2BGCA

Prfa-g145s, a constitutive active mutant of the transcriptional regulator in l.monocytogenes
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
235
structure length
234
Chain Sequence
AQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICSQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLAPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mutation G145S in Prfa, a Key Virulence Regulator of Listeria Monocytogenes, Increases DNA-Binding Affinity by Stabilizing the Hth Motif
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transcription
molecule keywords PRFA
total genus 77
structure length 234
sequence length 235
chains with identical sequence B, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2004-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2bgcA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bgcA01
3TOAA 2Q30A 1YIOA 4GXOA 4XSZF 3TO9A 3G73A 4A12A 3V8LA 1T6SA 1WLTA 2UYAA 1H0MA 3V4GA 4M9XA 1SFXA 3M9AA 3PFIA 3EBRA 1F9NA 5ICGA 1WA4A 1UHWA 4ZYDA 5KVRA 3GUDA 2KRFA 2VBWA 4GGGA 3SHFA 1ZLJA 3CEWA 2MLKA 5BOXA 1WQ2A 5ILSA 2F4PA 2MNGA 2D40A 2Z69A 2J5OA 3ZMSA 2DCTA 3PQJA 4J1WA 2EFNA 3JW4A 1YW7A 4LB5A 5H6RA 2BBYA 3BY6A 1BI0A 3L09A 1L0OC 3FXQA 4RS8A 3JSOA 4HF0A 1IW7F 1D8KA 2PHLA 5JFRA 1CAWA 1OYIA 3RKWA 2A69F 4NB5A 2XKOA 4DINB 2XASA 3KFWX 3LFKA 4EJWA 4U0WA 1T0FA 4K8FA 2ADUA 2ZXJA 5C6CA 3WTSC 2RNJA 3NL1A 3QP6A 3GEZA 3KP4A 4IVNA 3O3KA 3QU6A 5LEJA 2W84A 3W6JB 2CQKA 1MJ9A 3AAFA 2A6HF 5DUKA 3D82A 3ABUA 1I5ZA 3CL1A 4IF4A 3LAGA 2ETEA 4OIPF 2XIGA 3WTTC 2MBFA 3M8FA 2BE5F 2EFPA 2C0ZA 3JAMZ 2FU4A 1UCXA 2TDXA 1FYMA 1YFYA 4FT8A 1J3RA 4ENMA 2KKOA 1PMIA 2F5EA 1OYWA 4ZZLA 1H1IA 3GLXA 5E18F 2CFXA 3DN7A 1V3FA 2FXAA 2D2WA 3F6VA 2RC4A 5LRRA 2Q0AA 4KNYA 3BJAA 3IIAA 3FZVA 1XE8A 3L9FA 4MTEA 1ZH5A 4QLCU 1D3YA 4Y13A 1OMIA 1O57A 5TRDA 1I1GA 5KHJA 2P4WA 5KHGA 2Q2EA 1NZCA 2MA3A 4BHPA 4UVAA 1O3TA 2UY9A 2ACJA 1KU2A 1U5TB 1G3WA 1V70A 3UKNA 1Z05A 3ECOA 3C3WA 2HS5A 2XLAA 4G7OF 4I0AA 3RJPA 1KA8A 1LDDA 2XV4S 2FF4A 1K78A 4LJZF 2BEOA 4XF4A 2V79A 3U10A 3ZMDA 5CU1A 2EV0A 1GXPA 1HW2A 2Q1ZB 3WW4A 3WW3A 5EFUA 3GW2A 1W7PD 4MHGA 2IXLA 5LBQA 4XF0A 3KEQA 3L2HA 4U0VA 5DYMA 1K79A 5IT9Z 1X82A 3M3IA 4HVQA 1B6AA 4XEZA 4G6DA 2BNMA 3RPQA 3N97A 1ZREA 5KHHA 2QZ8A 2PHDA 2V9VA 3U2RA 3QPTA 3JTHA 1E17A 2EFQA 1YW8A 4N9HA 2JT1A 2YR2A 3FF5A 3FWEA 4O6JA 2GC0A 2KXLA 1SD7A 2H6CA 1FP1D 4UXNA 1X3UA 3CO7C 4BH9A 4IETA 3L00A 3BJ6A 1VP6A 5DD4A 4OMZA 1R1UA 2IRFG 1S29A 4OMYA 3K2ZA 4YRDA 2PEXA 2LF7A 4KT5C 1ZARA 3DKWA 2QBYB 3CDHA 5LGUA 4NQWA 3HSRA 4IESA 4P5OA 4HSLA 3P9IA 4FHTA 4I3PA 5FDBA 5D5WB 4IEQA 1MZBA 1Z6TA 1DZRA 2XRNA 4ZU4A 4XFAA 4ESBA 1J5YA 1RIOH 2K4BA 1PUEE 2PMHA 2LF8A 1XGOA 2DAOA 1ZRCA 3I5UA 2ZBKA 3CUQC 1V4RA 4IEXA 2QLZA 2YSRA 2HFHA 4EGZA 2P17A 4YNIA 2VBYA 3F22A 1HXDA 1SMYF 2ZMEB 1SFUA 2ESNA 4WXHA 3N4MA 1J9IA 3FE5A 3U1DA 1XMKA 3BZ6A 4PCQA 4UNOA 3PNAA 2M30A 5E8IA 1WWXA 1LVAA 3U0ZA 1UPIA 3CUQA 3RPUA 5I8SA 3BPZA 4FAHA 3EQLF 4L5JA 1X7NA 2EK5A 3FX3A 4RAYA 2LDUA 1OKRA 1K6OA 1AOYA 4LA3A 3GZ6A 4HLXA 2HTJA 4YSFA 1IXCA 3BPVA 3T8TA 2X4HA 1J1LA 2EA2A 5CYVA 1FWZA 1TTYA 3ST7A 2VT3A 4WZCA 4G9YA 4Q47A 3EHKA 4MUVA 2RVCA 2PA7A 3R60A 4I7HA 2UY8A 2CW0F 2IA1A 4JK1X 5D5UB 4A0YA 1UHMA 1TNSA 1ZZ6A 4IEPA 2HGCA 4MV2A 4HDVA 2IXCA 4Q5SF 4IEYA 5JHUA 2VODA 2P7CB 5KK1A 1VJ2A 1P4WA 1OYYA 2OD5A 3BOQA 3MYXA 3BPXA 5D8KB 1ZG5A 2GC3A 3NJZA 2P6SA 2ZMEA 3ZMZA 4WBBA 1O3SA 1J3QA 4QGLA 4EV0A 1AWCA 4KIFA 4BHCA 2D1HA 2FMLA 4OU0A 3UKTA 3FJSA 4N0BA 4L9NA 1MGTA 1F4KA 4EM2A 2ZKLA 4HW0A 2PN6A 1X8MA 1QWRA 2QYOA 4B8XA 5FCCA 1RC6A 1HBXG 1QQIA 4RGRA 2XAJA 4BNCA 2E7WA 3V7RA 1TW2A 1FBSA 3BWGA 2IJLA 3ERED 1H9GA 5FD5A 3RYPA 1VTNC 3BALA 3IHUA 5JR3A 2WV0A 2QJVA 1G3YA 3LA2A 3BB6A 2GZWA 3MAJA 3QAHA 5FGMA 2I45A 4RB3C 2QVOA 3ZQ7A 3HTSB 1ZRRA 5D1IA 4CYDA 4RB2C 2D5FA 1WSUA 2YU3A 4MGRA 4FX0A 3L2CA 5CADA 4HF2A 1UFMA 4OIOF 2CSOA 1XRUA 3HRUA 2A68F 2GXGA 3VODA 5F64A 5AONA 3ZN0A 1GXQA 3WE3A 3OTFA 2DPDA 4WK8F 2O61A 3WTXC 3MPBA 1QXRA 4HQMA 1CAUA 1T39A 4LGWA 4IHSA 3DEUA 2V1UA 2O8XA 2ELHA 4Q4ZF 4Q48A 3JZVA 2XLGA 1NHAA 4YFXF 4WCGA 4Q0SA 2QVSB 2WTEA 4LLOA 2DBBA 3B73A 5LHHA 1LB2A 4LLGF 5LHIA 3ZMUA 2Q0OA 4META 5A2QK 3KSCA 4A5MA 3ZPLA 5ILVA 5CVJA 4DNCA 1E2XA 4L11A 2QNKA 5FO5A 1ZYRF 3J81Z 2N7GA 3CLPA 4XF3A 4BYYA 2IC1A 5BV6A 1O3RA 4CGZA 3KP3A 4HN1A 1B4AA 2ZJ2A 1EV7A 4XETA 1JGSA 3SHRA 5BY5A 3H3UA 3WE2A 2CO5A 3T1BA 4KU7A 1RTVA 4BHBA 5C8WA 4QX5A 2PJPA 2DO7A 4LLLA 2GQQA 3E97A 4M6YA 4CZZA 5K8SA 5J8CA 4KDPA 2BYVE 5HS9A 2MH2A 2VQAA 4IRGA 3ROUA 3WU1B 3F8BA 3SCHA 3R61A 2JPBA 4L2NA 2IW5A 1IF1A 2DTRA 5KBFA 4G94A 5K5OA 2B5HA 1IAWA 1PDNC 3M1EA 4L9VA 4BAYA 3BU7A 1Z1DA 3NQOA 2DT5A 3KLOA 2MC3A 3ZN1A 3LOIA 2DQLA 4JV4A 4EM1A 4GCVA 4O9EA 2F5FA 1XB4A 2GH2A 2XGXA 3WTZA 4ENNA 4KYWA 2XLFA 2L4MA 1FBQA 2ZKZA 1W5SA 3CUQB 3OD0A 4LA2A 4EMSA 3IC7A 2O6GE 4HZFA 3COAC 3RYKA 3WG9A 3ELNA 4O5VA 2Z2SB 2G7UA 4XRFA 2L01A 2EB7A 3GZ5A 2BNOA 1ZGAA 5FD6A 4KU8A 1Q3EA 3F6OA 1USSA 1ODDA 3TNPB 1U8RA 2WFPA 3H50A 1U3EM 1G6NA 1I27A 1ZGJA 4MEYF 2A61A 3GFIA 4GYGA 1HSJA 3HHGA 4U7BA 2D93A 1J59A 4F8AA 2EV5A 3HUGA 2K27A 4EJUA 2G7HA 3RIRA 