2BGKA

X-ray structure of apo-secoisolariciresinol dehydrogenase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
267
Chain Sequence
TNRLQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADIADDHGQKVCNNIGSPDVISFVHCDVTKDEDVRNLVDTTIAKHGKLDIMFGNVGVLSTTPYSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAKKGSIVFTASISSFTAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDVFGVDSSRVEELAHQAANLKGTLLRAEDVADAVAYLAGDESKYVSGLNLVIDGGYTRTNPAFPTALKHGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Apo-Form and Binary/Ternary Complexes of Podophyllum Secoisolariciresinol Dehydrogenase, an Enzyme Involved in Formation of Health-Protecting and Plant Defense Lignans
pubmed doi rcsb
source organism Podophyllum peltatum
molecule tags Oxidoreductase
molecule keywords RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
total genus 89
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 1.1.1.331: Secoisolariciresinol dehydrogenase.
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bgkA00
3T7CA 2VHWA 2NU7A 3TN7A 1YVEI 3F6YA 3RBXA 1KC1A 1KEUA 5TF4A 4L76A 4D46A 1PGJA 3NJ8A 3V2HA 3QA9A 1B8UA 1U1IA 1SPXA 2PTGA 2QYSA 1T2CA 4RF4A 3U4HA 4AJEA 4D45A 5IFLA 1LU9A 1HE4A 3GGPA 1U5CA 5JNLA 4IJUA 4CM9D 4NPCA 5AYVA 2DVMA 1RJWA 3Q2IA 4FC6A 2E37A 5DCYA 2QW8A 1EMDA 3RWBA 1NQAO 2PH3A 2OBYA 5KCZA 1XLTA 3D5QA 3QQPA 3PRJA 3E9MA 3KSUA 4IY1A 5AXAA 3QE3A 4LVUA 3I1JA 1V3TA 3I6IA 4P22A 1Y9EA 4RPJA 2CZCA 2A9FA 1YB1A 3BTSA 3ZU3A 3GLQA 3HHPA 5ER9A 3L6EA 2BKAA 2RH8A 4S1VA 4Q3BA 3DBHA 2H63A 3C1OA 3NDIA 3JQ8A 2YQ5A 3NT2A 1E3JA 5G0WA 1P1RA 2IRWA 1OMOA 4BHTA 5EIOA 1XIVA 3RI3A 5CDTA 3LZ6A 1HDCA 2FHSA 1LJ8A 2PZJA 3GT0A 3IJRA 1JWBB 3IKVA 2HCTA 3DAFA 1KVUA 3PIDA 2IDZA 1HDZA 1SAYA 1SO8A 1S6YA 3V5NA 1IY8A 1IUKA 1UAGA 1ZCJA 2QRKA 2JD2A 4NBRA 2EJWA 2WSBA 1PZFA 1TXGA 3FNFA 4YQZA 5G4LA 1LLCA 3NT5A 2AMFA 1Q2XA 3LT4A 1TT5A 1YL7A 3OA0A 4U6QA 3VKVA 2DTXA 4NIMA 3D4OA 1CRWG 3UKOA 1VM6A 3DBLB 3K2BA 4IIUA 3JQFA 1NVTA 5G4KB 1GCOA 2PY6A 4D0SA 5CP8A 4NFHA 1O8CA 4J1TA 3LT1A 4JP2A 1DC5A 2NACA 4CUZA 1KOLA 2WEKA 3WGIA 2OFPA 3JQDA 1SB9A 2OXIA 4DBZA 5DULA 2VZ8A 1ZEMA 4LK3A 4Q3AA 3ABIA 1RPNA 3K73O 4JCOA 3DZHA 2BH9A 3UHAA 3NRCA 4AJOA 1Z75A 1IE3A 1K6XA 1NYTA 4I1IA 1HL3A 5TNXA 4NZ9A 1I30A 1QORA 6LDHA 1N92A 1E6WA 3R0IA 1TI7A 1UDBA 3D4PA 3HN7A 4U0KA 8ADHA 1CERA 2B36A 3DFUA 1NHGA 1KYQA 1P33A 5I8ZA 5CDSA 4LVCA 4NBWA 1EQ2A 4IZHA 1LSSA 3WG9A 4YRAA 2IXAA 3KETA 1C3VA 5JAZA 4IDGA 3GDGA 3GRKA 4FDAA 4GMGA 1HZJA 2B4RO 