2BGKA

X-ray structure of apo-secoisolariciresinol dehydrogenase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
267
Chain Sequence
TNRLQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADIADDHGQKVCNNIGSPDVISFVHCDVTKDEDVRNLVDTTIAKHGKLDIMFGNVGVLSTTPYSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAKKGSIVFTASISSFTAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDVFGVDSSRVEELAHQAANLKGTLLRAEDVADAVAYLAGDESKYVSGLNLVIDGGYTRTNPAFPTALKHGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
publication title Crystal Structures of Apo-Form and Binary/Ternary Complexes of Podophyllum Secoisolariciresinol Dehydrogenase, an Enzyme Involved in Formation of Health-Protecting and Plant Defense Lignans
pubmed doi rcsb
source organism Podophyllum peltatum
molecule tags Oxidoreductase
total genus 89
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 1.1.1.331: Secoisolariciresinol dehydrogenase.
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bgkA00
3LYLA 1KIFA 4RZIA 2Y0CA 1JVBA 4GGOA 1ZMTA 2G17A 2FWMX 3C7DB 3D4NA 3KEOA 1YE3A 3KETA 2GR9A 4IY1A 1N9GA 4PG7A 1CIVA 2E82A 2VWHA 4HUJA 2QRKA 3AY3A 4JX8A 2WD7B 5DCWA 4E4YA 4A0SA 4ZQEA 1V0JA 4Y67A 3L0DA 4M87A 1HLPA 1EVYA 4I1IA 3WGOA 2A9FA 3A14A 2HU2A 3EUWA 2NV6A 3GF4A 3JQ7A 1E1MA 2EF1A 2AQ8A 4MVJI 4WLFA 4RLHA 4EW6A 4J90A 1Y8RB 2ZIZA 1X15A 1TT5A 1OC4A 3HE3A 5F5NA 1BVUA 3EAGA 3PGJA 3PHLA 3DZBA 4BNWA 1QP8A 3I9LA 4ND5A 3V2UA 3DBHA 5JDIC 1T1RA 4BNIA 3PWKA 4J6FA 4J91A 3AOGA 4MJLA 4DLLA 1U2GA 2HLPA 4LSMA 5ITVA 3GMDA 1XGKA 3JYNA 2VZ9A 5TGDA 1EVIA 3NT5A 4YT5A 5CDUA 4I8XA 4JJIA 1JTVA 4BNKA 3U5TA 4JCOA 5I9LA 4BNTA 1X1TA 1PS9A 2QIOA 5U9CA 1HDXA 1P1KA 3EZYA 5JLAA 1ZNQO 2DBRA 1HETA 3KRTA 4OSOA 4BMSA 1P0FA 3WGHA 1R66A 4U8GA 3WIDA 4JBIA 2PWZA 4Z9YA 3AU9A 3R0IA 2D5AA 3W8DA 2OMEA 5JNLA 3Q9NA 1SNYA 1T2CA 2Q1WA 4YJGA 1P3DA 3U4IA 1TB4A 1DRVA 4M86A 4YQZA 2BGMA 3WMWA 4TRJA 3PHIA 4R9SA 1N1EA 3KBOA 3HWRA 3QJ5A 3KSUA 4BGVA 4KOAA 2WE7A 3AW9A 3ZW8A 4LRSB 4PFJA 2NLOA 3B1JA 4A7PA 2AEJA 2RIRA 3S1LA 1E92A 3JQ8B 4DA9A 4AVYA 3LF1A 1E1KA 4GVXA 2DLDA 5DT9A 1AXEA 1EVZA 3ZWYA 3D1LA 2E37A 4KZPA 4AJIA 4DMMA 5ES3A 4CMHA 2BGKA 1J49A 4BGEA 4KWHA 4J1SA 4NJMB 3GZNA 1P9LA 2ZTVA 3PVZA 1LLQA 2OZPA 4NBWA 4W4TA 4YBZA 1PU2A 1QKIA 1ZK4A 3T4XA 3ONFA 4CL8A 3WGGA 2HJRA 2VRCA 2V6GA 3ENNA 2I66A 2Q1UA 7ADHA 4ZA2A 2EEZA 3L6DA 1IPEA 3HNPA 2BMAA 2X0IA 3H4VA 2X0NA 4BMNA 1GPDG 3ZN2A 4B7CA 4JGBA 1CWUA 2HQ1A 3NX4A 2PGDA 1H6AA 2VUUA 3D4PA 3NDIA 4LRTB 1LQTA 4P38A 4RQTA 3GDOA 3UAGA 2ZTUA 3SLKA 3ETEA 3R3JA 2Q49A 5HS6A 3SC4A 3FR7A 1P1HA 5BSFA 1B7GO 1XG5A 5A5EA 2Q99A 3PQFA 1R4MB 4FGSA 4TROA 2X9VA 3BA1A 3GGGA 3DFZA 3FBGA 3FNHA 4PVCA 3ZU2A 4RPHA 3AJRA 3DZGA 2G1UA 3I6QA 4FSHA 2WD7A 1ARZA 3D3WB 3GN2A 5ICMA 3WWYA 4QSMA 2H63A 4EJ0A 5ER6A 1ENPA 1GDHA 5THKA 4HBGA 3NJ8A 4AJNA 3W4KA 1C1XB 1RWBA 3QWIA 4D45A 1EDOA 1KEWA 1YQXA 4DXHA 2VWPA 4QFCA 4F46A 4XIJA 3TL2A 2UDPA 3UCFA 1H6CA 1JA9A 5JBIA 5I7EA 4YJHA 4XB1A 2FPIA 3C7CB 4RF2A 2JHFA 3NGXA 1XQ6A 3K2BA 3KO8A 1KVTA 2X5OA 3TZKA 3QIVA 1NASA 2NU6A 4ALKA 4NU5A 3Q1LA 3BMQA 3WGIA 3ZI0A 3PJGA 5B1YA 3GG9A 5ITWA 3MJVA 4R9RA 2CF5A 4IZIA 1J4AA 4O6VA 1HEUA 5KJEA 2OFPA 3B20A 2BHLA 5DCUA 4OXNA 3GHHA 1FDTA 3IC5A 4K1LA 5L53A 3JQGB 2VUTA 1E3WA 2GF2A 3PK0A 2C7VA 2D0IA 3GVIA 4IJKA 4DBZA 3GNSA 3INRA 5IZCC 1FDWA 1ISHA 2R00A 1G1AA 1HE4A 2NQTA 3PEFA 3ZNQA 1V9LA 4QO8A 5IAAA 4BKRA 2I67A 4PG8A 1M66A 4XKJA 4F45A 5ILGA 5CAEA 5K9ZA 3KV3O 3VH3A 1YWGO 1KC1A 1YONA 3PDUA 1S7CA 1Z74A 1GADO 1ZEMA 3UUWA 3IUSA 2VRCD 3BTUA 2PZKA 4D3SA 1D1TA 3HADA 1XU7A 3BHJA 2DKNA 2ZCVA 4G5HA 3LC2O 4NK5A 3DZKA 3CEAA 1UXIA 2P5YA 1EFKA 3FTNA 3JQ6A 1PS8A 2I6TA 3OM9A 4CV1A 4E5NA 2YV2A 4OQZA 1ONPA 3S8MA 3F47A 1SPXA 4CM6A 5U1PA 3ITKA 1GQ2A 3AUAA 2I3GA 3ROKA 4IQ8A 2Y05A 1A4UA 1E6UA 2FSVA 4NJMA 1CERA 1PJQA 3L6OO 4RPLA 1GUFA 3WTBA 5KVSA 1H9AA 1K2WA 5CPBA 2DFDA 1CEQA 4R54A 3WX0A 1E0DA 4W99A 5CHEA 4CLXA 3KUXA 1HDGO 4C7KA 4DYVA 3NJ4A 4HNHA 3EMKA 4OH1A 4AJEA 4IM7A 2G82A 5CG2A 3AI2A 4R3NA 5BNFA 2O4CA 3EHEA 4GLLA 4B4UA 5IG2A 3WYEA 5JXWA 1QSGA 3I5MA 3I83A 1GYPA 2VYVD 4Z0HO 2EP5A 1X7GA 3BYZA 1I2CA 3LT1A 3N7UA 3JCZA 1IZ9A 2I5PO 4IMPA 5FEUA 1J5PA 1A9ZA 1R4MA 2R00C 1PJSA 5EESA 3BMCB 3PQDA 3PYLA 4D7AA 4TRRA 1CETA 1X0VA 5TSDA 2BH9A 4E2XA 2AA3A 3G3EA 1XKQA 3FPCA 1OMOA 4L76A 3S2IA 4DLBA 2PD4A 4ONEA 5JYDA 5DBGA 3FBTA 4MPDA 1F12A 2RH4A 4N18A 2A35A 1WZIA 4Y6PA 4WGGA 3MWEB 1H5QA 3RC2A 1DSSG 4XA8A 4CQMD 2EKPA 2VHVA 1PZHA 2ZYAA 3H3JA 4R4JA 2NU8A 1U3WA 3KEQA 5DF1A 1PWZA 3K31A 4WOJA 2YJZA 4CM1A 4QQRA 1UDBA 3JD1A 4UUOA 4JXKA 2VRBA 3JYPA 8LDHA 1TXGA 5B4UA 1PEDA 2C2XA 4U7WA 4EUHA 2O4UX 5H83A 1O9BA 1ZBQA 2QYTA 5COBA 2GLXA 4EUFA 1ISMA 3BIOA 4KDEA 2B35A 1DLJA 1PZEA 4LMPA 2GYYA 3JV7A 5ADHA 3L4BA 2IODA 1LQUA 3JD0A 3HSKA 4MKXA 5TC4A 1B15A 3RKRA 4YRDA 4ZD6A 1FDVA 4YB8A 1M6HA 3RJ9A 1GCOA 2PH5A 3FTPA 1KVQA 4E0BA 3JYOA 4BV9A 3TNLA 3LSYA 2Q2WA 1CYDA 1I2BA 4IS3A 4WE3A 3WYCA 4B3JA 1H93A 5BSEA 3FNGA 4CM9A 3PZRA 2VWGA 3H3FA 4Z3DA 2C59A 1IZ0A 2IXBA 2YQ5A 4Q3CA 3GFBA 1ZSNA 1KC3A 2PKQP 3PYXA 4J3FA 4BO2A 4CQLB 4DLAA 1U3VA 5AQ1A 4GWKA 3ZV4A 4QUKA 1LSUA 4IDAA 5CEEA 3ZU3A 1ISJA 