3M70A 4ZYHA 5BXXA 1TBXA 5AIPA 4P9FA 3BJOA 4A6DA 2P5VA 5I0UA 5L3GA 3LA3A 4QM9A 2R7FA 4XFGA 4ON0A 2HZTA 6PAXA 4QWQA 1CF7A 4LK1F 4AIHA 3DL3A 3ES4A 3PLQA 4HVOA 4R8HA 4LK0F 4N9IA 3QPHA 2FMYA 2VN2A 1P2FA 3EO6A 4HAMA 1YYVA 4YFKF 5BMZA 2VXZA 4IRHA 1J75A 3H92A 3I54A 1ZZ9A 3EJKA 5JCTA 1HKTA 4D0PA 2V6CA 2O0YA 1EH7A 3IWFA 4MQVA 3REOA 1MJAA 1ZG1A 5FFXA 4UBHA 4PGHA 4CICA 1BC8C 1YFXA 2UXNA 1UW8A 2FQPA 1B1BA 2H0VA 4KWJA 2XL7A 4O9GA 2XL9A 4AWXB 4KMFA 4RGXA 1FBUA 4MNUA 3EUHA 3FMQA 5HDKA 5JVTA 2EA4A 1UIKA 3KP5A 3IBMA 2P8TA 4R1HA 2OZJA 2Z9OA 1BI2A 2QDRA 2V09A 4X6RB 3ECHA 3QP5A 1ZZ8A 5I0RA 1O3QA 4PIYA 5D8LB 2HOEA 1MDMB 2F5DA 4UVCA 4KICA 4ESFA 4ENKA 2CAUA 2B0LA 3ZP5A 1QO0D 1YFWA 3MDPA 2CV6A 3SCFA 1WGPA 3O2PE 4HX8A 3EETA 1HKQA 3HRMA 5D5VB 1QZYA 5E1XA 5ERIA 3CLOA 3K1PA 1ZRDA 5CVVA 2ATFA 4E2QA 1XDSA 4BXUA 3TDUC 3SFZA 5FLIA 1STZA 1L3LA 3T8RA 3OCPA 1SD6A 2W85A 1F1ZA 3TO6A 2E7XA 1S7AA 5HOOA 2ETHA 5BPIA 2IP2A 2B9UA 2O8QA 1GHCA 4X6QB 2IA0A 4HOBA 4HF1A 4A0ZA 1B9MA 1CF7B 3D0SA 1D8JA 2PMUA 1XGMA 2QUFA 2HYGD 3C3VA 2EA7A 1JE8A 1Z6RA 5DCFA 3LQRA 3LWFA 1IPJA 1ZZBA 5HLGA 5L3BA 1YFHA 3G7DA 1U2WA 5D6EA 1HW1A 2W25A 2HQRA 1JHHA 1W7PA 2HYFA 4M9SA 1UCRA 2F5CA 3FXUA 5I8TA 1UB9A 1XSXA 5J7MA 3H9AA 1R00A 4HLYA 2LSOA 2ZCWA 5ICEA 3JSPA 4XF1A 2VC1A 4XBFA 1R1VA 2E9QA 4LUKA 5D5XB 1WKMA 4KWKA 1KQ8A 2VC0A 2O1QA 3FM5A 1YS6A 1KU3A 4L18B 2COMA 1I1SA 3DFGA 2VT2A 4P96A 1ZLKA 4O3MA 4Q0PA 4HX4A 4LUMA 2L4AA 3R6SA 4ZYEA 3KP2A 2GA2A 1FYKA 3TNQA 2BNNA 3K69A 3VEPA 4FX4A 2D5HA 4AXOA 3GXOA 2K9ZA 1BI3A 3K1MA 3C18A 4HBNA 1YWKA 3DQVC 3WTWC 1SMTA 2ZFWA 1U5TC 3HOSA 4EJOA 5HLHA 5HVQC 1C0WA 1T98A 4Q0VA 2KIUA 1VR3A 1PP7U 3J81K 4MGYE 1NE6A 4QXKA 4MTDA 3BROA 1DUXC 2XVCA 1QGPA 2QQ9A 1ULYA 1FX7A 3TDZC 1H1MA 3VHRA 1I6XA 1NE4A 3I4PA 3K9TA 1S7OA 4HN0A 4HQEA 3I64A 5LGTA 3GYHX 2Q8KA 2OPKA 3NRVA 5JSRA 4CXFA 4YFNF 4AVAA 1JXSA 4HYEA 3IKTA 2WWYA 4LLNA 2R3SA 5KHKA 2OZ6A 4XFCA 4AVPA 3OOPA 2E1NA 3EDPA 4E2SA 2H09A 1LEBA 3KGLA 1ZG3A 3E5QA 3C7JA 1T2KA 4Q29A 2HTSA 3IDBB 4G8XA 2ZNYA 2H6BA 4IEZA 1CAXB 3S7IA 3FZ3A 3FMRA 1U12A 1UD1A 2NNNA 4KFCA 2QCSB 4I98B 3S7EA 4WXCA 5E17F 2QQAA 3TO7A 3LA7A 2JSCA 4XLNF 2VOPA 2MLGA 2W24A 3F72A 1LR5A 4R79A 5FQ0A 5E8GA 5ICCA 4MX3A 4HV5A 3KP6A 3H1WA 2DK5A 2DLLA 3TGNA 1P4AA 3MQ0A 1FY7A 4IERA 1SEFA 3F23A 5I0SA 3UKVA 1BIAA 4LG0B 3Q9VA 5FPZA 3W6KB 4XFHA 5TJJA 3H7JA 5LGNA 4PIXA 5I0TA 2PLYA 1KU7A 2BV6A 2IXIA 1LJ9A 1USTA 2PTMA 2GU9A 4RB0A 3IDCB 2MPFA 1CGPA 4ONUA 2WC2A 1OFNA 2PG4A 4HLTA 2NS0A 2OAZA 3HT1A 4HX7A 4AIKA 3CO2A 1ZX5A 5K5QA 2GC1A 4BIFA 1FNNA 1U6GA 5HS7A 1IN8A 2ZO4A 3J80K 5J6XA 4PIZA 1TNTA 3NW4A 4RB1A 3Q5FA 4I2OA 2YPRA 4GYIA 3WTUC 1Z91A 2XAHA 2FQ3A 5D4RA 1ZRFA 2HR3A 4I0BA 5D4SA 3ETQA 4WWCA 1ON1A 5F6FA 3QU3A 1FZPB 4M6XA 1DGWA 4LB6B 1FC3A 3LSTA 4CO8A 1KQ9A 2RDPA 1ZN2A 2JTVA 1CAVB 1QBJA 2EAAA 2MHFA 3DPTA 5L3FA 4M9ZA 4ZZDA 4HSJA 3P9CA 5EZWA 2DW4A 1ZZCA 3U9GA 1LEAA 2YX4A 4JTOA 4Q0QA 2XROA 4LULA 4A6EA 5JSOA 5EEHA 1W4MA 1BI1A 2IXJA 2CWEA 4EJTA 3CJXA 1P6RA 3FHIB 2D45A 4M72A 3I59B 3GVAA 3E5UA 4Z07A 4A0XA 3QACA 4ASNA 3LZZA 1O5UA 1A04A 2P5LC 4P55A 4GULA 1G3SA 4ZYGA 1Q43A 4AQ6A 3ULQB 3CTAA 1XCBA 4YIIA 1MDMA 3SZPA 4OIRF 3V7CA 4ZU7A 4YYOA 4R52A 5E20A 1QY4A 4HBLA 3LAJA 2IA2A 4XLPF 2HDCA 4M73A 5FB2A 5HDGA 2EFWA 2PYTA 4UV8A 2FA5A 4IEUA 4P9GA 1SFEA 2STWA 4LEJA 3Q9SA 3D0JA 3E6CC 4IRIA 1EY2A 5DD8A 3P9KA 5JAXA 1ZVFA 3F8NA 1BJAA 1YQAA 1CAWB 3DXJF 2B8MA 1DGRA 3JAMK 5K5RA 1XGSA 4OIQF 5BPDA 2EV6A 2LKPA 3RKYA 4DQ2A 3H7YA 3OGJA 3KMHA 4K2EA 1LRHA 1B59A 2HEOA 3VB2A 4D7SA 5HS8A 1PM7A 2PQ8A 5FLXK 3R4KA 5F1RA 3BP8A 2QBYA 2A5YB 1QXJA 5E1RA 1XN7A 1D5VA 3NSTA 3ZMTA 4ETSA 1R7JA 1GQGA 1LDJA 2UZKA 4QGMA 4E2GA 1YO5C 5HLIA 3R0JA 3RDIA 4I01A 2L3DA 4FBFA 3CUOA 1K78B 3WW1A 2EVXA 1MD0A 1Q1HA 5BS6A 1ZHFA 1DP7P 3DV8A 1SAXA 2FNAA 2EFOA 4AIJA 1RI7A 2NYXA 2STTA 2ISYA 3G3ZA 3I53A 2HKXA 2Z99A 3GF2A 2NAZA 3GO5A 3GWZA 3V7SA 5E1WA 1JHFA 1CAUB 4AQ2A 2H94A 5FLHA 3ELKA 4XFFA 3T5XA 5LLQA 2FEZA 1R5GA 2XAGA 4IXAA 2JZYA 1Y3TA 1OI6A 4YG2F 4EVIA 3I58A 1EYBA 3MWMA 4RD7A 4CHUA 3ACLA 1U78A 4EWAA 5J3UA 2K4JA 4JVAA 3ISPA 3B02A 3F8CA 3DF8A 5HI0A 4QM8A 1LQ1A 5IT9K 2FBHA 4JBAA 3M8EA 3PQKA 3DP7A 2OA2A 1GVJA 1UIJA 1TQPA 4OLLA 3GFMA 4D7TA 2XAQA 5L3DA 1RUOA 4UV9A 4KA4A 2A3SA 2HQNA 4ZU5A 1CAVA 4PZJA 3T0YA 1W7PB 3E6BA 3E5XA 4HA8A 1IN4A 4LMYA 3QRFF 2GIVA 2HKOA 4IHTA 2NRAC 3HQXA 1FI2A 3H8UA 1DDNA 2AXLA 3SQNA 5JI6A 5FPXA 1XSVA 1YLLA 5ICFA 1KYWA 1Y9QA 2PAMA 2YX7A 3MCZA 1SQ4A 1L3JA 4RGSA 2OA4A 1RGSA 3IRQA 2QENA 2XAFA 1EP0A 3LQQA 3IL2A 3RTRA 3WW2A 2FBIA 3TOBA 2GXBA 2GA1A 2P7VB 3F3XA 2OU2A 1DZTA 3F8MA 4Z2YA 4Y17A 3WTYC 4L0ZB 2FRHA 3RI4A 1IUYA 5DDGA 3IWZA 2K02A 4EGYA 2IVMA 2V1DA 5CVUA 3SMHA 4GO1A 4NHJA 2K0GA 1KYZA 2K86A 5FFZA 3PVBB 3VOEA 3E6DA 3IKVA 5DUIA 3MZYA 4L9JA 1OPCA 4XF9A 5KHIA 3H1YA 1YG2A 1BOAA 4U88A 4E70A 4Y15A 4IJAA 4L0YB 5I8YA 1IPKA 3FXRA 3KE2A 2PAKA 1U5TA 2Q4SA 5AVPA 3KCCA 4UUVA 4KN7X 3CO6C 3SCGA 2OQRA 1Z9CA 1LDKB 4MQ9F 1HSTA 4WX9A 1S6LA 1O7LA 1CAXA 3HYIA 2PFBA 2D1VA 1FT9A 3HRSA 1S8NA 1FXZA 1T38A 3GFLA 2AS5F 1KGSA 1H9TA 3KEOA 5ED4A 4P9UA 1IZ1A 1XCVA 1NXMA 2M87A 4FAGA 1Z7UA 1CX4A 2OYZA 2Y0OA 2HJIA 2VPVA 