1P1HA 1DPGA 2DT5A 1PR9A 4CR7A 2VNSA 4L73A 5EESA 3X2EA 3FSRA 5F1KA 2CVZA 2O23A 5HBRA 1KVTA 2HQ1A 3B1KA 3KBOA 1GUFA 1X1EA 5G2OA 5A06A 4I9UA 1B7GO 3X2FA 3FNHA 5A3JA 1JN0A 3DTYA 3HJAA 3GNTA 4BO2A 2V6GA 3JQAB 5DP2A 4B8ZA 4ZQGA 3LDHA 5DZSA 1E7QA 1XELA 2CDCA 3QVXA 4PRKA 4RVUA 4NMHA 1TLTA 3EC7A 1V8BA 1N8KA 1V9LA 3IQDB 1D1TA 3KO8A 4YDRA 3WNVA 1H6DA 3GG9A 2OHXA 4R16A 1VI2A 4AJ2A 3E9QA 3OH8A 4ZD6A 3WWYA 1GD1O 1R4MB 1TT7A 2VHZA 4DLBA 3AFMA 2AQIA 2VN8A 1R16A 4D0RA 5FF9A 1PJBA 3RSHA 4WLEA 2V6FA 3PHGA 4HFMA 4ZGWA 3WIDA 5A03A 4IMPA 2DPHA 3RVDA 2XPCA 4FQ8A 3GH3A 3KYCB 2P5YA 3VPGA 3QW2A 5DBFA 3QVTA 3RROA 2PNFA 2HDHA 4J6FA 2X8LA 1MUUA 3B6ZA 4TVBA 3U62A 3VPHA 4GL4A 2X0IA 4J90A 3BMQA 3G17A 3JYNA 3QHAA 2VOJA 1F12A 2Y1OA 4BO1A 1LDBA 1NFRA 5ICSA 1KC3A 2RHCA 4OAQA 5JMPA 4KDFA 3RC9A 1TA4A 5A02A 5AOVA 3MTJA 4RO0A 3PTZA 4DL9A 1R12A 1XA0A 3MWDB 2Q1TA 4CLEA 3VHRA 1MB4A 1GADO 4G5HA 4L4SA 1P0FA 3D4NA 5L3ZA 4NI5A 1DC3A 3AU9A 4E3ZA 1W8DA 4EEZA 3PJDA 4NBVA 2YDYA 4OOEA 2NM0A 3VH3A 2GGSA 5KVSA 4E13A 1OAAA 2GO1A 4OMUA 1QV7A 5F5NA 5CAEA 1PR3A 3CINA 1KBZA 4PG5A 4U0JA 1N9GA 2X58A 4OOFA 5DCUA 4NG5A 4UUNA 4D3DA 4EBFA 3K5PA 5JY6A 1M6WA 3C7AA 4TWRA 4J49A 5EL0A 3WSWA 3DTTA 2CF5A 4RQUA 4YT2A 1GPJA 4J4TA 1E3IA 3BA1A 1CYDA 1FJHA 2EGHA 3OA2A 4QECA 5GY7A 3JQGA 1OC4A 3DZGA 1O89A 4DC1A 4JP3A 3LC7O 2ZK7A 4ALLA 1X7HA 4DIFA 4Z6KA 4IDBA 3RKUA 1ZK4A 4XEHA 4AL4A 1I32A 4EDFA 4CLRB 2C29D 2VHYA 2UV8A 4YA6A 2V7PA 1NWCA 1VKNA 3ZWAA 3Q9NA 5L9AA 3WX0A 4CV1A 2PWZA 2VYND 1FK8A 1PSDA 2BFOA 2OOSA 2P4HX 1H5QA 5CEEA 4DQVA 3ZWYA 4H16A 3UAGA 3OSUA 4YAKA 1LDMA 1MC5A 1N2SA 4QEDA 1LSJA 4PLWA 2VZ9A 3QRWA 1P45A 2VYNA 4PVDA 4XR9A 5CDUA 4II2A 3DZIA 3U5TA 4ESOA 3U3XA 2O3UA 4QTZA 2PA3A 2QIOA 3ZNPA 3PGJA 4CMJA 2Q99A 4AJ4A 2O3SA 4Q39A 1PGOA 1DLJA 2C7GA 3LVFO 4HFRA 3W4IA 2UUPA 3QP9A 4CM4B 1C1XB 1D8AA 5I7VA 3S2FA 4NR0A 1JQBA 3LSYA 4W4TA 2GN8A 4OKNA 2JFHA 4TVOA 4EUEA 1Z74A 3RC2A 2DC1A 2P5UA 2E49A 3B70A 3H9QA 3RUDA 1FDTA 4B8WA 2JCVA 3JSAA 1NPTO 4ND5A 1DIHA 2NU8A 1T1SA 2OP0A 4O6VA 4XQ9A 1X13A 3L4BA 4E2WA 4YAGA 4P4LA 5LDHA 3DHNA 3JYQA 1PJ4A 3PI7A 4M8SA 2R6JA 1LA2A 3AUTA 2YV3A 4RLSA 3JQAD 2ZJ0A 3ZWBA 4ZQHA 2Y93A 4AJLA 1YBMA 1Z73A 3MJEA 1C1DB 2QG4A 3U09A 1FDSA 4YT5A 3ZGYA 2GZ3A 2X1HA 4B4UA 3H9UA 4CM6A 4JX8A 3Q3CA 1ISFA 1PGNA 3VDRA 1X14A 3GDOA 3GMSA 5H83A 3TZ6A 5JE8A 1NQ5A 1NXQA 2VTEA 5FFFA 2UAGA 2DKNA 1YGYA 4I8XA 2WJPA 1EBFA 5JO9A 1UH5A 1N1GA 3U4CA 5C5IA 3U4IA 2O48X 1Y7TA 2IEDA 2YY7A 2NTNA 1CWUA 2EP5A 3GAZA 4URFA 3WWZA 5B4VA 1VKOA 