2BGCA

Prfa-g145s, a constitutive active mutant of the transcriptional regulator in l.monocytogenes
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
235
structure length
234
Chain Sequence
b'AQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICSQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLAPATWGKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRFA
publication title The Mutation G145S in Prfa, a Key Virulence Regulator of Listeria Monocytogenes, Increases DNA-Binding Affinity by Stabilizing the Hth Motif
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transcription
total genus 77
structure length 234
sequence length 235
chains with identical sequence B, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2004-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2bgcA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bgcA01
3IHUA 5FB2A 1TQMA 2RDPA 5BQTA 1IF1A 1ZZCA 4XBFA 5BMZA 2HEOA 1E2XA 1VP6A 5J6XA 2HDCA 2FXAA 1L3JA 3HSEA 1EH6A 4YIIA 4OIRF 4J1XA 2HQRA 3TOBA 1P2FA 3H1YA 4M9SA 1HBXG 3IDBB 3EETA 4H7LA 4A0YA 2K4JA 3RYKA 4HAMA 3W6JB 4AQ6A 4L0YB 5AIPA 3F3XA 1ZH5A 4CDGA 4Y15A 5JI6A 4UNOA 3GFIA 3N97A 3FM5A 4KUMA 3KFWX 1IPJA 4KFCA 2D5HA 4L2NA 3E6DA 2MA3A 5TRDA 3WGHA 1ZYRF 1GXPA 1K7AA 1RI7A 2EV6A 5HDGA 5HLIA 4ZYEA 1QXRA 2VOOA 1O7LA 3Q9VA 3J81Z 3CO6C 1BI3A 2KRFA 3UKVA 1RUOA 5LGNA 4ENJA 3ZMZA 5BPDA 3WW4A 1I27A 3T5XA 3F8MA 1HKQA 2Y0MA 4EM2A 1MGTA 3BROA 4OLLA 5DCMA 3BZ6A 4OMZA 5KHKA 3RNSA 1ZLJA 3DN7A 2E7XA 3CUOA 4MTDA 4HQEA 4RB3C 4KN4X 4XFHA 2AS5F 2VONA 2OZ6A 1EH8A 2PMHA 2H09A 2DO7A 1YLFA 1KQ8A 3L9FA 3RIRA 3H1MA 2FEZA 4HVQA 2PG4A 3M7GA 2K27A 4Z2YA 2HJIA 2ZXJA 2OZJA 4UXNA 1SEFA 4XF4A 1K6OA 3CUQC 1W4MA 4IEWA 1U5TB 1ZRDA 1GQHA 3LAJA 5K8SA 2HFHA 2IVMA 3TDUC 3I59B 4G6QA 3V8LA 2RNJA 4AIKA 2MH2A 3VHRA 3J80K 4JV4A 3P9CA 3RTRA 5FGMA 2O1QA 2PHDA 4D7TA 1BOAA 4MGYE 4L5IA 2OPKA 5FLJA 4O9EA 2OQRA 3H92A 4EJUA 2IW5A 2KIUA 3CEWA 3GZ5A 3GO5A 2YX7A 4RB2C 3HYIA 2RGVA 4Y17A 1O3SA 4ESFA 5E1XA 2CW0F 3E5QA 4PJYA 1FZPB 2DQLA 3ZDSA 2DI3A 5D8KB 1CAWA 4HMZA 5L3CA 4WCGA 3TNPB 4M9XA 2ETEA 4QX5A 3I53A 1J1LA 4WF2A 4XLNF 4U0YA 3SXWA 2XAQA 3MZYA 3C3WA 3VEPA 3J7AO 1DP7P 2X0LA 3M9AA 4WXDA 2XAGA 1S6LA 3V4GA 3SMHA 3L7WA 4IEXA 2KIFA 3VB2A 4IHSA 1LVAA 1Z6RA 1QO0D 5LHGA 2OU2A 5K5OA 3FF5A 2KIMA 3KP4A 1P4AA 2NNNA 2PQ8A 4HDUA 5D6EA 2QYOA 1DZTA 1L0OC 3FXQA 3JTHA 3WTUC 4KDPA 5ILUA 2XLFA 5LHHA 5ICGA 2V6CA 2X4HA 3U2RA 1F4KA 4KIFA 3F21A 5IT9K 5HS7A 1S7OA 2FBIA 5FD6A 1ZAOA 4LK0F 2H27A 2UYAA 1J3QA 4OIPF 2D93A 4MV2A 2PBIA 4A12A 1Q1HA 1Z1DA 4CZZA 2ET1A 3HHGA 3QU6A 1V3FA 1SD4A 1XDSA 2FBHA 2JSCA 2VBZA 3P7NA 2O6GE 1O57A 2EA7A 2OBPA 4E2SA 2QJVA 1RNLA 2E1NA 1T98A 4PDKA 1JE8A 1S29A 4MEYF 2L3DA 2PQQA 2VECA 3ZMTA 4LUKA 2QBYB 5BY5A 2WTEA 4BQAA 3EDPA 1IXRC 1FY7A 2K86A 4LK1F 4XF1A 4U88A 3I4PA 3E6BA 3KCCA 3WGIA 2XIGA 4YARA 3ABTA 5ED4A 2EVXA 1Z9CA 5AVPA 1OR7A 3DF8A 2G7HA 2M8EA 2V1XA 1ZG5A 4MQVA 1SFXA 1UPIA 3R0AA 4P5OA 1UCXA 3OOPA 3RI4A 5DYMA 5L3DA 1XSDA 4P96A 1Q43A 3O3KA 1T39A 3GWZA 3NKTA 5JCTA 5I0UA 5EEGA 1PM7A 3ES4A 2PJPA 5J48A 1BI2A 1E17A 4HV6A 4EWDA 4Q0QA 2ESNA 3KP5A 1IPKA 3I71A 2NAZA 1OMIA 1TW3A 2ZCWA 1QGPA 1KU7A 4IXAA 3J81K 2KJBA 1BI0A 1WGPA 3DEUA 5DCFA 2ZNZA 3O2PE 2Q2EA 2QVSB 2K02A 2DPDA 1JHHA 1YFXA 3IC7A 1ZHFA 1FOKA 5L3GA 3HSRA 1NE6A 4IPAA 2RQPA 2NNYA 3FMRA 5D6FA 3EBRA 1WQ2A 4KNYA 3ABUA 3HRUA 1IW7F 3LAPA 5D5UB 1FI2A 2Y75A 1X8EA 3W6KB 2YU3A 2GAUA 3GZ6A 4E2GA 1YFUA 1OPCA 1EPZA 2XLGA 3I5UA 1OFNA 1HSTA 1W7PD 2HYFA 5D1IA 5T3NA 3HTUA 4YG2F 3GXOA 3FWEA 2UY9A 2WFPA 1B1BA 4BHPA 4MQ9F 4G6DA 3ROUA 1NZCA 2Z2SB 4UVBA 5C6CA 2CGPA 1KQ0A 3LSTA 5FPXA 3LAGA 4R8HA 2DLLA 4L9JA 3EJKA 1LEAA 2QENA 2Q0AA 4MX3A 1U8RA 2IXIA 5L3FA 2RN7A 4HLYA 3T8RA 2VBXA 4KMUX 2GC1A 2DU9A 1VR3A 5HI0A 3SHFA 2ET7A 1FC3A 3FM3A 1YIOA 2V79A 3L2HA 2VE9A 3SQNA 3BOQA 2MD5A 4RGSA 3P9IA 3BJOA 4N9IA 4WBBA 4UUVA 3KP7A 3CJNA 1LQ1A 3VFZA 1KYWA 1UCRA 4PCQA 1CGPA 3MZHA 2Z5UA 1YS7A 5BV6A 3ZQ7A 1FWZA 5CLSA 3H7YA 1O5LA 2HR3A 1TTYA 3ELNA 4RAZA 4D7SA 4EWAA 2W25A 1OYWA 3RKWA 2MPFA 4OIOF 1EH7A 2V9VA 4QGLA 5L3BA 4HN1A 5BPIA 2JPCA 3HHHA 1MJAA 5HDKA 3IBMA 1U5TA 3KEQA 1O3QA 3FJSA 2VC0A 1TBXA 1HW1A 3I59A 1IXCA 2FQ3A 3KEOA 3QPHA 4ZH4F 4EQQA 3DPLC 2OYZA 1YS6A 2BYVE 3WU0A 3OGJA 4J1WA 2EFQA 3WW2A 3BDDA 4HF0A 5FLIA 3WTXC 2YR2A 1R00A 2IP2A 2DAOA 2O8XA 5CYVA 1R58A 4KN7X 3IDCB 4RB0A 1YTYA 4YFNF 2M1BA 2HWVA 4QGNA 2ETHA 4IEUA 3FZ3A 5H6RA 2GA1A 3LA3A 1GQGA 2ACJA 4LUMA 4HN0A 1I6XA 3ISPA 1C0WA 2O03A 2OA4A 5C8WA 2QVOA 1B9NA 4H0EA 4YFXF 4HSJA 2Z69A 4CXFA 1FYMA 1R5HA 3DXJF 5I93A 2MH9A 3QPTA 3KP3A 1J3RA 1R7JA 3I54A 1O7FA 3SHRA 4HBLA 4BHCA 3NEUA 1TNSA 2HOEA 4ORFA 4CHUA 3L09A 3ML6A 1H9TA 1U2WA 3BB6A 4O9GA 2ATFA 4UVCA 2L02A 4S04A 1FT9A 2GH2A 5DUIA 4Q0VA 1J75A 3V7RA 2ZFWA 1LJ9A 1R1UA 1UD1A 4HSLA 5J3UA 1FPQA 5KK1A 3GX4X 2B9UA 3S2WA 1P4WA 4IESA 3DKWA 3D0JA 1XGSA 5KHJA 2QM3A 5K1YA 4UV9A 5FLHA 1U6GA 4EJVA 3RYRA 4LG0B 1X82A 2CFXA 1HSJA 3PFIA 5D5XB 4ESBA 4EROA 2EFPA 2AXLA 3M1EA 3TKYA 3HRTA 2EA2A 3H3ZA 2MNGA 1PDNC 1BIAA 2F5CA 3ZPLA 4WXCA 4G8XA 3TQNA 2N7GA 3EQLF 1EV7A 1ODDA 3KMHA 2DK8A 3U11A 1YUDA 1AOYA 