA 5D5XB 2LDUA 1H9TA 3P9IA 3M8EA 4EMSA 1XDUA 5FFXA 4CGZA 4EV0A 3FZ3A 2QQBA 5HLHA 3GO5A 2Q8KA 1MDMB 4BXUA 1LJ9A 2XKOA 4M74A 4A5NA 3RPQA 1ZZ9A 2VBYA 2DQLA 3JAMZ 2ISZA 1ZN2A 2EV0A 3MQ0A 3BJOA 1R1UA 3SXYA 4WXDA 4HDUA 3V8KA 2ETHA 2G7UA 2C0ZA 4HMZA 1ZZBA 5DUKA 1K79A 1MZBA 3C3WA 4I01A 1DGWA 3GW2A 4K8FA 5DD4A 4XFIA 4UBHA 2JTVA 1OFNA 5CVJA 2B8MA 1J2XA 2XV4S 1RIOH 3WE3A 3DQVC 1ONVA 2DCTA 4AQ2A 4AVCA 2OQGA 4Q0QA 2M87A 3OOPA 5ERIA 2BNNA 1QNTA 1YW8A 1YS6A 1T6SA 5HDNA 3ST7A 4U88A 1UCXA 5LLQA 3ISPA 4E70A 4EGYA 2ZFWA 5JR7B 1WRJA 3M8FA 4YIFA 2OD5A 2PEXA 3G73A 1J59A 4I02A 3TNQA 1HKQA 5EEGA 3QPTA 2PQQA 2B5HA 1S3JA 2P5VA 3F72A 3HSEA 1B6AA 3I4PA 4OIOF 3U11A 4XF1A 3MEXA 2YPRA 3TDZC 2UYAA 4BQAA 3BDDA 1YW9A 2B0LA 4AIHA 2MNGA 5HDGA 2PAMA 4RB0A 3ML6A 3EO6A 3OGJA 1HBXG 4E2GA 3H7JA 3DPLC 1P4WA 5TRDA 2Z69A 4KN7X 5F6FA 5LHGA 4RB1A 3VEPA 4XFCA 5HS9A 3ROUA 3MZYA 5LEKA 2BNMA 1XSVA 3F8NA 3W6JB 4L9TA 1W7PD 2MA3A 4XF9A 4A2UA 4PIZA 4G9YA 5BOXA 2D45A 1X8EA 2QLZA 4MEYF 5L3EA 1O3SA 2LF8A 4A6DA 2F5CA 5CVRA 2EA2A 4M6XA 3DKWA 2GC0A 1WWXA 4MH0E 1V3FA 4BYYA 4IEOA 3LSTA 2EA4A 4AIKA 4QM9A 3R0AA 5BY5A 1YFUA 5I93A 4OU0A 2D1HA 1YQAA 2HQNA 3KCCA 4XFGA 1I6XA 4U0YA 4JK1X 5ILSA 4FBFA 4MX3A 4HYEA 2WV0A 1MD0A 4Q29A 3G3ZA 1CAWA 4LLLA 5CLSA 4BIFA 1PP8F 3MDPA 2VC0A 5HDKA 1ZNPA 1IN6A 4HF1A 4QX5A 4XRFA 5CJ9A 2VOOA 5E1ZB 3NRVA 5CU1A 2J5PA 3MCZA 2BBYA 1CAXB 1U12A 3CUOA 1RGSA 3ZMDA 3CF6E 3BOQA 2RC4A 3KETA 1SMYF 4Y17A 1FSEA 2KIFA 1ZZ6A 1LQ1A 2CW0F 4DINB 4MZUA 2K4JA 1SEFA 4PJYA 4OLLA 1G3SA 1I1GA 4N9IA 4IETA 2L01A 4R52A 1X7NA 4L9JA 2ZXJA 4CDGA 4HV5A 4G94A 3E5UA 4HA8A 1FC3A 3F8FA 3HRUA 4QLCU 1LR5A 1QQIA 4QGMA 3SCHA 1ZHFA 2V1XA 3GZ6A 3GFJA 4IVNA 4R8HA 3HT1A 4L2NA 1Y3TA 2W24A 2EFNA 2OU2A 5A2QZ 4LJZF 3F8CA 1FBQA 2DPDA 1GQHA 2MD5A 5KVRA 4MEXF 3DL3A 3U2RA 1CGPA 2UWMA 3NKTA 3KSCA 4GXOA 1SD5A 3PNAA 4LK1F 4LUKA 3EUHA 1ZRRA 4FX4A 4LEJA 1EY2A 2HJIA 4HX8A 4HLTA 3SHFA 3HTSB 1KQ0A 3OV8A 1QWRA 4OINF 3F22A 2ET1A 1MJBA 1TLHB 3I0TA 4KIBA 5L3CA 4RAZA 3BJAA 1NXMA 1R1VA 5K5OA 3ULQB 1YLLA 3HRMA 1BM9A 4ENNA 4E2SA 1BOAA 3K69A 1UW8A 4I09A 4HZFA 1CAXA 4KL1A 4KU8A 2QDRA 2FXAA 4O3MA 3DFGA 3HHGA 4Q47A 2PYTA 3WTYC 4ENJA 2XASA 3QP6A 2Y0MA 2FSWA 1I1SA 3PFIA 2DFIA 2GH2A 5LHHA 3TO9A 4AD9A 4LUMA 1UCRA 4BNCA 4G7OF 4XF3A 2HWVA 4HDVA 2PFWA 1MDMA 4Q5SF 2OPKA 2BE5F 2BEOA 4ASNA 2GWRA 4IEYA 3HRTA 2Z33A 1XMKA 4RD7A 4WK8F 3LA2A 3H7YA 5AIPA 5TJJA 2LNBA 4Q48A 2RV8A 1WSUA 1KU9A 3TQNA 5FQ0B 3S0MA 2V79A 4IEXA 3DXJF 1HXDA 2NNNA 3L9FA 5JI6A 4HW0A 5LGNA 1FOKA 2MPFA 2P7CB 2EVXA 1GXQA 1YUDA 1G3WA 1GHCA 1XN7A 3R61A 3FMRA 4Y13A 1C0WA 3K2ZA 4P9UA 1UHWA 5LBQA 3M7GA 3KLNA 5D4SA 2A6HF 3IC7A 2K86A 2XLGA 2P8TA 4LTAA 2A69F 1OYYA 1MKMA 1LEBA 4G7ZF 2VONA 1FYKA 4JTNA 5KHIA 1UHMA 5J8FA 1U78A 1P4AA 2ZNZA 4I0BA 1Q43A 3S7EA 5D6FA 2RVCA 2F5DA 5BQTA 2I45A 1ZYRF 5HOOA 3J81Z 1ZVFA 4KIFA 1OD5A 5J3UA 4IEZA 1TQIA 4M9XA 4XFAA 1KU7A 4ESFA 2O3FA 1O4TA 3QU3A 3REOA 2DPUA 2B9UA 1CF7A 5K5RA 1SFEA 2FRHA 5J6XA 2JPCA 2CAVA 4ZU5A 3MWMA 3RKYA 3BU7A 1SD6A 3M9AA 4O6JA 5HS8A 5CYVA 4AXOA 3I64A 5FGMA 3RZZA 3FFQA 1BN5A 5T3NA 3FXQA 3GBFA 4MGYE 2HOEA 2O0YA 2WWYA 4HN0A 4MTDA 4WX9A 4UV9A 4IRHA
chains in the Genus database with same CATH superfamily
3ASIA 3E6DA 3PIGA 5CPRB 1COV3 3WTVC 4QX0A 1FTZA 1XS9A 4CCEA 2HFHA 1LGBA 1LDDA 1I5PA 4V2GA 5TISC 1KS4A 2FEZA 2KRFA 3NV1A 2CYFA 1S7EA 2ZXWH 5HVQC 2R042 4XJ9A 1RUG3 4JGYA 4II2A 4AEDC 1JT6A 4RS5C 5IT9Z 1XNAA 4HKWA 2YC2A 2HWB2 3HNBM 5E16A 5D8AA 1LOBA 4XRSA 2NPIA 3QPSA 2PQSA 4RGRA 2TEPA 1VBE2 2R043 4YVWB 2HKOA 1BEV3 2JDNA 3HUGA 2D7FA 2BYVE 4P9GA 1FPN2 4CICA 2WWUA 3CL1A 5F3GA 1PK6A 3HOXJ 3N35A 1CAVA 5A7QA 1OOPA 3UT0A 1E17A 4UB6C 1ZH5A 2DAOA 3S5AA 3SKVA 4LO8A 1EV13 2E33A 1P8JA 5ICCA 4R1HA 1CAUB 4LIVA 3U9GA 4E7JA 4WM8A 2HDDA 1JZ3A 4U36A 3GWZA 1PUFA 2W1QA 3IIIA 1YW7A 1MW7A 2YUEA 2VGDA 1GNZA 4W65A 2HYJA 3QYBA 2BV4A 2IXJA 4A44A 3VZKA 4GWIA 2G19A 2Y64A 3OYEA 2WN3A 