2LDXA 3JQGB 4HBGA 1EVIA 3VVCA 1KEPA 2QRLA 3H7AA 1L1FA 4WK6A 1HE5A 1OOEA 5DCWA 3BHMA 3RKRA 1WDKA 3UCEA 3UXYA 3FBTA 2I65A 4BIIA 4F3YA 5ER6A 2VWQA 3WQQA 1EE9A 2VYVD 3NV9A 3DHYA 1YQDA 4IS3A 4DUPA 1PZGA 2IZZA 5CDYA 2VUSA 4R54A 1GPDG 3I4CA 5AXBA 1LEHA 1RM3A 3BHJA 1QYCA 1VRWA 2CVOA 2PKQO 1E7MA 1PIWA 5JYDA 1KEWA 2FR8A 1GUZA 3FTPA 3TFQA 2ZTUA 4BNVA 4NK5A 3AI2A 1T4BA 4OL9A 3Q6IA 4XCVA 4TRJA 2B5VA 1BXGB 3NX4A 5A9RA 4BV8A 1XQ6A 3LQFA 1SBYA 3GY0A 3ZWMA 1YE3A 4DLLA 5GZ6A 1EUZA 3GFBA 3TSCA 2A94A 4ZA2A 3PPIA 1ISIA 3RU7A 4YCAA 4OIMA 5JDIA 4CUJA 4CQMD 2VT2A 1K0UA 5IDXA 3H2SA 1DRWA 4IGFA 4R69A 5I7EA 3IOYA 4WNIA 3NGXA 4PLPA 1UJMA 1I3MA 4G65A 1HYGA 2J3IA 5CHEA 2SCUA 3IUSA 3U0BA 2Q2VA 1JWAB 4Y6PA 4UUOA 4KMSA 1AXEA 3V8BA 4E12A 1F14A 2XOXA 1XCBA 1XWFA 4G81A 2C0CA 4ZQBA 1Y5RA 4CLOA 5H81A 1VE9A 3BZUA 3IP3A 3MCVA 3JD1A 4FD3A 2NWQA 3RIHA 1YB4A 3GHHA 3N7UA 4UUMA 3MOGA 3IAHA 4JJIA 1IB6A 1PJQA 2C07A 1H6AA 2W8ZA 1ZJYA 2A4KA 1VSUA 1PQPA 1Q0HA 4O63O 4R9RA 1GCUA 2NVUA 1NAIA 3INGA 1PQWA 4LSWA 4F45A 5FWNA 4KWHA 2W2KB 4YQYA 4BGEA 3ITDA 4XIJA 2CVQA 3WJ7A 2CY0A 3H5AA 3U49A 4AJNA 3M6IA 1C0PA 2CSUA 1ZSYA 1KERA 4MP6A 1TB4A 3V1TC 3GNSA 3PWSA 3ZV3A 2FPIA 1GEGA 4KWIA 1CJCA 1HKUA 1U4SA 2J6IA 1QR6A 4GGOA 4MKZA 2R2GA 1CETA 2Z5LA 3RJ5A 1X15A 1NPYA 3K30A 3ZWOA 4BKOA 1EFLA 1GV1A 2DM6A 2X5KO 4Y6SA 1EDOA 4KUHA 3DBRA 3MZ0A 4WGGA 2BELA 4IZIA 4Q3DA 1YB5A 3PHJA 5EJ2A 4RPGA 1GYPA 3LC2O 3UOGA 2JCYA 1C1XA 1AGNA 4GMFA 1HF3A 3GF4A 4TKMA 2YYYA 1I10A 2W2LD 2FN7A 2YW9A 5ENDA 1DFGA 1SOWA 4P4NA 2C54A 4D43A 4W7IA 4XIYA 2VWHA 4HV4A 4CMEC 2GNAA 1E0DA 2I66A 2YFHA 3F1KA 5G0TA 4JBIA 1MC4A 3M2PA 2GN6A 1ZK3A 5TJHA 4BNYA 3NYWA 4RQTA 3K2EA 3JTMA 3NTRA 4NFSA 2O3RA 3K6JA 1NPDA 1U7TA 3R1IA 5TRTA 2CMDA 3FTNA 3PGXA 5L51A 4A5OA 4NU6A 3WQSB 5EPOA 1BVRA 4XKJA 1O94A 3WGYA 1T4DA 3JQ9A 2NU6A 1K3TA 1N5DA 4CODB 1JDJA 3F5SA 4OJNA 1H93A 1LDGA 3KXDA 4JK3A 2X4GA 5JAQA 1EDZA 2YQ4A 5JO0A 3M1LA 1BVUA 1KEVA 5G0SA 1YJ8A 2NUAA 4OQYA 1AUPA 4CLHA 4E5PA 2WD7A 3L77A 4NU5A 3NAQA 3B1JA 2HKIA 4J4BA 4CMAA 2NU9A 4UVHA 3TOZA 4MPDA 3DEYX 3RFXA 4OXKA 3S55A 2EV9A 3M2TA 1L7EA 3ADOA 5DNAA 2EIHA 4MP3A 1DIGA 3T4EA 3GAFA 3JYPA 3WICA 3WFJA 1MX3A 2DQ4A 1H94A 3TZQA 4PIVA 4BMVA 1MLDA 3AY3A 3O03A 5L7YA 4CMKA 3PHLA 1LRLA 4Z3DA 2FR1A 3HE3A 3BXXA 3HG7A 4JGBA 5A3VA 2Q49A 2B69A 3LT2A 4I5EA 4W9NC 4ALMA 3ZNQA 2FSVA 2HO5A 1ML3A 3GMDA 4NHEA 3WLEA 2VRCD 2GZ1A 1QYWA 4W99A 4Y98A 3SC4A 1GU7A 5TIIA 1T2FA 4UULA 2EXXA 4ONEA 1NR7A 2PKQP 3BTVA 2X7HA 4JJGA 4Z9YA 2IZ1A 1DHTA 4FPXA 