4RAYA 4O3MA 2CAUA 2Q4SA 3GW2A 4FX4A 2IXLA 1WLTA 1F5TA 1B4AA 2MBFA 2HYGD 1FSEA 2QBYA 2Q8KA 1OYYA 4IETA 1DUXC 2O0YA 4KYWA 2BGCA 4Q4ZF 2WWYA 3KGLA 4IEZA 3FHIB 4HX4A 3GYHX 3FXUA 3CO2A 2QLZA 3KP6A 1ZRFA 5E17F 1LDKB 1OD5A 1B9MA 4JK1X 5DD4A 2A5YB 3Q9SA 4G94A 2HQNA 3JSPA 3JW4A 4QMAA 2P4WA 5FCCA 4UVAA 3LOIA 3IRRA 1VTNC 1QWRA 1EP0A 1P92A 3GFLA 3N4MA 1LDJA 1O5UA 1OKRA 2EV5A 4BNCA 5CVJA 4KWJA 3KZZA 1FYLA 4KU7A 3WTYC 4PGHA 2WC2A 4U0VA 4GYIA 5JAXA 5CVVA 5HDNA 1ZN2A 5LEKA 4XFFA 2F5FA 4MTEA 2E1CA 2LKPA 2KXLA 2CSOA 3ZN0A 3I0TA 4AIJA 1IXSB 2GC3A 3E3VA 2ZMEA 1XN7A 5J8CA 2QWWA 3ST7A 1W7PA 4FT8A 4UHTA 4I0AA 2MHFA 4BH9A 2XRNA 4ZYHA 2BNNA 4L9TA 4AVBA 1WWXA 2P5KA 3CUQB 3CLPA 4XFBA 5K5RA 4IF4A 4KA4A 2XL7A 1ZZBA 2ZO4A 3C18A 2XVCA 3HOSA 2F2EA 1T38A 2A68F 3PNAA 2HZTA 4XFGA 5LLQA 2HKXA 1R23A 1CAVB 3ZP5A 3ECHA 4HLXA 2QCSB 2UXNA 3MFKA 2QZ8A 3R6SA 1SD7A 4QLCU 2HTSA 1JXSA 2TDXA 3IWZA 2O3FA 5BUVA 1FBQA 1XSVA 5E1WA 1RTVA 3G7DA 3H8UA 2CQKA 3H7JA 3UKNA 4GGGA 2PFBA 2STWA 3QRFF 2YX4A 5HS8A 4IEQA 1HXDA 2KKOA 4TLFA 3E97A 1QBJA 3KE2A 2F4PA 4I0BA 3I7DA 3G3ZA 5FPZA 3UKTA 2P7VB 3QACA 3TO7A 4BAYA 1HKSA 4META 1IN8A 4R1HA 4HF2A 4HLTA 4OMYA 1J9IA 4I02A 2FQPA 3TDZC 1S3JA 4MHGA 5I0TA 5I0RA 5JSPA 2K0GA 3CLOA 2DTRA 3ZMUA 2OAZA 2ELHA 5LGTA 1R22A 2FF4A 2G9WA 5DEQA 4FX0A 2BNOA 3K69A 3BJAA 3EHKA 1O4TA 4HX7A 5H20A 1D3YA 5D8LB 4HA8A 3WW1A 2R7DA 3LA7A 4UXAA 1IRFA 3WU1B 4HOBA 2Q30A 1SMTA 4EM1A 4GO1A 1IZ1A 3DV8A 3VOEA 1KYZA 1S7AA 4GXOA 4D0PA 3FXRA 2FA5A 3RKYA 1H9GA 3BPVA 1J7KA 2MC3A 4I09A 1PP7U 4B09A 4KL1A 1KU9A 4XSZF 1OYIA 1KA8A 5HVQC 5BXXA 1QZZA 4IVNA 4L0ZB 4PZJA 2IC1A 4U7BA 3CTAA 3KLOA 1ZZ7A 2UYBA 2XAFA 2QUFA 4HZFA 4OINF 1IN5A 3DFGA 4AWXB 4K8FA 3L00A 2XL9A 3GFJA 3DPTA 1J59A 3BJ6A 4AIHA 1EY2A 4A0XA 4RGUA 4EJWA 4IERA 5I8YA 1U78A 2M87A 3F8NA 5LRRA 4OFGA 1O3TA 2A07F 1ON1A 3LA2A 4O5VA 1IAWA 2M30A 4HBNA 2VE8A 3ES1A 1XB4A 1QNTA 3ACLA 4MEXF 1JUHA 2BEOA 2P5LC 4RGRA 3CF6E 3K1MA 2Z3YA 4NQWA 1ZRRA 2E9QA 2HTJA 1T2KA 1L3LA 2IXKA 2ZMEB 4LLGF 1H1IA 1W7PB 5FLXZ 2VN2A 3TGNA 4XSXF 4MGRA 1HKTA 3ZMDA 5KHIA 1O3RA 1QQIA 1EYBA 3DQVC 1Z6TA 1AWCA 3C3VA 2LF8A 3JAMZ 4M71A 2ESHA 2ZNYA 1ZGAA 3FX3A 3WTZA 3V7SA 4G7ZF 2Q0OA 3OCPA 2NS0A 3NVCA 1DPRA 2LDUA 2DCTA 5DD8A 4EJOA 3BU7A 2L54A 4LMYA 1DGRA 2C0ZA 1KQ9A 2MLKA 1DDNA 5LGUA 2IA1A 1T0FA 4HDVA 1YHFA 3LWFA 1PMIA 1R1TA 2XUBA 3SFZA 4IRHA 4AVAA 1TQIA 2P7CB 2W57A 2CV6A 4M6YA 2BE5F 4A2UA 3H50A 1MJBA 4GYGA 2IJLA 4K2EA 4LG0A 4M6XA 5D5VB 3FFQA 2VPVA 2B8MA 2STTA 1I5ZA 2BNMA 1NHAA 3C7JA 5E18F 1K78B 5FO5A 1ZRCA 4HYEA 1NXMA 4NHJA 1PUEE 2PYTA 3MYXA 4A5MA 1YG2A 3OD0A 1FBUA 3GVAA 1SD5A 3D82A 2JZYA 1LEBA 1SFEA 5EZWA 5IT3A 1TNTA 2W24A 4RD7A 3PQJA 1G3TA 2PLYA 3FE5A 4Q29A 3S0MA 4M72A 3AAFA 3OV8A 1XE7A 5E16A 1OI6A 1SMYF 5K5QA 3T1BA 2GQQA 4PGGA 2QNKA 5F1RA 5KBFA 5HOOA 4M74A 2NRAC 3QAHA 4Q0UA 2IA0A 3EYIA 4CYDA 1W5SA 4RS8A 5CADA 2IXHA 1DZRA 4L9VA 4LLOA 4FAHA 4B8XA 1H0MA 1CAUB 3FZVA 3H9AA 1I1SA 2QQAA 5JR7B 2UWMA 5J7MA 2R3SA 5FQ0B 1IUYA 2ISYA 1UHWA 3CO7C 1ONVA 2FSWA 2QQ9A 2IRFG 4WX9A 2L01A 3D0SA 3F6VA 2OZUA 3SCGA 4KWLA 4BIFA 5CVRA 3WE2A 4G7HF 5ICCA 4ON0A 2A69F 1YFWA 1B59A 1XGOA 3GUDA 3WTTC 1IN7A 4ZZLA 4XF3A 2BV6A 2XGXA 1V4RA 4ASNA 2PHLA 2D1VA 1MKMA 3R0JA 3CUQA 4X6RB 1CX4A 2UXXA 3T8TA 1UB9A 5FDBA 4ETSA 3ECOA 3NRVA 1ZVFA 2FNPA 4XF9A 2CG4A 5ILVA 5CJ9A 1XCBA 3Q5FA 1ON2A 3HT1A 3U0ZA 4U7DA 5FFXA 1FSHA 4LLLA 3PVBB 2HS5A 3HT2A 2IT0A 3K2ZA 2FRHA 3K0LA 3LFKA 1NE4A 1ZG3A 4EVIA 2COMA 3WTVC 5E1RA 1GXQA 1D8KA 2PMUA 4P9GA 3PQKA 1CAVA 1JGSA 2RC4A 3M8EA 1XSXA 4B29A 1U3EM 2OA2A 3E5XA 3BP8A 1K79A 1LNWA 3IKTA 4LGWA 2D1HA 3MEXA 4LJZF 2YSRA 1I1GA 2GC0A 3GEZA 1FXZA 2GU9A 3IKVA 3RDIA 5I8SA 1S8NA 2GC2A 2V1DA 1YW7A 1YYVA 4LD5A 4GULA 4EMSA 2XV4S 3KLNA 1KU2A 4P9FA 1FP1D 2EV0A 1F9NA 1Z7UA 3TNQA 3SCFA 1BN5A 1XDUA 3EQEA 2VODA 5CU1A 4U0WA 1D5VA 5LRSA 5BS6A 4IEOA 1IRGA 4QGMA 2PAKA 2FU4A 3MQ0A 4EWEA 3FHZA 4JBAA 1ZLKA 1UW8A 5JSOA 1Y3TA 3MPBA 1BC7C 4HF1A 1TW2A 5AIQA 4N9HA 2ZJ2A 5L3EA 3S7IA 2F5DA 3LWCA 3ERED 2B0LA 5FLXK 3GFMA 5EFUA 2CWEA 3HSFA 1ZARA 4QM9A 2PA7A 5E8GA 1FNNA 2P5VA 1SAXA 5DDGA 2FNAA 4HX8A 4BYYA 5ILSA 4S05A 3ZN1A 3JAMK 3RZZA 3TO6A 5JFRA 4YYOA 2R7FA 5I8TA 4WXHA 2ISZA 3ZMVA 1SFUA 1SD6A 3SZPA 4QM8A 3D5LA 2QDRA 1SFNA 2L4MA 4ZU7A 3F8CA 4Q0SA 3H3UA 2HKOA 4CO8A 2P17A 4Z07A 5FFZA 3HRMA 1X8MA 2EAAA 5A2QZ 3V8JA 5LEJA 1ZGJA 2FBKA 3LQRA 2IXJA 3ETQA 2B5HA 1XMAA 1CF7B 3CL1A 1XCVA 1WSUA 5E8IA 1RZ4A 2IPQX 3KETA 3M70A 1BC8C 3NL1A 2JT1A 1DPUA 3HQXA 3K9TA 1XE8A 3GF2A 2XAJA 4BHBA 1U5TC 3BY6A 4YIFA 3EYYA 4ENKA 1LDDA 4MZUA 5E1ZB 2FMLA 1IN4A 2P6SA 1R36A 1R5GA 1F1ZA 4HV5A 3I64A 3FMQA 4KWKA 5HLGA 2EFWA 4LFUA 2EA4A 4AD9A 4OU0A 4XF0A 4NB5A 1P4XA 3QOPA 3WW3A 2W85A 4G9YA 3FMSA 2OD5A 4JTOA 1HQCA 4UBHA 1J2XA 3QP6A 3K1NA 4I3PA 1MDMB 1U12A 4KICA 2FOKA 4ZU5A 1XGNA 2DBBA 2XHKA 3G73A 3I58A 3IIAA 4X6QB 5ICFA 3RKXA 1YFYA 4ZU4A 1PP8F 3VODA 4HVOA 5JHUA 1MJ9A 2CYYA 3KZYA 1R1VA 2V09A 5EEHA 3GYDA 2UZKA 4I01A 1KU3A 5DV5A 5F64A 4Y13A 5H6QA 4GCVA 4EGZA 4ENNA 2LF7A 2FMYA 2J5OA 2HGCA 4R52A 4YRDA 2WV0A 5FD5A 3S7EA 3IRQA 2EJRA 4XFAA 3JTGA 4M73A 1XRUA 1IN6A 2LNBA 3IL2A 2PTMA 3V8KA 1ULYA 3B73A 2JTVA 3O6BB 