1WI9A 5FQ0B 2M5WA 3J80Z 3MZHA 1EH6A 2JPCA 3QOPA 2VE9A 1Q5OA 5DCMB 4G6QA 1R58A 3BDDA 3FMSA 2RGVA 3HHHA 4PJYA 3DPLC 4L5IA 4MGZE 5J48A 3O6BB 1XSDA 4AD9A 1YTYA 3LWCA 4J1XA 1RNLA 2CGPA 1GQHA 4MH0E 2CYYA 4LD5A 4UXAA 4UBGA 1O5LA 2DK8A 2P6TA 3RYRA 4LTAA 4AVCA 1BN5A 4IPAA 5FLJA 3EYIA 1IRGA 2MD5A 4EROA 2FE3A 2VONA 1YLFA 2PAEA 4HVRA 4H0EA 3V8KA 4WVZA 2DFIA 4EM0B 4ZH4F 1YW9A 2GAUA 3U11A 1FPQA 3M7GA 4LG0A 3NKTA 2KJCA 4I09A 4RGUA 4KIBA 3SXWA 4LFUA 5IT3A 2Z3YA 3IRRA 1R36A 2ESHA 4KIGA 2IXHA 2GWRA 1ONVA 4CDGA 2XUBA 4H7LA 3HSEA 3E6MA 5H6QA 1PP8F 3WU0A 1J58A 4A2UA 1MJBA 2RKHA 4OINF 3KETA 3WGHA 4IEVA 3GX4X 2C6YA 5EEGA 3ML6A 3SZTA 2XKPA 5I93A 5E1ZB 4XSXF 4M71A 1IN5A 1LNWA 2IPQX 2DPUA 5LRSA 4JTNA 2PFWA 3GYDA 3FM3A 4EJVA 3C1DA 1WRJA 3I0TA 1KQ0A 4EWDA 3NEUA 2JRTA 5D6FA 4PDKA 4HV6A 2L54A 3H1MA 4UVBA 3OF1A 4RAZA 3KGZA 4MEXF 1B9NA 1J0RA 2E1CA 3JTGA 3FHZA 2W57A 2OQGA 4KN4X 3MFKA 2A6EF 4MGIE 1RZ4A 1TLHB 4MZUA 4TV7A 5H20A 1ZNPA 2IXKA 3RNSA 4WF2A 5K1YA 1FOKA 2IT0A 1G3TA 2DQRA 2DU9A 4PGGA 4F7ZA 5T3NA 2R7DA 2LNBA 2Y48A 1QNTA 3EYYA 2NNYA 1EPZA 4HMZA 4HDUA 3F8FA 3OV8A 4IEOA 2MH9A 1XD7A 3K1NA 3SXYA 3I7DA 3KZYA 5CLSA 5FLXZ 4KUMA 4KWLA 1JUHA 1QZZA 1XMAA 2M45A 5JSPA 3EQEA 5CJ9A 2ZNZA 3S2WA 1TQIA 2FOKA 2M8EA 2QM3A 1IXSB 1MKMA 2O3FA 2PQQA 1YUDA 1BIBA 2J5PA 3HTUA 2FBKA 5AIQA 3MEXA 2FSWA 2EWNA 1ZZ7A 1DPUA 2GC2A 4AVBA 1FSEA 3HRTA 2CAVA 1F5TA 2RQPA 2A07F 1O7FA 3TKYA 3GFJA 1XGNA 1J2XA 1REPC 1TQ5A 4ORFA 1J3PA 3KLNA 5BQTA 2RV8A 3KP7A 4WXDA 3CJNA 4XFIA 4Q0UA 4XFBA 2PI0A 3L7WA 1XDUA 2KIFA 2K7LA 2FNPA 4B09A 5BUVA 4ESJA 4U7DA 4YARA 2QQBA 1SFNA 3S0MA 1YFUA 4S05A 3WTVC 3HT2A 2CG4A 3KZZA 5L3CA 4G7ZF 3J7AO 3ABTA 2XHKA 3F21A 1KU9A 3TQNA 1FSHA 3E3VA 5HDNA 2UXXA 1YS7A 2Y0MA 3CF6E 4M74A 1W5TA 1RL3A 1TQMA 4B29A 4G7HF 3R0AA 5DV5A 3FFQA 3K0LA 2X0LA 4KL1A 5DEQA 1IRFA 5LEKA 1SD4A 3WGGA 5ILUA 2VOOA 4U0YA 4IEWA 2P5KA 3HSFA 5A2QZ 1HQCA 4BQAA 3P7NA 4UHTA 2EJRA 4EQQA 1BM9A 1RUNA 1SD5A 1P92A 3I71A 1OR7A 1XE7A 3HOTA 4A5NA 4OFGA 2VECA 1S3JA 2G9WA 3ZMVA 4ENJA 3O14A 5CVRA 1QPMA 1IN6A 4MGKE 5CVIA 4QMAA 1K7AA 3LAPA 3ES1A 2RN7A 1R1TA 3USSA 4Z82A 1LKNA 1ZAOA 2O03A 4EWEA 3RKXA 4JQFA 4S04A 5E16A 1NYWA 3V8JA 3H3ZA 2H27A 2ET7A 1R22A 2OZUA 1OD5A 1X8EA 2QWWA 2Z5UA 3WODF 1P4XA 1ON2A 1Y0UA 2ET1A 1G4DA 1TW3A 2Y75A 1FP2A 4OOIA 2Z33A 2V1XA 1EH8A 3WGIA 4L9TA 5JR7B 4NVPA 1O4TA 2L02A 3RZZA 1BBYA 3ZDSA 1DPRA 4YIFA 2BGCA 2VBZA 5J8FA 2UYBA 4TLFA 3VFZA 2KJBA 2HWVA 2VE8A 5I91A 3BCWA 4QGNA 1R5HA 2KIMA 1BC7C 5LHGA 3HIFA 5BPXA 2DI3A 1FLIA 2VBXA 2M1BA 3D5LA 1J7KA 3I59A 4I02A 4KMUX 3GBFA 2ISZA 1IXRC 1HW5A 1YHFA 5L3EA 2OBPA 2F2EA 3NVCA 1R23A 1HKSA 1IN7A 5DCMA 2PBIA 1FYLA 2UWMA
chains in the Genus database with same CATH superfamily
1W6MA 2EZHA 1DGWY 1QOTA 1YIOA 1BBT3 4ZDLA 2QA4I 3T0DA 4S2HA 2OQ6A 3V8LA 4XUNA 1T6SA 3ZN4A 3V4GA 4R4XA 1SFXA 3PFIA 1XNKA 3M4FA 1TMF2 3SYTA 1RVF2 3LD8A 3HPHA 5HXVA 2UURA 3GUDA 2XWBB 2VW2A 2VBWA 3SHFA 3HEIA 2MLKA 5BOXA 1RUF3 4V2GA 5IVYA 5A6YA 1LODA 2J5OA 3ZMSA 1HRV2 3POBA 3AK0A 3PQJA 4R9AA 2EFNA 3GNEA 3JW4A 3LPFA 4C91A 3CCEI 1YW7A 2FDFA 1UY3A 2CW8A 2BBYA 3JRAA 1BI0A 1PIV1 1WH5A 1OBNA 3L09A 2PHXA 1B8IA 3FXQA 4RS8A 1P8JA 1R4MB 1D8KA 2RS53 2Q8OA 4AFMA 4GKXA 2A69F 5T50A 4XL9A 2W1QA 2CDPA 2JA7J 1RUD3 2VZOA 3LFKA 4JGZA 4U0WA 1T0FA 5EG0B 4A3KJ 1HOMA 3PNTA 2ZXJA 2ZX3A 2CMPA 2QKLB 3WTSC 4EN6B 3VKNA 3PU8A 1KFXL 4IVNA 4RAFA 5LEJA 3W6JB 1Z7LA 3JBG3 2B45X 1X2NA 2CQKA 3ZFEB 1ENQA 1I5ZA 5DUWA 3LAGA 1RVF3 3CJTB 2ETEA 1X1BA 4XLAA 3WTTC 1KS4A 3I2KA 1EAH3 4QQHA 3FK7A 2C0ZA 2BFUL 2FU4A 4FE7A 5FRMA 4FT8A 1HB3A 5ACA3 4YZ3A 2F5EA 3M7AA 2DODA 4ZZLA 4D94A 1PK6C 2IS6A 5E18F 1OA2A 2FCVA 4II2A 2FJ1A 3DN7A 2FXAA 2GOMA 5LRRA 2VVDA 3VBOA 1C8NA 3M3QA 2K9LA 1O57A 4QPIC 1YX3A 3I49A 3HOUJ 2UY9A 1O3TA 2XJQA 2ACJA 5IPAA 1IKPA 1G3WA 3ZN5A 3ECOA 1NG7A 1PJRA 2HS5A 2O7OA 2XV4S 3QODA 1YXWA 2WS91 1UPSA 1I39A 3ZXKA 3ATGA 2KQRA 2WNVC 1HW2A 1SLBA 1TMF1 5EFUA 3HN3A 5LBQA 4AM3A 2NM1A 3MN2A 4HG2A 4XF0A 3VDXA 4DO0A 1RHI2 3L2HA 1K79A 3K4BA 1QJX2 4WM7C 2BNMA 3RPQA 2LYCA 4GIQA 1GOHA 2QZ8A 1QDCA 5GZGA 2PHDA 4XOTA 3OSGA 3VD9A 4BY7J 1KGYA 1WMFA 1YW8A 3BQZA 2GC0A 3ZQFA 1GNYA 4CP0A 2FDJA 2WIIB 5C3OA 3KYDB 4KG8A 2RVAA 2W7NA 2VUCA 4IETA 2A5ZA 1RC9A 3VYRB 1VP6A 3W59A 1S29A 4OMYA 3HKZA 5HPOA 4YRDA 2PEXA 3Q0UA 1WW5A 4GKYA 2WNVA 3OY8B 3ZR5A 1G9AA 2YGMA 1QIQA 4CXYA 4NQWA 3HSRA 2QBXA 5EZGA 4HSLA 1XYNA 2RM21 1FPN1 4RFRB 2YPJA 5D5WB 4IEQA 2CU5A 1R083 5F2WA 1PUEE 3ZR6A 4AHZA 1V5EA 1V4RA 1S0FA 3VBUB 2QLZA 4GRIA 4PQ9A 4XQ4A 4YNIA 5L73A 1LEDA 1SMYF 1FOD1 1J83A 2ZMEB 2ESNA 1SFUA 3VBOC 4F3QA 1AL22 3N4MA 1D4M1 4AF9A 3BYWA 2Q1MA 4K1ZA 1OC1A 1OCTC 3NV1A 2M30A 1WWXA 2LREA 4NIHA 2NS8A 3PUBA 5FMOS 2BBAA 1NLQA 4NBQA 4D7YA 2D43A 2LD5A 2LMDA 2VZTA 1UWWA 1YJKA 2QSHX 4TTGA 1AOYA 2XPUA 4YSFA 1LUJB 3OJBA 4LHNA 3SJMA 4NQWB 2J1RA 1WKYA 5A6ZA 1TTYA 3IH4A 4WZCA 3GZTB 2PA7A 1W9YA 1RKWA 4I7HA 1C1FA 5B5EC 2UY8A 2CW0F 1WJ5A 3AZWA 4BB3A 2AXTC 3PUQA 4A0YA 2HGCA 2YU9J 4HDVA 2IXCA 4JGZC 4Q5SF 1CESA 4IEYA 4XW3A 4BDZA 2P7CB 2F4LA 4HK8A 1VJ2A 3J7LA 1DF0A 3BOQA 1LOCA 2ILMA 2GC3A 1V6MA 2Z1DA 1O3SA 4GXLA 1D0GA 2K3PA 1YIJI 3RZMA 1X1PA 3R4SA 