1EVZA 5EN4A 4CLOB 5KKAA 3AM3A 2YHUA 3WMXA 4E30A 3TPCA 1DDOA 3PJGA 4J1NA 1OBFO 1CF2O 3I9KA 4PCVA 3KB6A 4GWKA 3ZI0A 7ADHA 3A06A 3DZKA 3KOUA 1RYDA 4Z3KA 2AE1A 4GAEA 4D3SA 1UXKA 3RUCA 5KJCA 2AQHA 4MVJM 3SBOA 4F6CA 2JD0A 4H7PA 3Q2KA 3TWOA 1ZK2A 2V6MA 3P7MA 3UVEA 4IDEA 3W8EA 2Y1DA 1J6UA 2ZATA 4WASA 3WGHA 3W6UA 3ONDA 1XG5A 4MIEA 2WM3A 5U9CA 4RVHA 3KSZO 5KJEA 3VH2A 3QWIA 2ZYGA 1RM4A 3W4KA 1R4NA 5T5QA 1R15A 4BGIA 4J0FA 2B37A 2Q46A 4HXYA 4YACA 3STHA 2ZCVA 4WNCA 3WSVA 2ZQZA 1MXFA 2PZLA 4N5LA 4AJIA 3ROKA 1KVQA 2B83A 3MJTA 1YJQA 1PJTA 3B20A 3DO5A 2OMEA 3ZW8A 4HX5A 4I5FA 4IDDA 1ZH8A 1QP8A 1IZ0A 2F1KA 4FSHA 4XRGA 3VPXA 4AICA 4CM3A 2EHDA 1GR0A 3I9JA 1ORRA 4MJLA 4BNZA 1WZEA 4WEOA 1P1JA 3V2UA 2Z95A 1EK5A 1WAMA 3ENKA 1AN9A 2OO5A 4J9VA 3WMWA 5FI3A 3OEYA 3ITKA 4TRRA 2AEJA 1L7DA 2HMVA 1IPEA 3BYZA 4PLHA 4CM7A 3VTZA 4B3HA 5C3MA 4LISA 1DSSG 4TRMA 3V1UA 3RUEA 2Q2WA 3EK2A 3VOSA 1E3LA 3GVPA 2PD4A 1G6KA 2P4QA 2FWMX 3C3XA 4J9UE 3FN4A 1K89A 1BTOA 2PV7A 4GKBA 1WDMA 1ZK1A 3ULKA 1D3AA 4BB5A 3JD2A 4NJMA 1I2BA 2Y0CA 3PZRA 4XYMA 5EMHA 2HK9A 4L9RA 2AEMA 1EEHA 1R66A 4UAGA 4DWVA 5BQFA 1JU9A 5I8WA 1FF9A 4DTIA 3FPCA 2AA3A 3FWNA 1U3TA 3WOHA 1E7RA 5KIAA 1E92A 3IUPA 5AXDA 5I9LA 4KTTE 2TMGA 1I3KA 3KEQA 3PFWO 3LU1A 1A4IA 1DLIA 3WFIA 1YONA 4PVCA 4J16A 2EWMA 3RBZA 4YT8A 3VPFA 3NGLA 3QJ5A 1PJ2A 5JSFA 4BQRA 2X86A 2ZB7A 4B7UA 2JFGA 3JV7A 2HJSA 3A14A 3OBBA 3OJEA 3W1VA 1Y6JA 2GF2A 3GUYA 4GH5A 4I5GA 4GX2A 1E7WA 4LRSB 3JQ7A 4YJFB 1N7HA 4W9NA 1ZSVA 4KTVE 3P2YA 1W0CA 4ROSA 9LDBA 2Y1FA 3ICPA 4MVJG 2Y1EA 4B4WA 3PQFA 1GUYA 1GYQA 2CDBA 1SZJG 3QY9A 3O38A 4KZPA 1XGKA 1XQ1A 3KLMX 2CD9A 2ET6A 4I9HA 4E2XA 1B8VA 4ND1A 3DOOA 1KVRA 4PRLA 1JW9B 1QLJA 2OGUA 2YFQA 2IYOA 5TT1A 3K92A 5KJFA 3TFOA 4DXHA 5C7IO 1DJNA 3WS7A 1UXJA 5F1PA 3F1LA 1ISHA 1WWKA 2HU2A 2Y99A 1DXYA 1F0YA 1JKJA 1X7GA 1ZFNA 3I3OA 2HMWA 4L4RA 4WUVA 4XQGA 3CMMA 3D3EA 4YRDA 4O1MA 4N5MA 3FNEA 4UEJA 2BF7A 1R37A 5TX7A 2BHLA 2C2YA 3WDSA 3JQ9C 1WLYA 3E5RA 3GUCA 3IC5A 1Q0QA 1Z82A 4FFPA 1QV6A 4CMBA 4BVAA 1Q7BA 1EZ4A 2RCYA 4LGVA 2HMTA 4EJ6A 2RH4A 1ULSA 1BW9A 1LXCA 3I6QA 3ENNA 1D4FA 2VOEA 4BGVA 3ROMA 4BOYA 1SNYA 4IUYA 2ZB3A 2IE0A 1EVYA 2DBRA 4WECA 1MG5A 4DGSA 1D7OA 3ON5A 2RAFA 4XWYA 4BGUA 1HETA 5JLAA 3GC6A 3GR6A 1SMKA 5B4TA 3ZU5A 2UVDA 4JIGA 1MFZA 4UVEA 2CFCA 4XZ3A 2X9NA 4CQMB 5T64A 3L9XA 4RPHA 1W4ZA 3JD0A 1RM0A 3OP4A 3IIEA 3KLPX 5EINA 3HQ4O 4BNIA 4BNFA 4UVIA 1T26A 2VUTA 4OO3A 2O4UX 2C20A 1YKFA 2IODA 1LTHR 5DP1A 2P9CA 5KJ6A 4FR5A 4XB2A 2YHIA 1RWBA 3F46A 