2XAHA 3MAJA 1CAXB 1QZYA 4LEJA 3GLXA 4I7HA 5KHGA 4DQ2A 1FP2A 2YPRA 3NSTA 4AVCA 5LHIA 1D8JA 2EK5A 2DPUA 1QPMA 3WE3A 1K78A 1BI1A 4I98B 2QQBA 4A0ZA 3MWMA 2DFIA 5ERIA 3WTSC 1J58A 2RV8A 1YWKA 1XD7A 4AQ2A 2PFWA 1Y0UA 3CDHA 4EGYA 4F7ZA 2DK5A 4LA2A 3E5UA 4XFIA 4L18B 1MZBA 2GXBA 4P9UA 2DW4A 1HW5A 3ULQB 4IEYA 3USSA 5JVTA 4CGZA 3U10A 2D45A 4ZYDA 5F6FA 5HLHA 3NJZA 2VOPA 4Q5SF 2K9ZA 4EM0B 4G7OF 2EFOA 4OIQF 4UV8A 1ZG1A 4YSFA 5BOXA 3B02A 4FAGA 2VC1A 1YFHA 3TO9A 1V70A 1Y9QA 4I2OA 4MH0E 4Z82A 1KGSA 1ZZ9A 2D5FA 1UFMA 1SQ4A 3E6MA 2MLGA 1CAUA 2GZWA 2Z33A 2Q1ZB 4MGKE 3F8FA 1RIOH 2A6HF 4PIXA 2ZKZA 1J0RA 2FE3A 2RVCA 5FQ0A 4HW0A 4WK8F 4CICA 5AONA 3MCZA 3MDPA 1G4DA 3BCWA 2UY8A 1FBSA 3M8FA 5I91A 4HVRA 5TJJA 3U9GA 3RPQA 5DUKA 4KIBA 3HIFA 2PAEA 3R60A 5D5WB 3SZTA 4AVPA 1UHMA 5DCMB 1ZREA 4JTNA 1UIKA 4PIYA 4L11A 4WWCA 2JPBA 5I0SA 4XFCA 2H6CA 3R4KA 1BM9A 2PN6A 5CVUA 4YFKF 4XLPF 1YQAA 4Q0PA 3BWGA 2VXZA 1USSA 3PLQA 4ONUA 4QXKA 4E2QA 3C1DA 4FHTA 2PEXA 4A5NA 1WI9A 1WRJA 1RUNA 3HRSA 3ZMSA 3LZZA 3NW4A 4PIZA 3WODF 1G3WA 1Z91A 2P6TA 1JHFA 4AXOA 1TLHB 3RPUA 3NQOA 2Z9OA 4JQFA 3OTFA 2DQRA 3HTSB 1DGWA 3WGGA 2NYXA 4DINB 3WTWC 1BJAA 5A2QK 2GIVA 4ENMA 5JR3A 2JRTA 3R61A 4HQMA 1REPC 6PAXA 1WKMA 3JZVA 1MD0A 3ELKA 2C6YA 1B6AA 4Q48A 4LLNA 2Y0OA 2GWRA 2M45A 1QXJA 1LR5A 1YLLA 5ICEA 4IEVA 1ZX5A 1BIBA 2GA2A 2A61A 3V7CA 1CAWB 4P55A 4L5JA 4MNUA 2K4BA 4DNCA 4A6DA 1ZZ6A 4MUVA 2XROA 3O14A 2ZKLA 2BBYA 3QU3A 3F23A 1FYKA 4WZCA 4LA3A 5J8FA 4YNIA 2XLAA 2VQAA 2D40A 4EV0A 1P6RA 2PAMA 3HOTA 5KHHA 2VBYA 3QP5A 4QWQA 4LTAA 2OQGA 4NVPA 4IJAA 2V1UA 1VJ2A 4KT5C 2W84A 1ZNPA 1STZA 1Z05A 4L9NA 1LRHA 3DP7A 4IRIA 4IRGA 4KIGA 4Q47A 1RC6A 2LSOA 2XASA 1A04A 4E70A 5E20A 1J3PA 5HS9A 2M5WA 3JSOA 3WG9A 4XRFA 3KGZA 2VT2A 3KP2A 3H1WA 3IWFA 1H1MA 2K7LA 5BPXA 5LBQA 3K1PA 2O8QA 1G6NA 3T0YA 3SCHA 2XKOA 3J80Z 1HW2A 2A3SA 2J5PA 3BALA 3RJPA 2IA2A 1Q3EA 1GVJA 4MGZE 3P9KA 2KJCA 1CF7A 2RKHA 3M3IA 4ZYGA 1NYWA 4MGIE 3REOA 1ZZ8A 2H94A 1GHCA 4ESJA 2G7UA 1RGSA 2CAVA 4JVAA 4IHTA 4A6EA 4FBFA 3KSCA 2L4AA 1WA4A 4XEZA 2EWNA 2Y48A 4OOIA 3RYPA 2P8TA 4RB1A 4KMFA 1X3UA 3DL3A 1G3SA 2GXGA 3LQQA 3EO6A 4LULA 1YW8A 4O6JA 1LKNA 4XETA 5KVRA 3F22A 4EJTA 1XGMA 2O61A 2XKPA 3TOAA 1T6SA 4WVZA 2EB7A 3F6OA 4ZZDA 2VBWA 1X7NA 2A6EF 3GBFA 1W5TA 1MDMA 3L2CA 3F8BA 1QY4A 3OF1A 2DT5A 5CVIA 4LB5A 5IT9Z 1YW9A 5JSRA 5D4RA 2F5EA 1XMKA 1YO5C 2H0VA 3COAC 2PI0A 3HUGA 3BPZA 2EFNA 1RL3A 4N0BA 1TQPA 2IXCA 3EUHA 4RGXA 1FLIA 3U1DA 1J5YA 4R79A 2VT3A 5D4SA 3SXYA 3CJXA 4UBGA 4LB6B 2Z99A 4BXUA 4IEPA 1Q5OA 2D2WA 1TQ5A 4M9ZA 2H6BA 3F72A 1FX7A 1CAXA 2I45A 4F8AA 1BBYA 2ZBKA 2ADUA 2CO5A 3E6CC 1UIJA 1USTA 3BPXA 1LB2A 4TV7A 2E7WA 4KU8A 1G3YA
chains in the Genus database with same CATH superfamily
1C8M2 3J26N 5FWEA 2WY8Q 1W05A 3ZLIA 4XJWA 1H9WA 1ZZCA 1V6KA 4XBFA 1E2XA 1C1FA 3GTPJ 4YIIA 1QJEA 5HCBA 4IHVA 1UG2A 5C9AB 5GPCA 1T95A 2K4JA 4FI9A 3IAQA 1FTZA 2B42B 4HAMA 1DGRN 3W6JB 3FBYA 5FYSA 1T56A 1XNTA 3EB7A 4CDGA 1U5IA 4IUGA 5JI6A 4A93J 4PDWB 1F4AA 5HODA 2O9LA 2X5IB 1RUC3 1DCSA 3L2RA 5TRDA 2JVHA 1GXPA 1K7AA 2EV6A 5HDGA 2Z1DA 3VLBB 3QWLA 4DZPA 2C26A 5DG2A 3Q9VA 3CO6C 1UOBA 2MFZA 2I07B 2KRFA 3UKVA 5LGNA 4SBVA 5DZGA 3WW4A 1AR93 1CPMA 5CFDC 2R7RA 5IVEA 5E89A 3JD72 1ZTRA 5A6QA 5DN2A 2DUPA 1UMZA 4FXKB 4E7HA 3ZKYA 1Y6IA 2E7XA 2WO1A 2H1KA 3AXEA 1FAYA 1GV5A 4MTDA 4HQEA 2WSUA 4QQHA 1JS9A 2OZ6A 1EH8A 1GKBA 2H09A 2WZR2 3FLTA 1F36A 4HVQA 2PG4A 2WFF1 1IZ3A 2LREA 4D5FA 1R092 4PBPA 1RR7A 3SQOA 1K6OA 3CUQC 3CCVI 4INDA 4IEWA 2XRLA 1GQHA 2O0OA 3OOUA 4NC6A 5K8SA 4Q4W1 5HPOA 2RNJA 4AIKA 3CCRI 2VPLA 3IT8A 3P9CA 5IVYA 2PHDA 2DVAA 2WS91 2Y31A 5KXCA 4O9EA 3V0AA 4EJUA 5FZ8A 1B72B 2YX7A 2ARXA 3HYIA 5F3IA 5JMCA 1IS4A 1O3SA 3QH6A 3ZR6A 5CG9A 2VVFA 1LE8B 2VKVA 2E36A 2K40A 3A1YA 3E5QA 4PJYA 4AF9A 3G1MA 5GJ6A 2V4AA 3SYTA 4HANA 4WM7C 2X1EA 4QX5A 1ONAA 2ECCA 1XS9A 4U0YA 3SXWA 3MZYA 2JA2A 3AVSA 3CCYA 5FYBA 3J7AO 1T33A 2XAGA 3V4GA 3CZ6A 2Y6KA 2M4GA 1LVAA 1Z6RA 3MF6A 2P0WA 5LHGA 5K5OA 1H88C 5FPBA 3FF5A 1R1A1 3JBG3 3KB5A 3KIOA 1MIJA 1SACA 5D6EA 1DZTA 5BNGA 1TL8A 3ZN6B 4CDXA 3JTHA 5BNOA 4XL9A 1SPPB 2QF7A 5ILUA 5A3MA 5EYXA 2X4HA 4L9BA 1SMVA 1JU3A 1NQDA 3F21A 5IT9K 4K7JA 2H27A 3U37A 3AMQA 1YJKA 3JRHA 3HN1A 3H8RA 5FXWA 4A12A 4XUNA 1Z1DA 4IE0A 1K83J 4CZZA 5IAVA 4D69A 3OBRA 1RUE2 2EXIA 3MKZA 3MMYB 5KXEA 2OVUA 1K6YA 4P5HA 1QDOA 2G4IA 5F6LB 1RNLA 5GAGJ 2QQVA 4DRVA 3WNMA 4XORA 1VBB3 2VECA 3Q0VA 3ZMTA 1NA1B 2V73A 5EF6A 5BY5A 3NV1A 3EDPA 3O1VA 3VGIA 1LHUA 4YVWC 2MSYA 4TTGA 5A3TA 2XSDC 1JZ8A 3TW7A 3KCCA 3AXDA 3VZOA 2DWRA 4FSJA 2EVXA 1Z9CA 1QGLA 3PIGA 3ITQA 1JODA 5GTHC 1W8NA 2L7KA 2V1XA 5IVCA 3R4SA 4MQVA 2JDPA 1C1LA 4XURA 2K9NA 3K3OA 4E7JA 3H5RA 5DYMA 5L3DA 4B4QA 2CFOA 3MLKA 2PQSA 4AVZA 1Q43A 1LVKA 3ZYGA 1T39A 1MH3A 2R5YA 4COYA 2DXIA 5I0UA 2A3WA 4P1WA 1PM7A 3ES4A 4B1MA 3KP5A 2RS52 4AEDB 2IS4A 1OMIA 3ONQA 5ACA3 1WGPA 2BVLA 3HMYA 1V00A 2VZOA 1RINA 3O2PE 4A3KJ 1DQ0A 4Q4V1 4GH4B 4QKFA 1JHHA 3IC7A 1BR4A 1RUD1 1ZHFA 1YJLA 2HWF1 4JQTA 5L3GA 2HVQA 1NE6A 2WNUA 4AYUA 5LD2C 1JU4A 3EBRA 1LU1A 2LRPA 1WJDA 2JUCA 3ABUA 1YI7A 3LAPA 1GU3A 4E6KG 4LE3A 1R6RA 1BEV2 2Y75A 4XZUG 4OZXA 3W6KB 3DYOA 