1K4SA 3U75A 1AWCA 2D1HA 4XE9A 5DPNA 4UT5A 4L9NA 1MGTA 3OUJA 3BR3A 4YVSC 2RR12 1CZTA 3IAQA 2ZKLA 1X8MA 1ETKA 2WV1A 1AX1A 1X2MA 5D8AA 1QQIA 4RGRA 2XAJA 3NNLA 3W21A 1N1SA 2WSVA 4GA9A 1RHI3 1RPWA 1BZWA 1GZTA 2LC2A 3LA2A 4MYEA 2GZWA 3MAJA 2EZIA 4Q1RA 3PUIA 4C3JJ 2FDKA 2NMNA 3ZXFA 2ZXWH 3O7OA 4FQ4A 1VAKA 2I45A 2V5DA 2QVOA 1VAVA 2QZ3A 5CZKA 4NN0A 1WCDJ 2LY2A 1RUD1 2HWB2 4DNYA 4FX0A 5GAHJ 4FXKB 1VBB1 1W9WA 5J36A 4E7ZA 3HRUA 1I5PA 4IV1B 1ZBA2 3VKLA 3VSKA 3BN6A 2GIZA 4WVMA 3VODA 5F64A 3A03A 5AONA 1GXQA 3WDTA 1BR1A 3OTFA 2O61A 3SH5A 4LOTA 1QXRA 1CAUA 4UFLA 1T39A 3VBUA 4AAXA 2O8XA 5FP8A 4Q48A 5H2FC 3GTOJ 2QQLA 4WCGA 5IT6A 3CCQI 2WTEA 1EV11 1N1YA 1ND2C 4CEWC 5F3GA 3ZMUA 5BNPC 3FXJA 3ZOIA 4S2DA 3OIOA 1AA7A 3AG4H 3S15J 1MBEA 3HBLA 5FO5A 2LM3A 4BYYA 3V65A 1MACA 3KP3A 1ITYA 4HN1A 3KHBA 4ANJA 2ZJ2A 4JCKA 3DLAA 5BNOA 1JKOC 1MQTA 4XICA 5JXGA 2NP0A 1KFUL 3WF2A 5BY5A 2CO5A 1SPPB 5C8WA 5APAA 2JENA 2GMEA 2ZOEB 3NJXA 3E97A 4CZZA 1IV8A 2BYVE 2VQAA 1JH5A 4YIRX 3FXKA 3WU1B 3F8BA 1RUI3 2IW5A 2JKBA 5HCHA 2B5HA 2XDVA 1IAWA 2VU9A 2WQ4A 4BAYA 4UB8C 3BU7A 3ZSLA 3UNPA 1Z1DA 2JVHA 4QPOA 2JA8J 3K4LA 4CCMA 2ZGTA 4XK4A 2MC3A 1OT5A 3BC8A 3ZN1A 3LOIA 2OT7A 1YQ8A 4XMYA 1RUG1 3USUA 2F5FA 2LTNA 1OF4A 3MKZA 2AR6A 2L4MA 3BG3A 1FBQA 3JD72 4AGGA 2PMZN 5JOXA 1SG3A 4BQ3A 4EMSA 3IC7A 2O6GE 4XR6A 3DTEA 4M6VA 3RYKA 2HBTA 2HOSA 2E33A 4AI1A 5JR2A 1RB8G 2L01A 1ZBE1 4XONA 3GZ5A 5FD6A 4KU8A 2DA5A 2I2SA 4L8QA 4C9YA 3ZN6B 1U8RA 4XXPA 3RJRA 1U3EM 1G6NA 2IGNA 1KD7A 5IJRA 2K9MA 2WFF1 1AYM3 2GN3A 1UXZA 3HHGA 4F8AA 4YZ4A 2XJTA 1NOVA 4D1QA 2EV5A 3HUGA 2A73B 3CC7I 5GP9A 5I0DA 2G7HA 1RUD2 4MHRA 1JN2P 1URXA 2A6XA 3RZKA 2CW7A 5AIPA 2HWD3 3BJOA 1DYPA 2ZHNA 4FSJA 1T6BX 3LA3A 3BIWE 2R7FA 5GADJ 4ON0A 4QPWA 1HF0A 5LASA 4A3BJ 3N9OA 1WLCA 4R8HA 1N77A 2FMYA 2LBFB 1NY71 1XU2A 1ZZ9A 4B48A 3CMGA 5JCTA 4FETA 4D0PA 2V6CA 4WM8A 3REOA 1G59A 3H0GJ 2XJRA 3CMYA 1APLC 5F6KA 3NAPC 4AWDA 1BHGA 3QPLA 1Y1WJ 2KDZA 2GALA 3RPUD 4GWNA 4RL7A 1E0EA 2DYRH 2XL9A 5FZIA 1W8WA 2D6PA 4BDYA 5E88A 1SCRA 4FISA 1GWMA 1CQ9A 1RETA 3IBMA 5DUUA 2Z9OA 2V09A 2QDRA 3H36A 3ECHA 4AU7A 4IV1A 2EZLA 1O3QA 4EEFG 1G86A 2EBIA 1LTEA 2VZ1A 4IV3A 2OCCH 1MR5A 1HIXA 2CAUA 1YFWA 4LNVA 4QTRA 3PJYA 2R92J 3EETA 2QSGX 5E1XA 5B2GB 4FCAA 3NV3A 1OPOA 5CVVA 2ATFA 3QBQA 2HWD1 4XKCA 1RUI2 4LKFA 2W94A 1SD6A 1WWYA 1F1ZA 5LWBA 4IE6A 2E7XA 2ETHA 3K7AJ 2VQLA 3K4CA 3TP0A 1KQRA 1DGRN 2PN5A 3LSDA 5DAXA 1ETXA 2O8QA 2WNUC 3G2BA 4BQNA 1GHCA 2VVFA 2IA0A 3K70D 3POJA 3QLQA 3WDUA 1B9MA 2K2SA 4P1WA 4A44A 2ADEA 5DS9A 2NLRA 1BEV1 1D8JA 1Z21A 2PMUA 4CUCA 5D8AB 4OQ9A 1XGMA 2GOXB 5IFTA 3AYEA 1HN0A 4NR1A 2E35A 4W65A 5G05L 1PGL2 5DCFA 3LQRA 4FTEA 3BZKA 2WFF2 2X6WA 1IPJA 4QPYA 5A7SA 5AFBA 4W4ZA 1TWCJ 4M9SA 3OBTA 1JZ8A 3FXUA 1UB9A 1XSXA 5FY1A 5HCAA 5ICEA 2VC1A 3OYAA 1UZCA 1MMSA 5JOZA 1SLTA 1KQ8A 2VC0A 4B1LA 2O1QA 3FM5A 3PUSA 4XDOA 4DFSA 3DYPA 2V4AA 3DCQA 4Q0PA 1UKRA 3ZXLA 1MNMC 1TWAJ 2P34A 2H1LA 1SHWB 3PM1A 2MEV2 2XUEA 5JLVA 3POYA 1OXCA 1TNRA 5ISLA 3ETPA 3GXOA 2BFUS 2VOKA 2K9ZA 1BI3A 1BL0A 1XU1A 3C18A 4IOCF 3WTWC 1W8UA 5EYXA 1MBFA 4OI2A 1W2UA 3H5RA 5C4WA 1GOGA 4XCAA 4Q0VA 5FXVA 1NE6A 3MPPG 5CFCB 4RSUA 1Y8RB 1Z3XA 2XVCA 1ULYA 3QH6A 4M3CA 2QEXI 2J1AA 3TDZC 3I4PA 4LITA 1JT0A 1S7OA 3OGGA 2R6QA 2BU9A 4CRQA 4Y1UA 3IMMA 4CXFA 4YFNF 1QH6A 3UJOA 2CGNA 2WWYA 2BY2A 5KHDA 2CH0A 5KHKA 1W0OA 2Y0SA 1HCRA 3PIGA 4RFT0 4DXZA 3OOPA 1H0BA 2QSFX 2A05A 1ZG3A 4Q29A 2ZJRF 3GTGJ 1YX5A 1YRZA 2YBPA 3S7IA 4BMEA 3FMRA 3GBGA 2QCSB 4N53C 3GLLA 4QU1A 1HQNA 3S7EA 1JU4A 2JVGA 1W8ZA 2RDQA 4C8DA 1KJLA 4L99A 4II3A 3TO7A 2VOPA 2OQ7A 1V6LA 2W24A 1LR5A 1X3ZB 2ZHKA 5FQ0A 5E8GA 4UB6C 1PVC3 4LOCA 3ZSKA 1ZKGA 1WVRA 3KP6A 1SFYA 2ZGSA 1BR4A 3C7GA 3ONQA 4XIDA 4FP3A 4IERA 2PQSA 2E5ZA 3LMMA 3I4IA 4EJRA 1GV5A 5M3FJ 2ZJCA 4XOGA 1IS6A 1LNSA 4RQPC 4XFHA 2KMUA 5TJJA 4PFOA 3LSIA 4PIXA 5F08A 2PLYA 3CIHA 3ZIWA 1AYM1 2BV6A 1JYIA 2GU9A 4RB0A 2MPFA 1CGPA 2W2IA 1OFNA 2PG4A 5C3PA 4AIKA 2E71A 2XRLA 2YY1A 5K5QA 3N9NA 2CNAA 3DPRC 4KWUA 2CWMA 5HS7A 1IN8A 1V00A 1SFPA 2B7YA 2X9DA 1FEXA 2KHMA 3WP4A 3MV01 1AR82 2VTXJ 2WZPP 2IFRA 4ZS2A 1HRI1 5FYCA 4RB1A 3T30A 4GYIA 2E2JJ 4XMIA 1UOJA 2VNVA 2HR3A 3ETQA 4WWCA 1ON1A 5F6FA 4AFDA 5K7ZA 3LCPA 4LB6B 1FC3A 3LSTA 1KQ9A 2M3AA 2RS12 3L2VA 3DPTA 4M9ZA 3H9QA 2EZKA 4Q4Y2 3P9CA 1RHI1 4LBQD 4JTOA 5A3WA 2XVKA 4BQWA 1ENRA 5J98B 3KCYA 3VHPA 2WNUB 2IXJA 3JRFA 2VQTA 3CJXA 3APBA 1LCLA 5E6HA 3AJZA 3AKPA 1A04A 5LCWL 4GULA 4MGSA 4AQ6A 4QSHA 3CTAA 3ZFFC 5FZAA 3ZDVA 3HN1A 1DYOA 3SDGA 4C3IJ 1F4HA 2BOIA 4UW6A 3LFMA 1NA1C 4WM7B 4MXWA 4R52A 2WABA 4IEUA 2PYTA 4UV8A 1R71A 1WHUA 2ORZA 2ZAHA 1C4RA 5CFCC 3E6CC 4IRIA 1EY2A 4XOPA 1LHNA 4EZ4A 1V54H 4AUXA 1YQAA 4QKBA 3MO4A 2JSPA 2BY1A 3ABZA 5C3QA 1UU5A 2C9KA 1AF9A 4CDWA 5K5RA 4LO5B 1XGSA 2CRGA 4Y22B 4OIQF 1BCXA 5JZGC 2RS33 4W6XA 1LRHA 3O1MA 1IS5A 1XG1A 1PMJX 1D5YA 4D7SA 3WF4A 5F1RA 1SACA 5C8CA 1Q8OA 2WNOA 1AL21 1XC6A 2VJIA 3H35A 3H0OA 1MBKA 3NSTA 4A45A 2WL1A 5T5JA 3LOCA 3ZFGC 4X0GA 3BKZA 4B4QA 2UZKA 1BR2A 2X5IA 4QGMA 4E2GA 2ZGUA 3RDIA 2XWJB 4AFAA 1ODNA 3CUOA 1E3HA 3KZIC 4NOTA 5HNHA 2DBIA 1Q1HA 4AOCA 1KJRA 1HB2A 4A3FJ 2EFOA 1YITI 1JUMA 