3DQPA 4W7IA 3GVCA 4LK3A 3ZCXA 3QRWA 2PFGA 1UZMA 1LLDA 3CZRA 3PXXA 5A3JA 4IXWA 1ISFA 4CUZA 1T24A 4YAJA 4J4BA 1I10A 3MOGA 3RC7A 2JFFA 3ICPA 2UYYA 2FRDA 3I6IA 3PTZA 4KMSA 4A03A 4B3HA 5A06A 2BI8A 3IS3A 2P2SA 1XU9A 2HMTA 4G2NA 4BKOA 3GFGA 1HE5A 1YB4A 5BNIA 4QX6A 4Z6KA 1DIGA 4I5DA 3WICA 1VL6A 1UXJA 3W6ZA 3F46A 4XYEA 4BV8A 4CMKA 3H5AA 3FR8A 4BIIA 3L4BC 4CJXA 4IMRA 3NUGA 4JNKA 4RV9A 4UEKA 3JQBA 5FYDA 4NPCA 1DBVO 1A27A 1HDCA 2PTGA 4OAQA 4R16A 2BF7A 4ALNA 2DU8A 1ZJYA 3QWFA 3LK7A 3ZWXA 4E2ZA 4YAKA 1C1DA 4HFJA 5IN4A 3EGOA 5KVCA 1PJBA 4ZN6A 1T2FA 3UCXA 2P91A 2HRZA 3RUDA 3T7EA 5CEFA 4XGIA 1YBVA 4CM5A 4ND2A 4ZGWA 3RASA 1IUKA 2BKAA 5I7VA 3CINA 1EUZA 4K9DA 1L1FA 4NMHA 1PQPA 3GGOA 3T4EA 1R12A 2DTEA 4AFNA 4HX5A 2F00A 4FR5A 3VAZA 5IXYA 1BDMA 4R5MA 3EY4A 3AM3A 1UXHA 2B83A 3MWDB 1B8PA 2B0JA 1N1GA 4KTTE 2XXBA 1A71A 5TNXA 2PD3A 1KVSA 3RSHA 4BNNA 4EI2A 3W6UA 4DYDA 3SJUA 4UUMA 3SXPA 3CSDA 1MC5A 1A7KA 4DIOA 1U5CA 1PJ3A 2C2YA 5TJ9A 3LZ6A 3WBFA 4BNXA 1TLTA 2QHXA 3I23A 2X5JO 3UICA 4J1QA 3U4DA 2Q46A 1E3JA 1V35A 1HXHA 1LTHR 4XYMA 2ZJ1A 2BFMA 3OEWA 2EP7A 1GQQA 4D42A 4IUYA 1D1SA 4MP3A 5BSHA 1U8XX 4CM9D 1A5ZA 1NR1A 1O6ZA 4N7RA 1QYVA 4D3DA 3QWHA 1VKNA 3CPSA 4RVFA 2OUIA 1MG5A 1YDEA 5L4LA 1XHLA 3VPHA 2GD1O 4CLOB 3CH6A 3WDSA 1NPDA 3GEDA 4OMUA 1MGOA 1UP4A 2CSUA 3VDQA 5L45A 2EG9A 1Y9AA 3UVEA 2ZYDA 3U49A 1IYZA 3DBRB 3JQBC 5KJFA 1N9GB 2WYVA 3WSVA 1JKIA 2GDZA 3R6DA 2ZB8A 1YOVA 1CDOA 4J7UA 1E7RA 2XOXA 4MO2A 1DRWA 2AEMA 3F5QA 4RGBA 4BKPA 1Z73A 4RF4A 4GKBA 3RQSA 3ZHXA 3BZUA 4IDGA 3VVBA 4NFYA 2Y66A 4TSKA 3JSAA 4NBVA 1E7SA 4QTZA 3Q2KA 4GSLA 4CQLA 3ULKA 3QW2A 3UW3A 4E5KA 4CV0A 2DFVA 3ZNOA 4QECA 4PRLA 1HYHA 4JN6B 5G0VA 1NFRA 4WECA 4FFRA 5GZ6A 1VL8A 1GU7A 2EIHA 2B4QA 3CE6A 3ZNPA 3ZW9A 5K0ZA 2OBYA 2NNLD 3WOHA 3RUCA 3GAZA 1ZK1A 2AQKA 4KDFA 1KS9A 1GL3A 3AUSA 3QE3A 3M1AA 1ONOA 3WQSB 4NZ9A 4PZDA 2YDXA 3IJRA 1ZSVA 2Z1NA 4FFOA 4E5PA 3E6AA 3H7AA 1HDYA 4MIOA 5L4SA 1HWYA 3D5TA 5EMHA 3WMXA 5HTOA 4R5HA 3RVDA 2ZCUA 1ID1A 4P4NA 2HMUA 3M2PA 3NT2A 1GV1A 4AJPA 5JY1A 2GN8A 2ZB7A 1U8FO 4M49A 4MVJA 5T57A 4PN3A 3INTA 2IYOA 4IIVA 1GPJA 3MZ0A 3ZWAA 4YJFB 4DMLA 3H5RA 3O9ZA 4YJGB 4ALJA 3K92A 3KTDA 3ZV3A 1VLLA 3RUIA 1LDNA 3H9EO 3V2GA 3AFMA 1X7HA 3ZWBA 4E32A 2B36A 4BKUA 4P4LA 2D5CA 5F1KA 2JD1A 1NPTO 2X0RA 3PI7A 4XRRA 2GRAA 3JQAB 5JE8A 2HK7A 1MB4A 1N2SA 1OZAA 2FR1A 4FOSA 4J2HA 2CMDA 3TFOA 1ISIA 1LDGA 1G0NA 1C3VA 1LDYA 3KZVA 4JBGA 3I4FA 2G76A 4E12A 3RU9A 4XGKA 1NNUA 2P68A 5A9TA 9LDTA 1ZSYA 5A9RA 5F3RA 1EK5A 1ZIDA 3O26A 1Z7EA 3WQRA 3PGXA 4PLHA 2V6BA 3KLMX 2HRBA 4YA6A 2NTNA 4W82A 3GZNB 4CLRA 2HMSA 4EUEA 1GQYA 5IXSA 2FZEA 4H7PA 3C85A 3NDRA 3VZPA 2R2GA 1L7DA 2QYSA 4B7UA 3HFSA 4ALMA 4BO4A 3DBVO 3D4OA 5AOVA 4IQ0A 4TVBA 2AG8A 2DAPA 5H82A 2QX7A 1EVJA 5DBFA 3W4JA 4U0KA 3QVOA 1EZ4A 1WNTA 4XB2A 4RVGA 5JDCA 1MXFA 5KWEA 3DMTA 1Z45A 4IDDA 1ZK2A 4DVJA 1YQDA 2ILTA 4J0FA 3DBRA 4FD3A 4HNGA 4WLNA 3W1VA 4B7XA 1KVUA 2NVUA 1AHHA 1DHTA 5LCXA 4I9HA 4RVUA 5IDWA 3TPCA 3V1UA 4UVHA 3KLPX 3PIIA 4BO1A 1I30A 1PSDA 1ZK0A 4IDCA 3GNTA 4YWJA 1O8CA 1WVGA 1I5RA 1Y5MA 3RJ5A 3SX2A 1YQGA 2C07A 3VPFA 2HMVA 4TRMA 4MVJD 3FPLA 1WPQA 1SOWA 3AK4A 3E48A 3MJCA 4XQGA 1OOEA 1HZZA 3NAQA 4OGWA 5C7LO 3FI9A 1IULA 1FDUA 3Q0EA 1YL7A 4Z0TA 4YJHB 1AN9A 4DPMA 3OP4A 2C20A 1C0LA 3BHIA 2Y1DA 4PG5A 2O3QA 3CUKA 4F3YA 4AJKA 3BMQB 4B8WA 5CDYA 1D4FA 4CMEA 3DBLA 5A3VA 2RH8A 1AHIA 4H15A 4XDYA 2EW8A 3CKYA 4YCAA 4DPLA 5TRTA 1ADFA 3VH1A 2NUAA 5GZ1A 4UVIA 3I9MA 4FC7A 4E33A 4YR9A 1ZKMA 2WEKA 2P9GA 4CQMB 1HDOA 5G0TA 4RVSA 4ZU3A 5T64A 1E3WB 1HF3A 1LC3A 2YV1A 2O23A 1XIVA 4E6PA 1AE1A 1NFFA 4YJFA 5JDCC 1PGQA 5THQA 1VM6A 1W6UA 3DMTC 4XIYA 4IGEA 4L73A 3ZWVA 3NTQA 3HJAA 1ZFNA 4DC0A 4I08A 3OSUA 4PVDA 3LVFO 3MOIA 5JAMA 3QVXA 3V1YA 3GVPA 2AQIA 1F8FA 2EJWA 5LDGA 3RWBA 1EUDA 3M2TA 3ZDFA 3VKVA 5I7FA 3BAZA 2HKIA 3JQAA 4LSWA 3U3XA 1QORA 1ZO8A 1PX0A 3FD8A 5CDSA 2Q1TA 4CR7A 1E7MA 1NTOA 3DAGA 4CODB 3PHHA 1N92A 4D3FA 1M6WA 3ZNNA 4UUPA 3WYBA 4F6LA 5B4VA 1R0SA 1OC2A 1O0SA 3WLEA 3GNQA 2ZB4A 2GZ1A 3C8MA 5F1PA 1U2DA 3WFJA 2BELA 2BI7A 1TI7A 4PZEA 2ZB3A 5F5LA 1I24A 2YQ4A 4M1QA 5G2OA 1ZMOA 1CRWG 2P4HX 4GQAA 5KOIA 1K6XA 2PNFA 8ADHA 3OQ1A 4F6CA 4L4SA 4FOOA 1ISGA 1VSUA 3TWOA 2IYPA 3KYBA 5L7YA 1SBYA 5CG1A 2ZQYA 2H1SA 1TEHA 2Y1FA 4J9UE 5JO9A 2X7HA 3H6KA 1B8UA 2Y1GA 2VQ3A 3TF5A 4U0JA 3S2GA 3OA2A 2B69A 1NFQA 2X4GA 3A4VA 3UXYA 3K30A 4NHEA 3NT4A 1BXZA 1HSZA 3KSZO 1H9BA 1ADBA 2YY7A 1EK6A 2JJYA 4IQGA 4BB5A 4KWIA 5KKAA 3WTCA 1SB8A 3AM4A 4AJLA 1NVGA 4S3MA 3GOHA 4JROA 1KEUA 1NQOA 1YBMA 4FJ2A 4GKVA 2BFAA 1EBFA 1ZCJA 1Y6JA 2FSSA 4GI2A 4NQZA 5TQVA 2PKRA 2QZZA 1IOLA 3TFQA 1FF9A 1NQTA 1O89A 5JAIA 4M54A 4WUVA 2O3JA 1V3VA 3V2HA 2AEFA 3FSRA 1V3TA 1JWAB 3CIFA 2QRLA 2IDZA 2VYVA 3K73O 1B0AA 2YV3A 1PS0A 5HM8A 2J5KA 1YRLA 5FI5A 3PYMA 1GZ3A 1SC6A 3BTSA 3G79A 4OKIA 3WBBA 4C4OA 3V1TC 2W4QA 2FPPA 2JAHA 2B5VA 2IRWA 1DHRA 1RM4A 3GDGA 5AXCA 1U9JA 1T26A 3GVXA 5B37A 3S2EA 3TDKA 4DIBA 2JD0A 4HWKA 3DTYA 3K5PA 1LDMA 3AOEA 1HTBA 4WASA 4XDZA 1XQ1A 3FNFA 3HDQA 3JQAD 4YQYA 3RFXA 4WCFA 4QEDA 4CQMA 4R1UA 4YYZA 1P0CA 3I9KA 1MX3A 1LLUA 4CMCA 2ZATA 4U5QA 4DREA 4JP2A 4DTIA 1I01A 2EGHA 1Q7CA 3VTZA 1NQ5A 