4NPRA 2P3KA 1W8FA 5F0FA 1UAIA 1WBLA 2VMGA 1P7IA 3OYAA 2Y9YA 2G9FA 4O65A 3MEPA 4GWJA 5T3NA 5J1YA 3HTUA 4HL0A 3GXOA 4YFWA 2BHYA 5C9AA 2KMUA 2XB0X 4BHPA 2OPWA 5JOXA 1W8OA 2DFEA 4BISA 2Z2SB 3OYFA 1BQPA 2CGPA 1KQ0A 4UY8I 1RUF2 4J6GA 3N9OA 1H8VA 4PDWA 4MX3A 3GBGA 5L3FA 2RN7A 3SJMA 2X5IA 2D3SA 3T8RA 4KMUX 1NCQC 2DU9A 5HI0A 2WO7A 4A7YA 2VZRA 3X2QH 4CU8A 4S0HB 1XX5A 5FOBB 4GB32 3A0NA 3BU0A 1X2NA 2V79A 3L2HA 2JA8J 4XOPA 4F3QA 2DA1A 4RGSA 2XVKA 4Z8BA 2QCOA 3BJOA 3RZKA 2YY1A 4XOGA 1ETOA 1KYWA 4FASD 1VQ5I 1YS7A 5BV6A 3URFA 3ZQ7A 4CUGA 3BZCA 4XJAA 3H7YA 3K4MA 3MKYB 1MNDA 3LSIA 1LHWA 2X6OA 2HR3A 2R062 1VBC1 2NS7A 4EWAA 3RKWA 2MPFA 4AW7A 4AYBN 4OIOF 1EH7A 2HWE2 1WJCA 1AJOA 5F5CA 1OA2A 5L3BA 3J7AY 4FO9A 3FBIB 4IX7A 3AKQA 1ENSA 2A3XA 3KEQA 3FJSA 3ZQHA 1ND3C 1IXCA 5E6HA 1WCQA 2DFFA 4UFMA 3DPLC 1YS6A 3O7OA 3EXUA 3WDVA 2EFQA 2NLRA 1B72A 1JHNA 2AH2A 2DAOA 4BOWA 3NV3A 4FPYA 3BG3A 3UT0A 4NQWB 1LE8A 4LBOA 4FPHA 5FJKA 2ETHA 2DF7A 3PIJA 4IEUA 5H9SA 3FZ3A 2YDEA 2GA1A 3LA3A 2ACJA 4LUMA 3GF6A 4HN0A 3ISPA 4XPVA 4A3ZA 2O03A 2OA4A 1B9NA 2JIGA 1JZ4A 4H0EA 2XF6A 3KZ4C 4A7KA 4UFHA 5FUNA 3DYPA 4DZJA 1R5HA 4IV1C 1J84A 1YJ9I 5FUIA 3W58A 2ZXIA 2F6BA 3PUSA 2FCUA 2FDJA 2NVUB 1H9TA 3BB6A 1CJDA 4UVCA 2DODA 4XDQA 5T50A 5A1AA 2GH2A 1U9NA 4XQDA 3GZTB 4Q0VA 1J75A 1KITA 1LJ9A 3ZN6A 1UD1A 4I76A 1NG7A 1SPPA 4GKYA 3H9GA 4PBOA 4QPGB 5FLHA 1Q8PA 3D4KA 4XONA 2BDRA 4ZC3A 1X82A 1MMNA 4A44A 1TWCJ 5AFEA 3RSNA 4IEJA 2KHMA 1HSJA 2UWCA 4RAFA 3K4NA 4ESBA 1HXS2 2AXLA 3RPUD 3TKYA 3O1OA 1CX1A 3C8XA 1PDNC 4WXCA 4XAEA 3D3AA 2V9PA 3TQNA 2EIMH 2GNDA 3EQLF 2N7GA 2FX0A 1EV7A 4NC7A 1V6MA 3AG4H 4RAYA 3E1F1 3M3CA 2Q4SA 4DXZA 5M3FJ 2IXLA 3CMMA 4DJAA 3S1NJ 1NA1A 4YGDA 2Q8DA 2BHZA 4IETA 4QB6A 4KYWA 1FMVA 3KGLA 4LHLA 2Y64A 4FPKA 4HX4A 3I3BA 3H8OA 3KHCA 3U1XA 2M0MA 2LYCA 1QNWA 1B9MA 5DD4A 5T5OA 4G94A 1SANA 1H89C 4QMAA 4QDSA 4UVAA 3GM8A 2OXBA 5FP4A 1P92A 1SVMA 5J1RA 5J4YA 2EV5A 5CVJA 4KWJA 4BE3A 1UOJA 2WC2A 4BQ5A 1B09A 3J8F3 5FMDA 5C4JJ 2XXZA 4FQZA 5CVVA 3ZN5A 3NAUA 3DBLB 2G9GA 1ZN2A 3RMXA 4XFFA 2AQFA 2E1CA 4BCUA 1OBNA 3T4VA 2CSOA 3ZN0A 4AIJA 2ZMEA 2C9AA 2P6HA 2QWWA 4AEDA 1JYTA 1VQPI 1KZHA 2QEXI 1E5RA 4UHTA 3PSIA 2XRNA 1VPHA 3AP7A 2P5KA 4Q4X3 2IFWA 4XFBA 3MGUA 1Y4WA 2FDHA 1QJY1 1SLBA 1ZZBA 3C18A 3VBHC 1YITI 4FP2A 4MXWB 2HQ5A 1PIV3 2A68F 2HZTA 2NN8A 3MV11 3EUHC 1LOFA 1R23A 5A3UA 4CCMA 1S0BA 1AR71 3HEFA 2UXNA 4LBNA 1SD7A 2A70A 2A3YA 4CPBD 5IK7A 3MLLA 3FXKA 3IWZA 2WQZC 3O1PA 4JDNA 5BUVA 5D8AC 4D0QA 1RTVA 2JG8C 1K42A 2PFBA 1O4XA 2W5FA 5HS8A 3RQ0A 1HXDA 2G9ZA 1S2BA 3FK6A 4II3A 1JJ8C 4CXXA 3I7DA 3Q8EA 3MZ8A 4B4PA 3BI3A 2BJSA 2EXHA 2VH9A 1IKPA 5ANQA 2RR11 1S3JA 2JG9B 3KQ4B 4Q1PA 4QB1A 1Y8RB 2DTRA 5LGTA 1TME2 5DEQA 2FF4A 4LO5B 5H9RA 1REFA 3A7QA 4NJ4A 4HX7A 5E79C 2WAQN 2LUWA 4YW7A 1AR81 1IRFA 3QPSA 1PNGA 1QQP3 4UF0B 2FDIA 4GO1A 2VJJA 1IZ1A 3DV8A 4QPOA 2FZ1A 1MBEA 1S7AA 1RUI3 4J19A 3KS7A 3T08A 2E1OA 4AQTA 4LBJA 3SZGA 3ACIA 2RE9A 2F6CA 1BCXA 4B09A 4QHOA 4XSZF 4PJ0C 3JQXA 3CTAA 1HJFA 1L7LA 3KV4A 4DYQA 2XAFA 1M4WA 2VKHA 4CA0A 3T1LA 1HV0A 3UNGC 5JZGB 3NWSA 3I2KA 4K8FA 2QZ3A 3L00A 4PQQA 3WHTA 3GFJA 2AREA 2J1SA 1OH3A 1VB2A 5IVVA 4OYUA 2DYRH 1EY2A 4A0XA 1YQ6A 4XIDA 4IERA 5I8YA 2CUZA 4EJRA 2M87A 5LRRA 5FZ1A 4OFGA 2J22A 2WFF2 1HC8A 1N3QA 1R71A 1C5HA 2YC2A 4TSVA 4O5VA 1IAWA 2M30A 2VE8A 4Y4YA 2HWC1 4Q4Y1 3BR5A 4Q4W2 2BEOA 2P5LC 4RGRA 3CF6E 2DCYA 2Z3YA 4NQWA 1VBE1 3PUAA 2F4OB 2ZGOA 2WS92 1L3LA 2IXKA 4LLGF 3KQRA 4CEWC 4C30A 3G6JB 1BR1A 4CCDA 3VYUB 2XQRA 3CIHA 3H0GJ 2K9SA 2VZSA 4LBQD 1UY3A 4MYEA 3ZFEC 1D4VB 3WTZA 3HQUA 5DM6F 2Q0OA 4AI9A 2VXDA 3NMBA 3AP9A 1D1CA 2IAIA 3DTEA 2FHRA 4NIDA 4EJOA 2ZX0A 3RZLA 1DGRA 1IUFA 4B48A 3L1PA 2MLKA 1IQAA 4UOJA 1OKQA 2RJLA 3FFZA 4YM1A 4IRHA 4AVAA 2A6VA 2W57A 1R1A2 1ZBE1 4QPGA 2IJLA 4K2EA 3GHMA 2VPVA 4UT5A 2B8MA 1IOAA 1H30A 1OOPB 2DTWA 1A36A 4GJYA 3ATGA 2STTA 3WP3A 2HQAA 2BNMA 5BNOC 1F8VA 4XUQA 1K78B 3PL8A 4NROA 5FFOC 4HYEA 3VBOB 1NXMA 2ZGSA 2PYTA 3FUQA 1LENA 2EZLA 3LEGA 4MXVA 2JD9A 4YW6A 1K45A 4OHVA 2COBA 2JZYA 4LIVA 1IRZA 1D0YA 2W24A 2W39A 3I2JA 3WDWA 3FE5A 3S0MA 4OUSA 3OV8A 3JCIA 5IOZA 1XE7A 3DBRB 4HSRA 1DGWY 2JDYA 5JIUA 1SMYF 5A6XA 3IP4B 3FHQA 1KONA 1C8M3 1ULEA 2CY6A 1JW6A 5KBFA 4XIKA 3DPRB 1Q8SA 1MPXA 2W7NA 2LW8A 2VBPA 4CCCA 3OSGA 1OVPA 2BZTA 3CDZB 2ZEWA 3FZVA 4AG4A 4YG3A 2QQAA 3VHNA 2V72A 3B6CA 2C4XA 3Q8AA 2EQRA 5FP7A 2K3PA 4NHLA 2ISYA 1HLCA 5C4WB 2DA4A 2FSWA 3LEKA 3O0WA 5IVFA 1X1DA 3F95A 2IRFG 3D0SA 2B7YA 4GZ9A 3WEZA 1QJX1 2CW8A 3RWNA 5LA9A 2A69F 2VTFA 3UL2A 2DYCA 1IN7A 4ZZLA 3GXUA 3BOPA 2ERFA 4YM2A 2Z42A 3AC0A 3SISA 3ECOA 1ZVFA 2CG4A 1EAH3 1XCBA 4QX3A 1ON2A 2WLPA 5T54A 1FSHA 4BQ3A 2HWD1 1WCUA 2HS5A 2WKKA 1GZCA 3HT2A 4MXWA 3JD73 3O5SA 1JYCA 1EKEA 4P9GA 5L73A 5FZDA 1JGSA 4JHTA 5DZFA 2RS13 1V5GA 3ZYPA 1U3EM 4B29A 2E7AA 4Q4V2 2OA2A 3BP8A 5A7PA 1TT5B 2VZ1A 1RUD2 2D1HA 4Y4RA 3M7AA 5GPAA 2HWF2 2OIIA 1NH3A 1BBT3 2GC0A 1U5ZA 1FXZA 2DDAA 2WZR3 2VJIA 2ME6A 2WNUC 1WCSA 1HCRA 3HOVJ 1YW7A 1R093 4GULA 5BNQA 1POV1 2HWB3 3NNJA 1HRV1 4EN7B 4P9FA 3MIFA 1DGRM 2EV0A 2HOTA 1J09A 3IV5A 4JC1A 3EQEA 2VW1A 4U0WA 1D5VA 1VQLI 1V9U1 3ZIXA 3HB9A 1IRGA 4FTHA 