1VMHA 4A45A 4MTEA 3AKZA 3E5XA 1S2EA 1E3HA 2DOAA 1MVQA 3E6MA 5JR2A 1L7LA 4QHOA 3KIOA 2Y9ZA 2DA2A 1MR5A 2PBIA 3ASOH 5BPIA 1QNWA 3S1QJ 2LKSA 1QZEA 1PVXA 3UYJA 1K7AA 3TL4X 3QAHA 1VB4A 1U2WA 5LEJA 1LFPA 3KVBA 2VW1A 2L7FP 4IHWA 3OBZA 1D2SA 4DEQA 2HWB1 3AVRA 1JT0A 2OYZA 1HX6A 5FO5A 1JYXA 2RS31 4XQ4A 2EFWA 1BI0A 4XVHA 1OJLA 1EUTA 4EN6B 3I58A 4CZZA 4YRDA 3PTRB 1IGNA 4YFNF 2R7UA 4LB5A 4LOSA 3I3DA 3SDGA 3R4SA 1GP4A 4YFKF 5H9QA 3KP6A 1S2BA 3ZQHA 3ZPYA 1SVOA 4AVBA 4NHKA 1HXS1 3DXUA 4XDQA 1ULPA 2QUOA 4QIWN 1R00A 5B1AH 1S0IA 3IAS2 1MNEA 2VKDA 3G1LA 1W9TA 1GBGA 1L7QA 2B39A 3WDTA 1A34A 2F5FA 1IV8A 2KDOA 3RCOA 2D93A 3J4UH 2XIGA 3R60A 1VBD3 3SCFA 3RZKA 2DUQA 3JRBA 3T5XA 1OURA 2W08A 3RJ2X 2A5YB 3FBIB 3VV1A 2BY3A 4P08A 4W50A 2ZGUA 4ZKTB 4PIXA 3DBHB 5LATA 1WPKA 2XXZA 1NYWA 2WS93 3I4MJ 3FUQA 1XSXA 3H1CA 3UL2A 2VBZA 1G8XA 5EZWA 1FOD3 2O5RA 3BLYA 1XCVA 1OH3A 4CHUA 2F6BA 4XORA 3WF3A 2UURA 1PMIA 3BG3A 4E2QA 2KDZA 3PHMA 3V56A 4RB3C 3OUHA 1G59A 4V1PA 4E8DA 1MEC2 4HL0A 2DO7A 1YWKA 3BY6A 2C9AA 4PJMA 2RS13 1YFYA 2EZHA 5GPAA 4Q4X3 4B4QA 4ENKA 1Y0NA 1R1TA 2JKXA 1J3PA 1YS7A 5LA1A 5A3PA 4JX0A 5C3QA 2FJ1A 2RJ2A 3TEZA 5H6RA 1OF3A 1UL9A 1AYM3 3WR0A 2VXRA 4DRRA 2YX7A 5CFCC 3GCMA 1MJAA 2LR8A 1XGMA 3NQOA 5L3GA 2UWBA 2XL7A 1C4RA 1AX1A 4RQPB 2XPVA 2CQKA 3NAUA 4IHVA 1DCSA 5BUVA 2D6LX 1Y9QA 4ZU7A 3HAGA 3EETA 5FDBA 2HR3A 5FZDA 5T5PA 2Q2EB 4NAOA 1Z6RA 3P3PA 4DJAA 2VJIA 2HWE3 1CJPA 3S30A 5A3OA 2XGXA 1MS8A 1O7LA 2RNJA 2WIIB 2DMTA 2AEZA 2VQAA 4RS5B 3S1RJ 1C5HA 3CMAI 1HRI1 2OVUA 1OR7C 2WFF3 5H9PA 1P6RA 5IYDJ 1SDWA 5DAXA 2WQ4A 2RHPA 1COV1 1YEWA 1T2XA 1OXCA 4PDKA 1S2KA 3FFZA 1HKSA 2GM4A 3LA7A 1RINA 2XHKA 3S6PA 1DIWA 5LRRA 5A7PA 3T8RA 2GXAA 5FLXZ 4YYOA 3I53A 3H5NA 1RHI3 4U87A 2O1QA 3JW4A 2GIVA 3EQLF 2YZ4A 3BALA 5E17F 3WP3A 2GU9A 3K1NA 5FZMA 1FWZA 3ZQ7A 1LGCA 2FBKA 3VD7A 1V4RA 1UFMA 3WW2A 2BVVA 1J3RA 2UXNA 2MW8A 3QBQA 1U3EM 1X2MA 2L9NA 1QHHD 4S2GA 4CXFA 5B3SH 1QQP1 1GDTA 3Q0VA 2UY9A 5EJZB 3OIOA 4Q4W1 1JMUB 3NJXA 5DD8A 2Q1FA 1YTYA 5E1RA 4GZ9A 1WD3A 2VI6A 4EN8B 3ZFFA 1MZ5A 3AJZA 1DBNA 3KEOA 3EUKL 3VBRC 1B09A 2EJRA 3GX4X 1UY4A 3OPWA 5HV4A 2XB0X 3D5SC 2V72A 4PBPA 2X85A 3F6OA 3ERED 1HDKA 4IO9F 5FWJA 1LVAA 3TO6A 3C3VA 2R5YA 3CJXA 4FXGB 3K51A 2XF7A 2J42A 1FEXA 4ZC3A 2WB1A 2VXZA 1LNSA 1D2QA 4JTOA 4RGKA 1OFCX 3ZO0B 2E32A 4Z2WA 3CCSI 2YDEA 4MGTA 3C18A 5C44J 1K6YA 3WLUA 3KS7A 5IWFA 4KWLA 5CVVA 4M9SA 1FIPA 5FY5A 3KP5A 3ZX7A 4C30A 4GIQA 4M6YA 2NRAC 4X6RB 2IA1A 3FLPA 1CF7B 2WJSA 2QBYB 2VOKA 2WR9A 3CJRB 3NSTA 4QPQA 3BPSA 3MHZA 3H1YA 5KC6A 1E5RA 5FZHA 3IDAA 1RL3A 5IK7A 1DF0A 1G6NA 4PGHA 3EYPA 4MUVA 1T38A 2LY9A 4I3PA 1V6NA 4FOYA 3ZYIB 3N05A 3OMYA 3KZZA 3FJSA 3THCA 4FQ4A 4XNFA 3F8MA 4XRSG 2RV9A 4YW6A 3ZQGA 4OZOA 2J1RA 3K4CA 2YC0A 1WCMJ 3AZYA 2E9QA 4AVSA 2R49A 2VC1A 2DA6A 2GAUA 4CP1A 5A7OA 1GICA 1Q5OA 2XOMA 2Z99A 1WLWA 2WT1A 3FK6A 4PJ0C 4E4DX 2MC3A 3NEUA 4RHV1 4C9YA 2LG4A 3SHRA 4DYRA 4IQJA 4ZS3A 4QU2A 3N36A 1HW2A 1C1LA 2JDZA 4XBFA 4J00A 4ZTFA 2ZGNA 2HKXA 2VQGA 2HTJA 3LSHA 2VBDA 1UQXA 5LW9A 3F95A 1A6IA 3I2OA 2XROA 2WNUB 3AYEA 3COAC 2D6OX 4DS0A 1RUE2 3OYWA 2P3KA 4D8MA 4GA9A 4LBQD 3S57A 2R7SA 1UIKA 4NDLA 1XB9A 3RYRA 1FBSA 3K1MA 2DJNA 4GQ7A 3QCWA 4MGZE 4YM0A 5FY1A 5FP8A 4RQPC 4ZU4A 3IDBB 1FNNA 1RUI1 1T6GC 3TRSB 5EZHA 3OBAA 3ZPOA 3U4XA 4R79A 4QPGC 2NN8A 2P4EA 3RZMA 4AE2A 1SFNA 1YYVA 3C7FA 2ARCA 2PLYA 4FTSA 2L9VA 3CP8A 2E1CA 3J7AO 1IKPA 2Q8OA 2VCMA 1RC6A 4EWAA 3Q5FA 2EV6A 1V9U1 1S7OA 2O8KA 4TN7A 1W6NB 2ZX4A 3CUQB 5J09A 4JGZB 1ND2A 2YYOA 1JH5A 2R5YB 3OYGA 4RDUA 2OV7A 3EJKA 4LMYA 3ZP5A 1SLAA 3RS6A 2E7XA 1FTTA 4WM8B 2WLPA 3HIFA 2YU9J 2RS12 3FX3A 2J1UA 2WQZC 1UMZA 4EN9B 3NAPA 3NW4A 1FBUA 4LO4B 3FHIB 3VHPA 3IKTA 3A0KA 1V9U3 4TZDA 2WB1N 3CP2A 2VE1A 2W57A 1QJFA 1DDLA 5L36A 1NY72 1S0FA 2BNOA 3UK9A 4E7SA 4BACA 4QMAA 2LS6A 2CUFA 1WBFA 2M4GA 4IERA 1ETXA 2G7HA 3VD5A 4BE2A 1MEC3 3NV3A 1S6LA 1JN2P 5EYRA 5JIAA 2YR2A 2R071 