4CLHA 4IPTA 2IEDA 1D7OA 2VWQA 1K6IA 2JFGA 2ZQZA 3B1KA 4JQCA 4XZ3A 5JCJA 4R1NA 3HB4X 1LDEA 1DXYA 4PLYA 1U4OA 3HZZA 3LC1O 3FWNA 2D2IA 2J5RA 4XJSA 4YDRA 3RD5A 5C5IA 4DPKA 2NVBA 2WJPA 5K6AA 2CUKA 1MC4A 4LW8A 1E7WA 4MVJG 1B14A 4J4TA 1FK8A 3IOYA 5JC8A 1IL0A 1K5HA 5C37A 3DHNA 4XYLA 2E49A 5ILOA 3HG7A 2DBVO 2GZ3A 1GZ4A 4RVDA 4ZJUA 5MDHA 1BSVA 1WDMA 2RHCA 5HS4A 4MVJF 2EHDA 4XQCA 4CM8B 4CV3A 3HN7A 4XX0A 2RAFA 1VL0A 4Z9FA 5I9MA 3NRCA 1QRRA 2WYUA 2YHUA 3ANNA 3DZHA 1T2AA 2Q4EA 4IJUA 1D3AA 2DBQA 3ZV6A 2P5UA 1ADGA 4HXYA 5AXBA 3X2EA 4E21A 4MKZA 2O7QA 2PR2A 3AU8A 3WGTA 3UOGA 3AOEC 1GV0A 1PQWA 4WLUA 4TVOA 4CM4B 3RFTA 4J1TA 3GEGA 4AJ1A 1NPYA 1RM0A 3TZHA 3TZ6A 1C1DB 4NU6A 3EVTA 1TT7A 5GZ3A 4RORA 3PJDA 1QV7A 3OJFA 2QW8A 2VUSA 1E6WA 3GPIA 3P5SA 1DAPA 4RDHA 1YB1A 2ET6A 1RJWA 2W8ZA 3A06A 4AJ4A 2YZ7A 2DQ4A 4BOYA 2HMWA 3D5QA 3RC9A 2B4RO 3OHSX 7MDHA 3BHMA 1I0ZA 4BMVA 5K6AC 3OECA 3U0BA 4L9RA 1Q0QA 4EITA 1BDBA 1H6DA 4PLPA 2UV8A 1X7DA 1Z82A 3G17A 1UXKA 4JP3A 3KSDO 5G4KA 1W8DA 4FC6A 4P8RA 5EINA 1U7HA 3UKOA 3WNQA 4B4WA 5GY7A 3MJSA 1X1EA 1ULSA 4NBRA 1DC3A 3CMMA 5JCJD 2GGSA 1GR0A 1SB9A 5T67A 1ORRA 3SLGA 4JLWA 4W9NA 5HBRA 3EVNA 1UDCA 4BO0A 3UHAA 1LUAA 1ENYA 3IUPA 3OA0A 3AFNA 4KP7A 4OYRA 4RL6A 5DBIA 5IZ4A 3WG9A 2FP4A 1DJNA 1Y1PA 5I7SA 1NHGA 1GUYA 4FIZA 4WEQA 1VKOA 1LU9A 3JTMA 1O94A 1LRJA 3VDRA 1C0KA 1LNQA 1UP7A 4NFHA 3UH1A 3IKTA 3ORFA 2W2LD 3GGPA 3W8EA 1YOVB 1LC0A 1Q7BA 1KERA 5A9SA 2C7GA 5KIAA 3PJEA 3ETDA 3B70A 1U4SA 3NYWA 5BNTA 3JYLA 2AE2A 4KUEA 1X14A 3N74A 5I8ZA 4LVCA 4MKRA 3DWFA 3TL3A 3DFUA 4DC1A 1BHSA 1HYGA 5DDIP 3U9LA 1YH3A 3PQEA 3OICA 1P77A 3DONA 3E18A 3QV1A 4XCVA 4WJZA 4GGPA 1BTOA 2X8LA 3MJ4A 1GAEO 4DUPA 3RUHA 1MP0A 2POQX 1LA2A 1R0KA 2E48A 4RF3A 5L40A 3PLNA 4NJOA 5L51A 3JQCA 4OOFA 2I76A 5DN9A 4S1VA 1NVMB 3INGA 1LSJA 2D4AA 4JIGA 3GH3A 3ON5A 4EZBA 3NTOA 1U28A 4IDFA 1RPNA 2J8ZA 3PWZA 1WAMA 1JVSA 1E7YA 1SO8A 1V3UA 3SC6A 4LISA 3ZWCA 3S55A 4CM8A 5TLSA 3L6EA 2DC1A 1BXKA 2FPGA 1H94A 2Q4BA 2Y1EA 4J16A 1J0XO 4MIYA 5AVOA 4CMIB 4PRKA 3IP1A 2WTBA 3GC6A 1R4NB 1HDRA 3N58A 4W9NC 1DRUA 3IKVA 1IB6A 3DHYA 1F06A 3DL2A 5A5FA 3GPDG 5C7IO 4LGVA 2NWQA 4FDAA 3ZHZA 4CL3A 3QWAA 4P22A 5KNLA 3U4HA 3WJAA 4CM4A 1VPDA 3ROQA 3DDNA 3D64A 3NV9A 1QXSA 1KEPA 2VHZA 2ZKLA 2HAEA 1DDOA 1DIAA 4A27A 4OOEA 2PD6A 1M75A 1A4IA 4UVDA 4EGFA 4BUCA 2EXXA 5B4TA 1GEGA 4AJHA 3LQFA 4CMGA 1WMBA 2IE0A 3PRJA 4XD2A 1QYCA 4WK6A 3GEMA 4J4HA 1SEVA 2X23A 2UUPA 4Q39A 3F4LA 5A05A 1GTMA 2VNAA 1RM3A 4TKMA 5JAZA 4XYGA 5JSFA 1X0XA 4D79A 2O3UA 5DULA 5G0UA 2J3IA 2DTDA 3CXRA 3HDJA 5DNAA 4GH5A 2GUGA 2HK9A 3DC2A 4RVHA 4HADA 2IZ1A 4PG6A 4CLRB 5IDXA 2O2SA 3C3XA 5CPFA 3BTVA 4I5FA 4MP6A 5BQFA 1JKFA 2CDAA 2NSDA 2HK8A 5LC1A 1I33A 3O03A 3DAPA 2OORA 2BGLA 2FZWA 4R3WA 4A10A 1WXDA 1U1IA 3C1OA 2UAGA 4OXKA 5JS6A 1JN0A 1UDAA 3ABIA 3ETGA 2E6UX 2V7PA 1B3RA 5CEJA 1LEHA 2Q2VA 1OFGA 4L4RA 1Y8QB 3DEYX 3VTFA 4XEHA 1HRDA 2EKLA 3LLSA 1I36A 3ZWNA 1U7TA 2GPTA 4ZICA 4BS9A 3ANMA 1KEVA 4K26A 5EERA 2TMDA 5AYVA 2P9CA 1EMDA 5B12A 4Q3BA 4R69A 5BT9A 3GHYA 2HDHA 3H65A 4UAGA 1Y81A 3BMNA 2NVUB 4B3IA 5HWSA 1ZXBA 2IZ0A 4BNGA 2AG5A 2OOSA 3SJ7A 3EK2A 3RIHA 2X5KO 3JQ9A 4U6SA 4Y6RA 4NIMA 1K6JA 3ASVA 1YL5A 2C0CA 4MINA 4Z0PA 3HDYA 3GR6A 4BO8A 1W73A 2VHWA 4QT0A 4Y8VA 1SOVA 4JJGA 4OKNA 4C7JA 3AI1A 1I2ZA 4WNIA 3AUUA 4ND4A 3DZJA 2DTXA 4ND3A 1K89A 5I8WA 3P2OA 5TX7A 4ILKA 2EERA 2J6IA 4I5EA 4INAA 4CV2A 1N7HA 3R3SA 4RZHA 5KVQA 2DPGA 3AM5A 2R6JA 2YHIA 2EKQA 4KTVE 3DR3A 1PGOA 4OXYA 4KQWA 1I3NA 2J3JA 1DFHA 3DBLB 1H2HA 4A73A 4BNHA 1KY4A 2WM3A 3OEYA 4ZVVA 2ZK7A 3GRPA 1VI2A 1Q0LA 1UJMA 1V8BA 2VNSA 2WYWA 1T4DA 1QV6A 4UULA 3LLVA 5TF4A 4XRGA 1H0KA 4J1NA 4CMIA 1WMAA 4TZTA 2D3TA 1DLIA 1P33A 3CMCO 3KYCB 2C5AA 3HB5X 1SEPA 3OQBA 1R4NA 4D43A 1IE3A 4N54A 1VRWA 6ADHA 1LX6A 1LSSA 4RQUA 3G1TA 3JQFA 2QQ5A 1PL6A 5L9AA 4L4XA 4DQXA 1Y7TA 4HY3A 3ZWPA 2BLLA 3QY9A 4RO0A 4GL4A 1PQUA 3OQ6A 2Y93A 3DZIA 4K6CA 2EJVA 4D0SA 1SCUA 5EJ2A 2AE1A 3T7CA 2HCTA 4KUHA 4PLVA 5T6BA 1LRKA 1XWFA 3STHA 4DL9A 1P74A 1GUZA 2JCYA 2OP0A 1NAIA 1EQUA 1U5AA 5FFFA 5CDGA 3F5SA 3JQ9C 4FBGA 1F17A 1ZXLA 4E5MA 2H9IA 2UVDA 4BQRA 2NU9A 3AWDA 1BVRA 2ZJ0A 3LT2A 4YAIA 4AG3A 2EW2A 2XPCA 1PZFA 4L74A 4ALIA 1QYDA 2OL4A 1JU9A 3OFSA 2YW9A 1W0CA 4GSKA 1Z6ZA 2Z1MA 4M8SA 3VH4A 4EDFA 3C7AA 3RCBA 3F3SA 3I9JA 4RPJA 4M89A 3DTTA 4EJ6A 1G6KA 2Q50A 3NDJA 4L8VA 1LDBA 1QG6A 3DAFA 1NM5A 1PL7A 1YJQA 2RBEA 5T5QA 4PZCA 5JYEA 1VSVA 1PJCA 5T8KA 3K96A 4UUNA 2VCYA 3MTGA 4IJWA 5EQFA 4P4GA 5DOVA 4RPGA 4CLDA 1J6UA 4QXMA 1HDZA 1B8VA 2GSDA 4MVJH 4RJTA 1Y8QA 2LDBA 4BNLA 4DQVA 1UXGA 4IBOA 4W7HA 4D44A 2JD2A 2Q2QA 2DVMA 2VZ0A 4OHUA 3ZHYA 3IL2A 4MDHA 2HSDA 3JQFC 5EL0A 1PZGA 1DPGA 4ALLA 5CFZA 1PGNA 3H5NA 2E4AA 4BQPA 2QZ9A 5I9NA 3ENKA 3VZRA 1MFZA 4N5NA 1E3IA 3QLJA 1S6YA 4PLWA 1PWXA 3I3OA 3DHEA 4HFMA 4QFDA 2O2YA 3K2EA 3F6YA 2RHRA 2HJSA 3Q3CA 1I8TA 4I5GA 4Y6SA 1NX6A 1LXCA 4RCVA 4DGSA 1TA4A 4YTEA 1MG0A 3IJPA 5L95A 5IJZA 5JMWA 5FI3A 1TVEA 3DXFA 3OBBA 1O5IA 1OBFO 4D0RA 3GMSA 5EIOA 2OP1A 2WWRA 3E5RA 4G65A 3RBXA 3ZU4A 5EQDA 5JPIA 4Q3EA 1BW9B 3GT0A 2X9NA 2CD9A 2I9PA 4WLEA 1GFSA 1MFPA 2FR0A 4NH4A 1NQAO 1MV8A 1T2EA 5G0WA 2NTJA 2D59A 4L0QA 1E1NA 