1E3PA 1ZLKA 1ULCA 2V7FA 3MIEA 3MPBA 4HF1A 1EV13 2IGNA 3S7IA 2F5DA 2E2IJ 3ERED 2KQRA 2VIXA 2VOVA 3UV9A 2EPFA 2E7TA 1ND2B 2CGOA 1MMAA 1SLAA 5AC93 1FNNA 4PDWC 5IT6A 3AYEA 3H36A 2X5IC 4UB8C 4M4RA 2IBDA 3V64A 2XGEA 1CQTA 4RAGA 4N90A 3ZCOA 1UO9A 3JRGA 2ISZA 1SFUA 3SZPA 3CHXA 3K4CA 3F0CA 2QDRA 3G1OA 1F9KA 3P6BA 2L4MA 4C1XA 2QDNA 2AEYA 2YBKA 4RYDA 5JZGA 4ISQA 2EIJH 3H3UA 2VVDA 1X50A 4CO8A 5H2FC 1GV9A 3V8JA 4CCEA 2FBKA 2JE8A 3AYDA 3VDXA 1X19A 5FKNA 2Q5TA 1VBC2 5E8IA 1RZ4A 3A03A 1COV1 4CDQB 4AFCA 2JT1A 4ES8A 1PUFB 4A41A 3WLUA 3FL7A 1XE8A 4BHBA 4CCNA 4QX0A 4K21A 1RUH2 1RUE3 2L2OA 1X36A 4ENKA 3H9JA 3CLQA 2X6XA 2P6SA 1L7RA 1R5GA 3AKRA 4P9JA 3I64A 3FMQA 2R073 2LTPA 4FPJA 4AD9A 4XF0A 1RYYA 4LO6B 5C3QA 2LS6A 1W9FA 2XJPA 1K3IA 2ZJCA 3FMSA 1HQCA 3QP6A 4I3PA 2Y6GA 2JA6J 2RHPA 2B39A 4A6OA 4CCLA 5ICFA 3CCEI 5FMOS 1YFYA 4ZU4A 3GTJJ 2LLKA 4DUVA 2CYYA 3S57A 1VAKA 3GYDA 4OULA 3HUGB 1FPN2 4A7ZA 3T2PA 5FZ6A 3ZSEA 2LF7A 4R52A 1CR7A 3S7EA 1OCRH 4B1RA 2DU0A 3AG3H 1XRUA 3K4JA 4FISA 1ZM1A 5K7PA 3B73A 3BKZA 3O8GA 3WNLA 1OOPA 1QPIA 2R7SA 1JI6A 2RS53 3NSTA 2EK5A 2VE1A 2PMZN 1K78A 1BI1A 2D6KA 2Z79A 2RQQA 3VBOA 5ERIA 4NIAA 2PLV3 1YWKA 2C6SA 4DNYA 4EGYA 4F7ZA 2OTJI 4ZDLA 4A69C 4XFIA 4L18B 3C7OA 4P9UA 1W9TA 2IS2A 1I3AA 3ULQB 2BUKA 4CZCA 4QXCA 4FPEA 1A35A 3U10A 3ABMH 2D45A 4XMYA 2CV1A 1RUJ1 4KH9A 3NJZA 3OYIA 4ATFA 4EM0B 1YXWA 4IE7A 3DPRA 4AYBA 1ZG1A 2QQKA 2AGSA 1D0XA 2F4LA 4J25A 4EE2A 1UY4A 4FAGA 1YFHA 1NY72 1NA1C 1V70A 1Y9QA 4MH0E 1JTYA 4FQGA 1VQOI 2JECA 5F1JA 2D5FA 3NKGA 2HXIA 1RHI1 2QE3A 4GMP0 2Q1ZB 2P2KA 1RIOH 1WZ2A 2E19A 2ZKZA 3J4UH 1FV2A 3FKJA 2VKDA 4HW0A 5L19A 4CICA 3TWIA 4WM8C 3MCZA 5C4WA 1SVOA 1FBSA 3M8FA 1WMFA 1RUF3 5I91A 4XKWA 4KNCA 5EP9A 4NHXA 4KIBA 5D5WB 1QKQA 4AVPA 5DCMB 3I2OA 4LPLA 1WCKA 2QKDA 4X8NA 1Z78A 1BOBA 3OYWB 1XYNA 3LPFA 5EJ1B 4FCAA 1KRIA 1SDWA 5CVUA 4XLPF 1BA5A 3WNNA 3BWGA 2VXZA 3OY8B 4KG8A 3VBFB 4AEDC 4JDMA 1G8XA 2DVFA 1WI9A 3VZMA 3HRSA 3EPZA 1DQ6A 1QJY2 3ZMSA 1G3WA 3VN4A 3G1LA 3A0HC 4AXOA 4GH4C 3NQOA 1JYNA 4LBMA 5DUWA 4B3AA 3VBSB 2R063 1DDLA 3OS1A 3HTSB 2NYXA 4BJ0A 4DINB 3WTWC 1LOFC 1BJAA 5A2QK 2DMUA 4XZPA 2GIVA 3AB0A 5LK5A 2JRTA 3R61A 4HQMA 4P9XA 4XLCA 3H0DA 5DG1A 4D5CA 1LULA 3NJVA 4G12A 4LLNA 1KJRA 3EUKL 2WB1N 4S2DA 1WCDJ 4HPKB 1QXJA 2WV1A 4YW5A 3V7CA 4P55A 5LCWL 1EUTA 3VDBA 1OLQA 3S3MA 1RKTA 4A6DA 5TSWA 3TBDA 3UYJA 3HPHA 4JOMA 4RGAA 4LA3A 5LY2A 1JKQC 3BT9A 2I10A 2VR4A 1ND2A 2RR12 3OY9A 5J4VA 2MABA 2VBYA 3QP5A 2WQ4A 4LTAA 1W6OB 2OQGA 3BN6A 2UU8A 3IMNA 3DCQA 2QQJA 5HNHA 4QHZA 1ENQA 2CQXA 4IHXA 3RFRA 4KIGA 4Q47A 2LSOA 2E1MB 3PUHA 4FPGA 4AAXA 1NCRB 1AR82 2XPJA 2M5WA 3JSOA 3KP2A 3H1WA 2DT6A 2V4VA 1UJ8A 5C71A 1T2XA 1Z21A 2ZEYA 5LA0A 2O8QA 3SC7X 1G6NA 3T0YA 1JH5A 4P02B 3DU6A 2CGNA 5FREA 4Y1ZA 4LOCA 3IAM2 2IA2A 1W36C 3POWA 2W82A 3M3IA 3B7MA 4MGIE 2MG4A 3REOA 1ZZ8A 4AHXA 2H94A 3A4UA 1RC9A 4LT5A 1QJU3 3WQ0A 4CDQA 3A0BC 3MFAA 4CA9A 4IHTA 1HXS3 1PUFA 3V0BB 3RG0A 2L4AA 1MR5A 2DCEA 2VJXA 1WA4A 3I2IA 4HFSA 3TEYA 4BIOA 4CE8A 4CSWA 1X3UA 4ARXA 3DL3A 3LDKA 1YCIA 3LQQA 4LULA 3WHUA 2A6ZA 3AG2H 3ZMOA 1GLNA 4UW4A 2FJ1A 2HWC2 4Q4Y2 3ZFGB 1I3HA 3OB8A 4FE7A 2DOFA 1T6SA 1FOD2 2BW8A 1VBE2 1G8WA 3F6OA 4ZZDA 1PX4A 2NVYJ 2KFDA 2CTVA 1TWHJ 5FZ0A 4Z2AA 1R081 3K7AJ 4Y1UA 2WN3A 1QY4A 4A3BJ 4C2TA 4YLZA 1LECA 4LB5A 3HOYJ 5JSRA 5CKNA 3VKNA 3BG5A 3OWTA 3WU2C 3COAC 2PI0A 3HUGA 3BPZA 1RL3A 3TEWA 2C5DA 1VI0A 3Q0UA 4ZTFA 3U1DA 2P1BA 1J5YA 5FRNA 3K46A 5JUVA 4BXUA 3DKYA 4IEPA 1HN1A 2QQIA 1FIPA 2Q2EB 2D2WA 4LR4A 2GOMA 3HC7A 1MBGA 1LFPA 4M9ZA 4LBKA 4F3JA 4ASLA 2I45A 3IZOA 1JXNA 2QQMA 2WAQA 3WVJA 2ADUA 1UYZA 2V9KA 5IYDJ 1ZBE2 1G3YA 3KPHA 4QPGC 2DVDA 4NMIA 3CMGA 4OQ8A 1O91A 1TQMA 2RDPA 1O59A 4ZPIA 1U0AA 3SDGA 1IF1A 2VCBA 5BMZA 2HEOA 1SBFA 3DBHB 5IP7J 2Y6LA 3ZYHA 2FXAA 1Y9GA 3HSEA 1OQ1A 2IFRA 4AFBA 3TN91 1P2FA 5GLVA 4QAWA 2ZMKA 2R0FA 3SITA 4M9SA 4Q8KA 1W8ZA 4JGZB 3NJYA 1WH7A 1ULGA 3HN3A 4AQ6A 2P5BA 2ZAAA 3E1SA 3LSPA 4RQPB 3GFIA 4TYSA 2KRHA 4KUMA 1MS5A 3ZR5A 4KFCA 2MA3A 4LO7A 1ZYRF 4ZYEA 2SBAA 2VOOA 2VPRA 3T09A 3J81Z 1I50J 4A3MJ 1OXCA 1BI3A 3ZPYA 5BPDA 1ULOA 2PHTA 2XGDA 1HKQA 1O8SA 1MGTA 1AU7A 3CJQB 3WP5A 4AWDA 1QRYA 1TVGA 5DCMA 3O1RA 3T1MA 3RNSA 3WD5A 1UZVA 1W6MB 3SDBA 4QWNA 3OYWA 2YU9J 4H3WA 2ZGKA 3TW6A 3HVDA 1IDYA 1QJX2 2E71A 5CFDB 3TOJA 2PMHA 3VZLA 3OY8A 1YLFA 5DDJ1 3VBFA 2DBNA 4AE2A 2W00A 3N7MA 2BY3A 4CUAA 1SEFA 2R0QC 5B5EC 2RM21 2JEMA 1ZRDA 3FK7A 3K2AA 1FIAA 2HWD2 3ORJA 2IVMA 3I59B 3HNBM 3VBSA 2MH2A 1XE0A 3GALA 2OW4A 4JV4A 4AK3A 5FGMA 3RCOA 3MUZ1 1BOAA 4MGYE 4L5IA 4A6SA 2OPTA 3WF2A 4UB6C 2DA6A 1B35A 1BR2A 2IW5A 3I4IA 5FYVA 2L5QA 4Y17A 2LM3A 2ZGTA 3D8CA 3FDYA 5E1XA 4HPKA 2D98A 1FZPB 2WFF3 3ERMA 2XR4A 4HMZA 3TP0A 5TISC 3TNPB 4M9XA 1HRV2 2ETEA 3NV2A 3I53A 1OLME 4WF2A 1V6LA 5A7SA 1PGSA 2ARAA 4Q4W3 3RGBA 2RVAA 3PVEA 2F4IA 3SMHA 2WS93 4B8EA 4IHSA 3ZYFA 4O7XA 1U9OA 2IS6A 2JG9C 4EN0A 3DXUA 1P4AA 2PQ8A 2VLAA 4HDUA 2FUG2 4DRRA 1PM4A 1N1VA 1L0OC 3WTUC 4QTRA 3B94A 4KDPA 2NM1A 4CP1A 1NCRA 5LHHA 5IWFA 5ICGA 3ZOIA 3U2RA 1F4KA 5LW9A 5HS7A 1S7OA 5FD6A 3KVBA 2UYAA 1YHQI 1RVF3 1FMWA 3ZGKA 2XWBB 4BZ4A 3FISA 1NLSA 2PBIA 3GTKJ 4QIWN 3MW2A 