4XJ8A 1HKTA 2ZGKA 3CZUA 3G7DA 5EV7A 4JGYC 1ZKGA 5AVAA 5A3MA 3VOEA 2PTMA 1B9MA 2K4BA 2MBFA 1MH3A 5T55A 4AFDA 3IDCB 5KNLA 5DUIA 4EE2A 5F1RA 3O2PE 2XVLA 4XLPF 2B46X 1JU3A 3E3VA 3TGNA 4HANA 2HTSA 1FOD2 5L3BA 1PO22 2R16A 2WZR1 2LM3A 4G12A 1FZPB 4URAA 2VZPA 2MH2A 1W8HA 3S2HJ 3I56I 4LORA 2RN7A 1UZZA 3CEWA 1S0CA 5FPAA 3K70C 2OCCH 2ELKA 3ES1A 4IEJA 5CIRA 4UVBA 1HCRA 4M3DA 2PMUA 3GTGJ 4L0YB 3V65A 2LD5A 4ETSA 3PO2J 3WVJA 3GBGA 2HZDA 2BRTA 2I07B 3PQKA 5KXEA 4AF9A 3KYLA 2KJCA 1ZBA1 4NHXA 2F6CA 1W0UA 3ZFEA 2HQRA 2R061 1X1CA 2FNPA 2WNUA 5FRAA 2QQNA 1BBT1 5CFDA 2A5WA 3GNEA 2FD5A 4RQPA 5GADJ 3THDA 3TN93 3GZ5A 3CHXA 1TBXA 2H6CA 3BR0A 4W6XA 1X8MA 3IM0A 3T1LA 4CO8A 3CLOA 2DDAA 2AEYA 3TN92 5CQGA 4Z2AA 4YRVA 2A6EF 2ZMEB 5FKLA 3HEIA 4R9BA 5CFDC 4L5EA 3D3AA 2KRHA 4UVCA 4QKFA 1WI9A 1BJAA 4Q8KA 3VBFA 5FZIA 1VI0A 2DYRH 2M45A 2PG4A 1WLTA 3H1WA 1U0JA 5HLGA 4TSVA 2ZS6B 4XTMA 3EUHC 3JRAA 4IOCF 1K12A 4U7BA 2Y8KA 4HG2A 2ZGPA 1MS3A 4MXWA 1KONA 4XFHA 2JPBA 2NAZA 3SNMA 5D8LB 3AL0B 2ARXA 2ZGMA 3I2IA 4FE7A 2WWJA 2WYSA 2E7QA 2LF7A 2K3PA 2UY8A 2TNFA 1Z0HA 1R23A 2FMYA 4AVVA 1NG0A 4YZ5A 4EROA 5DAQA 4JDOA 5EP9A 3LAPA 3FMGA 4CXWA 3UESA 1HV0A 1IG0A 2BOIA 1VQLI 5FREA 1DGWX 1FYMA 5JMOA 3FXRA 2WWSA 1ZG5A 2V1DA 1D8JA 2LH9A 3TMOA 3S8PA 2DV9A 3ZXSA 5HLIA 2KA3A 2HWF3 2JE8A 5JZGC 1OCZH 4LG0A 5FY0A 5H6QA 2ZJ2A 4E7IA 2LFBA 2VG9A 4YM2A 4KWUA 1S5LC 1PMHX 2V6EA 3ME2A 1ODDA 2DYCA 3PNVA 1RXFA 2CGPA 2NVXJ 1QMJA 2ZACA 2QZ3A 2M30A 1VPHA 4BQ4A 2VODA 2VCBA 3B9CA 4F83A 5LCWL 3MMYB 4M71A 4Q5OA 4S0HB 3MZHA 3J7AY 1OLTA 1NCQC 1CONA 5L7OC 4JGZC 2XF5A 5CKQA 1VBC1 3LSGA 2CV6A 4WZFA 4AIJA 3J7ZI 3POYA 2PMZN 5IOZA 3HQUA 3W2VA 2D6MA 5FPBA 2RG4A 1Y9MA 2EA7A 2HYKA 3IUOA 1ZREA 4NROA 5J4YA 2ES3A 3TDUC 5JFRA 2DU1A 4B1RA 1JI6A 1CX1A 1N1TA 3ILRA 1KQ9A 3UKNA 1W0PA 1WH7A 1UKRA 2YSRA 2DMUA 3WP5A 2JQ7A 3HOZJ 1NT0A 4IL6C 4LHNA 4RGXA 5TGTA 2VPVA 4UW5A 2C24A 3IMMA 5J98B 1UIJA 3OYWB 3QOPA 1Y1VJ 2DVBA 3I2HA 5HI0A 1LB2A 3WGIA 4NMIA 3AMNA 2CUJA 3HR9A 3PSFA 2CL2A 3BG5A 1D1CA 2CS3A 4XL9A 2BERA 1FLIA 2AXTC 2UU8A 1YQ5A 4YSFA 1P9QC 4NC6A 4A3JJ 1HF0A 1D0HA 3QLQA 3VBRB 1XOYA 2TDXA 3JAMK 2R0QC 3BIEA 2JXAA 5LWBA 4QT6A 3ACHA 5GLTA 3VHOA 2QBYA 3GXOA 1WZXA 5A80A 4Y24A 5ANNA 4HETA 5IVEA 3Q3SA 2JSPA 4Y1XA 4PQ9A 2HDWA 3WQ1A 2R7RA 2HEOA 2UWAA 2G9WA 1J0RA 3T0DA 4XHBA 4B8EA 3DWLE 4PBOA 5D8AC 3ZMVA 3OYHA 1W5TA 3KP3A 2EFPA 5DABA 5C3EJ 1IQDC 1AWCA 4YPJA 1FATA 4PDWC 1D4M2 2PXJA 4SBVA 1DP3A 4B7EA 3H92A 1BVP1 5C7GA 1W6OB 3BVCA 1IG3A 1H0MA 2WAAA 1H1AA 4HLYA 1AR81 4XJUA 1OLQA 2E31A 3O0VA 2CY6A 5JR3A 3K6GA 2XAUA 2VL4A 3ZM8A 3K75B 3IKVA 4CEYC 3V7RA 2IRFG 3M1EA 3IWFA 4WM8C 3IMNA 1H9WA 1Z7S3 3GTOJ 3VBUC 1X1AA 4LD5A 2DA5A 5F8PA 3AG1H 2FOWA 5D21A 1LODA 4OIPF 2M7BA 4CUCA 1OPCA 2K2SA 5C4WA 3FKIJ 1PP7U 3K4BA 3WTSC 5LY2A 4UI9L 2NVTJ 1BYHA 1PYVA 1QPMA 1FPN3 5L7OB 5GPCA 2DT5A 4MGIE 4LKEA 1WD4A 1XQNA 3ZXFA 2D5FA 3CDZB 2K0GA 1KA8A 4E7LA 3R05A 1O91A 3OIQA 2LC2A 4BOWA 1R58A 4C3JJ 1ZG3A 1ETKA 4WZCA 1GV5A 4PSXA 4KQ7A 2GXBA 4Y22B 5H9RA 3WP6A 3LFKA 4AEKA 3J9SA 3THPA 3V0BA 1HQCA 1EF4A 3RKQA 2PHUA 3HBZA 1RNLA 2GC3A 1OUXA 3T09A 4MFDA 1MIJA 4GWJA 3WG3A 1A36A 4AYBA 1O4ZA 5JSPA 1TWCJ 3S3MA 3P9KA 4XCAA 4AI0A 4Q4Y1 4UVAA 1MACA 4JV4A 2D40A 4A5MA 1REEA 2ZEYA 1SCSA 2CW7A 3CMEI 4CH7A 3RZOJ 1BIBA 4M72A 5BNPC 2V73A 2AACA 1GR3A 2W47A 4ZYEA 3CTAA 5IVJA 3PIPF 4KWKA 3O1VA 2XGDA 1I50J 5BXXA 1F43A 3I55I 3VDXA 4XICA 4KDPA 2ZTNA 3A0HC 3A01B 4URTA 2CV0A 3KCYA 2R7TA 3HSFA 4AWXB 4CCNA 1WJBA 1RPWA 2PHRA 5FK7A 2CO5A 4E7ZA 1W6MB 2OTLI 1MPXA 3B3QE 2OF7A 4BJ5C 1OBNA 1H9TA 3M8EA 4EMSA 1XDUA 3RZGA 1ZM1A 4EV0A 2QQBA 3AKTA 5A6ZA 1DG6A 4XUPA 1QJU1 4IHYA 3U21A 4A5NA 3UGFA 2JDYA 5HXMA 1F9KA 2V9KA 1A6QA 3K46A 2EV0A 1D4VB 2Y9YA 1HLCA 1ACIA 3ZQQA 2G7UA 1Z7S1 5EF6A 3LD8A 4HMZA 1GNYA 4I01A 2JTVA 1DU3D 2CMPA 1PNGA 2I10A 3BODA 3C2BA 2XV4S 3TW7A 1XNTA 1X58A 1RIOH 3KT1A 2J7MA 4KBBA 4AVCA 2OQGA 1VBC2 3BZCA 2GP5A 