4GPD1 3GLQA 3PWSA 3RUEA 5KJ1A 3LT0A 2X6TA 1HYEA 2P9EA 4E2YA 2X58A 4ESOA 4DWVA 1JLLA 3G49A 4KUGA 2GNAA 3AUTA 4HFRA 4HFNA 4O59O 4WCFB 3OIFA 3U4CA 4NFSA 5AXAA 3H2SA 3KYCA 5T8KC 2C5EA 3VPXA 2Q1SA 1W4ZA 1WDKA 3S2FA 4FB5A 1Q1NA 5JW6A 3L07A 1YJ8A 2VT3A 3WXBA 1YXMA 4O0LA 3M1LA 2JKVA 4K28A 3BXXA 3I9OA 3OH8A 3WS7A 2GN9A 4OSPA 2J5QA 4W6ZA 4AJJA 3IDSA 4FGWA 1DOHA 5G0SA 2OBNA 3Q9UA 4UREA 3U09A 4NI5A 4EEXA 1XSEA 2CVOA 4AJ2A 3GRKA 1YDWA 2O3RA 4EEZA 1HKUA 3ZV5A 2CFCA 5FWNA 1R16A 5TJHA 3ITDA 2P4QA 1ZK3A 3ICCA 1XEAA 4AICA 1O95A 3KYDB 1HL3A 2CF6A 4FCCA 1KVRA 4PLFA 4OO3A 1B16A 3WJ7A 1YVEI 2VTDA 1DEHA 1DB3A 3TZCA 1FMCA 3PZBA 1DFIA 1UH5A 3GG2A 1U3UA 3H9QA 3UGKA 3CTMA 2FY8A 4BO6A 4FN4A 3DOCA 3K8ZA 3MJEA 2B37A 4MVJP 2CNBA 3SBOA 2X1HA 1PR9A 1ULUA 2JCVA 3RROA 5DZSA 2D8AA 2TMGA 2O7SA 2V6MA 2Y1OA 3NTRA 4CUJA 3HHPA 4Z3KA 4J43A 3WWZA 3TQHA 1PJLA 5MGBA 4CMEC 4WNCA 3F4BA 3DB2A 3GDFA 3O8QB 4RDIA 4DQUA 5COQA 5H81A 4FFLA 1GD1O 3LC7O 1B3BA 1X13A 4PLZA 1ZH8A 3E9QA 4YACA 5A04A 4B79A 2CY0A 3Q2IA 4YEDA 1Y5RA 3IP3A 3TRIA 5JO0A 1LI4A 4O63O 4XQ9A 1E77A 3F1KA 4R51A 1XDWA 1UAGA 1JQBA 3IMFA 4ZQGA 2A94A 4PLTA 2XF8A 1M67A 1ZEJA 3FF4A 1ENZA 4CMBA 1ADCA 1RKXA 1YO6A 1WW8A 2BD0A 5KCZA 1EDZA 2CDBA 4GX1A 1EEHA 1FXSA 3E1KA 2O3SA 5DCYA 2QG4A 4DBVO 5IZCA 1PJ4A 2FMUA 4MVJE 1BXGA 1FJHA 3GAFA 4R1SA 2HO5A 2YDYA 2ZTLA 4IDEA 2PGJA 4YRAA 1ZJZA 1MUUA 3EW7A 5G4KB 2PK3A 5EPOA 3VOSA 1BW9A 3FHLA 2PZMA 3TOXA 4ZQFA 1JDJA 1SMKA 2XXJA 5KTKA 4NG5A 2FN7A 1CF2O 4OIMA 3WSWA 1SZJG 1WZEA 1T25A 1UR5A 1F0YA 2PKQO 4BNFA 3GUCA 4XJTA 1QR6A 3UN1A 3W4IA 3KB6A 2C54A 4J0EA 3ZZNA 4E2WA 3DOJA 1PR3A 4TZKA 4IIUA 2EGGA 1Y8RA 3C1AA 2NADA 4CMAA 4IZHA 4CMJA 4O1MA 3WGQA 5L7WA 1M76A 3QP9A 4BNVA 1NHWA 4E3ZA 3E9MA 1VE9A 5A03A 4I9UA 1YBAA 3GUYA 4GMGA 4FW8A 1A9YA 4TRNA 2EV9A 2DT5A 4WOKA 2GO1A 5L7TA 1XYGA 5A1TA 2I65A 3MEQA 1HE3A 5TS3A 4AJOA 5A9SB 2AXQA 4FFPA 1K3TA 4UVEA 4TKLA 2Z5LA 5EN4A 1RYEA 1EQ2A 2X0JA 2VHXA 4TMFA 1E6EA 4ZQHA 1NWCA 1B26A 2VOEA 4BO9A 2C82A 1WDLA 3DMYA 5JAQA 1BG6A 1UP6A 3VHRA 1P44A 4MVJM 1DFGA 3RU7A 3H9JA 3B1FA 5DP1A 2WDZA 5L3ZA 2AQHA 1YS4A 2DPHA 4ZRNA 4A5OA 3KYDA 2FHSA 1I3LA 4FJ1A 1T4BA 1PGPA 1P1RA 1VJ0A 1QLHA 1DC6A 4GWGA 4AL4A 1DC5A 3L77A 4O5OA 3L9XA 5TIIA 1MLDA 2W2LA 5IDQA 4NBTA 3CZMA 2BFOA 3VZQA 4GVLA 4LCJA 3WGYA 1ONNA 2NACA 4A2CA 3NEPX 1HT0A 3HN2A 4FPXA 3PJFA 1JKJA 4I9NA 4Q9NA 4LCEA 1H2BA 4BGIA 1ZW1A 4WLVA 1ML3A 3VZSA 3ZWOA 3ZHBA 4UEOA 4E30A 4YT2A 4HV4A 5ICSA 1EE9A 3JQ8A 2NVWA 5DOZA 3ZWWA 3O8QA 1NBOA 4RF5A 4ZHSA 1VC2A 3A28A 1R15A 1F14A 3AY6A 5DP2A 5JCXA 1QYWA 1LLCA 1EBUA 4HKTA 4RLSA 3DOOA 3I9NA 2DM6A 5KJ6A 4ND1A 5JY6A 4WCFC 5GMOA 2FOIA 4YT8A 5IFLA 2PY6A 1AUPA 2OO5A 3EC7A 3JQDA 4BNYA 2PH3A 3KOUA 1NYTA 2A4KA 4E5YA 4L75A 3H9UA 4Y98A 4DIFA 2OGUA 4Q3DA 3LDHA 3W8FA 3H9GA 3OJLA 4NNJA 4BNMA 4M55A 1LBEA 4CM7A 3GQVA 3P7MA 1M2WA 1G0OA 2JFHA 2F1KA 2Q45A 1CQJA 4K6FA 3TJRA 1A7AA 4Q3AA 2GZ2A 1XCBA 3BTOA 4D46A 5KKCA 4CUKA 2NTVA 3HFGA 1NXQA 4LVUA 1PJ2A 3PLRA 1PGJA 1E3SA 3ADOA 1JW9B 4CR6A 3HUDA 3ROMA 1FDSA 4GX2A 3FWZA 2NQ8A 1UZLA 3LF2A 4XWYA 5CDTA 1NR7A 2YFQA 3ST7A 4YVFA 1NAHA 3D3WA 2OXIA 3O4RA 2O50A 4BVAA 4CM3A 3RFVA 4R1TA 4WEOA 1DIHA 4R01A 1BRMA 1P31A 1QMGA 1KY5A 1C1XA 3GK3A 3Q6IA 3RC1A 1ZZEA 4WPGA 4BNZA 4CR8A 1UAYA 1XR3A 3IAHA 2LDXA 5AXDA 3TZQA 3KHUA 3WIEA 2Z95A 1MXHA 4XYBA 4YRBA 2AMFA 3D3EA 1DAOA 1NVTA 1GYRA 4GX5A 4PLCA 3QA9A 2DUWA 3K6JA 2SCUA 3OMLA 5COAA 1HSOA 3M6IA 1IY8A 1CQIA 3OJOA 1Q2XA 4LMRA 3F1LA 1Q7GA 3BMNB 3E8XA 1I3KA 2AHRA 1BGVA 2IXAA 3R1IA 3SEFA 4ZRMA 4OL9A 1R0LA 1C0IA 5U4QA 5A02A 5KVVA 2PLAA 4WKGA 4MIEA 2GASA 2VT2A 2Y68A 4GBJA 2VYNA 3GZ4A 1VJTA 4U6QA 3C1TA 3JQGA 2BFPA 3PHGA 4IS2A 3MJTA 1E3EA 1RYDA 3I4CA 3RAJA 4GMFA 4TWRA 2GN6A 3C24A 2YHIB 2CZCA 2I99A 4B8ZA 4GAEA 1Q0HA 4JJFA 2JHGA 4GLOA 1Z75A 1B2LA 3DZFA 4J9VA 4B4OA 3Q11A 4YXFA 3WR5A 2V6FA 3WLFA 5HRUA 3IIEA 1KETA 4J49A 1KBZA 1CJCA 1OI7A 3G1UA 3AI3A 3F9IA 3HQ4O 4BO3A 3RBZA 1DJQA 3L4SO 2VZ8A 3V8BA 2PGLA 3K9QO 4IINA 2BRUA 3PDJA 3QVTA 3I52A 3ROPA 3OJEA 3JD4A 4WLOA 1YKFA 3QHAA 4BNUA 2AW5A 4FQ8A 4II2A 1U3TA 5CP8A 4BHTA 3KVOA 4QO7A 1AGNA 1R6DA 1DIRA 1HE2A 3ONEA 2CVZA 3VPGA 4YT4A 3QWBA 2CDCA 3ADPA 3RI3A 4YAGA 1JWBB 3G0OA 1PJTA 2VHYA 1WP4A 5FF9A 1QYXA 3UCEA 1E3LA 1IPFA 3WQQA 3D7LA 1E5QA 4TQGA 2Y67A 3ZU5A 5TT0A 4GX0A 5BSGA 4IGFA 3AY7A 1KOLA 5IDYA 1H6BA 2Y0EA 3QQPA 5C7OO 4OM8A 1GZ6A 1YL6A 5IN5A 3NKLA 2W2KB 2Y1CA 2G0TA 4E13A 1BMDA 1WLYA 4OJNA 1NWHA 1YB5A 3BMCA 4X54A 1RM5A 4H3VA 4R68A 3H2ZA 1LRLA 4FJ0A 1LSOA 3BMOB 2CVQA 1I3MA 2H6EA 3A1NA 3E03A 1A72A 4Z9XA 4BKQA 1HLDA 4ITUA 4R41A 4EJMA 4UEJA 1XELA 1K0UA 2B4TO 2NU7A 3TSCA 4CPDA 1E5LA 1R37A 2GCGA 1C0PA 2VYND 3GN1A 4HP8A 2ZTMA 1DC4A 1N7GA 2V65A 5ENVA 3PP8A 2VTEA 2IZZA 2B5WA 1GCUA 3EZLA 4KQXA 1P45A 5IF3A 2G5CA 4JBHA 6LDHA 3D0OA 3WNVA 3P19A 1DIBA 4E31A 3EDMA 5G4LA 3JQEA 1I32A 4IDBA 3ZWMA 3NGLA 3FRJA 4G81A 3RUFA 1YGYA 3U62A 4BL5A 2WD8A 2W90A 4J7CA 1N5DA 4H16A 5JFOA 2Y99A 4OQYA 4N5LA 3VVCA 3QSGA 1GYQA 3PFWO 5JC1A 4ID9A 3E9NA 3VKUA 3GVHA 5L4NA 1BWSA 2YFHA 4JK3A 2X9GA 4RPKA 3DO5A 3COSA 3ZH2A 4MOWA 4EYEA 2Y0DA 2J3KA 2H5LA 4PIVA 1PL8A 3L9WA 2PA3A 2OHXA 3PIDA 2NM0A 3KXDA 1VJ1A 3A9WA 