4OCTA 5CG8A 1S72I 5GZGA 1N77A 2FDFA 1VNDA 2VB6A 1SD4A 3S1QJ 2CMPA 2FBHA 3P7NA 1R1A3 3PNVA 2EA7A 2OBPA 1APLC 1AJKA 1JJ6C 3CBNA 2JN6A 3WOGA 5JZGC 2E1NA 5T55A 3BTLA 2RJ2A 2JE9A 1S29A 4MEYF 5IP6A 2W08A 3V0BA 4FFFA 1JN2P 5SV5A 2C9KA 4YRVA 1FY7A 2K86A 4XF1A 4Y7NJ 1QHGA 2W52A 4X0GA 5ED4A 4XR6A 1OHFA 1DG6A 3NAPB 1WA6X 3DF8A 2JENA 3WCRA 3LD8A 3ZFGA 3ZN4A 1SFXA 3ZQGA 1E5HA 4P5OA 1UCXA 4OI2A 1GT0C 2JQ7A 2JJ7A 2JVGA 1RUG1 3GCXA 2D6LX 2WA0A 1MBJA 3TL4X 1UOGA 1OFCX 3IH2A 3MKLA 4WVMB 3WNPA 5EEGA 2FD8A 1OISA 1BJQA 1GFF2 5J48A 1BI2A 1E17A 3PUIA 4JRLA 4HV6A 1JUIA 5FPAA 4Q0QA 2ESNA 3I71A 1QU0A 3ZXEA 1AHDP 5A7OA 4NAOA 2NP0A 5C3EJ 1KU7A 4L99A 3FIWA 1BI0A 4YW4A 4WV8A 3CDIA 1KFXL 2KIQA 1FTTA 4MSVA 2ZNZA 4XJZA 1YE9A 2Q2EA 2CH0A 3PUFA 1XQNA 2DURA 2ZEZA 1A6IA 2PHWA 4RDUA 1T6BX 3FLRA 1I39A 1WLCA 1A3KA 1YOVB 2KD7A 4JX0A 3H3LA 4QDRA 2XAUA 4AL9A 3FMRA 4A3LJ 4R9AA 4DUWA 5FO7B 3HRUA 3PHMA 3K4BA 2WA4A 5D5UB 1OOPC 2YU3A 2X09A 2GAUA 1JI8A 1YFUA 1MMGA 3PTYA 4HOOA 1OFNA 2HYFA 3ILRA 4YG2F 3FWEA 4JGZA 4Q4V3 3AL0B 4MO3M 1B1BA 2XJUA 3I3QA 1RUD3 4UAPA 1AL22 1NZCA 1HJGA 3FLPA 1LESA 1Z7S1 2K9QA 5FPXA 2P3JA 3PU8A 2BY0A 2GDFA 4RQPA 2IXIA 2OCCH 5DUXA 1RUJ2 4HLYA 2A6TA 1VR3A 1GBGA 3DPRC 3JRDA 2P4EA 4YWAA 2ET7A 1FC3A 4OMDA 1U5XA 3T0DA 4XAAA 1GYKA 1RHI2 3QYEA 3D5SC 4PLNA 2D6PA 4YGCA 2Z5UA 3IH4A 4PF1A 1W6MA 1LCLA 5C4WC 1UYYA 3GTGJ 2FOWA 3LSMA 5JOWA 4UWDA 4QX1A 1O5LA 5CFDA 2DMTA 1TTYA 3ELNA 2QKLB 2W47A 2Q8CA 3WR0A 3M4OJ 1DHKB 1TC3C 2V9VA 3JCUC 1Y7BA 2VOTA 2WUHA 4HN1A 2W0XA 4L92A 1MJAA 3IBMA 4L0PA 1Q8VA 2FD5A 2VC0A 3I59A 2LY9A 2J1EA 2TCTA 4BBSJ 2FQ3A 2ID4A 4YZ1A 3QPHA 1WGXA 4DYCA 2OYZA 4LK7A 2BYVE 1CIYA 5CIRA 3J7ZI 1DQ1A 3OGJA 4MGSA 1S0JA 1S9HA 3WW2A 3PIOF 3AX4A 3WTXC 3CC2I 1R00A 2IP2A 2O8XA 5CYVA 4KN7X 4BE0A 3IDCB 1YTYA 1IKQA 1VBC3 1JHJA 5FY7A 4QGNA 2PMZA 2W4SA 3B9CA 5H6RA 2CV2A 3MF9A 4BDYA 3ZMNA 3OG2A 1I6XA 4K8RB 3WCSA 3TAYA 5GLWA 2R7WA 2TNFA 5FZIA 3CMYA 4HSJA 1JTXA 1FYMA 4XLAA 3C7GA 3AL6A 3DXJF 3E7LA 2MH9A 4AHWA 2V6EA 3QPTA 1J3RA 1R7JA 3I54A 1OF3A 1YEWA 1O7FA 4HBLA 3AMPA 3WDYA 1IHMA 2HOEA 3S3OA 4CHUA 3L09A 4DO0A 5FZBA 1VE0A 3ZQQA 4B47A 2ATFA 5CB7A 2L02A 3EMRA 4IV1B 1H1AA 1FT9A 3ZYRA 5FZEA 3MBWA 2ZFWA 1NT0A 1R1UA 4HSLA 2VQHA 5KK1A 3GX4X 5J3UA 4M3CE 3C2GA 4H4KC 1ND2C 4IQ4A 4MOAA 2XH6A 4IESA 3DKWA 3WF1A 1OCZH 3D0JA 3LDRA 3VL9A 5APAA 5KHJA 5K1YA 2LRDA 1U6GA 1DF0A 1ZK8A 2CFXA 3AZXA 3OYCA 1WD4A 4OMCA 4XKBA 5D5XB 2VGDA 4EROA 1TZOA 2EFPA 2YU2A 1SVLA 5M5YJ 4E8CA 1PVEA 1VB4A 2LFBA 2DK8A 2R30A 1YUDA 3UETA 1AOYA 2OV7A 2CAUA 3GW2A 4FX4A 3W20A 1F5TA 4FTBA 3DTIA 4BK5A 2Q8KA 1DUXC 2BGCA 4SLIA 3PU3A 2Y33A 1T8IA 4BE2A 5FKOA 4K20A 2VY0A 4Y1XA 1ASJ1 1ZRFA 1GV2A 5E17F 3OS0A 2A5YB 3OGSA 3NAPA 1DGWX 3CF2A 3JW4A 3LOIA 4L97A 1R5ID 2BTVC 2OJED 5A6ZA 1EP0A 4CRQA 4PFPA 1OKOA 1VRH1 1REEA 3POJA 3KZZA 1FYLA 3ABZA 5D2AA 3JB4C 1X3WB 4U87A 4U0VA 5JAXA 4WVMA 2WABA 4B3NA 2LKPA 4NUBA 2WB1A 1SZBA 5GM0A 1IXSB 1W8UA 1R082 2GC3A 1REDA 2ZJPF 4A3EJ 5J8CA 4K3UA 2HLEA 3ST7A 1W7PA 4FT8A 2LK2A 4BH9A 4ZYHA 2BNNA 2VUMJ 4HG2A 1WWXA 3CLPA 5K5RA 4IF4A 4KA4A 2XL7A 1PZ7A 2ZO4A 1MVEA 3DECA 4HONA 3BVCA 2W1OA 2XVCA 3HOSA 1G9FA 2R32A 2K85A 1T38A 3AZWA 1OD3A 4HK9A 2HKXA 4UW6A 1H6XA 1UL9A 2XGCA 1CAVB 2VXRA 4N8MA 3ECHA 3DEWA 2QCSB 4NPLA 3MFKA 3HBLA 1W0TA 1SFOJ 2WINB 2HTSA 1QHHD 5JLWA 3GBWA 2WWSA 5DABA 2O3FA 1FBQA 4AVSA 3H8UA 2CQKA 3H7JA 4QHBA 2STWA 3LFUA 3UJQA 3HJEA 3TRSB 2JX9A 4JAAA 3PJRA 5J40A 4PFOA 4TLFA 2F4PA 4I0BA 3G3ZA 2R49A 3UKTA 3QACA 2P34A 3GCWA 3TO7A 2JG8B 5FPUA 4XJ8A 5LBEA 3DWLE 1XC6A 1VBD2 1VBB1 4ZZ8A 4R1HA 5FXZA 4HF2A 1J9IA 1AR73 3SNMA 1TMF1 5I0TA 1Y43B 1H8TC 5I0RA 1TWFJ 2WAFA 2DJIA 4L8QA 3RWKX 5JXGA 4COVA 4LLFA 3ZMUA 4EN9B 2ELHA 1G86A 3HR9A 1O4TA 3MIHA 5H20A 3K51A 4HA8A 3WW1A 3QOEA 3SEZA 2R7DA 3CMEI 2ZGMA 3WU1B 4XLEA 5JXHA 5EGOB 1SMTA 4NPMA 4OI0A 4UW5A 3T30A 1S0CA 3RKYA 2QTWB 1SFPA 1J7KA 4I09A 4GB31 1PP7U 4KL1A 1NLQA 1I1EA 1KA8A 2RR13 5BXXA 4BQOA 2IC1A 4U7BA 1CZTA 1W06A 1ZZ7A 4BXFA 2ECBA 4E4HA 2DBIA 2JDNA 2QUFA 1Y1VJ 4HZFA 3B5LB 4CU6A 2RNGA 1LHVA 2HYXA 3C7HA 4ZXEA 3FC0A 1HRI1 1PMHX 2XL9A 5CFCB 1H4HA 2AEZA 3DPTA 4OWRB 4XBQA 3A02A 1JMUB 1IG0A 4AIHA 4HNVA 5DDJ2 3HPGA 4ASMB 2O8KA 1POV0 3VBFC 2DFCA 2AYHA 1O3TA 1UELB 3KYCB 4K6BA 5FK7A 2GBYA 3HBZA 5FR3A 2RM22 2HWE1 4HBNA 2XWJB 5FMCA 2JUGA 3ACLA 2KR2A 4II2A 2Z4FA 1JUHA 4A3CJ 4C3JJ 5IPAA 3K1MA 1VMHA 2JRMA 3VBSC 5JPNB 1V6OA 1ZRRA 2NMOA 1ZA4A 5FLXZ 2VN2A 3TGNA 1MS9A 1JZ2A 2E51A 1EA3A 2KDOA 1EYBA 4BQQA 5GKAC 4EN8B 2LF8A 4F93B 3KF5A 4ZTJA 2OF7A 2ZNYA 5KHDA 4LO8A 4CEWB 4G7ZF 1LGCA 2M7AA 3OCPA 2BQPA 5FJHA 3OIQA 2HWC3 4OUMA 4Q4Y3 1GP4A 3S5AA 4AVVA 3BU7A 3BIEA 4IV1A 3ZFEB 1VBE3 3MV01 1DDNA 2Y38A 1ENXA 3WDTA 1R1TA 4IL6C 2CV6A 4M6YA 1OSGA 3H50A 4GYGA 4B44A 1BK1A 3O12A 2PHFA 2LOOA 5D5VB 3SEEA 2VVEA 1JYVA 1DP3A 4XOTA 4LG3A 4Y24A 2E1MC 3MO4A 1W6QB 5FO5A 4ARYA 1NUKA 5KR7A 4A5MA 4B43A 3LKJA 3INAA 1SFEA 1W2AX 1TNTA 3T4HB 3HM5A 4D94A 1HDKA 2WNVC 4Q26A 4M72A 1X58A 5EJCA 1GWMA 4NHYA 3T2OA 1ZBE3 3POIA 2ADEA 3T1BA 2GQQA 2QNKA 5F1RA 1XPXA 2DTZA 2W1QA 4FOVA 2DUQA 4PSWA 3OMYA 4Q0UA 2IA0A 2ZBJA 3ZXJA 4DPNA 4CYDA 1W5SA 1S0DA 4RS8A 4LHSA 5T5PA 5DAXA 