4XX0A 3EW7A 4II3A 1G0OA 1SB8A 4BO0A 3PLRA 3ANNA 1LDEA 3RU9A 4BNUA 3RAJA 3MTGA 3PQDA 4RLHA 4TZTA 1UUFA 4MVJI 4MP8A 3JYOA 4WEQA 4QSMA 4W7HA 1DO8A 1Y5MA 3EVTA 4K9DA 5IG2A 4J7CA 2NADA 4RVDA 1U4OA 1R6DA 3HN2A 5CG1A 1VC2A 3PK0A 1WNTA 1P44A 3AWDA 1PWXA 5FI5A 5ADHA 3RQSA 3SJ7A 3VC7A 4XJSA 5ILOA 5K6AA 3WYBA 1G0NA 2WDZA 4FGSA 2WYUA 1IHXA 1NR1A 3A9WA 3N74A 1HWYA 2JHFA 2HK8A 3K9QO 4R1SA 2WE7A 3ZWWA 4PZDA 4AJKA 1HLDA 1J49A 1HZZA 2D3TA 1ENYA 5CEJA 1NFQA 1P1IA 4QO7A 3D0OA 3PJEA 3L4SO 1MGOA 2DBVO 3GNQA 1U3VA 4XGNA 4RL6A 3ZCXA 2W98A 4CR8A 2W2KA 1G1AA 1ZIDA 4R5HA 3CZMA 3ST7A 3Q9UA 1YBAA 4WCDA 3OQ1A 1ADGA 3VKUA 1C1DA 1O5IA 3LF2A 1YO6A 1GQYA 1ZNQO 2YDXA 1P1FA 1T1RA 4TKLA 2ZTLA 3I9NA 3CIFA 2G1UA 2FY8A 2RIRA 4IBOA 5I9NA 3FI9A 1H9BA 3RBVA 1GQQA 3JQ6A 1FDUA 1JAYA 4KQWA 4A03A 2I99A 4JBHA 1WW8A 3DAGA 4IXTA 3PEFA 2QZZA 4RPKA 3ROPA 3W6ZA 1XDWA 4Y8VA 5TS3A 1UXGA 4IJWA 4IQGA 5DOVA 3UUWA 5HS6A 5JFOA 4GI2A 4WCFA 2E4AA 5JCXA 1U5AA 3PLNA 2WE8A 1I33A 3JCZA 3OHSX 4U8GA 4XD2A 3PQEA 5BSEA 4C7KA 1E1MA 1MV8A 2EKPA 3BHIA 3Q11A 4HADA 4RF2A 4CM5A 5A5FA 4I5DA 4RORA 4EITA 1HXHA 4GSLA 2J5RA 1DEHA 1R0SA 5GMOA 5G0VA 4A26A 3WXBA 2DAPA 3L4BC 1FDVA 5JCJD 5BNIA 3ZNNA 5JDCA 5KKCA 1HEUA 4BL5A 4LW8A 5B4UA 1JA9A 4Z9XA 1WXDA 2YHIB 4PLZA 1HYHA 5LC1A 4E32A 4KP7A 1ZK0A 4CMEA 5LCXA 1Y81A 4PG6A 4A10A 1B8PA 4YYZA 3DONA 1SEVA 3FBGA 5B37A 2GASA 5F5LA 5K0ZA 4FFOA 1PEDA 3T4XA 1PJ3A 3GPDG 4HP8A 2XF8A 4YEDA 4N18A 4QFCA 1JLLA 4LN1A 1ZUD1 3INRA 3TZHA 3PFFA 2DPGA 2WMDA 4R1NA 3GRPA 1PJSA 4CM8A 3SJUA 2Y1GA 5GZ1A 2Q3EA 5L4NA 1A27A 3MWEB 3S2EA 4FC7A 1X7DA 4FOOA 4BQPA 4BNNA 5K9ZA 4BV9A 3JQ8B 1EFKA 3RCBA 4R68A 2NTJA 3EHEA 4IGEA 1ID1A 3NEPX 4F6LA 3CPSA 3F3SA 1A9ZA 5CEFA 3PZBA 3ZHXA 1M66A 3O26A 3P5SA 5F21A 2TMDA 2PR2A 3TDKA 4WOKA 1O0SA 1P0CA 1GAEO 1F17A 1QRRA 1EK6A 5CG2A 3S2IA 3C1AA 5L4SA 2EF1A 1VJ0A 4OH1A 2OORA 3CE6A 4WPGA 3C7CB 3MJSA 3K31A 4U6SA 1Q0LA 2GPTA 3OQ6A 4YT4A 2EEZA 4PLTA 3KYCA 4B3JA 1NQOA 2C7VA 1XSEA 2X0RA 4MKXA 1H0KA 3AUAA 2GRAA 3VZSA 3TL2A 2Y05A 5IZCC 1NWHA 4BO4A 4B3IA 1LLDA 4XQCA 1EE2A 2CDAA 3F47A 1Z7BA 1PTJA 3JQFC 4DYVA 2DFVA 4DYDA 5ES3A 3SEFA 1UAYA 1LUAA 1LQTA 4UEKA 4FJ0A 4E0BA 2V65A 3S8MA 5KVQA 3SX2A 4JROA 5F3RA 3WBBA 4DRYA 2JCXA 2IYPA 2EKLA 4J3FA 4PFJA 2I5PO 3ZV5A 2PD6A 4BNHA 1FMCA 3ANLA 3C24A 1V35A 4RZHA 4WJZA 5ITWA 1V6AA 4JQCA 1A7KA 3DXFA 5BSGA 2C5EA 3HB4X 4XYEA 1QLHA 3BAZA 4RCVA 1GEEA 4Z0HO 4J2OA 3DB2A 4NBUA 2P2SA 2QQ5A 4J43A 4OQZA 2O2SA 5AVOA 2UYYA 2NVWA 4R51A 2RBEA 3NKLA 4TQGA 2HJRA 3EGOA 3L6DA 