2FCUA 2JG8A 2H8RA 1VBC1 5IP9J 1BK0A 3I53A 2Z99A 4UFJA 2NAZA 2VCMA 1UHSA 1JHFA 5FKOA 2E2HJ 1H9PA 2H94A 5FLHA 4KGQA 2XAGA 4X6AJ 2YROA 4A3XA 5A3OA 3BCBA 1BKZA 4FPKA 4EVIA 2JMWA 3WF0A 5FZ6A 3MWMA 4XACA 4HL0A 2YUEA 5M5YJ 2YU2A 2XHNA 2E1MC 4QM8A 2ZGKA 1RUC3 3PQKA 4PCRA 2OA2A 5A3UA 2BV4A 3WD5A 3ORJA 5L3DA 4D7TA 1XNAA 2HQNA 2HWD2 4TZDA 4BQ4A 1BBT2 4J19A 3INAA 3JD71 1W7PB 2KZGA 3LNQA 1O4YA 5DZGA 5C4JJ 1CIWA 4LMYA 3QRFF 3T2QA 4CUGA 2RG4A 5EJ1B 1O6UA 3H8UA 2AXLA 1PZ8A 2WT2A 4OI4A 1UY2A 1POQA 1KYWA 2ZJQF 1Y9QA 2PAMA 1F8VA 2YX7A 4M0HA 4J25A 1PIV2 4HETA 4NUBA 1EP0A 4CDQA 4JRAA 3AP9A 2FBIA 1Q1VA 1RUG3 3H42B 1QJEA 1IJWC 1OF3A 3PUAA 4E7KA 2QQVA 4NIIA 2YPDA 2JDMA 4SBVA 5IW0A 1AR91 4J01A 4JX6A 3OBRA 1ZR4A 2K02A 1PNFA 4MOAA 2V1DA 2DMTA 4NHJA 5FFZA 3PVBB 4DS0A 5DUIA 3BR2A 3MZYA 5K9YA 4L9JA 3FKJA 1YQ6A 4XF9A 4NRMA 3H1YA 4AI9A 3O1UA 4BGDA 1D0YA 4L0YB 2CV0A 4AGVA 4ZYAA 1SZBA 2B46X 1GUUA 2A6TA 3I2IA 1PO21 4WX9A 1CAXA 3A02A 3HRSA 3U14A 1FXZA 4GMP3 2F4IA 4NAMA 3LSMA 1H9TA 2YUSA 4GWJA 2RS32 2ME6A 1JZ6A 2OYZA 2Y0OA 4HFSA 5CB7A 2HDWA 5FQ0B 5DUXA 4JDOA 4AL9A 2JPCA 3G1MA 5J09A 1AKHA 1VAMA 2WBMA 5D21A 1HQLA 2KM2A 4EQVA 3CJQB 5ERLA 2L9LA 2PXJA 3ABLH 1GICA 3O6BB 3OB8A 5J4VA 1GQHA 2M0CA 4LD5A 4UXAA 2DOEA 3I3LA 3POFA 4IPAA 2R5ZB 3UL2A 1NCQA 5J40A 1OH4A 4IGPA 1IRGA 1X36A 3FFZA 3O0WA 1YI9A 2WAOA 3TEYA 2ZGOA 2VONA 2ZXHA 4HVRA 1A8MA 4XBNA 1K5MB 3V8KA 4RLFA 2DFEA 4WVZA 1MS9A 5DXDA 2ZEWA 4AR2A 4IW3A 1CWPA 3EXUA 3NKTA 4RGUA 4KIBA 1FOWA 5FO9B 2VQCA 1SVLA 1OFCX 2IXHA 4CP9B 1GZCA 2B4KA 1VRH3 2P1BA 1R4NB 3WU0A 1J58A 4A2UA 5FV3A 3WGHA 4IEVA 3WQ0A 2C6YA 5EEGA 3ML6A 1V6OA 1AR63 2VMCA 1LNWA 2XJUA 4QWNA 4BE2A 1BVP1 2PFWA 4P14A 2X51A 2RMU1 3WNOA 4KBZA 1F43A 3ZXAC 3I0TA 3M07A 5BNGA 2LRPA 4A7KA 3NEUA 5D6FA 2L54A 2RJKA 3OF1A 2RDNA 2Y34A 3KGZA 3ZXDA 4MEXF 1W6QA 2XJPA 1CZVA 3FHZA 1TNFA 2IVJA 4KN4X 2JDKA 5FJ8J 2A6EF 4CH7A 5ANNA 3B6CA 2F17A 4MZUA 1CD3G 3ASIA 5K1YA 1IRZA 1FOKA 5FRAA 2DU9A 4QU2A 3VDCA 5FRNA 2F5VA 3HQRA 5T3NA 4A3LJ 2LKXA 2Y48A 4ISQA 2LW8A 3EYYA 1IG3A 3F8FA 4IEOA 4QT6A 3S5QA 1TWFJ 2X48A 1XD7A 4NHMA 1IDZA 2VG9A 1ETOA 2VD7A 5CLSA 1ONAA 1I6HJ 3ZQCA 1RUC2 4FQZA 1XMAA 1ND3B 1CVNA 1Z67A 4LLFA 5SV5A 5CPRB 3C7HA 3KCXA 2QM3A 1AR83 5LK5A 1IXSB 1MKMA 2Y26A 2PQQA 2ZSHB 2QKMB 1H8TB 2J5PA 2FBKA 4QXHA 3BR1A 5DQ0A 2DMPA 1DPUA 5FZ4A 4AVBA 1QKQA 1GZ9A 2RQPA 2DA1A 3SC7X 2CTVA 3A7QA 1LOFC 1JODA 3VZMA 2VLAA 1TZOA 1DQ0A 1REPC 4LO6B 4JKMA 4WM8B 3AXDA 3MIDA 4QXBA 5T55A 4A7YA 3NJYA 3IAPA 4ASKA 3KLNA 5BQTA 4CYCB 3KP7A 3WG2A 2WAQA 1O4ZA 3SEQA 1OQDA 5FKLA 1VFCA 1XDUA 2AGSA 2FNPA 3K77A 2Z4FA 1Y7BA 3NAPB 5BUVA 4YARA 1YFUA 3JBG2 1OLTA 1EF4A 2Q5TA 3LEKA 3H0DA 2VQ0A 2KPMA 3RI8A 2YYOA 1IHMA 3TQNA 3PNYA 5HDNA 4DY5A 2NOJB 2X1CA 2Y0MA 1OKOA 3MMYB 3WOGA 1GP5A 1D0ZA 2WO1A 4B29A 4G7HF 4BQ2A 4CP9A 3R0AA 3FFQA 3NV4A 5FYMA 1FMVA 5LEKA 5ILUA 4U0YA 2W68A 4BQAA 4UHTA 2EJRA 3DTIA 4EQQA 1BM9A 1CQTA 4OI0A 3C7FA 3N7JA 4A5NA 3LL7A 1GZWA 2Y0IA 2VECA 4IQJA 3IV5A 4ENJA 1QPMA 3DBLB 4FFHA 3LSRA 4BM8A 2YB7A 1JZ4A 4XKWA 2TEPA 4UOJA 2G19A 4FOQA 2EICA 3ES1A 3K3OA 4K21A 4DXRA 3HOXJ 5K4LA 4Z82A 1U0JA 3RKXA 1RUE3 3I2FA 1MZ6A 3FXMA 1N25A 1HXS2 3DBHB 3ZYBA 1LVKA 2NVXJ 2ET1A 2DCEA 2WYSA 1H2NA 1ERDA 3WGIA 5E3NA 4BS9A 1REEA 4BEHB 5JR7B 1MEC3 2BVMA 3OR1C 3AC0A 5A1AA 5FZKA 3J9SA 5DDJ3 3AXEA 4YIFA 1IDYA 2BGCA 2UYBA 1H2KA 4FFFA 4XUOA 3A0HC 1XPXA 2JJ7A 3VFZA 5I91A 3BCWA 4QGNA 1R5HA 3MLKA 5JZGB 4XJZA 4DEQA 1YNAA 2M1BA 3GDBA 1J7KA 1HRI3 1RXFA 1IXRC 3A01B 4IHWA 3CCVI 1YHFA 4AEMA 4CEWB 1QJU2 2OBPA 4V2WA 4CXWA 1QXPA 2VO5A 3PIPF 5FY5A 3NVCA 4XPVA 2PBIA 2UWMA 1QHDA 2Q30A 3HDDA 2O0OA 5FZOA 1O91A 4A12A 1WLTA 4LBJA 1H0MA 5EXOA 1HJGA 1RKTA 4M9XA 4PQQA 5AC93 1RUJ3 3EBRA 5ICGA 1HXS3 1WA4A 5GPAA 5IK8A 2O14A 4AI0A 4ZYDA 2QQUA 5KVRA 3CCLI 1V6NA 3MLLA 2KRFA 4GGGA 4COVA 2F4PA 3MZ8A 1W28A 2Z69A 2DCTA 1RUG2 4BBSJ 5GPCA 4K1YA 2VMDA 2Q8EA 5LA2A 4CDXA 4A3EJ 4BK5A 2FOWA 1V9U1 4GDFA 4NAOA 2WUHA 5J1UA 3JSOA 2PHLA 4XILA 1CAWA 2IS1A 1WCKA 3TYJA 1LULA 3GTJJ 1WD4A 3BLYA 2XASA 3KFWX 1DHKB 4LKSA 4YM2A 5FUIA 4EJWA 1AXYA 4ES8A 4K8FA 3POGA 4SLIA 2X53S 3NJVA 1HRV3 3LEIA 2RNJA 4CCEA 3QP6A 4YW6A 3KP4A 3ESWB 1AYM2 1HQWA 1YJWI 5DUKA 1CJDA 2R7SA 1K45A 3ABUA 3BTIA 2R30A 4IF4A 1POV0 2XIGA 3IMNA 3KV4A 1JOJA 2IGKA 1JOBA 1FNYA 1UCXA 3E7LA 3JD73 4C3HJ 1YFYA 1J3RA 2HQ5A 3T09A 3QCWA 2KKOA 1PMIA 5F5AA 1EA3A 1NK2P 3FL7A 3ZPYA 1H1IA 2Z79A 3GJBA 2DVFA 3VWBA 3OOXA 1AR62 1CONA 3BJAA 1XE8A 4MTEA 1ASJ1 4QX3A 2PLV2 3C8XA 5TRDA 1I1GA 2G4IA 2Q2EA 1NZCA 4CA9A 4UVAA 1TL8A 1VRH2 3VYTB 1MSFC 2YG0A 1LGBA 5K7PA 2OUHA 1QJY1 5J47A 2XLAA 3BUCA 2RDRA 4I0AA 4TWTA 4NIDA 4ZDOA 4RQPB 4EN0A 5EGOB 2WN2A 5GLUA 2OF7A 3KVAA 1OCRH 5DAWA 4LJZF 3HBZA 1WJEA 2BEOA 4YW2A 3KHCA 3HL2A 2V79A 2A7AA 4Y1ZA 5F3CA 4PBOA 3A2KA 3WW4A 3AZYA 1O4XA 1W7PD 5FYZA 4GH4A 4HVQA 1B6AA 4UY8I 3N97A 5KHHA 3RQIA 2V9VA 4BK4A 1YHQI 3C2HA 3QPTA 1E17A 1WBFA 3FF5A 2KXLA 2PMZA 1JI8A 2VCBA 1FP1D 2OTJI 1X3UA 5LY1A 4FASD 2ZXQA 3RMXA 3BJ6A 4R9BA 4YG3A 5JI9A 5DD4A 1R1UA 4CU7A 1SVMA 3CCJI 2ZJPF 3DKWA 3CDHA 1BMV2 4WVVA 3NNFA 3WF3A 1QU0A 2WSUA 4IESA 4JX5A 3POIA 2K85A 2FZ2A 4FHTA 4I3PA 4OMDA 5FDBA 1OCOH 