5E3NA 4C3IJ 2BNNA 5E79C 3T2TA 5DN2A 4L0PA 4DO0A 2O7OA 3ST7A 4U88A 1UCXA 4XURA 3O1RA 4EGYA 2ZFWA 2TCTA 3LSRA 2F4LA 4KGGA 2DUOA 2D5VA 5FRNA 3M8FA 3USUA 1US2A 1ND2B 4RAFA 1G7YA 1WJCA 1N3PA 2HWD1 2VQ0A 1ODMA 1GOFA 5IVYA 1I39A 5EEGA 4Z8BA 5A6XA 5BNNB 3BTCA 1S3JA 3N7KA 5T5OA 3B5LB 3KV6A 1VAVA 5FXWA 1C28A 2ZABA 4HNUA 4H55A 5J47A 3OYBA 1W28A 2ZGRA 2VQTA 4NHLA 3PVNA 3BDDA 2K3FA 4CZCA 5K0UB 3WDVA 3ML6A 1W99A 4E2GA 3DPLC 4HPKA 1P4WA 5EGOB 4L9BA 3K4MA 1Y8RB 4KN7X 4GALA 4UFIA 3BOPA 3GTJJ 3VEPA 4MADA 2W68A 2WFF1 3VDDA 4HK9A 3F8NA 2E26A 4L9TA 2VOXA 3AKRA 4A2UA 1YJ9I 2EBIA 1NA1A 4PIZA 2NOGA 1Z7LA 2E71A 4F55A 1X8EA 5BNPB 4ZDOA 4DXSA 1K5JA 3HEFA 1OH4A 5L3EA 1W2OA 4A6DA 2ICWG 2F5CA 3KV9A 3DKWA 2GC0A 1WWXA 4MH0E 3L1PA 3C2GA 4QM9A 4BS9A 4UUSA 1L7RA 3ZIXA 3W2AA 5I93A 4OU0A 2D1HA 4XFGA 4U0YA 2HBTA 1QVTA 3FBNB 4CDXB 3RSJA 4IHXA 4Q29A 3POBA 5DUXA 2J1VA 2XRLA 4HXCA 1PP8F 2DVDA 4ES9A 2K9QA 2VC0A 5HDKA 4QU1A 5IVCA 4XRFA 5CJ9A 1GZTA 1SC7A 2X1CA 5E1ZB 2BW3A 3MCZA 1CAXB 2JUGA 3ZMDA 3CF6E 5F5IA 4YW4A 1SMYF 2L2OA 4OWRB 3VZMA 2Q8EA 4BQ1A 2CW0F 1SFOJ 2K4JA 4QDQA 4PJYA 1G3SA 2XDVA 1DQ6A 1I1GA 1Y1WJ 5B66C 4R52A 1DZQA 2ZXJA 4CDGA 4HV5A 4E27A 3ZXGA 3KB5A 3K10A 1LR5A 4QGMA 3OY8B 1PNFA 1D7PM 2NM1A 3HT1A 5L9RA 1IGOA 2W24A 1RMU3 4PLOA 1RC9A 2AO9A 3POWA 4W97A 2M8GX 1KFUL 1FBQA 5J96B 2MD5A 4MEXF 1CWPA 4P5YA 4CU6A 1N3QA 2UWMA 2ARAA 2TUNA 4GRIA 4GXOA 1T95A 2XC7A 3O5SA 4AFMA 1EY2A 2HJIA 3KV5A 2ZAHA 2BWCA 3M4FA 1TLHB 4KIBA 5L3CA 1R092 1R1VA 1BHGA 1BM9A 4XDOA 4OHWA 1BMV2 5DG1A 2OS2A 2PMZA 3OUJA 2ZX0A 2ZX1A 3T30A 3AFGA 2R7EB 3DCQA 4QB1A 3TB0A 3VBOC 3KYCB 3HJRA 2FSWA 1LUJB 4GWMA 2BXYA 2HBUA 3PFIA 4RAGA 2GH2A 5LHHA 2YBPA 4S2HA 4OULA 3J7MA 1JKOC 1R083 3TEWA 2HVSA 4ASNA 4RLQA 3KF5A 3T1MA 1GANA 2EXIA 4IEYA 1XMKA 4RD7A 1ZA4A 3LA2A 1GMMA 3FN9A 4DXTA 3VD3A 5TJJA 3DXTA 2CU7A 2RV8A 1WSUA 1KU9A 2G9FA 1VBA1 3M3QA 2BBVA 2V79A 4CXYA 1V0AA 3T0BA 4FISA 4HW0A 1DQ0A 2P7CB 1W39A 1GXQA 1YUDA 2GMMA 4RMNA 3QQAA 1G3WA 2X1EA 4A42A 1HQNA 4HEA2 4P9UA 3BG6A 1KXGA 3AVSA 1UHWA 2VZQA 2GOXB 4CU7A 1Z3XA 1SDDB 2HQ5A 2TBVA 2OTJI 2XLGA 3KX2A 2DXIA 2R7OA 3A01A 5KHIA 1UHMA 3U1KA 1HIXA 2ZNZA 1Q43A 2E34A 1GZ9A 2PLV3 1ZYRF 1IS5A 1OPOA 4NN0A 1PMJX 4XMIA 2EIKH 3VBFB 5IY5H 1AYM1 3NJYA 1FOYA 1DQ5A 2NQYA 2VMIA 1D0ZA 5J3UA 5KXDA 4XFAA 3BIWE 3SC7X 2IFWA 1UG0A 3DYPA 1O4TA 1JXNA 3REOA 2DPUA 2AGSA 5K5RA 3BQYA 3DEMA 4XKVA 5J6XA 2K46A 4QXCA 2JPCA 4ZU5A 2G4IA 3MWMA 3VSLA 4W6YA 3RKYA 5FOBB 1SD6A 3M9AA 4QDSA 3H3VK 5FGMA 3PL0A 3S2DJ 2RM22 2W95A 4CCMA 1EV11 1I3AA 2O0YA 1GP6A 1MS0A 2FMDA 3R4UA 2DA7A 4BQXA 3LSEA 2VUAA 2VZSA 4WX9A 3LPFA 4IRHA 1ENSA 2OZ6A 3BGAA 2EIBA 5JSRA 3HWJA 4M01A 1QXJA 1N78A 5GZFA 3WV6A 3ZYBA 2ID3A 1XG1A 1G9DA 2CV1A 1PUEE 2XQXA 3NWKA 2X6OA 1APLC 2ZMNA 2FQ4A 2RR11 3ECOA 3F0CA 1XNKA 4Y7NJ 5HBAA 3OPZA 5F3CA 1Y0UA 2IXHA 4E9KA 2L7ZA 3PO3J 3WW1A 2WC2A 3WXPA 5J7MA 3HC7A 4AVAA 2O8XA 3VKNA 5LHIA 1TNTA 2CNAA 5FJKA 2H09A 4HRIA 3ZLIA 3VDBA 3EYYA 1G86A 3I2KA 5KXCA 1GVJA 4CEWB 5FUNA 5AIQA 4AU7A 3T4HB 2XLFA 5J48A 3I3QA 3DKQA 4CUGA 1KEXA 1X4OA 5EFUA 1BXHA 3POIA 3K9TA 3OOXA 4WF2A 4QQPA 5F2WA 1R64A 3EBRA 4BU2A 1A8MA 4YW1A 5ILVA 2L0KA 4KBZA 3TYJA 4AM3A 2E2IJ 3MKLA 2XUEA 1WBLA 3DN7A 4YVSA 2HYGD 1R081 2EINH 3LKJA 2B42B 4R9DA 3WDWA 1J5YA 2QQWA 1OKOA 2ARBA 2X48A 3R4DB 2QQIA 4MGQA 4WCGA 5GM0A 5F37A 2GZWA 5A7WB 1MBKA 2V26A 5HNHA 3JQXA 4AC0A 4DUVA 2RS52 2Q4SA 1RETA 3J8F1 2I8DA 3V7CA 4DNYA 4ZDLA 2HLEA 4HSLA 4ZZDA 4QSHA 2EFQA 4DBRA 4QPYA 2JA6J 4R4XA 3MFKA 1QPIA 1LTEA 3I5UA 3ZN6A 3GFIA 4C1XA 4F8AA 2WS92 2W4SA 4YARA 4M4PA 4AHZA 1W8ZA 1EPZA 3VBOB 2WSVA 1YRNA 3AZXA 2ZBKA 4G4FA 1SFXA 5ICFA 3EYIA 3VYUB 4U0VA 5J1RA 1OA2A 2OZJA 3BN6A 1R71A 3WGHA 4DUWA 3LQRA 2BGPA 4AI8A 4AIDA 5ABJA 3ABLH 1AA7A 2LTPA 2KXLA 4ISRA 3WTXC 5FYMA 4KITB 2W48A 2L4MA 1S9HA 4IHTA 3AZZA 5EJCA 2VMFA 4IE7A 4M3CF 3GFLA 3JR9A 5C8CA 4A3EJ 1ZBE3 1TP4A 3U07A 5LBEA 3FXOA 3BTXA 4B29A 2VE9A 1V5EA 