2NVBA 1GQ2A 2PGJA 1ADFA 1XYGA 2H5LA 3OEWA 4FFLA 1PX0A 4UEOA 1C0IA 2BMAA 1Y1PA 2OZPA 5DBIA 3IL2A 3GZ4A 2DTDA 2B5WA 3LC1O 3T7EA 3KZVA 3I9LA 3HSKA 5A9TA 3RUIA 1I3NA 3TL3A 4GVXA 2Y68A 4BO3A 1P3DA 4KQXA 2QX7A 2I3GA 1CDOA 5COAA 4WCFC 3DZBA 2BGLA 3NDJA 4HFJA 4P38A 4DMMA 2VCYA 4DQUA 3QWFA 3W8DA 5L45A 4MVJA 3SC6A 2H6EA 2J5QA 4LSMA 4Y6RA 3DZJA 3ZZNA 4ND3A 1E5LA 3NDRA 2Y67A 3G0OA 4W6ZA 4XB1A 1OFGA 1ONNA 4FS3A 1EQUA 4NDNE 4YAJA 3ZW9A 1B0AA 2Y0DA 4NJOA 1GV0A 3H4VA 3AI3A 8LDHA 3DC2A 1EBUA 3A28A 3R3SA 3EVNA 2P9GA 1MXHA 2HAEA 1YRLA 4BS9A 1Q7CA 3ROQA 2ILTA 1K6JA 4YB8A 5IDWA 2IZ0A 4GBJA 1RM5A 3V2GA 2DLDA 3Q1LA 1PL8A 1Y9AA 1A7AA 1H2BA 3MOIA 4QX6A 1LDNA 3WQRA 4DPKA 3QVOA 5DDIP 2C82A 4WLUA 4TRNA 3OECA 1WMAA 3I9MA 5HTOA 3EDMA 3HZZA 1BXZA 3JQCA 1EVJA 4CMHA 3TZCA 3RUHA 2ZCUA 4Q3NA 4AG3A 4YXFA 3HFSA 2Q4EA 4E2ZA 3GEMA 1A5ZA 5I7FA 2JD1A 3GFGA 1YOVB 3GGGA 3KUXA 3AOEC 2E6UX 4FW8A 5U4QA 1M2WA 2PZKA 1ARZA 4EZBA 3VDQA 1PWZA 1P77A 3V1YA 2ZYDA 1UZMA 3ADPA 5AXCA 2AG8A 1DIBA 4Y67A 3FF4A 1BW9B 2EJVA 2P91A 1R4MA 3N58A 1H6CA 4K28A 3TRIA 2BRUA 4CM9A 5JXWA 3AOGA 1P31A 3PHHA 4XR4A 2X9VA 4QT0A 5THKA 1KETA 1GZ4A 3OF2A 4YAIA 4N5NA 1HT0A 3OM9A 4A27A 2J5KA 5C37A 4ZHSA 1U8XX 4OXYA 1I3LA 2O2YA 1BXKA 3S1LA 3D3WB 1YQGA 1YXMA 3HNPA 4IXWA 4Y9DA 4Z9FA 4J7UA 2D8AA 3BMNB 1E7SA 3FR7A 4WLOA 4NH4A 2HSDA 3D1LA 4DPMA 1SEPA 4WLVA 1EUCA 1PZHA 2O7QA 5KOIA 1F8FA 3PWKA 2BFMA 1E3SA 3E03A 2P9EA 3ICCA 4HKTA 3ZDFA 4R1UA 1LLUA 1PZEA 4J91A 5J23A 2Q50A 3OMLA 4ZVVA 4BO7A 1YDWA 5JC8A 2VQ3A 3KRTA 2FP4A 2W90A 2ZTMA 3IKTA 3E82A 4OXNA 3PYLA 2NLOA 2J3HA 5EQFA 1VL8A 4OSOA 4BUCA 3G49A 3PYXA 3JQ7B 1DJQA 1W6UA 5THQA 3RFTA 2ZJ1A 5B1YA 1WP4A 1VSVA 5IDYA 1LBEA 4R5MA 3QWAA 1IHYA 1BWSA 3CH6A 3GEGA 4FCCA 4HY3A 1UDAA 4BNGA 3EMKA 3L0DA 3JQEA 3H5NA 6ADHA 1PS9A 4JBGA 1GZ3A 1LX6A 1ZSNA 2W4QA 3ORFA 3I9OA 4QO8A 3RFVA 4CM4A 3AI1A 3DZFA 4PN3A 2G5CA 3KV3O 4BNXA 1ADCA 3ASVA 1DIAA 1U2GA 3EAGA 1DB3A 1CQJA 4A2CA 1ZZEA 2Y66A 4BMNA 2X6TA 3F5QA 1P9LA 4JLWA 3KYBA 3HUDA 2VHXA 3ZWCA 1QMGA 3GN2A 4O59O 1HDGO 3GHYA 3HFGA 3SLGA 3DOCA 4IDFA 3OJ0A 5EQDA 1ZXLA 4BO6A 1H9AA 4PGFA 2VWGA 3O9ZA 5IN5A 4NJMB 2W2LA 3OQBA 4MDHA 1ISGA 4UVDA 4BB6A 2WTBA 3EY4A 5F1OA 2X22A 4PLYA 4IMRA 4L8VA 1GTMA 4CLRA 2AQ8A 1JTVA 4C4OA 1U3WA 5KVVA 1C0KA 1ENPA 4HNGA 3G3EA 1T2AA 4E21A 4F46A 3O8QA 1NQTA 3DAPA 1WDLA 4KDEA 5A05A 3IJPA 4TMFA 5KNLA 1QXSA 3KVOA 3GVHA 5A5EA 1IL0A 3JYLA 5BNTA 1K6IA 2GN9A 4YWJA 3A4VA 2X9GA 4J2HA 3E6AA 4DBVO 1A72A 1DBVO 3DBRB 1V0JA 1N9GB 3ZHZA 2EERA 3CEAA 5IDQA 