1OQYA 4XTMA 3CDIA 3GTKJ 2WAAA 4BY1J 1K12A 4ZU4A 2DFFA 1ULGA 5F1JA 2EXIA 4YLZA 4XFAA 4MHUA 1J5YA 2WNEA 4YEJA 3MKLA 2K4BA 1GWKA 2PMHA 2TNFA 3RWNA 2DAOA 3CUQC 5DAQA 4IEXA 2DU1A 2HFHA 1QZEA 2WZR3 1W3XA 3WINE 1UOGA 1WLWA 2YXSA 3NV2A 4RHV2 4A7ZA 3Q9OA 4QDRA 3N7MA 5LD2C 4M3BA 3WCSA 1J9IA 3JBG1 1D1CA 3FISA 3GZNB 3FE5A 4IV3B 5JXIA 3BZ6A 4PCQA 1PIV3 2COBA 3U0ZA 1A78A 4RS5C 2CV2A 2VIXA 4YPJA 1OLRA 2XF6A 2HVSA 1BBT1 5I8SA 2P6CA 3BPZA 1C8M1 2R0QC 4B7EA 4L5JA 2ZS6B 1BQPA 2EK5A 3FX3A 1QNWA 3LEMA 5FY0A 1LFPA 2BXYA 3GZ6A 1MSEC 5A7NA 5DABA 4LIUA 3CJIC 3T8TA 3WT3A 2X4HA 3MHZA 5CYVA 1UMIA 2VT3A 4MUVA 2RVCA 2VUJA 2K5CA 1FV3A 4UW4A 2OJED 4AI3A 2IA1A 4XN0A 3OIPA 4JK1X 1XQNA 3OYDA 1W39A 1Q8VA 1UHMA 1TNSA 3M1CA 3IZOA 4MV2A 1Q8PA 2RAEA 1AR92 1UX6A 4YM1A 1RINA 3A1YA 5JHUA 2VODA 2F48A 5KK1A 5C71A 2RE9A 1OYYA 3BPXA 1PZ7A 2XGCA 1LPQA 2B63J 2P6SA 2ZMEA 3ZMZA 4WBBA 4L5EA 3C2UA 1HXS1 1J3QA 4QGLA 3W2WA 4DOZA 1F35A 1H1AA 4OU0A 4D0QA 3UKTA 4N0BA 3FHQA 1YI2I 1F4KA 4B8XA 2BOLA 3RWKX 3S17J 2KIQA 2WN3A 2E7WA 5CG9A 1NT0A 3BQYA 4YVWA 1JW6A 1H9GA 1VTNC 1QDOA 3BALA 1V9U3 3H8RA 5FOJB 2WV0A 2W52A 3QAHA 3J7HA 2XGEA 1PYVA 1JUSA 3Q0WA 3ZFGB 5C70A 3HTSB 1JMUB 1REDA 2D5FA 3VBFA 2KLOA 4RR3A 4MGRA 4PDWC 3PTRB 1UFMA 5E8AA 1VI0A 4OIOF 3CCUI 1CX1A 2A68F 3G6JB 5FPAA 1U9NA 1WI3A 1RR7A 4CU9A 4IHSA 5IUQA 3ZQLA 2V1UA 2AACA 5FMOL 5IAXA 4FXGB 2ELHA 4Q4ZF 2XLGA 1Y39A 4YZ1A 3TW7A 4A3CJ 5KNLA 4Q0SA 4OYUA 5BNPB 4LLOA 2DBBA 3B73A 4PLOA 4LLGF 4Z1VA 1YO8A 1FATA 2Q0OA 3D4KA 4META 1NXD1 4DNCA 1E2XA 2R7TA 1ZYRF 3ACFA 4XF3A 3BOPA 4CGZA 3WQ7A 3R4DB 4MIMA 5F0FA 1EJ9A 2HWF2 4XVHA 3PVNA 4QPGB 3SHRA 1SFKA 4MO7A 4FE4A 1N3QA 1HC8A 4KU7A 4BHBA 4ES9A 1FPN3 1PVC2 1TME1 3LSHA 2DO7A 1ETYA 4LOSA 5FXZA 3LE0A 2VJ4A 2HPMA 4FPYA 5H9PA 5K8SA 4P9YA 4KDPA 5HS9A 1XYOA 2BY0A 3GTMJ 4COYA 2G0EA 1IF1A 2DDUA 5KBFA 3NNJA 4I3GA 3ZLIA 5K5OA 3AMPA 1YQ2A 3H1CA 5FZHA 1FOD3 2D3RA 2UV1A 1LOGA 5DG1A 2DOFA 3IKWA 2V7FA 3AVSA 2ID6A 4YZ2A 3JRGA 3BZCA 4EM1A 2VQUA 4O9EA 1NZIA 2GH2A 3VBRA 4ENNA 4KYWA 3VUOA 1FMD1 1H4GA 4XLHA 1W5SA 2W46A 4CEYB 3PIJA 2W92A 4XRSG 2RMU3 1SDDB 4P9XA 1PMHX 2VVEA 5EGOA 2I8DA 3WG9A 3SFIA 3ELNA 2YFZA 1DQ5A 1WPKA 4HSRA 3M4OJ 2BNOA 3OBZA 2W08A 1YQ5A 3TNPB 3H50A 1LESA 4HRIA 1ZGJA 2BPA2 2D97A 4MEYF 3NNMA 3HR9A 4GYGA 4U87A 2R073 1WUVA 1X9TA 3C2BA 1VRH1 1E5SA 3M70A 2M34A 5BXXA 3VBSA 4BZ4A 3I3BA 1DGWX 4PI2A 3PMSA 3M8JA 4QM9A 5GM0A 2W1SA 2DOAA 4LK1F 5JMOA 4CCDA 2W3JA 3Q0VA 5CFDC 4DUXA 4CCJA 4LK0F 3JRIA 2WJSA 5FZEA 2VN2A 5LW9A 2WZEA 3ALQA 3EO6A 4HAMA 2ORXA 4YFKF 2DDAA 2W4SA 4DZPA 1UZVA 3I54A 3EJKA 2H1KA 2LVSA 2O0YA 3IWFA 4MQVA 2HWE3 1DGLA 3QQAA 2E6VA 4PGHA 3BTCA 4LQRA 1Z0XA 3AP7A 3QWLA 4MGQA 5GLVA 1YFXA 4K8RB 1UW8A 2FQPA 2H0VA 1QOOA 3HOVJ 4KWJA 1B35C 1VNDA 5JPMB 1JTZX 1L7RA 3RMYA 5C3SA 4K20A 2CUZA 1RITA 3ABMH 3CJIB 2DCKA 4RGXA 1FBUA 3SQOA 3EUHA 4CYCA 2YMZA 5BNOB 5HDKA 1HDKA 4NDLA 2D5VA 4TN7A 4UW3A 5FR3A 4AQTA 5FLVA 4R1HA 3K6GA 1DCSA 1SC7A 1L7LA 4X6RB 1JYTA 4FPOB 5AVAA 3HKZN 2A5WA 1MPXA 4CSWA 2JX9A 4PIYA 3J8F2 1BMV1 4UVCA 3S3MA 1GFF2 3FK6A 4QKNA 4KICA 4JGYC 5C8CB 4PJNA 1S0IA 3ZP5A 2E34A 5GTIC 2ZPXA 2RQQA 3ITQA 1S55A 4FQGA 3I2HA 1XMXA 4HX8A 4O61A 1ST8A 5M5XJ 3HRMA 1QZYA 1LECA 3W3CA 1ZRDA 1AJKA 2I74A 4E2QA 4UI9L 2ECBA 5FLIA 3SFZA 3ZSMA 2Q8CA 1PVEA 4D9JA 3KIOA 3N35A 5CIRA 4XDPA 4OAYA 2JA2A 1GZWB 1ULFA 3WG4A 2IP2A 2X5IB 5DAPA 2OUJA 3S32A 4HOBA 2DU0A 1UG0A 2EAKA 5HXMA 1GNHA 5A70A 5A33A 2QUFA 2IS4A 1RUJ2 2HYGD 1NK3P 3C3VA 4IGQA 5FXWA 1DYKA 2HU9A 1JKRC 5L3BA 1YFHA 3I8TA 1U2WA 4LHLA 4ASMB 1FTZA 1HW1A 3RQ4A 2HQRA 1W7PA 2F5CA 4GD4A 1QQP3 2ARCA 3H9AA 2DT7B 2ZCWA 2P4EA 2M0MA 5D5XB 3VYSB 3KQRA 3WSOA 1OH3A 4L18B 1I1SA 5JVVA 2A6WA 4P96A 1ZLKA 4TYSA 2Y33A 1OLME 4NC7A 1WJFA 2JICA 4ZYEA 5CFDB 3WDVA 4IGOA 4A3ZA 4Y1XA 4FX4A 3OYGA 4AXOA 4AHYA 2XB6C 2L5QA 1DQ1A 5GLTA 3D5OA 4HBNA 5EV7A 2GNMA 3DQVC 1WW6A 3F95A 1SMTA 5C44J 2ZFWA 4URTA 2WFF3 1EAH2 1U5TC 3HNMA 4EJOA 3WHCA 4XCBA 3X29B 1K5MC 4LBLA 1VR3A 3I3QA 4MGYE 3PL8A 4QXKA 1LFUP 1DUXC 3RI9A 2LRDA 1FX7A 2WADA 1H1MA 3PO3J 1NE4A 5JIAA 2LFBA 1F5JA 4CDUA 4X1EA 5LGTA 1GANA 5A1LA 3DYOA 2ELJA 2MW8A 2ME0A 4CZSA 2OPKA 4JHTA 4B3AA 2NXNB 3NRVA 5JSRA 3HB9A 1JXSA 4HYEA 3IKTA 2F4OB 1VBC2 2PJRA 3P5BA 4DEVA 4LE3A 4AVPA 2E1NA 2NN8A 3EDPA 2DBNA 4BDVB 3JU9A 3C7JA 1T2KA 3OL4A 2HTSA 4BJ5C 4A3MJ 1U5ZA 4G8XA 2H6BA 1DQ2A 1CAXB 1AKHB 1YCIA 1U12A 1KS5A 2NNNA 3E1F1 3AMHA 4E6KG 1X1CA 5IAVA 2QQAA 1OD3A 4XTPA 2K3FA 4LBOA 4XLNF 3ZM8A 2SLIA 5CKQA 2Y9ZA 5FZMA 1S9HA 3OY8A 5FROA 4M0NA 4HV5A 5FIXA 3H1WA 2DK5A 2DLLA 1U0AA 5FPUA 5FO8B 1FY7A 3F23A 3UKVA 3KYCB 2K9SA 5FPZA 3W6KB 4AHWA 3DKXA 3H7JA 5LGNA 1X33A 3GHMA 1V55H 1KU7A 3AVRA 1UYZA 1SBEA 1E5RA 2WC2A 4HLTA 3THPA 3HT1A 3D5SC 1QJFA 1XE0A 2IXSA 4RA2A 2RMU2 1ZX5A 4GJZA 4JHZA 2VTXA 2ZABA 1G8XA 4PSWA 4UWDA 1N3OA 3J80K 3AG1H 1GR3A 2WT0A 2TCTA 4V1PA 1C8M3 4YW1A 3AZVA 5JWPA 5F6LB 3RSNA 5FY9A 2YPRA 2DYCA 2CWSA 2CY6A 2WDBA 2VPRA 2FQ3A 5D4RA 3LOBA 4FVVA 1DGWA 3OYWB 3GHNA 5DDJ2 4CO8A 2RDPA 3K46A 2EAAA 4ZZDA 5L3FA 4BMBA 3B00A 3QYBA 3FBMA 1ZZCA 2HWE1 4Q0QA 1FAYA 2DA2A 1SAUA 1W4MA 2XMLA 3ZQHA 1BK1A 3HC7A 2HNHA 4XQFA 5CKMA 1W36C 1P6RA 2D45A 