4PF5A 3N7MA 1ZRFA 3I7DA 1F1ZA 3JRHA 3BZ6A 2X4HA 3WF4A 4I0AA 2DOEA 5B5EC 1R093 1NG7A 1JE8A 3Q9OA 2P1BA 4GB32 1FYLA 4PQQA 4L5IA 4HBLA 2OQ7A 3CCJI 1F4KA 5BNNC 2PAKA 3C2UA 2HQAA 3JRIA 3AB0A 1NE4A 2LREA 4X0GA 1Z6TA 2VVDA 2UV1A 1XMXA 1RITA 5C3RA 2DMQA 1AYN2 4CDQB 4LK7A 1GOHA 5D5VB 4UW3A 3B00A 2XB6C 4FOWA 5FD6A 3ECQA 3ABUA 2VNOA 3EDPA 5GLZA 1UO9A 5KK1A 4META 3B6AA 2VY0A 3GFMA 4EQQA 1CZVA 4XBQA 1TZLA 1H4GA 4BQ2A 1A04A 1RMU2 2Y33A 4Q0PA 4X8PA 3AP9A 2NS8A 1UU4A 3HOVJ 4PI2A 1KGSA 1H9GA 3VYSB 1AXZA 5BNOB 2L7KA 1OQEA 2YB7A 4LNVA 1U8RA 1XNDA 1DPUA 4HX7A 1RR7A 1YE9A 1ZZ7A 4AEDA 2WZ8A 4CTEA 4YGCA 4WXCA 2NS7A 2VUCA 3PDQA 4YZ2A 2HGCA 3KLOA 3WODF 3BROA 4UOJA 3PFYA 1NCQB 2P17A 3I49A 4KMQA 4UBGA 3CCLI 1S0DA 2PHDA 1K78A 2XAFA 3KP2A 4YG3A 5GAHJ 2AQFA 2SLIA 2R1BA 5CFDB 3LFMA 2C6YA 1W8NA 3KD4A 1W5CC 1S0EA 5C71A 2B9SA 3W2WA 1HV1A 3LDRA 1AYN3 2IXKA 5IT3A 2OKXA 4N53A 2W3JA 5JDBA 3LEKA 1AUYA 4W1UA 4FASD 4ARXA 1PIV3 1UZYA 3VHRA 3ZFFB 2RS33 2ZEXA 4LBJA 3NNMA 1K3IA 2BZTA 2XRNA 1ZBA3 4DZGA 3H9GA 1HC8A 4XSXF 5H2FC 1N1VA 2HWD3 3VN4A 1K6OA 1F5JA 3SFZA 4TYSA 1W3XA 3OYCA 2ELJA 1Q1HA 1S72I 3DEWA 2ACJA 3NO8A 1BR4A 1H0BA 2HWD2 2NVUB 3NNLA 2AQEA 5JHUA 5EPAA 1GYKA 5FLXK 1H89C 4N8MA 4IZZA 1H2LA 4QDRA 1WCUA 3W9AA 1VZ0A 2XUBA 4A3DJ 2P6TA 5CG9A 1RUD3 5FB2A 2QZ2A 5T54A 2GH8A 1U9NA 4KGQA 2YV8A 4OMZA 4I98B 4IOAF 4XACA 2GIZA 1Y39A 3Q9VA 2ZJCA 1H1MA 4Q26A 2GNDA 3LWCA 1LE8B 1GV2A 1IRFA 4XN3A 4CYDA 1TQPA 4HSRA 1W36D 4IF4A 5F9TA 3SEZA 2XVKA 1FAYA 4UAPA 5ACA2 1LAJA 1O3TA 5K7FA 1A8DA 2VUDA 3FKJA 5FZ7A 3C7GA 1FV3A 1T8IA 3JU9A 2WT0A 4IEUA 1K5MC 3TWIA 2QZ8A 1AXKA 2BP6A 5F0CA 4XPVA 1TNRA 5FZ8A 5SV8A 3BB6A 4FPLA 4XIKA 4MIMA 5KWRA 4KNYA 4IHSA 5F7UA 4OI2A 1YX3A 4QKBA 1H6XA 2QYOA 1KZHA 1R6RA 3PUHA 1U5TB 1LDJA 2IJLA 3AXEA 1EYBA 4E7HA 2BY2A 3H42B 4PFPA 5C70A 1ZX5A 3IAM2 4OIQF 1LHWA 3MLKA 1UOFA 1XJAA 1IPJA 3MKZA 5JVTA 1MNMC 1J3QA 4YWAA 4C2TA 1JZ7A 2K27A 2C5DA 4K20A 2DI3A 4YG0A 5FMOS 3HB9A 2NS0A 2R041 3KWVA 2GN3A 5H9SA 3TNPB 1OQDA 1RUI3 5K5QA 4OAYA 2FU4A 3RPUD 3DF8A 5JXGA 2QUFA 1O57A 1OA4A 2KISA 3MYXA 5C4WB 4IKFA 4Q4Y3 4Y5Z0 3HXLA 1R1A3 4XZPA 1UAIA 3ZXLA 3U1XA 2NYXA 5ACA3 4YW7A 3T2PA 4LBLA 4PJNA 1UU6A 5IK4A 2X51A 1NXD1 2E1OA 3BTZA 2ZAAA 1RKTA 2STWA 4IPAA 4MGKE 4UUVA 1H8TB 1LHVA 1OCPA 1D8KA 2IXLA 3UJOA 3GTMJ 2IGNA 1USTA 1GZWA 1YQ8A 3L9JT 3KEQA 3GEZA 2HXOA 5FIXA 3LB9A 1QGPA 1YHQI 4QQHA 1GQGA 1VQMI 3KGZA 4BMEA 2KKOA 5DYMA 1YO5C 4NBQA 1CVNA 5DZFA 3A2KA 1E5SA 4YFWA 1W8TA 2K9ZA 1D5YA 3S7IA 1Y56A 2HU9A 3IPVA 3UR3C 4DW6A 1SFUA 5ABJB 4CUAA 4SLIA 2X6XA 4LLFA 5DPNA 1VQPI 2X6YA 4IXLA 3ERMA 2XQRA 1SD7A 1VBD2 5A1FA 3SH4A 4QHBA 2AYHA 1I9RA 1NZCA 2KPMA 2OC6A 1XB4A 1JUMA 2Y69H 2LUWA 2JWPA 3OG2A 1GP5A 3S3NA 4FOQA 3OBTA 2YFZA 1F5TA 2F48A 3D5LA 1VMJA 1OHFA 2ZEWA 2ZPXA 4P9IA 3O1TA 3KZIC 1UYZA 1RIRA 4KWJA 2GMEA 4RB2C 2O03A 1JOPA 4P9LA 1RVF2 1MBJA 4R4ZA 5I0UA 2X5IA 4D1QA 1KRIA 2YGLA 1AOYA 4GYGA 4LLNA 5C8CC 3EQEA 3CCYA 1YG2A 1OCOH 1M06G 3ZMSA 4JKKA 2EPFA 5C9AA 4LHKA 3VBHA 2J22A 5D5UB 1DP7P 4CDWA 4BISA 4MNUA 1TZOA 3WDXA 1KFXL 3H0GJ 1AJKA 3ACLA 4WXHA 5DV5A 4NPLA 3IPVB 3CD6I 2KIMA 3KF3A 2DCYA 1LKNA 1WMXA 1C8NA 1UPIA 1HA8A 3AP7A 3MO4A 5I8SA 1CAUA 2VZ3A 3JSOA 1QJX1 2DTRA 3E0JB 1U5TA 3KGLA 2DFCA 3BCWA 3HOSA 2EICA 3AAFA 5E8GA 4Q0UA 2IA0A 3IH2A 2GALA 4L99A 1FOWA 1ZLKA 3HPGA 2AH2A 3HHHA 3HMYA 4HVOA 4WM7C 2JWTA 4BQQA 3NARA 1QOOA 1STMA 5KHKA 3G6JB 3FXUA 1T33A 4HONA 4PT6A 4N0BA 3WW4A 2MSYA 3LFUA 4KFCA 1Y8QB 4WVMA 5KCMA 1ON1A 5DDGA 1OLMA 1NQDA 2V5DA 1ZGJA 1P7JA 2E1NA 1NCQA 2LW8A 2VBPA 2QDNA 4AAPA 2IS6A 1JHNA 4HBNA 4NIHA 1VQKI 1ETOA 1AYN1 3GCWA 5A1AA 3WU1B 1SCRA 3BI3A 5FYUA 3S32A 3CJIA 5A6YA 1UF2C 1R9TJ 4NAMA 4W8JA 1OKRA 4OUEA 1XSDA 1H2MA 4OFGA 2CDOA 1KDMA 4E4HA 1BW5A 2GA1A 1U5YA 5JOXA 1VBB2 1SD4A 3GCXA 2ZJPF 3HT2A 3ETPA 2GBYA 5LASA 1O4YA 1YFXA 1D1AA 2KHMA 2EZKA 4FFHA 1ALYA 4AFBA 4DY5A 4A41A 1AXYA 5FYBA 3K3NA 4RN5A 3S3OA 2GMPA 1DP0A 