4LN1A 3SVTA 2YYYA 1MA0A 5LDHA 3WB9A 2C29D 1C14A 3EYWA 3H8VA 1E1LA 2GERA 1JAXA 2WE8A 3JQ7B 3LU1A 4NBUA 3RBVA 4URFA 3PPIA 4BGUA 1TT5B 2RCYA 2PZLA 2O3TA 4WCDA 3KM0A 1GEEA 2Q3EA 4YAEA 5A4DA 1ZVMA 1ZUD1 1E7QA 4D41A 3DBHB 3IQDB 4BB6A 3FN4A 3PHJA 2A92A 3LT4A 3MTJA 5JMPA 2GN4A 3UF0A 2X22A 2JAPA 4NDNE 2O48X 9LDBA 1LJ8A 3OETA 2WMDA 1KYQA 3X2FA 1XLTA 2PZJA 4XR9A 3MCVA 1PTJA 2IEBA 4PG4A 1EUCA 1PIWA 3GY0A 2W98A 4FFMA 4B4VA 4UVGA 5C3MA 5F21A 3RUAA 3GA0A 2J3HA 3TN7A 1DO8A 4ROSA 1Z7BA 1EE2A 3O38A 3JD3A 1IHXA 4IJVA 5ENDA 4FS3A 2VOJA 1P1JA 3OJ0A 4BO5A 1T2DA 2UUOA 5J23A 3VPSA 2EWMA 3E5MA 1GY8A 1V6AA 4J2OA 1N8KA 1JAYA 3ANLA 3OIGA 2XAAA 1HZJA 3I1JA 4Y9DA 3ASUA 1EFLA 4PLGA 1XA0A 2WSBA 4FFNA 1NP3A 4MP8A 3QVSA 5HA5A 1ENOA 2DBZA 5ER9A 3PFFA 3ONDA 2W2KA 4BNJA 1L7EA 1P1FA 5TT1A 3TOZA 2JL1A 4IXTA 3JD2A 3WGZA 2FR8A 3UFXA 4YPOA 2YUTA 1OAAA 1UUFA 3JYQA 4NK4A 2VN8A 3BMOA 1SAYA 5JDIA 3RKUA 4CLEA 4DRYA 2JCXA 4BO7A 3E82A 1P1IA 3VH2A 1Y9EA 4YJDA 3OF2A 3ZGYA 3B6ZA 4NR0A 4Q3NA 1F8GA 1IHYA 4ZQBA 2D1YA 3WFIA 3FCOA 1WWKA 3QVWA 5KJCA 2QRJA 4A26A 2I3AA 3FNEA 2HUNA 1UZNA 4XR4A 4N5MA 1D8AA 2ZYGA 4PGFA 4XQEA 3VC7A 4II3A 1AXGA 4EBFA 2PV7A 3OIDA 4PCVA 1T1SA 3P2YA 4XGNA 2DUUA 3HDHA 5BR7A 3V5NA 4CLOA 2X86A 1QLJA 4J7XA 5F1OA 1BXGB
chains in the Genus database with same CATH superfamily
3LYLA 4I1VA 1XF1A 4I4CA 4RZIA 5JRJA 2QLFA 5AVRA 2RH9B 1ZMTA 3D4NA 1ZIYA 4PHGA 3OE7A 4YC7A 1KOGA 4ZHQF 1NW5A 1N9GA 2NO1A 3N07A 4L6AA 4PG7A 1CIVA 2E82A 4BE7B 5HYVA 4I6JA 3QYJA 3O4GA 4MWBA 2X13A 3IEKA 4JEUA 5LLSA 2DWCA 4KIWA 3KKQA 2FPMA 2OGWA 1AA9A 1G16A 3EXIA 4S1WA 4ZQEA 2OAQ1 2KSQA 1V0JA 2ZBVA 4OK6A 3L0DA 4QBFA 1HLPA 4BQSA 4Z7JA 2AI1A 3ZE0B 2IPMA 4V0ME 5KDLA 5YASA 7REQB 4L02A 4NV0A 3P4XA 4DRXB 1JNYA 3GF4A 1TTHA 2PMEA 3V4VB 4HQLA 3UQYS 6PFKA 1Y1LA 3JQ7A 4I9GA 5JWOA 4RLHA 1Y8RB 4FYHA 1HC7A 3K6RA 3UMMA 1OC4A 5F5NA 4DNPA 1ODSA 1XDBA 1T8WA 2I22A 2C8VA 3EAGA 3SC3A 3PHLA 1FYWA 3ZGLA 2QP9X 1XTPA 4PPGA 5KNDD 1T1RA 1R6AA 4JBWA 4MJLA 4RGYA 3HGQA 1VA5A 1Z2DA 1U2GA 4QGBA 1ND5A 3ZIUA 4YCCA 2IPXA 1GXSA 3JYNA 1JU3A 2VZ9A 3BE5A 3MAAC 4FZVA 3TCXB 4YT5A 4YUWA 2XKAA 3EOBI 1ANKA 2PZ8A 1A8HA 5EVCA 4ZCQA 3WK4A 1CVRA 2K87A 4D4LA 1DARA 2PDAA 1VCMA 4ETNA 2BEVA 1JEJA 1OU4A 1X1TA 1YR3A 4WZBE 2ILVA 2QIOA 3AR2A 1P1KA 4REMA 5E6RA 4RTLA 2H00A 3KXPA 1I0LA 4MGIR 4QAQA 4UMFA 4ZZ0A 2BGUA 4LSGA 4OLBA 1H2EA 3FKSD 1HETA 2HNKA 4KMOA 3B36A 3KRTA 4OSOA 2IGTA 2V54A 4DIDA 4UM8B 4BMSA 4ES6A 3BKWA 2JGRA 3SIRA 2PWZA 1E20A 3G2QA 3R0VA 1FDRA 2D5AA 1J8YF 1RHUA 4JFAA 2OMEA 3KNZA 5EZYA 4YONB 5KB3A 2PWYA 4JJAA 2IW1A 4OFXA 4F11A 4YMHA 3NS7A 3IV9A 4YJGA 1P2FA 4KLNA 1DRVA 1IXZA 4M86A 2TMKA 1VMKA 2BGMA 5HJ7A 1QIKA 5CYOA 4JI2B 3IJEB 1QDLB 2FQWA 5P8WA 5BY2A 1ND6A 1TJ3A 2BBOA 4KDRA 1US8B 1ODCA 1Y6ZA 4Z5XA 2JZNA 1YE8A 4LRSB 3Q0IA 4Q1AA 3IJ5A 1ZHHA 4IDQA 2QLBA 4OLFA 2ZRIA 5E9JA 1SCKA 5EJ9A 3GROA 4AIIA 2AEJA 3KR2A 3JS5A 3MBOA 2BFCB 1CY4A 1E92A 3QPCA 2P6RA 3VC2A 3JXEA 4PHCA 4CIAA 2CVFA 3HPRA 4DA9A 1K0FA 3H19A 5FWAA 2FTKE 3E8SA 2W6MA 4GVXA 2DLDA 5DT9A 3C87A 3KUUA 3PXEA 3M6MD 3ZWYA 3MXOA 4KZPA 5KQRA 4AJIA 1P8AA 3BE8A 5DHPA 4BXOA 4NONA 1N2GA 1J49A 5K4HA 1YCHA 1D9XA 4J1SA 4ZVNA 3WMRA 4YHHB 1LLQA 5CXUA 1PU2A 1ZK4A 4ZOCA 1YC2A 2IC5A 3R77A 2JBAA 4FFWA 4I1UA 4HNAA 1O2DA 4JL8A 4UZSA 3WGGA 5AVUA 4RVOA 5JATA 1R8XA 2Y0BA 2V6GA 3IAFA 2Q1UA 1RJ9B 2EEZA 2Q3LA 4NE9A 3SXJA 3WAJA 3QOYA 1X77A 4EYGA 3HWSA 3MIIA 5HK9A 1H2RS 2BMAA 2X0IA 2YRWA 1SUWA 4D8WA 3LC0A 2X0NA 4BMNA 5B1YA 2PIAA 3AZQA 2XRMA 2HQ1A 1RLTA 5EKSA 4OKSA 2WU8A 2M1ZA 5ELLA 3CG4A 1J0DA 2FQ1A 1LQTA 2Q3JA 3EISA 4IGKA 4P38A 2R4UA 4RQTA 4UU8A 1KQNA 1KKLA 3ETEA 3L43A 4HWPA 3SLKA 7YASA 5HS6A 4RKYA 3NDBB 1OYWA 3ASYA 1R9GA 2WTEA 2RGEA 2ZTSA 1B7GO 4IKEA 4CCWA 4KACA 4R0MA 2ICAA 5A5EA 4PXSA 3PQFA 2WKRA 3FYTA 1QZ3A 3MLAA 5AMXA 5HE8A 2RBKA 3B1WA 3OJCA 4Q4HA 5D3MA 3GLIE 4PQFA 3NMUF 3AJRA 2YINC 3DZGA 3FB1A 1JL3A 3NHUA 2X0KA 3URKA 1U1FA 2VS1A 2DJ5A 5ALQA 2AX3A 4EJ0A 3NYIA 3UJ3X 2AFHB 4BCCA 5TE9A 5FEUA 2GAFA 1ZCZA 1GDHA 3DLTA 3R3UA 4TTIA 5THKA 3NJ8A 4U7GA 5DHQA 1A9OA 521PA 3H9BA 3UMGA 1HBJA 1EDOA 1U81A 3IMKA 3U2QA 1NNSA 1GZ7A 5HQTA 4Y2HA 1XPOA 4DXHA 4QFCA 2E55A 1Z4IA 1OGJA 1E96A 3UCFA 2O8BB 2IXGA 4JT8A 1JA9A 2H29A 2OM6A 2SCUB 3GPCA 2ZXFA 5JBIA 2JS7A 4RF2A 3L0OA 4UTOA 3KO8A 2QVYX 2X5OA 3TZKA 1F2TB 3QIVA 2XITA 3EVDA 5KEIA 4AYTA 3BJMA 2O8FB 3BDAA 3BZWA 3LX5A 3Q1LA 5CTJA 4WA8A 3ZI0A 3UJ8A 2BCGY 4KQ6A 4R9RA 4BX0A 2CF5A 2WF5A 4IZIA 4YO7A 5D86A 1J4AA 1W46A 4O6VA 2QDXA 5KJEA 3VR3A 1NJ8A 3D3KA 5A7GA 4L8WB 4KO2S 3I1IA 3OO0A 3DPIA 1CDZA 1D7AA 2PE5A 3VDXA 2B9VA 4I9FA 2BHLA 1OX4A 1ZOLA 4US0R 3UK7A 2FMTA 2QJRA 3C6MA 2I4NA 3GHHA 1M2FA 1SKYE 2DR3A 3AG6A 4K1LA 4MUBA 2MYNA 3ILSA 4ZO7A 2G6TA 2PSSA 5J1SB 4DB2A 4NLLA 2D0IA 3ABOB 4IJKA 2F8LA 1D8TA 1DTSA 1UEJA 5KQLA 1RS0A 4R7GA 3T5DA 5B1DA 4B3FX 1FDWA 1ISHA 2ARKA 2CJFA 2KBFA 3HUUA 4DLUA 1QVAA 5HNKA 4GLJA 4U2CA 4MW2A 4OA5A 5FB3A 2VDNB 1WMSA 4BC1A 3MRTA 1D6SA 2VKTA 1GT91 2HCFA 3I9V1 2YWJA 3KV3O 3VH3A 2K7ZA 1JP7A 2BN4A 1CY0A 3QENA 5GV8A 1ZEMA 1FA9A 1T6BY 3DHVA 2VRCD 1OF1A 1NBMA 2MR6A 3M6UA 2VK8A 1R0RE 1XU7A 4M0PA 5A2GA 1TK3A 1N6HA 2ZCVA 3PKZA 2A1TS 4DLYA 2ECOA 