2XONA 4M72A 4Y5Z0 3LSJA 5IK4A 3QACA 4NMIA 3UETA 3LZZA 2D3SA 3QD6A 4HOOA 3H9JA 5JIUA 3AL6A 1ULOA 1G3SA 4ZYGA 3CBNA 4RGKA 3ULQB 2WWUA 3VDBA 4LHKA 1MDMA 5DZFA 4NIAA 3H5AA 4JRLA 5E20A 3DF0A 1QY4A 3IPVA 3LAJA 4XLPF 2R5YA 2HDCA 1MBJA 5FZLA 3U37A 5HDGA 1BJQA 1W6QB 4LEJA 1LOAA 1F36A 4A6SA 2Y6LA 5K0UB 3NO8A 4C0BA 1UO9A 1KXGA 1WJDA 4EATA 3P9KA 3F8NA 5LA9A 2VKEA 5IP7J 3DXJF 2JXAA 4LO4B 2YDEA 1T2XA 1PVXA 2VCAA 2IBDA 2VCCA 3Q3SA 5BPDA 4LO7A 3H7YA 3RZHA 3BTLA 2HEOA 2E7QA 1GV2A 5HS8A 2VXRA 5J1YA 1ASJ3 2A5YB 4Z6YA 5E1RA 5A3MA 3JXSA 1H6XA 4Q5OA 1D5VA 3ZMTA 1GP4A 1R7JA 3I97A 4D5CA 2QQ8A 5HLIA 3AP6A 4IKFA 4Y4RA 4RLQA 1DDLA 4FBFA 1C8M2 2W0XA 5BS6A 1ZHFA 5IYCJ 2R32A 3QYEA 2NYXA 4XDQA 1KDKA 2HKXA 3IN9A 3GWZA 5E1WA 4XIKA 1D2QA 3CCYA 1H89C 4FPLA 3U07A 2E63A 3FLPA 4NIGA 4FPGA 3S57A 4Z92B 3SKVA 2A71A 1Y3TA 1RUH1 5FZFA 4RD7A 2DA3A 2VPLA 1N78A 2J42A 3FBNB 3DPUA 1U78A 4EWAA 5J3UA 1MBGA 3B02A 3F8CA 5IT9K 2EIJH 4UF0A 3DP7A 3VBSC 1ZBA3 5FZ1A 4OLLA 3GFMA 2XAQA 4N43C 4UV9A 2A3SA 2XXZA 2ZACA 4ZU5A 4KH9A 1SANA 3POSA 4LXLA 4Q4W2 3E5XA 1JYNA 5A7PA 3AFHA 1IN4A 1WD3A 2W39A 4IHTA 2NRAC 1CZSA 3VDDC 1FI2A 4AHXA 1K83J 1WZ2A 2DYSH 1T95A 5ICFA 3I2DA 4ZHNA 3VZJA 4ARXA 2P3KA 4C1XA 1L3JA 1RMU2 5JOWA 4XYXA 2OA4A 1RGSA 3NWKA 1EUTA 3BG7A 3IL2A 2XPVA 3RTRA 3EUKL 1VMJA 2DTWA 3F3XA 2OU2A 4Y17A 3O1TA 4CP1A 3RI4A 5DDGA 1QVTA 1UZ0A 3ZQQA 1RUF2 3MFCA 3ILNA 1UZWA 3SMHA 4GO1A 4FOYA 2K86A 1XPWA 5KC6A 2B9SA 5KHIA 1OFSA 3RSJA 4YWAA 2WB1N 4FPFA 1AYN1 4U88A 3BODA 2QCOA 5BNNB 4A3GJ 5I8YA 3FXRA 4N53B 3KE2A 2PAKA 2Q4SA 5AVPA 1UZYA 4KN7X 3GTQJ 1HSTA 1O7LA 3VBSB 3OYEA 4JC1A 2AS5F 3U4SA 1KGSA 3ZCOA 2VZUA 4AYBA 3I9V2 3MEPA 2L9VA 1T08B 1XCVA 5FKCA 5C3RA 1Z7UA 1PO13 3FN9A 2VPVA 2W9XA 1WI9A 3J80Z 3MZHA 2G9FA 2R042 2ZMNA 2BHZA 2VJ5A 3QOPA 1Q5OA 5DCMB 4DBRA 1R58A 2RGVA 4PJYA 2GXAA 3LSGA 5J48A 2PHUA 1OQEA 5M5WJ 4AVCA 3RYRA 4KG0A 3MW4A 1BN5A 1NCRC 2GBYA 2MD0A 3VD3A 4JGYB 3EYIA 3O1RA 1QU3A 2MD5A 3OMYA 4EROA 2FE3A 1D2SA 1IG0A 2PAEA 2BQPA 4ZC3A 4NJ4A 2NPIA 5GKAC 4JZRA 3V0BA 4XN3A 2B39A 1JYWA 1NAEA 3M7GA 2O5RA 1S7EA 2KJCA 4LFUA 5IT3A 2R7ZJ 5T5OA 3IRRA 4IE4A 2ESHA 4KIGA 1VQMI 4CDXB 5EG0A 3U4XA 3ZYPA 2GWRA 1UF2C 1ONVA 3NQHA 5FP4A 3IIIA 4W6YA 4YRVA 1MJBA 4RN5A 3GX4X 3GCMA 1VQPI 4ZZ8A 4DYQA 2MFZA 4HKWA 2MEV1 4XSXF 1RVF1 2R063 4QPIB 1MNDA 3T4VA 2P3JA 2DPUA 1S4CA 2L7MP 5FLMJ 3KQ4B 3C1DA 1W8TA 1WRJA 5FYIA 2RS31 2ECCA 1HLVA 3AMQA 3THTA 2IS2A 1PK6B 3ERMA 2VZSA 3GZEA 1SFOJ 4HEA2 3H1MA 4RAZA 3PSFA 1J0RA 2E1CA 2EH3A 3S2HJ 4ARYA 2R93J 1K5MA 2EQRA 3MFKA 3F0CA 3VB9A 3A21A 5K7HA 1SBFA 1WJAA 4Y1VA 5H20A 3IDEA 2IXKA 3RNSA 4WF2A 2IAIA 4BWOA 2JDPA 2VJJA 5B1BH 3BIEA 2V26A 1VQ7I 1XTAA 2HWB3 1KONA 1QNTA 1EPZA 4HDUA 4EZHA 2MH9A 2VXJA 3KZYA 2VOXA 3B5LB 4IDZA 1H9WA 3WF1A 5FLXZ 1VQ5I 4KUMA 2XPJA 2XQXA 5TISC 1A8DA 4GB31 1JUHA 1QZZA 4CEYC 2M45A 3V56A 2ZGMA 5K7FA 3LFIA 5JSPA 3PO2J 1UY0A 4DY3A 1TQIA 5E79C 4FFIA 2E51A 2M8EA 4YGCA 1VBE2 4RS5A 2C24A 5A32A 1BIBA 1STMA 2BVLA 3HTUA 1GU3A 1COV3 2OTLI 3N7LA 2EWNA 5GZCA 4CP2A 3D5RC 1FSEA 3HRTA 5F0HA 1F5TA 4ZDPA 1O7FA 3PIOF 1XGNA 4RAGA 2HXIA 2F4MB 2A75A 4UFKA 4P9LA 1F2NA 1J3PA 3CJNA 2XJVA 2PI0A 3L7WA 4CXXA 1OLMA 2KIFA 2VMFA 1Z0HA 1K61A 3ZYIB 4U7DA 2DFHA 3S0MA 3WTVC 3HT2A 2BHYA 3KD4A 3B3QE 5EJZB 1ENXA 4YGBA 5EPAA 3FLTA 1LU2A 3E3VA 2UXXA 2VE1A 1OCPA 3ZSJA 3CF6E 2P81A 1RRJA 3K0LA 2V4VA 3VL8A 1IRFA 1SD4A 5FPBA 4GWIA 3JB8A 4IEWA 3OL3A 1UAIA 3P7NA 1ND3A 2BTVC 1RUNA 4JAAA 1AZDA 2BOJA 2EIBA 2BWCA 3K70C 3A0BC 1XE7A 4OFGA 3S1MJ 1WJBA 3VKMA 1VMHA 3M8LA 3ZMVA 3O14A 2FDGA 4R9DA 4QMAA 2ZFUA 2CU7A 3LAPA 1W6MB 2LLKA 4B1RA 1R1TA 1S2EA 4NHXA 1LKNA 4EN8B 4I99C 2WO7A 1U5IA 2WAEA 3WLUA 1NYWA 2ARXA 3H3ZA 1R22A 1GSLA 2QWWA 1ETVA 3WODF 1YJLA 1I9RA 1P4XA 1Y0UA 4KT6A 4CCLA 3OYJA 4OOIA 5J3LA 1RIRA 3UESA 3D3AA 2B7EA 3CHXA 2JKXA 2BVBA 4ZPIA 4IUGA 2NQYA 5IVJA 2DA4A 1XNTA 1XSQA 3RZZA 1BBYA 2PHFA 1DPRA 3ZMOA 2W1UA 3AJYA 3BTYA 2J1SA 1MZ5A 2AC1A 2HWVA 2N8GA 2A3YA 1BC7C 4L0PA 2XB0X 5LHGA 5BPXA 4QQ2A 4KMUX 1UKGA 2P6HA 4BQ5A 1MIJA 4D8MA 1AXKA 4OHXA 2F2EA 3KB5A 4OZXA 3BR0A 3AZXA 1HKSA 1IN7A 5DCMA 5HNFA 1J1TA 4FPJA 3TOAA 4DBQA 1DLCA 3RZGA 3W20A 4GXOA 3TO9A 4IL7A 1ZGWA 2LK2A 3WR0A 4ZTFA 4GWMA 3G73A 1BVVA 2HBUA 1VLNA 2UYAA 3N05A 2BY3A 2ZZJA 3AB0A 3KV6A 3RKQA 2Q8DA 1Z3YA 2WYFA 2XPWA 2YGLA 2ZX2A 1BLZA 1UHWA 4RDUA 1QJZA 2WZ8A 5EJCA 3NKGA 5M0TA 4HNUA 5ACA1 1WQ2A 3LKJA 1ZA7A 1UMQA 1ODMA 2BDRA 2FX0A 3FC0A 5ILSA 3VBRC 2D40A 1COV2 2VH9A 4BLIA 2H0BA 4XAAA 3GZUC 4J00A 4XAEA 1CJPA 1NCRB 1XS9A 4AGRA 4LB5A 3AFGA 5H6RA 3P6BA 3N36A 1IUFA 3MD2A 1L0OC 4CDXC 1W99A 5FYVA 3CC2I 5JFRA 4AVSA 1OYIA 3T0AA 3PUFA 2DXIA 2JD9A 2OKXA 5HCFA 4IXLA 2XUMA 3VHNA 4CCCA 4M4RA 4DINB 2VOWA 4A41A 3B93A 4A6OA 2VNOA 4MXVA 3O0XA 2ADUA 2WB1A 1HA8A 4Y4YA 2Y38A 3GEZA 1RR8C 3O3KA 3QU6A 2W84A 3K10A 5A7WB 1SLAA 4LPLA 1OISA 2E36A 2A6HF 4PK4A 3D82A 1US3A 5FY4A 3CL1A 5HV0A 5FY7A 4OIPF 3OS0A 4AI2A 4AC0A 3U1KA 1GBGA 5FP3A 3A23A 1R092 2VKVA 5FKMA 2Y64A 3TWIA 3JB4C 2LS6A 4D7MA 1FYMA 4ENMA 4QDQA 1AVBA 5FXXA 5FYHA 2CFXA 1PGW1 1V3FA 3F6VA 5F5QA 1LAJA 3OG2A 4BJ6C 2Q0AA 1N1TA 3B01A 3IIAA 4PF1A 3FZVA 3H8XA 3L9FA 4BXXJ 1ZH5A 3TEXA 4QLCU 