5CADA 5A33B 2UURA 4FAHA 2DYSH 3THPA 3S15J 4FVVA 5EYRA 1UZWA 1MSFC 1SDDB 4KITB 2BBAA 3WG1A 3ZQLA 1IUYA 4S2HA 3CO7C 1AYM3 4JGYC 3QYFA 1RKWA 3ZFGC 2QQ9A 1S4CA 3RZDJ 2L01A 3F6VA 1FNYA 3UGFA 1WZXA 4KWLA 5CVRA 3M3EA 4G7HF 1YFWA 1B59A 1RUG2 2NVXJ 5C4XJ 2BV6A 5C70A 1V4RA 2LG4A 2D1VA 3WQ7A 3JU9A 3ZR8X 4TZDA 4X6RB 5FDBA 3SH5A 4ETSA 3WINE 4RL7A 5F5QA 5JWPA 3NRVA 5FK8A 3VYRB 5E8AA 5CJ9A 3Q5FA 3HT1A 3WG7H 3U0ZA 1LEMA 4URTA 3LSGA 2DVBA 5ABJB 2VO5A 1HDDC 2IT0A 3S32A 2HZDA 1NE4A 4EVIA 4NNJA 5E1RA 1GXQA 2LBFB 1HX6A 3PQKA 1CAVA 4GMP1 2RC4A 5A1LA 3CJTB 3GTLJ 3E5XA 1S5LC 1QJX3 3MEXA 4LJZF 2YSRA 3HNMA 2W94A 2VNOA 3TBIA 2GU9A 2B7EA 2J1AA 2GC2A 1FJLA 2V1DA 4EMSA 1QEXA 4RMNA 3CD6I 3PO3J 1FP1D 1N1YA 3IAS2 2HWD3 1Z7UA 3TNQA 3SCFA 2JG8A 3O0XA 1BVP1 4XCBA 5LRSA 3HGYA 4DQAA 1NZIA 3CF5F 1QU3A 4ZY9A 4QGMA 1AZDA 4V1PA 5JSOA 1Y3TA 4B1LA 3AZVA 4JGZC 5HV0A 4H55A 4EQVA 5L3EA 4HKOA 3LPGA 3LWCA 3OIOA 1B8IB 1VAVA 2YC4A 1Z7S2 3HSFA 1IC8A 3A01B 5DUUA 1ZARA 4QM9A 2TBVA 1POGA 4RQPC 1GP5A 1POV3 3AM2A 4AU7A 1HRV3 2KT0A 5ILSA 3MIGA 5EGOA 2ZGLA 3RZZA 3JAMK 1X1BA 3TO6A 4E7ZA 1FNZA 4YYOA 5F32A 2R7FA 2VNVA 1TME1 2R041 3ZYJB 2BOJA 1V9U3 4HNUA 3I2HA 4WXHA 2F48A 3ZMVA 4MHUA 1X1PA 1SD6A 3J8F1 3WDXA 1EUUA 4BUPA 2DOAA 4UFJA 4ISRA 2XUMA 1VBA2 3DLAA 2K46A 4ZU7A 3K70C 4Q0SA 2DCZA 3R0RA 3HKZN 5C5TA 1OPMA 3VDCA 4Z07A 4Y1YA 2EAAA 4NDLA 4C8DA 5CFCA 1ZGJA 4JX6A 2IXJA 2GIZA 3ABLH 4DY5A 1ST8A 2B5HA 1XMAA 1CF7B 1XCVA 1WSUA 1W2NA 2IPQX 3M70A 3AKZA 2VAUA 2W95A 1DPUA 2YFZA 4IOAF 2VBBA 3GF2A 1KD7A 2WQ8A 4M3BA 3BY6A 5FY9A 5CZKA 1K5MB 4YIFA 1CVNA 3T0BA 4XILA 3EYYA 2B9VA 2ARBA 2CNAA 5E1ZB 2FMLA 5GP9A 1UMHA 4PF5A 2XBO1 4CCJA 4E4DX 4PT6A 1ULPA 4LFUA 2IEKA 4OU0A 5HV4A 1P4XA 3S5QA 4COUA 2MC4A 4JTOA 4CP2A 1MDMB 1COV3 2OKXA 2ZS6B 4CEWA 2DBBA 3ESWB 5KCMA 4RM3A 3RKXA 1PP8F 3M4FA 3VODA 5JHUA 5GAEJ 2XC7A 2H1LA 2D3RA 3KZYA 1R1VA 4GD4A 2V09A 3ZFEA 3K48A 2UZKA 5DV5A 4Y13A 1W9YA 4EGZA 4GQ7A 4QQ2A 2J5OA 2HGCA 4YRDA 2EJRA 4XFAA 4Y5TA 3JTGA 4E27A 3P5JA 1GANA 1FX5A 1NAEA 4LMFA 5A3OA 1XNCA 3O6BB 2HOAA 4LEJA 1PO11 3GLXA 3UESA 1FP2A 2CU5A 1WKYA 2DUOA 2VMCA 3WE3A 1W6QA 4I98B 2QQBA 1ITYA 3S17J 1JTZX 3WTSC 2RV8A 1UZYA 5A3WA 5CA6A 2PFWA 1Y0UA 4C1WA 3ACHA 3CDHA 5FBZA 4LA2A 4W97A 4Z2WA 2LP0A 3LSRA 4IZZA 2ZHMA 2GXBA 1AHSA 1HW5A 1RB8G 3USSA 5JVTA 2ZX3A 4CGZA 4IDZA 4ZYDA 4P9WA 1CJPA 4AGRA 3U75A 2VOPA 4Q5SF 5EJZB 2EFOA 5A1FA 2OS2A 1GNHA 4YSFA 4XABA 1MS1A 4HKLA 4I2OA 5A33A 4MGKE 2Z33A 1ASJ2 2LR8A 2Q1FA 1YI2I 1UZZA 1DU0A 1VMFA 2FE3A 3NAPC 5IUQA 2OC6A 3OYBA 4LBQB 1JT0A 1S0IA 2DCJA 3BCWA 2UY8A 1FOXA 1AYN1 1A31A 4HVRA 5DUKA 3S16J 3HIFA 4UYBA 1RUJ3 3PURA 2PAEA 3R60A 1VRH2 1K5JA 2KA3A 4PJNA 4PIYA 3KEYA 3HEIA 4WM8B 4L11A 5IOYA 4WWCA 5FPLA 2H6CA 2EINH 1BM9A 2PN6A 1JUSA 1GUUA 4M4PA 2YZ4A 4PCRA 4Q0PA 5ABJA 1VQNI 3LOBA 2E7QA 2HYKA 4ONUA 5GADJ 3OR2C 3CCJI 2EXKA 3JQWA 2LBFA 2DDUA 1EF4A 2E26A 1WRJA 1RUNA 1DQ2A 3AK0A 4PIZA 2WDBA 1JHFA 4QX2A 1WLWA 3RPUA 4JQFA 2BU9A 2XDVA 3WGGA 2IVIB 3ZSLA 5IAXA 4ENMA 5JR3A 2WAEA 5E3NA 1REPC 1WKMA 5EJ3A 4Y26A 2BY1A 2C6YA 1B6AA 1F5JA 1QXPA 5ANNA 2XOMA 1KDMA 3CJRB 3BC8A 4HKWA 1ZX5A 2D43A 2BFUS 3P5BA 2BOIA 2GA2A 2A61A 3M07A 4YW1A 1CAWB 4W1UA 4DNCA 1ZZ6A 3WF0A 3KVAA 2XSJC 4AI8A 3AL0C 3F23A 1FYKA 4WZCA 2WIIB 1B8IA 1VBB2 5FYUA 3A01A 1WVRA 2VMEA 1TMF2 4XQFA 3HOTA 3OGGA 3C2UA 1QJFA 4C91A 4NVPA 1MS0A 4IJAA 1VJ2A 1G9AA 2QQPA 1XU2A 3LOCA 4KG0A 2CWMA 1WJ5A 4A4AA 1Z05A 3DP7A 4IRGA 2UUZA 2XASA 4E70A 5E20A 1J3PA 2YUSA 2YU1A 3DEMA 2Y34A 4GWIA 1D4M1 2VOKA 3KGZA 1PZ8A 3RI8A 5FYTA 1H1MA 3HOZJ 5BPXA 5LBQA 4R4ZA 3B93A 4WVWA 2QZ2A 2A3SA 3K4DA 3BALA 1GVJA 4DB5A 2VG9A 3ME2A 3P9KA 1CF7A 2RKHA 3C7EA 2BERA 2L7FP 5F3GA 4ZYGA 2VQTA 1UU5A 3FXJA 1FMD1 1GHCA 1PK6B 4ESJA 1RGSA 3S14J 1HRI2 2K2SA 1OCOH 3SFIA 3DTKA 2EWNA 2RS11 1K5MA 2ZAHA 3POGA 5K0UC 2ZMLA 2M3AA 5B1AH 3QYBA 1H0BA 3OL4A 2XF5A 1HB4A 1VLNA 1W99A 1WH5A 2UV1A 4O6JA 1VQ7I 4KGGA 4XUOA 2JA7J 3BGAA 3F22A 3ALQA 4ZJZA 1XGMA 2O61A 2XKPA 2HWB1 1V6IA 3HDDA 1TT0A 4W50A 1RUH1 1CESA 2VBWA 4BE1A 2A6EF 1W5TA 4DBRA 1MDMA 2UWBA 3QODA 3RMYA 3MIBA 3WQ1A 4ZKTB 5C44J 3OF1A 1N3PA 3GLLA 5CVIA 5IP9J 5IT9Z 1OQYA 1YW9A 2EILH 1HQLA 5LBCA 2C24A 4A45A 1YO5C 5IYCJ 5EQUA 1UY2A 4BY7J 2JA5J 1R64A 4Q1RA 1WW6A 4E7IA 2IXCA 4RGXA 4QX7A 3OGRA 3S8PA 3SXYA 4UBGA 1IG3A 3WDUA 1Q5OA 3VSKA 1TQ5A 1UU6A 3F72A 3BODA 1AL0G 4IQPA 5H9PA 1FPN1 1R083 4MFDA 3E6CC 2ADDA 4K1YA 4QSHA 1IGNA 2EIBA 1USTA 3BPXA 2EF6A 4TV7A 2E7WA 1WWYA 2K9LA 5FZ3A 3DEEA 1HLVA 2CWSA 1HB2A 4XQ4A 3AYCA 2RV9A 5HCAA 3KT4A 3CZJA 1HQNA 2O8OA 1F2NA 3DLLF 1VP6A 2CL2A 2HDCA 1L3JA 2ZB9A 3C2BA 4J1XA 5FY1A 2HQRA 2KZVA 3TOBA 3H1YA 3KF3A 1UKGA 3IDBB 4X8PA 3EETA 3AMMA 4QKBA 3ZO0B 4H7LA 3P3NA 3A22A 2OQ7A 1Y9MA 4L0YB 5AIPA 3F3XA 3L2UA 4Y15A 2R92J 3L2QA 4UNOA 4HETA 3FM5A 5BNNC 3KFWX 2I2SA 1SBDA 2E31A 3I49A 3J9SA 1E3HA 1ZGWA 3E6DA 1QH6A 3WGHA 4PHZA 1UMQA 2DCKA 4RA0A 1Z3XA 1QXRA 3N3HA 1NY71 4LBQA 2JWTA 2RS31 1LKXA 3TN93 1O4ZA 4ENJA 2M2EA 1I27A 3F8MA 5FYMA 2Y0MA 1LU2A 5CPRB 4EM2A 4OLLA 3BROA 3BZ6A 1A8DA 4OMZA 4QX8A 4YVSB 1W3XA 4WM8A 5K7HA 3F9KA 2KPMA 1PO21 1NX9A 3AFKA 4QPIB 2FZ2A 4KN4X 2E5ZA 2VONA 4RHV1 3ZXSA 1WMEA 1IO2A 