4RFVA 1QH8A 3TD6A 3GX1A 3JQ6A 3EJWA 4FYIA 3M34A 1PS8A 1QF9A 3BK7A 3OM9A 5ALEA 2AF3C 5EGNA 2YV2A 4ZCIA 3UA3A 5AJYA 3FNBA 5ALRA 5FL7D 1MKYA 1ONPA 3RVSA 3S8MA 1E0SA 3DVSX 3F47A 4Q7JB 3SDBA 2I2CA 3WLLA 1Q0ZA 4FBLA 4JJ8A 1I2DA 4CM6A 1CFJA 3S7ZA 1CEYA 1L5WA 3HKBA 1LNSA 3H1FA 5ARBA 2DFTA 4HYEA 4NJMA 4PX9A 3ISJA 3WNDA 4JYZA 3OY7A 2JRLA 4DA6A 1I0IA 3V8NA 4BFXA 3L6RA 1E64A 1VIDA 2W11A 3TR0A 2VPTA 4Z3OA 2BFFB 2A57A 3Q5GA 1WV1A 4G37A 5CPBA 2FDCA 1N32B 2RAUA 2WP8J 3V4OA 3VBCA 4MQEA 1RTTA 1E0DA 1U3GA 1FRNA 5CHEA 1CUZA 3KUXA 1Z13A 3D7RA 2YZ2A 4C7KA 5ADUS 3QPWA 1NNLA 1P5RA 2BCJQ 1OPRA 3E3LA 4K03A 4GU5A 2A59A 5IARA 4AJEA 4QDTA 3IAM1 3ELUA 1ZN9A 5CG2A 2ODAA 3EHEA 3PKIA 4TXHA 4IHAA 3VKFA 1ZICA 4GLLA 1YZGA 2NYAA 2WC1A 4OQDA 2BR3A 5JXWA 1HE1C 1QSGA 2PUVA 3I83A 5B2FA 3ZUGA 3TLEA 5F2NA 3N7UA 4MQ6A 3K6KA 4Q1VA 2WKPA 1IN7A 3A3PA 4DB4A 2I5PO 4WQMA 2JFZA 2AC7A 5AI8A 4DV5B 3P26A 1X7WB 4B7ZA 3PQDA 4A91A 3PYLA 5HKKD 2QQFA 5EP2A 3FDFA 2BH9A 3VU1A 4E2XA 3G3EA 4MWZA 3ZJ5A 2FK7A 3B6EA 1AK1A 4JXXA 4JP1A 2QL6A 4ONEA 5JYDA 2D7CA 5DBGA 3VYRB 2OG1A 2RH4A 2YS7A 4MPDA 2FVXA 5DM70 4EG0A 1WZIA 5GONF 3D6HA 3GFVA 3OKCA 1SUEA 1GPKA 3H3JA 1L8AA 4MEJA 2A9OA 4W8HA 4BFTA 5ITZB 2OXRA 2YJZA 3RHZA 4DDUA 2P6UA 2YWCA 3UV6A 4UUOA 1NXOA 2AD5A 2HDOA 4NQRA 1BAPA 2FW8A 3ZV6A 1JHQA 4QHTA 4CKWA 1Z5ZA 3QE4A 1FLVA 3AF0A 3V42A 5B4UA 2M32A 3K5HA 1H4VB 2B2XA 2CYCA 1ORTA 3K35A 4JT2A 2F9FA 3E22A 3K2QA 1M2JA 3MAGA 4OP3A 3SBDA 5DWDA 4B17A 4MVXA 1TJNA 3ABQB 3IDOA 3BL5A 3GUUA 2VSQA 3BIOA 3T3HA 4KDEA 2B35A 2IYNA 3FY4A 3HXMA 4HB0A 4LMPA 2A5FA 2W22A 3ELBA 3G2MA 3K05A 1CNEA 3AR7A 2GYYA 3LKZA 4X3CA 4HUQB 3TLBA 3B2EA 3L4BA 3C3KA 1NMZA 2CKMA 2PEYA 3G7UA 4MKXA 1DDIA 1UWCA 2N1MA 3RKRA 2IEGA 1PSWA 2GZRA 4YRDA 3DG9A 3BN3A 5FQOA 4NBSA 5F35A 1E6MA 5BOSB 1GCOA 2A8YA 4PRYA 3FDIA 2G9UA 4M9ZA 4E0BA 1WOYA 2IY7A 1YA8A 2ID4A 3KVYA 3LBNA 4YLYA 4BV9A 5J5CA 4KYVA 3TNLA 2IXDA 3KQOA 3SQLA 1WQ3A 4LDRA 2Q2WA 2QQ0A 4LYDA 2CXSA 4WE3A 3WYCA 2Z58A 1CUWA 3B38A 2X40A 4D98A 2Q62A 1H93A 4EF5A 3FNGA 5J4YA 2FP3A 1Z38A 3PZRA 1RLIA 1H2ZA 1XJWA 2ANBA 3CT4A 1P7YA 3EODA 4Q3CA 3K5IA 2PMWB 1JDZA 2PKQP 4UHKA 4DLAA 2YUIA 3UO8B 2XIQA 3KTAA 2AG6A 3C48A 4LJ8A 4LOHA 2JLRA 1LSUA 4IDAA 4I4TA 2CJPA 2WT8A 3RIYA 1KEKA 1VBKA 4F5YA 3H5LA 5KX5B 4AP9A 1KDPA 2ZRDA 2X9LA 3PXXA 4IXWA 5JI3E 2SICE 5K09A 1HTTA 3UK0A 1M72A 4OHYA 2Q9AA 3G5AA 1JF8A 4J4BA 1K7YA 4HQ6A 4DCTA 2UZ0A 5F2OA 3DVAA 3GZJA 2I2BA 5DGTA 4B3HA 4KMSA 2YX1A 3V1MA 5LWHA 1BCSB 4EH1A 3QU2A 4G2NA 3FPAA 1HE5A 1YB4A 1DNPA 3H1TA 1R6XA 4FZ3A 4S35A 4WFKA 1WPGA 3SS7X 4QOHA 4Z6KA 1V8FA 1A9XB 1MZPA 3RO7A 4P0QB 1UBUS 4RNDB 3OFVA 3WICA 4ER7A 1LV7A 1XRPA 1G17A 1SC1A 1WVIA 2ZIUB 1WKVA 3F46A 2YKGA 1F0NA 4UBKA 3ZHXA 5DGDA 2PWAA 2A5YB 3EG9A 3R3HA 1T0UA 5JQWA 5KOJA 3U39A 4RV9A 4UEKA 3I01A 5FYDA 4NPCA 4TMKA 4DJ5X 4Q9AA 4QJBA 1R6BX 1HDCA 1Q1BA 3T7AA 2BF7A 2BMDA 3W3AH 2BEWB 2FYTA 3LK7A 2G77B 4KSCA 3ZWXA 1C1DA 1NLZA 2CV2A 4OLJA 1T2FA 2PCJA 2JFPA 1SULA 1DS6A 2QN7A 4IO0A 3JVEA 4WN3A 5CEFA 3B85A 1PJRA 3C45A 3D6MA 1JKXA 5K45A 1Q84A 2HRQA 3SR4A 2QENA 4ZGWA 2XMCA 5I7VA 4AK9A 3IQHX 2WJYA 3GGOA 4Y1EA 3MM4A 2REQA 3QMVA 5CYGA 2F00A 2XVMA 3U48A 4PSVA 3VAZA 5AVJA 3BB4A 1UXHA 4KFTA 1B8PA 2B0JA 1N1GA 2D0PB 3G2JA 1A71A 3MMSA 3OJWA 3KQYA 3RSHA 3TTSA 4AG5A 2PGIA 3W6UA 4MIKA 2ZM5A 1LX7A 3KD2A 4QNMA 4RU1A 1OI3A 2IE8A 4UUMA 3SXPA 1SXPA 4RBNA 5KDDA 3Q4GA 3LUGA 1A7KA 3OKFA 4DIOA 2B1RA 4DT1A 2Q2NA 1XTJA 1T8YA 5CLQA 1PJ3A 4C7MA 3D4BA 2OCIA 3NHYA 1TLTA 2QHXA 1VPTA 2X5JO 2XAUA 4G85A 1HXHA 1V11A 4XYMA 3OEWA 2BFMA 2FW0A 2GILA 4OGLA 4TL6A 1GQQA 4K8RB 4IUYA 2X7JA 4ILEA 4YASA 4RXMA 1GU1A 1AUOA 2C5SA 3NLLA 4CM9D 3OQPA 2GBPA 3SOZA 4KI7A 4AAYA 4LYEA 3CUVA 1QYVA 3HA5A 4D3DA 1W8IA 3P9PA 3A3OA 2OUIA 3MTAA 5JXGA 1AO0A 2BY4A 4IYRA 1LNZA 1PQ4A 2VA8A 3NHLA 5L4LA 1XHLA 3LDFA 3CJRA 3GFQA 1IZ8A 1Z47A 3WDSA 4WXPA 4CLOB 2IYTA 1GGKA 4UNRA 1NPDA 4GFDA 1WXFA 3HHEA 2HPVA 4H7JA 2FKAA 4TTRA 1UP4A 2CSUA 4I1YA 3VDQA 5L45A 2PX0A 2BEJA 4CKYA 1SY7A 4E70A 4BAZA 2ZYDA 2MTBA 4C04A 1IYZA 2I2XB 1EYZA 3SHVA 4BZQA 4DLRA 2QRNA 1W0JA 4GL2A 1IQRA 1TLLA 3EFHA 5FI0B 5HRCA 3AHDA 4KLRA 3U3KA 1E7RA 1I1HA 3BG5A 4EAQA 4EKDA 2PJRA 4ETWA 2QVLA 1M2EA 3WLSA 3BE4A 1P5ZB 1ZD5A 1BROA 2Y6UA 4M7WA 1BJTA 4B83A 3V7FA 3PFHA 1H69A 3RQSA 1X7ZB 3HBMA 4IDGA 1CXZA 4XJVA 1K7SN 3WIBA 1ZM2A 3C4JA 3EPRA 5CK4A 3JSAA 4ASUD 3DZ8A 4DF3A 1ZNYA 4CQLA 4WDQA 1K9SA 1SH7A 3UW3A 2VDUE 1LWOA 4MB0A 4CV0A 4EB6A 3VISA 3W1EA 4PRLA 3A9UA 1PFUA 1NFRA 4FFRA 1I6WA 5GZ6A 3H0CA 4YRGA 1GU7A 1BMTA 1MQSA 3RUCA 2WICA 4GR4A 5FPSA 1ZK1A 2AQKA 3EBOA 4NAVA 4PC2A 4BVHA 3D9QX 1KS9A 1SU7A 4RHEA 4TUYB 4XDGA 2JIMA 5BMOA 3C3YA 3WQSB 1YRWA 3BEDA 1ORIA 3H97A 3OQIB 4AO7A 3EUEA 4CWAA 1EVLA 4PZDA 1R8YA 2YDXA 3P9QA 3CGGA 3TPFA 2IZ5A 1PL0A 4FFOA 3H7AA 2R86A 1Z6PA 2C7PA 3A9CA 2XHEA 1HWYA 3WMXA 1DCKA 3V00A 1TW2A 3RVDA 2ZCUA 4DMRA 4JWKA 4MGHA 5FWYA 2HM7A 2D5BA 2A5DA 1NJ1A 3K4HA 3NT2A 2F48A 2P2GA 3KLOA 2AYXA 5JY1A 3VYUB 3O2NA 2NOAA 4BMDA 4EHNA 3UWKA 1E1QA 2ZIWB 3OQMA 5TPZA 3BEOA 5EEGA 1IM2A 9ABPA 5E8JA 1SXJD 1B73A 3A4YA 4UD6A 4YJFB 3ZWAA 3TW4A 3ES9A 1N6NA 1YA4A 1DAMA 4RD1A 1M6EX 5I9SA 1FUIA 1C0EA 1USGA 2VHUA 5GADl 