2OBPA 2Y75A 3IAQA 3WF1A 3BPVA 2VOVA 3WUDA 2OPWA 3AMPA 5LK7B 3HVDA 2K7LA 3RQIA 1CESA 5FYTA 3RZDJ 3OS0A 3PMEA 4A93J 4O61A 5FMBA 1JW6A 2JENA 5JMCA 5B4NA 1KYZA 3B6CA 3WG4A 2Z1DA 3WT3A 3EB7A 2V6CA 4UFMA 6PAXA 1YI9A 1EV7A 4DYCA 5JZGB 4NPRA 5FZBA 2WABA 4QD2A 5FYYA 4D5FA 2QVOA 3DYMA 3I4IA 4ENMA 2DYSH 3I97A 2MLKA 3VZOA 1PVC1 1BC8C 1GWLA 2EIGA 4LK6A 5G04L 2EXKA 1TNSA 1JTYA 3ZN5A 3GYDA 4CSWA 3F2ZA 5IYCJ 1WZ2A 5HODA 3WG1A 4YFXF 2WS91 4DNCA 1UZVA 3VYTB 2Z2SB 5F6KA 2VASA 2VW2A 1XE7A 3FDYA 5J36A 2M3AA 5FWEA 2WNVA 5A33A 3BR5A 4L92A 1UXZA 4K6BA 1K83J 3HYIA 4CEYA 2RS51 2QWWA 2VNVA 3O12A 5E18F 2FNAA 4AQ6A 1DGLA 2O9LA 2MFZA 3TBDA 3O6BB 3RYKA 4HV6A 4XJAA 2PHWA 4MQ9F 1UXXX 2DVAA 1R082 2JG9B 1JUSA 1D3YA 5F64A 1VBE3 1H8TA 5K7PA 2YU3A 3KLSA 1IRXA 2VJ5A 4ZTJA 1J09A 3GZUC 4DZPA 3OYMA 3JRCA 1I5ZA 2A71A 3RVHA 1BI2A 1EAH3 2ZXIA 1W8UA 1IKQA 2VM9A 1XRUA 1QO0D 4EJVA 4Q0VA 1IAWA 1TW2A 4LE4A 1E3OC 4EATA 1W2TA 2YBSA 1GLNA 2ZO4A 3DGTA 2KD7A 4H3WA 4BLJA 4QQ2A 2CJJA 1BBT2 4OMCA 1NOVA 2P0WA 1SACA 3QPHA 1YOVB 3TP0A 1YQCA 1H9PA 3HBKA 1UNBA 5FZ4A 1UELB 2NVYJ 3MV01 4PHZA 4IE4A 4GGGA 4NQWA 2CGNA 4NB5A 3PNTA 3JTGA 2RR12 2DU9A 3VYRB 1GZWB 2QEXI 4ZZ5A 2A3WA 2Y6KA 4OI1A 1C1FA 2PLV1 4A0YA 5IW0A 1POV0 3P6BA 5IVVA 1J75A 1ENHA 4MG2A 4K21A 2WZR2 2HYFA 3AMMA 2YG0A 5M3MJ 3OGSA 4BLIA 1UMQA 4D6RA 3PU3A 1A3KA 4Q4X1 4PGGA 3WHTA 3B73A 5K7ZA 2Z3YA 1QZZA 5IP9J 2WA0A 4EEFG 5K8SA 2A68F 3L2YA 3FMQA 4QWQA 3OS2A 2A6XA 2JE7A 1UOGA 4N4NB 2L54A 2FMLA 4B3AA 5IOYA 1G2HA 2XMLA 2N7GA 4IRGA 2V5YA 4IV1A 1BEV1 2VNRA 3ABKH 1OQ1A 2A6YA 2CH0A 2XVCA 3HZJA 2BDRA 4BQ3A 1SBFA 2JDKA 2BJSA 2E5NA 3CCVI 2EV5A 5JOYA 3ZFEC 1GSLA 1T0FC 2HNHA 5B4XA 1B8IA 3WF2A 4M0NA 3LZZA 3BR6A 2BGCA 3TKYA 1GQPA 4EJTA 2V4VA 3RZHA 2WNVB 4D5CA 5FLHA 2QQMA 3Q8CA 1JBCA 5DDJ3 1NA1B 1GXPA 4B3NA 1MBFA 1XGSA 2JDHA 1JJ6C 2IT0A 2BV6A 2Q8DA 1NQJA 5FCCA 1VQNI 4MLOA 5GALA 1X3UA 2WZPP 2LSOA 3NJZA 2QCSB 5CKTA 2DDBA 2K9MA 4CCLA 4C0BA 3TOBA 1PGL1 2YFUA 1REPC 2JA2A 4BQNA 4MQVA 5KBFA 3LSJA 5FP4A 2RGVA 4YFZA 4J01A 4NVPA 3JUUA 5FO9B 2WNUC 3FXJA 5C4WC 1BQPA 3WG7H 2HI3A 5DAWA 3F21A 1CD3G 3V8LA 1H8AC 4EZ4A 1VQ6I 4HQEA 1K61A 4KIGA 4LR4A 1WA6X 3L2VA 3BPZA 3RKXA 2DFFA 3AYDA 1PX4A 1L0OC 1GWMA 4IQPA 1V6KA 2W00A 4FX0A 4CEYB 2BHYA 3K4JA 4OHYA 3X2QH 4L11A 3WD5A 2OQ6A 1E2XA 2NMNA 1WA4A 3O1PA 4E4SA 3WW3A 1Z7UA 4N53B 2JJ7A 1FX5A 4PJJA 2A3XA 1RUC1 1IS6A 1VRBA 3POFA 1ASJ1 2EXJA 1IXCA 3E97A 4FE4A 1MJ9A 3FISA 1QXPA 3CMGA 2KFDA 3AM2A 1JZ5A 4I99C 1IXSB 4QPIC 2VBXA 3RQ4A 5ED4A 3GVAA 2YPDA 2W84A 1KGYA 2AENA 1US3A 3Q8AA 1P7IA 2VQLA 3GF2A 3WG2A 2WTEA 2CYYA 2O8OA 1SEUA 2CWEA 3LSIA 1LNWA 5BNPA 3WU0A 2ZSIB 1TME1 1LRHA 1EP0A 2RMU3 1W6PB 5J8CA 1RVF3 5ICGA 2ENRA 4EN7B 5F27A 5GZDA 5K7HA 1DYKA 2AXLA 4IGQA 1AKHA 1HDPA 2W1UA 1QHGA 3M1CA 5FFXA 1HQWA 2YXSA 2DMPA 2I74A 3MZ8A 3ALQA 1MDMB 4DGWB 4RA2A 1AZDA 1LJ9A 5C33A 3IH3A 4M74A 2QSFX 2AC1A 1UYXA 3WDYA 3OR1C 4V2WA 5F2SA 3WQ0A 3AMHA 2VZ1A 1TEIA 3SXYA 4PLMA 3DU5A 2ZGQA 4C0HA 3WOGA 1MMNA 3SEQA 5DUKA 3C3WA 5L7OA 3VKOA 4AYBN 1ETYA 2B8MA 3G71I 1J2XA 1HRV3 1AR92 4AQ2A 5C5TA 2W52A 4A3FJ 3W3CA 4ZXEA 3MIGA 2K9LA 4HKLA 1YW8A 2RVAA 1Z67A 4PSWA 1NCRB 5LLQA 4YG6A 4E70A 4JHTA 2XJQA 3LDBA 1WRJA 2R30A 1BR1A 4YIFA 1EUUA 2ILMA 3I3BA 1TT5B 2DCEA 1LOCA 1R4NB 1J59A 4P02B 1CJDA 4WV8A 1HKQA 1LHUA 4XXAA 2JG8C 3LMMA 3QPTA 2B5HA 1UWWA 4Q4W2 3IP4B 3V42A 3OWTA 3U11A 3FHAA 3VBHC 1YCIA 1RUG2 2UYAA 1U5XA 3N9NA 4BQAA 2W1WA 3CMYA 2DA4A 2B0LA 1TL8A 5JXIA 2PAMA 5C3PA 3H7JA 3B69A 5CNAA 5TRDA 3N3HA 5BYNA 1POGA 2JUCA 5M0TA 5F6FA 3PVEA 3HL2A 2SBAA 1SFYA 4A7KA 2A7AA 2E60A 3O0WA 1XSVA 4Y26A 2G9ZA 3W6JB 2ZMEC 1CQTA 1G8WA 4LXLA 2Y0SA 3VBUA 2MA3A 4DQAA 1S0GA 4XF9A 4B7KA 2XH6A 2D45A 2YUSA 5BNOC 2YS9A 4BA6A 2OX0A 1W3VA 1CR7A 2KZGA 4IEOA 4AR2A 1YFUA 2ZGSA 4P9XA 3M3CA 3TEYA 4LE3A 1MQTB 4XKBA 1YO8A 4MX3A 2Y38A 1MD0A 2VKEA 3RSNA 4BIFA 3NRUA 3MDPA 2YGMA 3JXSA 1QJU2 1ULGA 2JECA 2VOOA 2A73B 2W9XA 