5IXSA 4DMLA 2D59A 3ZV4A 3I52A 1SC6A 5COBA 2FOIA 4BNLA 3HADA 4MIOA 4L75A 1U8FO 4KUEA 3CMCO 4N54A 5IAAA 3SVTA 3CZRA 4R41A 2NV6A 3QVWA 4XA8A 3UH1A 5I9MA 4IQ0A 5L95A 1LQUA 3RUFA 5COQA 1T24A 3JQBC 3CKYA 5H82A 4CMIA 1R4NB 1J5PA 3DDNA 3E18A 2ZYAA 3AFNA 1Z45A 1HYEA 2VYVA 2O3TA 3RUAA 1WZIA 1NHWA 3BMNA 1LNQA 3OJOA 1BHSA 4H3VA 4JXKA 3FD8A 4XYGA 2NVUB 4YJHA 4R1TA 3D3WA 3UFXA 5KTKA 5A4DA 1NVGA 2I76A 1HDRA 2YUTA 2YV1A 4IM7A 3ONEA 2WYVA 1UZLA 2NSDA 2CUKA 2VUUA 3HDHA 5ILGA 5BR7A 4ND2A 4I9NA 3SXPA 5JW6A 4K1LA 4C7JA 4ZN6A 3VZRA 1ENZA 1BDMA 3GZNB 1GY8A 2OBNA 5DF1A 3TOXA 2EP7A 3BIOA 3RD5A 3IMFA 1M76A 2HMUA 3P19A 2BD0A 1ZXBA 2IEBA 3ETDA 4RVFA 5KJ1A 3NUGA 3WYEA 4ZQEA 4ALIA 4ND4A 3H9JA 1B14A 3GG2A 4RDIA 1DRVA 4DQXA 1E3EA 3ZU2A 2VHVA 1A9YA 3DMYA 4YJGA 3RC1A 2OL4A 2EW8A 1LI4A 1PJCA 2VZ0A 4WOJA 4X54A 3WGQA 3ASUA 5L53A 1W73A 3PVZA 1WVGA 1WMBA 1YOVA 2QRJA 2YZ7A 1WPQA 4E33A 2HLPA 1MA0A 3E1KA 4XGKA 3Q0EA 4BKQA 1BXGA 1UXHA 3JQAA 1QKIA 4XYBA 3D64A 1YH3A 4R4JA 1RYEA 4GKVA 4ID9A 3CSDA 2FRDA 2Q1UA 1ONPA 5IF3A 3CUKA 1UP6A 4R3WA 1JKIA 2C59A 5BSFA 5LDGA 2FR0A 4OYRA 3ZWXA 3BTUA 1UDCA 2DUWA 2G76A 2Q2QA 2BFPA 3DOJA 3UF0A 2AG5A 1E7YA 1ZBQA 2DUUA 1U9JA 3BMCA 2D4AA 5BNFA 1HTBA 1I5RA 2DTEA 3QWHA 3PWZA 3G1TA 2O7SA 4MVJH 3PJFA 1XHLA 2X0NA 1YL5A 3GOHA 5G0UA 2VNAA 4XJTA 3ZHBA 1Y8RA 1HRDA 4FFMA 2EG9A 3HDJA 3LLVA 2DBZA 2WD7B 4QUKA 2UDPA 4LCJA 3OJLA 3I4FA 1ZW1A 4PLGA 2GR9A 4S3MA 4KOAA 2VRBA 2B4QA 1K2WA 1E1KA 2I9PA 2X5JO 4BNWA 1S7CA 3VZPA 4CV3A 4R3NA 4RVGA 1Y8QA 4B7CA 2H1SA 2A92A 2BFAA 1CIVA 2Q45A 3ZN2A 1PS8A 4PG8A 3DL2A 2R00C 2BLLA 1E77A 5KWEA 1VJTA 1HSOA 3KHUA 3K8ZA 3NTOA 2AHRA 1ZVMA 1YS4A 3FPLA 1ISJA 4E5YA 1B26A 1YBVA 2GN4A 3H5RA 3WTBA 3W8FA 1BGVA 3JD3A 2CNBA 3RC7A 1PQUA 5TJ9A 2H9IA 2ZIZA 2O50A 2CF6A 1AE1A 1PL6A 4GQAA 4R9SA 1BDBA 4A73A 1AHHA 3EZLA 1JVSA 2JKVA 3WGOA 1DOHA 1RKXA 1ZO8A 5IZCA 2Y1CA 3R6DA 4MVJD 5JDIC 4CR6A 1ZJZA 1ONOA 3KYDB 1IOLA 1IZ9A 3C8MA 2Q4BA 2V6BA 4ZQFA 5JC1A 1E3WA 2D0IA 3GEDA 4K26A 5JBIA 4BKUA 4WE3A 4ZICA 4B4VA 4G2NA 2GZ2A 1E1NA 2GUGA 3H9EO 1U28A 1TEHA 1X1TA 2G0TA 1VL0A 4RVSA 5T57A 2DFDA 4W82A 1XEAA 3H9GA 3W4JA 1T2DA 5AQ1A 2PLAA 4FIZA 2PFGA 3OIDA 5JDCC 4FN4A 4YTEA 3LYLA 1C0LA 3S2GA 3EYWA 3ZH2A 1DFIA 3TJRA 3BTOA 1KIFA 1UR5A 3O4RA 3KYDA 2O3JA 1HLPA 1Z7EA 2VRCA 4E6PA 5A9SB 2RHRA 2OUIA 1U2DA 1TVEA 5JMWA 1ZMOA 2D1YA 3G1UA 1HDOA 5ENVA 4CQLA 2IXBA 2VTDA 5L7TA 2Q1SA 5HWSA 1O95A 2NQ8A 4LCEA 1CEQA 4GVLA 3R3JA 1D1SA 3PHIA 1DHRA 2QZ9A 4L74A 2D2IA 3AW9A 4EUHA 1R0LA 3CXRA 2PGLA 2F00A 