3ZQUA 4P3KA 3DV2A 1M5TA 3QMPA 4BKUA 1WDWB 1TO6A 2D5CA 4F8YA 1VLVA 2YBDA 4MR7A 1CR1A 4F0JA 3AUJB 1GG5A 4HAOA 2X0RA 4KGDA 3K4QA 5EI5A 2ZAMA 4O0MA 1Z6XA 4V0QA 1GLVA 5D87A 2HK7A 2FR1A 3R9KA 4AO8A 5IT0A 3TFOA 2ZJ5A 5BPFA 2FW1A 3RK1A 1JBEA 3AF1A 1E63A 2HI0A 1C3VA 2ZTHA 3MWDA 4MI9A 4N0DA 2J9GA 5IUNC 2OHGA 4MW6A 1TO2E 3ZHRA 3CNLA 1AMOA 3DVLA 1NOJA 5A9TA 1G55A 2DUJA 5I7OA 4TXLA 4OI4A 3GGJA 2RFLA 1N5OX 3O26A 4K9OA 3M9XA 4YA6A 4IG9A 2NTNA 4OREX 4C5AA 1CJTC 4CLRA 2NYVA 1R0CA 1RJFA 2L0XA 4DSZA 4KLAA 3BWCA 4QPCA 2FZEA 4H7PA 4NL4H 5D3KA 3U60B 1YUMA 2X77A 1QBKC 3HLTA 4B7UA 4D96A 3HFSA 2OCDA 3IPRA 3T9AA 2FRXA 1AKNA 3GLFB 2VJQA 2XWPA 3DBVO 3D4LA 1CY2A 4KSBA 4RGVA 4EPVA 4X65B 3MWFA 2N46A 2WM9B 4C3OB 4LOKA 3TECE 3HV2A 2DAPA 4ND8B 1MOZA 3FAKA 5KREA 2QX7A 2IFTA 2R85A 4FHFA 4F6RA 2LPMA 3I6YA 3ND7A 3OURA 3HBLA 3W4JA 1V41E 3QPAA 3ZK7A 2PUHA 3RGGA 4RVGA 5A4JA 6GPBA 2IYYA 3CA8A 1WETA 5JDCA 2AFIE 1ZUNB 5H4GA 4IDDA 2P0YA 3GEHA 4E5VA 2WFZA 1UMCA 3RSGA 4J0FA 4DE5A 3DBRA 3B89A 2QMZA 4FD3A 1MT3A 3DMRA 2PXCA 3GDHA 4L9AA 3W1VA 4B7XA 3MJDA 5K2OA 1OAOA 4Q7LA 3EARA 2XZDA 6REQB 1AHHA 5LCXA 2QX6A 1T91A 5IDWA 2RHDA 1YS2X 4FT4A 3KLPX 4EY6A 2AD1A 1Y1QA 5F2EA 4IUDS 3CNBA 3GJYA 1ZK0A 4QRHA 1TAGA 1VIYA 3AM1A 4IG4A 1WVGA 1Y5MA 5HZHA 2JGFA 3OIWA 4OU4A 4R1PA 4X1KA 1F9EA 4IL5A 3EAFA 4K9KA 2FUCA 3KTOA 4TL9A 1UK8A 1UDXA 4G1MB 3R7WA 5BNWA 1JYSA 4JWTA 5JHHB 1ABBA 2W4IA 3MTQA 1GDDA 1SOWA 1SOAA 1V3QE 3E48A 3MJCA 2Q6LA 3HLKA 1OOEA 4GO1A 5EJIA 4RIIA 4YALA 1L4HA 2XUKA 3JQPA 4OGWA 2F1JA 1FDUA 5KTOA 4Z0TA 4IIXA 1RYBA 1FZTA 1MJGA 1C3JA 2YZKA 2ZBEA 4KWCA 3EY9A 5CB6A 1OY1A 1TCBA 1N6OA 2R8OA 2XH8A 2Y1DA 1JEQA 4LNUB 4OQXA 3OKAA 1FP2A 5FORA 1BOFA 4B8WA 1D4FA 1PJ8A 2QNBA 5FOVA 4CMEA 1GUAA 3FFBA 1KI8A 4PCUA 4ZTUB 1G2IA 2EW8A 5AIAA 1BYIA 3OWXA 4LA4A 2ZR8A 2AOVA 5TRTA 1J5EB 4F8JA 1JR6A 3BD6A 3VH1A 2RHGB 3IDFA 4UVIA 3ZLJA 5GQSA 1R8JA 3UXHA 1ZKMA 2WEKA 1FFAA 5ALFA 5ALSA 1USWA 5F12A 4RVSA 5BW4A 3HYCA 4ZU3A 3D7SA 1URPA 4U7PB 3NHFA 4ZVPA 2O23A 2RSLA 3KKZA 4EJSA 4UTVA 2DMRA 1Q0TA 1QQAA 1Z3IX 5H3CA 1UC9A 5HRAA 2OPHA 4N40A 1V8OA 4C1NA 4I4TF 5DLEA 1GCGA 1USUA 1Y1RA 3AR4A 1H22A 1PGQA 1SZDA 4EJ2A 3V48A 1W6UA 3IMEA 4JT4A 4IGEA 1G8GA 4XIYA 3ZZ0A 3SDSA 3OQNA 2L42A 1AJEA 3OSUA 1N5JA 1RFGE 1SGWA 2NSJA 4XD7D 3R7NA 3TTVA 4FYVA 2WNSA 1I80A 3DKVA 3V4RA 1LPMA 2MHCA 4FMCF 4JV5B 2Z2JA 3ZG6A 2DFNA 1F8FA 2EJWA 4LXTA 3VUFA 5FA8A 2BDUA 3M2TA 3SS9X 4A6EA 3IERA 4GXNA 3D6TB 3IA2A 1SHUX 1YNSA 1NVVR 3JQAA 3CLTD 4KVZA 1ECLA 1QORA 3RREA 1PX0A 5J3JA 3PFBA 3PNMA 1TIBA 2Q1TA 3FOWA 3VFDA 4GOMD 1T5IA 4CODB 5BT8A 3HRKA 3K1AB 1N92A 3PHHA 5LQDA 1FY2A 2HF9A 4D3FA 4PONA 4TMXA 5AI5A 3ZNNA 1NVFA 2GK3A 2CL0X 4F6LA 1V5GA 4CIWA 3MPUA 1EFHA 1LBSA 1O0SA 1OC2A 1UF9A 3MUOA 3N7AA 1J9ZA 3T7IA 2O1XA 3ZCQA 2LCFA 4AIRA 3H2YA 3IT0A 1IOVA 3PIRA 4MSUA 3C6KA 2XVXA 3TLGA 1U2DA 2VP4A 2BI7A 4L08A 4PS0A 3D8SA 3P1JA 2GK6A 4NKRA 4R9NA 3Q3HA 2F3TA 4R31A 4URWR 5G2OA 1CDDA 1ZMOA 1WB5A 2ATCA 1H5UA 2P4HX 4JLOA 4MWDA 4BFSA 5KOIA 4PF1A 3JWGA 4F3CA 3WWDA 2Y71A 3D3JA 4EO7A 3ANYB 3PSHA 5K3FB 4BP1A 4JJKA 1PK9A 1DQNA 2IYPA 5F5XA 4KVGA 3NONA 1CUHA 1WCIA 1TQ8A 1DTWA 2MT9A 2H1SA 3HZRA 2C8JA 3K9FC 1QHYA 4IIHA 5JO9A 4YH1A 1WR8A 4HS4A 3O8RA 4J2TA 3O73A 1M34A 3DH0A 3DXXA 4EY7A 5KOHB 1FNCA 4K86A 5EZ5A 3S2GA 1NDHA 3U9TA 2ISQA 3EXHB 5AK6A 3T9DA 3HKDA 1HSZA 4KYUA 2C4NA 3MBKA 1EK6A 3CWZA 1HUQA 2AZMA 4NZPA 2JI6A 5DNWA 4YP1A 2ZT8A 1FTGA 1NF2A 4KWIA 5KKAA 1T43A 2G67A 5BQXA 1W34A 2XLCA 4H6XA 1XI2A 3UWSA 1XROA 4AJLA 1NVGA 4S3MA 4C6SA 1WBDA 4JROA 4FCWA 3MWYW 3H2IA 2IHUA 1IEXA 2QRHA 4GKVA 4LZPA 5BQ3A 2QTCA 3LP5A 2QXTA 3HL0A 4FNGA 5TQVA 4BDTA 3G0CA 2QZZA 1H66A 1AQUA 3OOHA 1ABFA 3JAWA 1GKLA 2JGNA 1B4DA 3QYAA 1FF9A 3Q8KA 3I42A 2QP3A 4M54A 3UK2A 1IXKA 5FCDA 3JZMA 1QP4A 4KO8A 1PVVA 4D9HA 2D1SA 2ZUTA 2Q4RA 3G0DA 2IDZA 2VYVA 2NZWA 4N9WA 1PS0A 2TSYB 4ZWNA 5HM8A 2QTWB 1TJYA 2AI2A 4NRDA 4B40A 1YRLA 1N3IA 1NE7A 2P67A 1Y3DE 2Q8PA 1KTIA 3TOVA 1NI5A 5KTPA 5L3VA 3V1TC 2W4QA 1QWSA 2Y9PB 5AXCA 1KJIA 3EZNA 3ROEA 1GZHB 3HXLA 1T26A 2JFXA 2O0JA 4MRPA 5AUQA 3LWNA 4TKZA 3TDKA 4HWKA 3G82C 2FP4B 3KOOA 3A6FA 2P77A 1NUQA 1O95D 3FNFA 3W5IA 3P0IA 4WCFA 1P39A 1EXWA 3WYFA 3A9SA 4K40A 1P0CA 4BFUA 1NP7A 2QJFA 1QB8A 2BEUB 3KJZA 3LPMA 1BKDR 1LLUA 2ZIXA 4ZCSA 2R7MA 1OXMA 2ZATA 2WFAA 4RQBA 5AI0A 2YQZA 1O1YA 3RVJA 1VB5A 4AYWA 4EHJA 4DTIA 2CXPA 1I01A 4ERXA 4BJHB 2EGHA 5BWBA 1AZSC 2VSXA 4P6VF 2O0HA 5I45A 3PPXA 2RE8A 1RYYA 4M21A 1P18A 4L9SA 5IUJC 2IYEA 4NU8X 3ZBUA 3ZWQA 2Q3BA 1K6IA 1VP9A 2C98A 4M9CA 4JQCA 2LGJA 3PC3A 1RQRA 5ALHA 2XZLA 1Z22A 3B13B 4M0LA 3T6KA 4PLYA 3HZZA 3LC1O 4UCFA 3DTVB 1YR1A 3CF2A 3FWNA 2WWVD 4QG7A 4H1WA 2J5RA 5C53B 4ITVA 3RD5A 1ZM3A 2WJPA 3W90A 4EYOA 5KWSA 5FWDA 2BHTA 2CUKA 1OIXA 3N9IA 4OGKA 3L1JA 5I7WA 4J4TA 1FX0A 2DFPA 3MQ4A 1JIJA 3IOYA 4WESA 1CUVA 1IL0A 2B2NA 5H16A 1T9KA 1OV6A 3IT3A 7AT1A 2AOWA 1WF3A 3GAMA 2KHZA 4XOUA 3T7KA 1K8ZB 3HG7A 4XYLA 2WQ7A 2GZ3A 3FRIA 1F5NA 3AQIA 3OJXA 4H0CA 3QEAZ 3ESBA 1YS6A 3KSMA 3A1EA 2AH5A 4OD0A 4XB6B 3TTYA 5MDHA 5HG0A 2PUAA 4NYMQ 4RSMA 3UMFA 1WDMA 4DZZA 2EHDA 4CM8B 5B6IA 821PA 4MVYA 1U11A 5I9MA 3NRCA 3Q7SA 5JQGB 3L4JA 4K9RA 2YHUA 