4JKLA 1BXHA 3MPPG 3N9QA 1KQ8A 2J1TA 3H1MA 2AZ5A 2BVVA 4IGPA 2FEZA 4E8DA 3M7GA 4Z2YA 2K27A 2OZJA 3K6GA 2HXOA 5A32B 2X48A 1QMJA 5E3OA 1W4MA 1APNA 3ILFA 4FFGA 3H9QA 5G04L 4DFSA 1U5TB 1Z0HA 1H9PA 2ZSHB 4BJ5C 3SLIA 1XSRA 2ME0A 3VYTB 3LAJA 3TDUC 4W8JA 4E4SA 4G6QA 1H2KA 3VHRA 4MFEA 3J80K 1D0HA 1RPWA 4W6XA 2O1QA 5FP8A 3OBAA 3LGRA 3H35A 2WL1A 3POSA 1BW5A 1VZ0A 3H92A 3CEWA 2KIUA 1AVBA 1UY1A 1SCSA 3SKJE 4RB2C 1AKHB 4GH4A 2RGVA 2OX0A 1S2KA 2MYSA 4BQNA 5DDJ3 3JUUA 3I97A 2CW0F 1E3OC 4H14A 1W2TA 2JD4A 1QZEA 2DI3A 5D8KB 5F39A 1CAWA 2PMWB 5L3CA 4I0WB 1MEC1 2RM23 4WCGA 4E4ZA 2YS9A 2WT0A 4YELA 4P5YA 2GALA 3G71I 2XAQA 4ZONA 1SFYA 3VEPA 3M9AA 1S0FA 5GZCA 1JZ5A 3LIHA 3L7WA 2VM9A 4G4FA 4IEXA 1VAMA 2KIFA 3VB2A 3CQZJ 4LO4B 1QO0D 4AUXA 2OU2A 2WNEA 1AR61 2KIMA 1YYNA 3RVHA 3Q9OA 4LITA 2HH9A 4IXLA 3FXQA 4FE4A 5HNFA 2BBVA 2XLFA 3CCUI 3CP8A 4FCYA 4KIFA 2CQNA 2FBIA 1J3QA 2SLIA 2RMU1 2E53A 4OIPF 4MV2A 2NQYA 1YQ2A 4MGQA 1IQDC 2R042 2VC9A 2EXJA 4BWOA 1D7PM 1URXA 3J8F2 2ET1A 3HHGA 1V3FA 5EWSA 3AMHA 2JSCA 3KT7A 2O6GE 2GNMA 5IK8A 1PK6A 4E2SA 2VBDA 4JKMA 5ERLA 4PDKA 1JE8A 1R49A 3BTIA 5CFCC 2MW8A 2QBYB 4M3EA 4CUBA 2CHHA 2ZXQA 4LK1F 4XBLA 4U88A 5K7FA 2XIGA 4XK4A 2A71A 5T5JA 2CUEA 2X1DA 1HOMA 1OR7A 2VU9A 1WJEA 1HB1A 2G7HA 3GNEA 3ENRA 1ZG5A 3H1CA 1MH4A 2M0CA 1UPIA 2V1NA 3R0AA 3W6VA 2WYFA 4OHZA 2NS8A 1V5EA 4ANJA 1WMDA 4P96A 2XBO2 3MW4A 4NE9A 2NMNA 4N7IA 2XPVA 3GWZA 5F5AA 3NKTA 1TWAJ 1DGLA 3OUHA 4BJ6C 3OEBA 3ZYBA 1FATA 4UFLA 5JCTA 4ZHNA 3ZRGA 3LFIA 1FOD1 1UG0A 1O8PA 2YB7A 2PJPA 4N53B 4YM0A 1TW3A 2ZCWA 1QGPA 2ARCA 3POBA 2KJBA 4YZ5A 2VQ0A 1OURA 1XNKA 3POYA 2V26A 4A3FJ 2ZFUA 1UX7A 2BZDA 3GZAA 2B4KA 2WADA 2DPDA 3W2AA 1YFXA 2DA5A 3I4MJ 1FOKA 5EDNA 4MHRA 3HSRA 1PGW1 4M0NA 1GLHA 4ASKA 4V2WA 1ULFA 2RQPA 2NNYA 1TWGJ 5D6FA 5LFAA 1RUI2 2BVMA 2VOXA 3LQCA 1FI2A 3GTOJ 1PO12 3BTYA 3FXOA 1OCPA 2BXYA 4E2GA 1W8HA 1UYPA 1EPZA 2XLGA 5B66C 2W48A 3LSHA 3RSJA 1XTAA 2EICA 3POEA 4ZDOA 1AUYA 4N4OB 1HSTA 1W7PD 3J7LA 5D1IA 3T3YA 5CNAA 1Y8QB 3U21A 2WFPA 3PM1A 1ZR4A 2V5DA 4BQ1A 4A3GJ 1YQCA 2KISA 4LORA 4MQ9F 3HKZA 4G6DA 1KQRA 1OVSA 3K4ZA 2WWUA 5FRAA 3Q0WA 2FDGA 3J7MA 1SFKA 3LAGA 4R8HA 4O61A 2DLLA 3EJKA 1LEAA 1PHMA 2Q0AA 1XJAA 1U8RA 1P8JA 4C0HA 3K4KA 4ZDPA 4FOWA 3D5RC 1P7JA 2GC1A 4N7UA 4RBOA 3SHFA 3MUY1 1MBFA 2V5YA 2TEPA 1YIOA 4CP9B 4OI4A 4BKXA 3T2QA 5CISA 2VE9A 4W4ZA 5E3MA 4X6AJ 4DEVA 5FLMJ 4YGEA 4N9IA 4WBBA 2RDRA 4UUVA 4GWNA 1XMXA 3CJNA 4Y3OA 5LBBA 5GZDA 4PCQA 4Q27A 1CGPA 3MZHA 4YVSA 3FN9A 1Z7S3 1AYN2 1OJLA 3AP6A 5CLSA 5F0CA 2ZC2A 2R7EB 4QPIA 5DZEA 2ZPXA 3B3QE 2IGOA 1XSQA 2X51A 4RAZA 2HBUA 5C3SA 4QGLA 5A32A 5DUVA 3VYSB 5BPIA 1NXD1 3HHHA 5HDKA 1U5TA 1ODMA 1NG0A 1YC61 1HW1A 3W3CA 3CQOA 3OJBA 2JB8A 5ABJC 2X1CA 1POQA 5A7NA 2OUMA 4L5EA 4JYKA 4ZH4F 1PZ9A 2WR9A 3WU0A 3ZXAC 1OF4A 2DT7B 5FYHA 1LUJB 2XJVA 4HF0A 3KZIC 1BYHA 1DYOA 5FLIA 2QUOA 3M3OA 1V54H 2YR2A 1AKHA 3NWKA 1W28A 3AZYA 4YFNF 2M1BA 2HWVA 4N4NB 2JDKA 2F17A 2R7XA 3UGHA 2DFHA 1C57A 3D5OA 1C0WA 2VMHA 3ZKUA 1CIWA 4A3XA 2GMPA 3PUQA 5C8WA 2Y60A 3S6PA 3DPUA 3JXSA 2Z69A 4V2FA 5FZKA 4G9SB 1N25A 3MD2A 1C28A 3RJRA 1W6PB 4IHYA 2HYJA 2I8DA 4XN0A 4YZ4A 3VBRB 4ORFA 3WHBA 2R6QA 3B00A 1GOFA 2W9XA 4O9GA 5F04A 4S04A 1QHDA 5DUIA 2DMPA 4AAPA 3V7RA 3W5NA 3L2WA 2BWAA 1BK0A 3HGGA 5F5IA 1F15A 2B9UA 1P4WA 5FROA 3QLQA 4NHMA 2JG9A 2YBPA 1XGSA 3O8HA 2FBEA 4UFKA 2QM3A 2K9MA 4QKNA 4EJVA 4BXSV 3PSFA 2JDUA 5CQGA 1HDPA 5FLVA 2A6XA 3H3ZA 1D4M2 5F08A 3ZPOA 3NNMA 4G8XA 1ODDA 4UF0A 3KMHA 5LB6A 1XOYA 1NTCA 3OD4A 1MW7A 2ID3A 2E2HJ 4O3MA 2EIEA 1BMV1 3DKQA 3I2DA 4Q5OA 3SH4A 1B4AA 2HYGD 1FSEA 2QBYA 3Q8FA 4OZOA 5JVGF 3VV1A 2Y6FA 4Q4ZF 1EAH2 4DMIA 4IEZA 1FMD2 3GYHX 3NV4A 4CDUB 3FXUA 3CO2A 1JKOC 1LDKB 2YC0A 1D2SA 3Q9SA 1KEXA 2HQNA 1WBFA 5JOYA 3JSPA 4Y1VA 4GFBA 2RS12 1JZ7A 5FCCA 4BK4A 3IRRA 1VTNC 1K5MC 1QWRA 2WY7Q 1KFUL 4HPQA 1BBT2 2VQGA 1LDJA 3GZEA 1O5UA 1OKRA 5FY0A 4G3YC 5JDBA 4BNCA 4PGHA 4M3CF 4QD2A 1UZ0A 5M5WJ 4OVEA 2HWB2 2M7BA 3LSKA 5LEKA 2VNRA 5GALA 5FV3A 4N53A 3E3VA 1ASJ3 3IUOA 1XN7A 4I0AA 4QQLA 3WG3A 4P9LA 2FQ4A 1XB9A 1EV12 1RETA 2NXNB 2J1RA 1TE1B 1G9BA 2F2EA 4RFT0 4PK4A 1VRH3 1ENHA 5LLQA 1QNYA 4Y20B 5FZHA 5F6KA 5JXIA 4IW3A 5C7GA 5AC92 3ZP5A 5F0HA 4HLXA 4TXWA 1NQJA 3H3VK 2ZGNA 2YMZA 2XF7A 5I0DA 5FRMA 2BOLA 1RVF1 1KS5A 2QKMB 5JVVA 3SKVA 3AG1H 1XSVA 5E1WA 1J1TA 3FXMA 3UKNA 1D1AA 2M9HA 2YX4A 1VQ4I 1UAAA 1YNAA 4YPJA 1VFCA 4BM8A 4RA2A 2HNHA 5L9BA 3HOWJ 3ETPA 2CUFA 1QBJA 1GUIA 3MKWB 4WZFA 2P7VB 2NVQJ 4M0HA 1W9SA 4M3GA 4BAYA 1HKSA 4META 1IN8A 5DQ0A 3H5NA 1S7EA 1H2LA 5JSPA 4DS0A 5J96B 3CLOA 5EHDA 5LWBA 3LE0A 2OAZA 4AHZA 1AL21 1XG1A 1F4HA 3BJAA 3WV6A 2P81A 4NIGA 1YX5A 4CP9A 5D8LB 5L36A 4Y52J 3LA7A 1H8TB 2JE7A 4UXAA 3H5AA 4HOBA 2Q30A 4EM1A 3VOEA 5IW0A 2YV8A 4GXOA 1BEV3 5IYYA 2BRTA 2ZACA 2L0KA 2MC3A 2R072 4IQJA 2RS32 3ZXLA 2ES3A 1O6UA 1OYIA 5HVQC 4HXCA 1TMF3 3VKMA 1QZZA 4KI5M 3PVNA 4PZJA 1NK3P 3KLOA 2UYBA 3DUIA 3ZQFA 1DQ4A 4AFMA 3N7KA 4OINF 4AWXB 5F37A 1VQ6I 4GDFA 4C2MJ 1PO22 5FMBA 3U4SA 5HBAA 4RHV2 4RGUA 3K3NA 4BBRJ 3THDA 1N1TA 2HVRA 2YYOA 1U78A 5LK7B 2R7TA 1OT5A 3PIPF 2CDPA 2A07F 3LA2A 4W65A 1W04A 4GB33 3ES1A 1GVDA 4M00A 1XB4A 1HIXA