3PVOA 2DWRA 5IJRA 1PGL2 5GAEJ 2P3IA 3V64A 5A7WA 3PUBA 3ZQIA 3BOQA 2AHQA 4Y17A 1FSEA 3HN1A 4OLLA 3WU2C 1LHOA 3A7QA 4IETA 3DU6A 4G94A 4JHZA 1MEC1 4N43A 3F8FA 2ME0A 4QLCU 2BBAA 1K42A 2ZJRF 3SCHA 2C4XA 2V1XA 2WBKA 3QH6A 1JKQC 2EIDA 3BCBA 4L2NA 1FMD3 1BK0A 1Y3TA 2EFNA 5A2QZ 4LJZF 4DB5A 2D43A 4YVWA 3M3YJ 3CC7I 2M0CA 4XKWA 2VMCA 2DCZA 1EAH2 1E5IA 2KZVA 4LUKA 3OYFA 3QYEA 1JYTA 2R93J 4LEJA 4HLTA 1GU3A 4FPOB 5K4LA 3OY9A 2IS1A 1V54H 1KQ0A 1QWRA 1NZIA 2VMEA 2VR4A 1RKWA 1NXMA 3HRMA 4ENNA 1UW8A 1CAXA 1CN1A 5GTHC 2FXAA 4O3MA 3PUQA 3HHGA 4Q47A 5FYIA 3VHNA 3IT8A 4M0HA 2PYTA 3WTYC 1SAUA 3DYOA 2A6WA 1W6OA 2FDKA 1HXS2 3RMXA 4D7YA 2A1XA 4AGGA 3TO9A 5EWSA 4BEHB 3WY6A 4A6OA 1UCRA 1OVPA 4BXSV 4XF3A 1DYOA 1WCDJ 2VMDA 5EYXA 2HWVA 3NAPC 5CZKA 4X8NA 5APAA 5C4JJ 4Q5SF 3VBSA 2CHHA 2BEOA 2GWRA 1LPQA 2B4KA 1MSEC 4WK8F 4FFFA 3H7YA 3CJIB 2EIEA 2XWBB 3SZGA 3H0OA 4RS5A 5JPNB 3TQNA 5FQ0B 2EH3A 3S0MA 4GDFA 4IEXA 1HXDA 2NNNA 3D6EA 1FOKA 2EVXA 3LNQA 2HWB3 5J3LA 1GHCA 3MF6A 3J7YJ 3R61A 1OPMA 1ZK8A 3UETA 3ZIWA 1ZGWA 3K2ZA 5CBLA 4QKDA 1DGWY 2XPUA 2OIIA 1C8M1 4FPYA 5D8AB 2VTXJ 1PK6C 3KLNA 4BPZA 4NIGA 1YIPA 2XJVA 1ENXA 2P8TA 4LTAA 3ZN6B 1OYYA 1LEBA 5FZEA 4G7ZF 1HJFA 3VKLA 5GJ6A 2PJRA 4I0BA 2WO3A 3WF0A 1W6QA 3J81Z 3CJTB 4NRMA 1X1PA 4JAAA 4NR1A 1GUUA 4QX1A 2XSJC 4M9XA 4QPIB 4E8CA 3HNMA 5LBCA 2VU9A 3H8OA 3QU3A 3VBUB 5FOJB 2ZHMA 3K2AA 3O8GA 1SFEA 3D5OA 4B4CA 2CAVA 2H0BA 4KISA 1RR8C 3BU7A 2A6VA 2WYFA 3MUZ1 3Q0WA 3I64A 3FFQA 1BN5A 3HPHA 3GBFA 4MGYE 3OYIA 3FXLA 4E4ZA 3GM8A 4A3KJ 2FHRA 2ZMLA 2WWYA 1VBE1 4MTDA 4ZXKA 4UV9A 5EXOA 2D3SA 2DDUA 3U10A 2LYCA 3DTEA 1LJ7A 4FOVA 3MKYB 2DBIA 4XABA 4K2EA 2W91A 5FYSA 3T1BA 3WTUC 1VNDA 3CCEI 1DQ4A 2ZHKA 1FPQA 3ZOIA 1MQTC 4HK8A 3ELNA 4P55A 5JLXA 4H2AA 3I71A 2M4KA 3DUIA 4L5JA 3RTRA 5FXXA 4XBLA 1KD7A 1OISA 5J40A 5D8KB 1SAXA 1AX0A 3JTHA 5FZ3A 4BHCA 1WI3A 5JIUA 3VBFC 4YW3A 5FPXA 4KJZA 3VDDC 5EZGA 3FZVA 3R6SA 5BNQA 1X33A 2HWE2 2QKMB 2QENA 1DPRA 4KUMA 1IUYA 2OT7A 2AS5F 4Q27A 4UFJA 4XEZA 2WV1A 1QJY3 5E20A 3MFCA 2H8WA 5LK5A 1YQ6A 2G1MA 1LULA 3VZLA 4MSVA 2VC9A 2VW0A 5LY1A 3ETQA 3PIOF 5CKMA 2ZGLA 4ORFA 1PO11 2PAEA 3K48A 3GLXA 5CADA 2J1SA 2PELA 1DQUA 4Z1VA 2QBXA 2JDAA 3O8HA 2L4AA 5IT9K 4OMDA 2IW5A 4X1EA 2NOJB 5IYBJ 4UNOA 5FKBA 4KNCA 4I7HA 1YJNI 2OZUA 3OJBA 2QQAA 4GO1A 3ZR8X 1LOGA 2FF4A 4C8DA 2LRDA 1JI8A 1W7PB 4FXKB 5IYYA 1JS9A 1PVC3 2VQUA 3BR1A 2Y0SN 1KU2A 3BTIA 5K1YA 2Y60A 4GMP0 1VBB1 1BBYA 2FQPA 3ENRA 2PHFA 4ZH4F 1D1BA 3Q8EA 1WH5A 2KR2A 3CBNA 4FETA 1Z1DA 4COYA 2ZNYA 3U75A 2JIGA 2Y6FA 4FHTA 5LGUA 2L02A 4KYWA 3WHUA 1AR62 2UXXA 1GFF2 5CFCA 1IN7A 4JGZA 1XGOA 4L18B 2F5EA 1POQA 1O6UA 3ZXAC 1R4MB 3S14J 3KHBA 1G4DA 3DV8A 4H7LA 4JDMA 4KMUX 3U1DA 2Z5UA 1CIWA 1JODA 1HB1A 5HLTA 4NUBA 2WKKA 3VL9A 3K4LA 4JQTA 1QJX3 4GKXA 2HZTA 1GOGA 2QQKA 2VQHA 4B09A 3ZYPA 4XF4A 3LDKA 4D6SA 3V0AB 3OSDA 1HRV2 5HCHA 2GXGA 3RMYA 1RUC2 4IEPA 2WA4A 3RZJA 1Y7BA 3EPZA 2PN6A 2WAFA 2K85A 3RIRA 3PM1A 4P00B 1ZRCA 2Y26A 3DPUA 1AL23 1VQ9I 3IRQA 5DTDA 3W5NA 5CEHA 1MQTA 5KAFC 3DTKA 2QF7A 4XFBA 1E3PA 4LG3A 5FO8B 4CCKA 1WMDA 2R7VA 1T98A 1ND3C 1RVF1 1XU2A 1V55H 4ASLA 2F4OB 1SVLA 2EB7A 4FQZA 4UXAA 5F39A 4ZONA 1MMDA 4IGPA 2M7AA 1S7AA 1WJAA 2NNYA 1QVUA 1JHHA 1RTVA 3VBHB 3KHCA 1AX2A 1XD7A 4YVWC 4Y20B 2E35A 2OXBA 2HXIA 4QPWA 2M5WA 2ZC2A 4Y1ZA 2A6TA 5FR3A 3KVAA 5EJ1B 2IPQX 5JVGF 1XPWA 3ZXDA 1U6GA 4CDXA 3BCAA 4BY7J 1I27A 1QA6A 1ZELA 4INDA 2CWMA 2D3PA 1Z3YA 3L7WA 4B44A 2ZB9A 1UOJA 2KP6A 3J8F2 3AJYA 2GC1A 2FBEA 4NIAA 4DUXA 2DFBA 2XPWA 4KA4A 1DHKB 4K1YA 1ZGAA 2ME6A 3LA3A 2P4WA 2ADDA 2EQRA 2P3YA 1TWHJ 2R072 5BPXA 4AI2A 3JD71 1QNYA 1WGPA 3KQ4B 2DQRA 1XYNA 1XMAA 3CCQI 5FQ0A 1DGRA 1YIJI 2WINB 5DZEA 1FT9A 3I3EA 5EG0A 4KMFA 3BYWA 4XLFA 2PHLA 4X6QB 1YHFA 2ZXHA 4AZZA 1SMVA 1W0TA 2OCEA 5A6QA 2BGOA 1NY71 4OOIA 4CCJA 1OC1A 1OOPC 1UU5A 1WW5A 5K0UA 1BEV2 1IUFA 1QOSA 2AREA 3OYLA 2EIMH 5FKMA 2X0LA 3WNXA 2LP0A 1DFQA 1HN1A 2JG9C 2WSUA 