5DTMA 2XXAA 5DYYA 1M0SA 1Q3KA 5DXJA 4DXAA 4YV2A 3CEHA 5FAKA 5ESRA 4DLVA 1CE8B 2Q0SA 2IU4A 4EY5A 2P5UA 3QI2A 1VRCA 4E21A 1T5OA 4MYUA 3ECAA 3NH6A 4HDSA 4MJXA 3T9CA 1TU0A 2PR2A 1XNQB 1U98A 3AU8A 4HTFB 3UOGA 3AOEC 2J5XA 4YDHB 4GR9A 2VPQA 5C31A 3RFTA 4D4KA 2DETA 3GEGA 4I50B 1NPYA 2ZZKA 4TKVA 1QRTA 4RACA 2HWKA 2CDNA 4B09A 1UMBB 3EVTA 4OJYA 3G8DA 1XK6A 3I5AA 3PRYA 4URYR 1WU8A 1EGQA 1L5HB 1W5BA 2R8XA 3OJFA 5G41A 3WADA 4W9MC 2EWWA 3DSRA 4BBPA 1EKXA 2EC5A 3K1JA 3P5SA 1DAPA 4FEEA 5DHUA 3NZEA 4RNCA 1UMDA 3N28A 2YXDA 4KGZA 4HWRA 4ZPXA 1N5LA 4G25A 5DMHA 2I6GA 2H52A 3L02A 4PR3A 1CCWA 1EM8A 2FPUA 1YS1X 4JLNA 3RIMA 2WWIA 3CY6A 4JI1B 2V58A 3V7UA 1Q0QA 4MW4A 1BDBA 1HA3A 1N0VC 2WIAA 1U65A 2C42A 4KXVA 3GJTA 3L46A 4HCJA 2C97A 3NEAA 4BV2A 3U7EB 4YR7A 2NSYA 4JP3A 3SYTA 3KSDO 4F84A 1EVKA 2JJQA 5ESWA 1BEZA 3GLKA 5EINA 1U7HA 3UKOA 3WNQA 2O7NA 3PCRB 4CTJA 3OE1A 3BXOA 2CFTA 2BKVA 2ZUUA 4JC8A 4RESA 2GGSA 4O8CA 2G8NA 2EQ5A 3HO6A 3TNDA 2Z2IA 4JOBA 1Q16A 1ORRA 2SECE 1WS6A 2YCLA 1WXHA 3E4CA 1L3BA 1Q0SA 1GGMA 1UDRA 2HSEA 4F4HA 1F7VA 1HOTA 3ZZTA 2QOEA 1U0JA 1UPAA 3WG9A 3JARA 1PV1A 3D8BA 5BOVA 5KCMA 5C4IA 5I7SA 1NHGA 4XIFA 4HJRA 1AH2A 1VKOA 1T4CA 1I13A 1O94A 2NO0A 1ACLA 4G9BA 3SQDA 5FUQA 2ORED 1LRJA 3VDRA 1EP3B 2PMKA 3R3VA 5I3CA 1Y1SA 5JVDA 4WGFA 5A6SA 4B47A 2YVUA 3GGPA 3EX7C 2HD4A 1LC0A 3OZEA 5L6LB 2J7KA 5KIAA 2WIBA 4NE7A 3KTFA 3RWMB 3NBKA 3PFNA 4M53A 1Q95A 3N74A 4MGZR 4UZEA 3P71T 3OPNA 2OD7A 2GARA 3K20A 4LVCA 4MKRA 4HVCA 3MG9A 5GM1A 5K8IA 2R1UA 5HKAA 3U9LA 1YI0A 3OICA 4D9EA 3QV1A 2OGZA 2Q6OA 4DUPA 5GVSA 2X8LA 1GAEO 2IOFA 3FCSB 1R6VA 1RRCA 2JLCA 4DCNA 1LA2A 3MBIA 3CUTA 2WF6A 1A1SA 4RF3A 3OLYA 1V96A 4OOFA 5LSAA 1NJ2A 1Z28A 2I76A 3IXMA 5DN9A 4G0UA 4DYHA 2MMCA 1QYRA 2EYQA 1NKSA 2WLSA 1JLSA 1OLXB 1G1MA 1LSJA 1MMFB 2EFGA 2GZAA 1ODTC 2YW2A 3E9RA 4JIGA 4MGEA 4Y0VA 1R3UA 1F0KA 4ZVOA 3OPYA 5FP0A 1I9GA 3S68A 4EZBA 2AOTA 3WOVA 2NP6A 5ALDA 1ZDMA 3QG5A 4ZOLB 1WAMA 1JVSA 2G88A 5E3HA 3ZWCA 2WF9A 3EH2A 3S55A 1QFXA 3OTOB 1T0IA 3L6EA 3PNVA 1VA4A 4LF5B 4IHJB 3V8VA 2FPGA 1H94A 2Q4BA 4DCPA 2FN3A 3O3CA 2ZT5A 4FNOA 3Q3JB 1PZXA 3GC6A 2FOLA 3KQTA 3ENVA 3F5MA 4G4GA 3DL2A 1A9TA 4JEMA 2J1LA 1M74A 3GPDG 1Q5PA 3A6ZA 3B2NA 4PZLA 2I55A 3AKDA 3CVVA 2NWQA 4AI6A 2ORIA 1N2EA 2V3WA 3SSMA 1N33B 1L4BA 4E1AA 4CL3A 1VMDA 5EKTA 5GINE 1QE3A 1TYZA 3COWA 4HLUA 4MWTA 3CUUA 3MFYA 3ROQA 2YOGA 3NV9A 3SVLA 3BKXA 2VHQA 3MGKA 4MQFB 4GOOD 5C8ZA 5E4YA 1DIAA 4IRUB 4XWAA 1N2CB 1GTSA 3S7TA 1EPUA 2BBTA 2PD6A 9GPBA 2YYSA 3FCCA 2EXXA 4BUCA 3EZ2A 1GEGA 5JSKA 5LU8A 3P2IA 4V0MA 1X87A 3FYUA 3IP7A 3OCCA 4U7HA 3R3ZA 4EA6A 1WMBA 3HXOA 2WQZA 4HWTA 1QYCA 5AHRA 2C9OA 4J4HA 1UCFA 3U44B 2HJ9A 2CHFA 3NBFA 5A05A 1A2KC 1FU7A 2XRFA 5EMNA 4D5GA 4W9RA 3MTIA 4KXNA 4XYGA 1N2OA 3LLCA 1KJJA 3M33A 2O3UA 2NW6A 4Q7MB 1D4OA 1TA0A 3IXQA 4YRTA 5DULA 2DTDA 1FUEA 3HDJA 4C4XA 5A5VA 1U8TA 3QI7A 1L8OA 2GUGA 4FTWA 1ZD3A 3OC0A 3O47A 3D6JA 3DC2A 3G9QA 4EMUA 1AGYA 2CLLB 1VE7A 3NEJA 2DB3A 3EH1A 2B4YA 2WYIA 3K9CA 5BQFA 3UY4A 3BD7A 4N8SA 4WZBA 2EBUA 3SD7A 1S5PA 1T3ZA 2HO4A 2QA5A 1C9DB 1U28C 1I33A 3FGOA 5AP9A 3WNBA 3DAPA 2OORA 1IU9A 2ASVA 2BGLA 2FZWA 2R84A 3O2JA 4G84A 4QYTA 4R3WA 3IKLA 5IVPA 1U1IA 4PSAA 2JEYA 1BXRB 2UAGA 3IDAA 2QLJA 2JIRA 1UDAA 3BHNA 4S24A 4YAWA 1CQWA 3HJTA 5BSRA 4J16C 1LEHA 2ZBQA 1OFGA 2A84A 2WG0A 3CB2A 4L6CA 3DEYX 1BWPA 2PN1A 3RVNA 1X7XB 3LLSA 4F97A 1I36A 2C88A 2Q5OA 3A36A 3LOUA 5DTJA 3W3AD 1YSCA 2OAGA 3A1FA 4I1OA 5E7MA 3ANMA 3KPUA 2JAQA 3JQRA 4K26A 4XVCA 5JTUA 2KX7A 4REQA 3MMXA 5TNXA 4TYYA 1FBNA 1XD8A 2R66A 2XZTA 1GILA 3RYFB 5C1PA 2QROA 2OD2A 2ADOA 4DDWA 1DWPA 1JDBB 5HWSA 2ZOSA 3PC6A 2OFWA 1RI3A 2QG6A 2X6RA 3Q5EA 4NG4A 3EK2A 5JZSA 1I4LD 3OQVA 3LL4A 2NPFA 2R7LA 5LQNA 3RRXA 1JXAA 1K7XB 3PFIA 3SNKA 3MYYA 4NTZA 2HT6A 1BU8A 2QEQA 5GTDA 3WWCA 2PPLA 1YZUA 3AILA 2C0CA 4Z0PA 2IBSA 5MHTA 3U7QA 2GAJA 1W73A 2R8PA 3CWCA 2QZSA 3AY0A 3DPUA 2P3LA 4YK7A 5DNYB 4OKNA 2CYBA 4WK0B 1EXDA 2PZEA 1S4QA 2EU8A 3AI1A 4WNIA 1LVHA 5DN6D 3GYBA 3E3MA 1F9AA 1LS6A 3DZJA 3U61B 1HT2E 1K89A 1XJ0A 2FUNB 5I8WA 1P1BA 2XDYA 3P2OA 4A2QA 3FPEA 2EERA 4I5EA 2V7VA 4NDZA 4NOLA 3W06A 5LP6A 3K2IA 4G41A 5LJIA 4B7AA 2YHIA 1QH9A 4MUEA 2EKQA 2P40A 5E4JA 1JEOA 2WIKA 1I3NA 1PF7E 2D5LA 4HUTA 1OXKB 3AB3A 4K05A 5ECWA 1KY4A 2YYAA 3KD3A 1QS0A 1SUPA 2DWQA 2O1WA 2PCLA 4ZU1X 4Z8YA 3HVRA 1UJMA 1V8BA 4FHZA 4QAJA 5DPMA 1T4DA 4Q00A 5AM1A 2NUAB 3RIGA 3KQHA 3IT2A 4YV7A 4ZKDA 1H0KA 2QMEA 3EMVA 4QBGB 4TZTA 2XTNA 3EEOA 2ZFUA 3D3QA 2D3TA 3KYCB 2DJIA 4RY8A 3TLZA 3HB5X 1W4LA 3T5BA 1SEPA 3OQBA 1R4NA 3O83A 3TDNA 1CQPA 1IE3A 2ZVDA 3ZGVA 4D43A 3ZKAA 1KY3A 3I58A 5L3QB 4I36A 1VXOA 1LSSA 3NOVA 2UVPA 5EXPA 3JQFA 4PWZA 3X1DA 3O4IA 4YRQA 2H4HA 3A1WA 1EGVB 1ZVKA 3B9RA 3L82B 4FHEA 1AB5A 3D43A 4YP9A 2BLLA 2FPLA 3H1EA 1Z2AA 4LSZA 4L4YA 1XUOA 1J8MF 3GUZA 3CNNA 3HRHA 4KYIB 4MAFA 1TCVA 2Q5JA 4PBSA 4PINA 4Y2RA 2RAVA 3DD1A 1Z06A 2G9VA 3G5MA 4HH3C 5EJ2A 4MRAA 1KSFX 3FVQA 4PLVA 5CK5A 2XCQA 4WKPA 1Z4OA 2NMVA 1T5TA 2IQ5A 5K8VA 3L7LA 1H0RA 3HACA 2YR0A 3F5SA 4D3ZA 2WHEA 3C5HA 3O74A 5BW5A 1FXWA 1ZQ1A 3GAAA 3QLUA 3EPJA 2NU9A 4PFKA 2Z6QA 4G6ZA 1QB7A 1T2VA 3V4LA 3LT2A 2NZXA 4AG3A 4CRWB 1Z8NA 4F5DA