5T5LA 1D4M3 4PHZA 1OMIA 5KHJA 2P4WA 4GB33 5KHGA 4XQDA 1UYXA 2MA3A 4BHPA 2C26A 2WO3A 3S1QJ 3ZGKA 1OQ1A 4UF0B 1U5TB 4PDWA 2BZTA 1V70A 3C3WA 1N1VA 1TE1B 4FPEA 1AU7A 2YV8A 3PHMA 4XORA 3RJPA 1NH3A 5KWRA 1KA8A 3ZKYA 1LDDA 4YM3A 1H8VA 4Q27A 1XC5A 4M4PA 1B72B 1FIPA 5EJ3A 4JQTA 1OUSA 2YC0A 3WNMA 4YW5A 3VD4A 5IVCA 3J8F1 1QOSA 1H8AC 4YVWC 5CU1A 4ZONA 2EV0A 1GXPA 2Q1ZB 3WW3A 2Y69H 4BXSV 4MHGA 5IVBA 2IXLA 2DF7A 3OGSA 1QPIA 2CL2A 4DMIA 3J7AY 5IT9Z 1QRYA 1APNA 2W87A 4XEZA 4G6DA 2AQEA 2TBVA 3JRHA 1Z7S3 4LBQB 4S2GA 4D6QA 3L2RA 2VI6A 1VE0A 2ZMEC 5H9RA 5FFOC 1CR7A 1D1AA 1QEXA 3GXUA 4BCUA 2EFQA 4OZOA 3DECA 4O6JA 2CV1A 5H9SA 2R5YB 2X6YA 1QH7A 3CO7C 3L00A 3RGBA 1PNGA 4UYBA 2ZGQA 4LO8A 2P5BA 2KZVA 3K2ZA 4KT5C 3LDRA 3VL9A 2FDHA 5KXCA 4Q4V1 3IUOA 4P5OA 4FCYA 3MVPA 4CU8A 2L2OA 3W58A 4PI0A 4S2FA 4XJ9A 3HWJA 1DZRA 4TSVA 3SEPA 4N43B 4KNCA 4QPQA 3I56I 1DLLA 2LF8A 3HBKA 2EINH 1ZRCA 2VGDA 3I5UA 2ZBKA 3PFYA 1LE8B 3M3EA 2QF7A 1WLDA 5A3NA 1FOXA 4ITVA 4CU6A 1R091 2VBYA 1FOYA 4K40A 3F22A 1HXDA 1LOFA 4E7SA 2P3YA 2LH9A 3U1DA 1XMKA 2DVGA 1IZ3A 3PNAA 5GLWA 1LVAA 4A4AA 3ZR8X 3CUQA 3RPUA 3UV9A 4FAHA 3EQLF 2GP3A 2R7OA 1PM4A 4RAYA 2LDUA 1FMD2 1W9SA 1OKRA 5AC91 4HLXA 2WS93 1QNYA 3DLLF 2M8GX 5FMDA 3BPVA 2VM9A 1J1LA 4LORA 3RVHA 4H7MA 2EA2A 1FWZA 2W00A 3ST7A 2CQNA 2JRMA 1HB1A 4G9YA 1XYPA 3R60A 2JB4A 4GFBA 2L7FP 3H9GA 4CCNA 3DBRB 4X8NA 4IEPA 5LY2A 3G1LA 1TWHJ 5C4XJ 3ZX7A 5IFPA 2HH9A 1P4WA 4C2MJ 2OD5A 1YJ9I 5D8KB 1ZG5A 2X05A 3NJZA 1DU6A 4EV0A 5J96B 4KIFA 4BJ0A 1Q56A 1VB4A 2FMLA 5JMCA 4ATFA 3AKTA 2VUAA 1MZEA 4HW0A 4GH4C 5FMBA 1AHDP 1IG7A 1RC6A 4XC9A 3KF3A 3NWSA 4CA0A 3BWGA 3U78A 3ERED 5FD5A 3RYPA 1ULDA 1KITA 2M7BA 2XB5A 5JR3A 2RM23 4PDWB 3BB6A 1UOFA 4ZXKA 3A0KA 2PX9A 3AFKA 1UXXX 2VNGA 5FP7A 1E57A 3ZQ7A 4CYDA 2IGMA 2YU3A 3L2CA 2ZA9A 1HV0A 5CADA 3ON7A 3FUQA 3DU5A 5FBJA 4F92B 2OCEA 4N43A 4E7HA 3Q8BA 4PF5A 1V5GA 3MPBA 1IPSA 5JLXA 4HQMA 1S0GA 4LGWA 1LEMA 5FKKA 1S2KA 1X1AA 4NWWA 1NHAA 2DFBA 1PO11 2AHQA 2WWSA 2CS3A 3DU6A 1LB2A 2MG4A 3MICA 4ZTJA 4A5MA 5ILVA 3ZPLA 3MFAA 2JDZA 4LKEA 4L11A 2AYHA 2QNKA 3DEEA 3J81Z 2R4GA 1C3HA 2DMUA 2IC1A 5BV6A 3SITA 1RYYA 1O3RA 3HOZJ 1S0EA 2PJRB 4IQPA 2YZ4A 5FWEA 4BBRJ 3RZDJ 1WMDA 1XJAA 5FYBA 5C4WB 3O0VA 3IT8A 4AZZA 4XETA 3K3NA 5EQUA 3WE2A 3T1BA 3M3OA 3CMMA 4QX5A 3TOJA 2AZ5A 1TWGJ 4M6YA 5J8CA 2QQJA 2MH2A 3R61A 5DTDA 2JPBA 4I6ZA 4L2NA 3BI3A 1VALA 2DTRA 3HOYJ 1W5CC 1IS4A 2NOGA 3AL5A 2IEKA 3MIEA 3A22A 2IGOA 5F0CA 3P3NA 1HV1A 5TSWA 4DB5A 3ZXSA 1GWLA 4JV4A 1ND3C 3J7YJ 2C9AA 4GCVA 4A69C 4N4OB 4HXCA 2XGXA 2HXOA 2XLFA 4DRRA 1P7JA 2XBO1 2RR13 1Z7S1 1JUPA 1VBD3 4HZFA 4DOUA 1P7IA 2E2IJ 1D4VB 4UUSB 4BUPA 4O5VA 2Z2SB 4XRFA 2DN0A 1HB4A 4YVWB 2WAFA 1Q3EA 3S1NJ 1ODDA 1TMF3 3G4SI 2PHRA 1VBB3 3B6AA 3P3PA 3GFIA 3IP4B 2VZPA 3MIFA 2ZGNA 3UK9A 2Y6GA 2D93A 1D0HA 4V2VA 1VBE1 4QX7A 1M4WA 1W8HA 4A3JJ 1EV12 1W03A 2YBSA 2RNGA 1EUUA 5IWFA 5DM6F 2FMDA 2GN7A 4A6DA 2P5VA 1UYYA 3PMEA 4XFGA 2HZTA 1CF7A 3MIBA 4UFMA 4DRVA 3PLQA 4HVOA 3S5AA 1H2LA 4BKXA 1ZQ3P 4MFDA 1W36D 3MF9A 2RS52 2VXZA 3WDXA 1J75A 3H92A 4JGZB 3ZMNA 1OOPB 4QB2A 3BPSA 4CEYA 2EIMH 5FYYA 3BTZA 1RESA 1ZG1A 4E4HA 2RV9A 5A7OA 2WY7Q 3DXTA 2JG8C 3W5MA 1VBA2 1COV1 3GBWA 1LHVA 2VUDA 2UXNA 3OUHA 3POEA 4A3IJ 2IZWA 1W2AX 2XL7A 4O9GA 1OCZH 1GDTA 4AWXB 4KMFA 3X2QH 5A3LA 3FMQA 5JVTA 1BOBA 5A3PA 4Q8LA 1G9BA 1W8FA 2OW4A 3BVCA 3KP5A 5H9QA 4PUSA 2OZJA 1BI2A 3FKIJ 2EALA 2VJXA 2VR4A 1NQJA 4NRQA 3PJRA 5I0RA 1A5JA 1MDMB 3CJRB 2F5DA 3W2VA 3ACHA 1OKQA 1B35B 3J26N 2HWF1 4ESFA 3T4HB 2O8KA 3GALA 3VBOB 2EF6A 3IPVB 3DGTA 4CCKA 4BE0A 1ZM1A 3MDPA 2ZGPA 3TN92 4DJAA 1QJY3 3SCFA 4G9SB 4IO9F 3A01A 1JYXA 1W6PA 2D6LX 5ERIA 3K1PA 4B47A 3I2JA 3OPTA 1XDSA 4BXUA 1W1WE 1VBC3 4I76A 1L3LA 3T8RA 3OCPA 3OWTA 2HWC3 2W85A 2R7UA 5M3MJ 3TO6A 3VBRB 2C4XA 2DA7A 4B43A 4IZZA 3C7OA 3G1OA 3UT0A 2L9SA 2GH8A 4DZGA 1SLCA 1JU3A 4X6QB 3E1SA 1Z78A 4CDUC 4CPBD 1TEIA 1YOVB 3C7EA 3WQ1A 1JYVA 5DDJ1 3D0SA 4NPLA 5FZBA 1TVGA 5KAFC 2WA0A 2EA7A 3I4NJ 3VD5A 3DKYA 4YVSB 3LWFA 4A3DJ 5HLGA 5A3TA 4F52A 4NROA 4C2UA 3K4AA 5GAGJ 2W25A 3SH4A 1JHHA 3OYHA 1OJLA 1OURA 1W2OA 5A6QA 1UCRA 1NCRA 3PU3A 2VUMJ 3LEGA 2LSOA 4XF1A 5JHFA 4XHBA 3KWVA 4LKDA 4XBFA 1R1VA 2E9QA 3LF7A 3GCWA 4LUKA 4KWKA 3IB3A 4B4PA 4NE9A 4A42A 3OGVA 4WZFA 1VQ8I 1V0AA 2VT2A 2PLV3 4O3MA 4G6TB 4HX4A 4LUMA 2L4AA 2DURA 4HG6B 3TNQA 2BNNA 3K69A 3DUIA 3AMNA 5KAIC 4IHXA 3IAS2 4Q4X1 2BW8A 1WCUA 4JX0A 3KX2A 1SMVA 2FZ1A 3K1MA 4OAZA 2ZSIB 1U8BA 4JKLA 1M06G 3WY6A 4YW4A 3KYLA 1W90A 4AFCA 3THCA 1C0WA 4PBPA 2JUGA 1PZ9A 3J81K 1XNDA 3B94A 4MTDA 3AP4A 3WNLA 1QGPA 2QQ9A 3MW3A 5B1AH 2NVTJ 5CQGA 5B66C 1I6XA 1AHSA 4D7NA 3K9TA 2ICWG 4HN0A 3WUDA 5F27A 4N53A 2K46A 5FPLA 3AMMA 2E5NA 3I64A 1W6NB 2V9KA 3WNPA 4FTBA 2Q8KA 2ZXIA 3ZYFA 4P5YA 2VY0A 1HRV1 2G9ZA 2Q1FA 5EIYB 2R3SA 3OYMA 1B09A 2OZ6A 2ZMKA 5IATA 2O8OA 4BQOA 3ZXJA 5FUPA 4E2SA 2X1DA 4IX7A 1LEBA 2WZR2 5HBAA 3KGLA 1W0TA 2WLQA 1BYHA 3WNXA 4D5FA 1MVEA 3O8HA 1SPPA 3V64A 2ZNYA 4IEZA 3B7MA 1S2BA 3AYDA 1UD1A 3VDDA 2LUWA 2WBKA 5E17F 5FUNA 2M4GA 3LA7A 5CBLA 2ZHMA 3CESA 3OS1A 2V73A 1R49A 1VBB2 1JKPC 2ZX4A 3OS2A 3DYMA 3AYCA 1VQ4I 4JKKA 1OHFA 3TGNA 2F6BA 1P4AA 1SEFA