3H3UA 5IVBA 1OLRA 2P5KA 1BA5A 4CA0A 3C7OA 5HS7A 2ZFUA 4YGBA 5LA9A 3ZPLA 3QP5A 2ZKZA 1MH4A 4P1WA 1OVSA 2JVGA 1F4AA 2JN6A 4YM1A 1S4CA 2LMDA 4CDWB 4BB3A 4Q4X2 4BJTA 1QGLA 4F3QA 4QPGB 3WQ7A 4S04A 2A5ZA 5E1WA 1OT5A 5FYVA 2ZXQA 4F52A 1O3QA 3ZMZA 2K02A 3HKZA 2DVFA 5JXHA 1I6HJ 5FMCA 5FV3A 1IPSA 4XAEA 3HM5A 1HXS3 4L97A 4BK5A 4LHLA 2HDCA 4JQFA 2VZUA 4BHPA 2W85A 3RKWA 2XGEA 1DLCA 4JKMA 1VALA 2RQPA 1W0NA 3ZSMA 2XJTA 2VKHA 1C5IA 1POV1 2GC2A 1IS4A 2O6GE 1W9YA 4J1XA 2FCTA 5IK5A 4GYIA 1O5UA 5GKAC 1UMIA 1N25A 1CPNA 3I4NJ 2R7XA 2R7DA 1RUE1 1UOBA 4G6DA 2LY1A 2BUKA 1Q8SA 1KYWA 5DM7F 1VBC3 4L0ZB 4TTGA 5GTIC 2WAOA 2HOAA 4Y4RA 2R7WA 2VKVA 4XQDA 3PL8A 3ORJA 4ZS2A 2DODA 1OKQA 3K3OA 1AYM2 1S55A 4YVSC 3WGGA 1U5IA 5IUQA 3CJNA 5FMDA 1CAWB 4RHV2 1VR3A 3IAPA 2JDMA 2CG4A 3MLJA 1REDA 1MMGA 2RDQA 2MYSA 1FMVA 5F1JA 1BZWA 2XBO1 2QTWB 4M3CE 5CYYA 4ITVA 2A05A 3S15J 3PUFA 4YNIA 4HX4A 3ZQLA 2GNBA 3ZCOA 4MFEA 3OGGA 3JCUC 4CEWA 1SLCA 4XXPA 3PMSA 1TE1B 1DLLA 2Q8CA 4IE6A 2X5IB 1XYOA 1TVGA 4OCTA 4FT8A 2QQLA 4HN1A 1UZCA 1RUG1 4I0WB 4COZA 3DEUA 4XIDA 5DCFA 3D0JA 2V09A 1VBA2 1OF4A 1WQ2A 3CF2A 4YZ1A 4AHWA 1IZ3A 2F4PA 3WZ1A 1VQ8I 1ND3B 1GKBA 2C1FA 3W6VA 1T2KA 4EM1A 4QPIA 3PURA 2R7ZJ 2KIUA 4GCVA 3OEBA 1NUKA 2DVGA 1ULYA 2CSGA 1JOJA 1MS4A 1YIFA 1PVC2 1NX9A 1PO23 5GZEA 4EWDA 5ANQA 2FUG2 4FPEA 3CO6C 5J1UA 4LFUA 2BQPA 3FC0A 3Q9SA 3VB2A 4OHZA 1AR91 1NG6A 4OUSA 1HSTA 4BE0A 1IO2A 1UG2A 1WJDA 1QJY2 3O1UA 4M3CB 1ULEA 1ZLJA 1XC5A 3MI8A 1BI1A 3A21A 4RHV3 2WQ8A 2RJKA 4ZYDA 2V9PA 3KMHA 1U5TC 1HW5A 2AZ5A 3GYHX 1RMU1 3M3EA 4MYEA 1RI7A 3FBMA 1ZBE2 4EM2A 4BQ5A 4QXKA 4M3BA 3HPNA 4I6ZA 1W0OA 1F35A 4YELA 2JA8J 1AL0G 4RS8A 4PLNA 3DPRB 3HOWJ 1SVMA 2YHJA 5DS9A 3CO2A 5BV6A 3ES4A 3DCFA 2B7EA 2OQRA 2DK5A 1LE8A 4G9SB 3A22A 5BNGA 2IUWA 3QACA 1WGXA 4XOPA 5FLMJ 4LBOA 2M8EA 5EGOA 1USSA 4BAYA 1CQ9A 3PVBB 2PJPA 5I0DA 5FFZA 4FFGA 1TME2 3B02A 2ZBJA 4XTPA 5FP7A 3QRFF 3EUAA 2EWNA 1F5FA 1RXGA 1X9PA 1YX5A 3LE0A 3L2UA 4H0EA 4LO5B 3LL7A 3H3LA 3RWNA 1WFXA 2BVBA 4XJZA 1EPWA 3S2WA 4BDZA 4H14A 2NP0A 1EH6A 2DBBA 2BVMA 3MUY1 3O3KA 1Z91A 2Y34A 1W9FA 5KHHA 5FBZA 1J1TA 1JGGA 5CG8A 4XCBA 5A70A 3GBWA 3NL1A 1UJ8A 1LKXA 4YIRX 2HOTA 3DF0A 4WWCA 1UHSA 3LAJA 2R5ZB 1WHUA 1K4SA 3B93A 1EA3A 2STTA 1ON2A 3AKPA 5CB7A 4UFKA 1COV2 2QKDA 4DOZA 5LFAA 3WNMA 2WZEA 3V8JA 5A3LA 3MPBA 1XXNA 3JB8A 5T5JA 2YC4A 4GJYA 1BL0A 5JHFA 5FP3A 3N7LA 5A2QK 1TWGJ 1WLCA 4Q4ZF 2HOSA 3MFAA 2IS4A 2QFEA 4A0XA 3DECA 4RR3B 4BUPA 1MBGA 4XMYA 3H9AA 1O8PA 3MIFA 1RZ4A 1B59A 1BIAA 3PUAA 4JDNA 1SFPA 3GGLA 2HEWF 2ZZQA 4FI9A 4BJ0A 4ASKA 2JJ6A 4BQWA 1KITA 1C57A 2XJSA 1VQ5I 3A4UA 3CDHA 4R9AA 5E6HA 1Q1VA 4AVTA 2IBDA 1TT0A 3JREA 1LOFA 2RDSA 2KRCA 2H0VA 3KYDB 1VAMA 3J26N 3M8JA 3T8TA 3J81K 3ZN4A 1O5LA 5J37A 4RFRB 3POEA 3MPPG 2D1VA 4PUSA 3TEXA 1B1BA 3JRGA 2QNKA 3JZVA 5EG0B 1SPPA 3LIHA 1RUF2 2XG3A 1IN5A 4LITA 2CQQA 3GTPJ 5DMYA 1IN4A 1L3LA 3R0RA 4EJWA 2IC1A 4A3GJ 3W5MA 3VWBA 5D6EA 4EJOA 1R49A 1S0JA 3OYKA 1DYPA 2DLLA 4MVTA 1QU3A 4R9CA 4MV2A 2IVJA 2XBO2 3CMMA 3SZTA 3V4GA 1VBD1 1R5GA 5JSOA 4AUXA 4YM3A 4MGSA 4YEJA 4BMBA 2PI0A 1HKDA 4JX6A 5DCMB 5CVUA 3LSKA 2Y48A 4YGEA 3P9CA 2JEMA 5FZ6A 2ERFA 2ATFA 2A61A 2FBHA 4D7TA 2GSYA 3LOIA 1X3ZB 1JHFA 5F5AA 2R6QA 5FXZA 3LSPA 2VJ4A 2AR6A 1PO13 3GZEA 3H9JA 3I2GA 4IX7A 1Z21A 4XM3A 2D2WA 1Z7S2 1T56A 2M0MA 4BZ4A 1SLIA 3WNKA 1HJGA 4Q4V1 5C9AB 1H6YA 2IWGB 2MLGA 2VOTA 3MF9A 2DBNA 3WX5A 2FDJA 1JZ8A 2FE3A 2R3SA 1RUJ2 4MHUA 1AR83 4XRMA 2ECCA 2XR4A 4H4KC 2X09A 5JLWA 1TQ5A 2MABA 3ZFGB 3FBYA 4IEQA 4LG0B 2P2KA 4IE5A 3JBG2 2KMUA 3CC4I 1E5HA 3J8F3 3HOYJ 1YI2I 1G9AA 1JKRC 1QJU3 3ZXKA 2WNEA 1MBEA 1WKMA 1YIOA 4L9VA 1EV12 4IDZA 3JBG3 1UY1A 2RM21 5ICEA 1E0EA 4O9EA 3RGBA 4Y3OA 4XQWA 3SQOA 3KFWX 3PUIA 3PJRA 3ATGA 2DFHA 4Z82A 4BE3A 4WVVA 1Q56A 1M1EB 2A07F 3NJVA 3IWZA 3OUIA 4DOUA 3SEEA 1IW7F 1VBA3 3KQRA 1N75A 1POV3 4AHXA 1QRYA 1QOTA 2LKPA 4RGSA 4Y5SA 3ZYFA 2BWAA 4AL9A 4AWDA 2CUZA