3UICA 4CUKA 1N7GA 2EGGA 3H6KA 3E48A 3FCOA 4XRRA 4CV0A 2NQTA 4NQZA 3I23A 2JFFA 1H2HA 4XDYA 4J4HA 1E1LA 4NFYA 3RASA 1Y8QB 3E8XA 4J0EA 5JPIA 2PD3A 4GWGA 4IJKA 4GLOA 3UCFA 2QYTA 3E5MA 1JVBA 2ZQYA 4CL3A 2GLXA 2J8ZA 3COSA 4AVYA 1VLLA 3HDQA 4YJDA 3VPSA 3GVIA 1P74A 3WJAA 4DC0A 3AJRA 3AY7A 3UN1A 1LDYA 3QSGA 4PLCA 4CPDA 1E6EA 4RJTA 1DAOA 1PGQA 1UXIA 4EW6A 3DR3A 4BMSA 4L4XA 3DQPA 2R00A 3VH1A 2AXQA 4D42A 4BNJA 5A04A 4RZIA 3ZU4A 1Q7GA 3JD4A 3IS3A 5FYDA 4BO8A 3MJ4A 1M6HA 4J1QA 4LMPA 2B4TO 3I83A 3OIFA 2XXBA 2GERA 1ISMA 5DN9A 2DU8A 5JCJA 1CQIA 4L0QA 3FR8A 4RPLA 4YRBA 4ALJA 5L7WA 3NTQA 5HS4A 2WD8A 3I5MA 2GD1O 3D7LA 2LDBA 4EJ0A 3OIGA 3TZKA 4Q3CA 2I67A 4AJPA 4M1QA 3GDFA 4MVJF 3UCXA 4YR9A 4CV2A 3TNLA 3VTFA 4BO9A 1NAHA 2I6TA 3AM4A 3H8VA 5T8KC 1A71A 1DC4A 1VL6A 2POQX 4BNTA 1IULA 2X23A 1N1EA 3OETA 4YAEA 4Z0TA 4M87A 2O4CA 4RDHA 4WCFB 1R0KA 5CFZA 3VZQA 4IIVA 4EI2A 3LT0A 4FGWA 4WLFA 2JJYA 4GX5A 4IS2A 4A7PA 1HDYA 5A1TA 1B3BA 4BNMA 2B35A 1NBOA 1DC6A 2YJZA 5BT9A 3H65A 5CPBA 3TQHA 5JAIA 1O9BA 9LDTA 2PKRA 4HWKA 1IYZA 3DMTA 4GX0A 1NM5A 5JS6A 1DIRA 4RV9A 1YDEA 4YVFA 1QG6A 4HNHA 4DIBA 1H6BA 2JL1A 2XXJA 4TSKA 4ALKA 1QSGA 1BSVA 3TF5A 2X0JA 3AOEA 2JAHA 4UREA 4CQLB 4IINA 2VT3A 4FB5A 3DFZA 3L6OO 2FZEA 4MKRA 2HMSA 1UZNA 3C85A 4CMIB 3UW3A 3WGTA 1I0ZA 1M67A 4PLFA 1J4AA 2AEFA 1B3RA 4LMRA 4ZRMA 3VAZA 4DPLA 4KUGA 4M86A 4NBTA 3D5TA 3M1AA 1OI7A 4FFRA 3GA0A 4GGPA 2J3JA 4HUJA 4ZU3A 4BNKA 1NX6A 4D79A 5IZ4A 5HRUA 1DRUA 5L4LA 4K6FA 3AM5A 1ADBA 2NNLD 4OSPA 1C14A 2E82A 3ANMA 1DFHA 5JAMA 3H3FA 3WR5A 4E4YA 1E3WB 4D3FA 1KVSA 3ZWPA 2GSDA 3C7DB 1YL6A 2ZB8A 4E31A 1U7HA 1GZ6A 1ZMTA 4CMGA 1SCUA 3O8QB 1XKQA 5L40A 3A1NA 3K96A 2NTVA 4K6CA 5MGBA 3ZNOA 1NVMB 5KVCA 5C7LO 5U1PA 4NK4A 1NNUA 2Q1WA 4R01A 4PZEA 2AE2A 1I24A 1UP4A 1GDHA 1V3UA 4O0LA 1PU2A 4DIOA 2XAAA 4OGWA 1AHIA 2PGDA 2EKQA 3DBLA 3LLSA 1LSUA 2ZKLA 3KTDA 5TGDA 1NP3A 1KY5A 5TSDA 3FRJA 4A0SA 1LLQA 4I08A 4DA9A 5ICMA 3IDSA 3P2OA 1A4UA 2FPGA 3DBVO 1I8TA 3F9IA 3MEQA 3U9LA 4E5MA 1O6ZA 3CTMA 3AU8A 3LK7A 3AUUA 3GGOA 4CLDA 2FPPA 4IJVA 3HDYA 1MG0A 2OP1A 3E9NA 3GVCA 4MOWA 4D41A 5EERA 4AJ1A 3F4BA 3FNGA 3ETEA 4CM8B 2HRZA 2QHXA 1BRMA 2FSSA 4GX1A 3EZYA 2B0JA 1XU7A 1Y8RB 2G17A 2EW2A 4IDCA 3UGKA 1B2LA 5FEUA 4OHUA 2FMUA 1X0VA 3JQBA 4UVGA 5CDGA 3BMCB 4GLLA 4P4GA 1LC3A 3AY6A 3F4LA 4FFNA 1LSOA 3DBHB 1MP0A 3QIVA 3C1TA 1Q1NA 4M49A 4MO2A 4Q3EA 3INTA 3OFSA 4U7WA 4ALNA 2VWPA 4IQ8A 2X5OA 3PDJA 4EGFA 1GL3A 2UUOA 3MJCA 2WYWA 4HFNA 2BGMA 2P68A 5IJZA 4GPD1 4TROA 2BGKA 3ETGA 4PLVA 5TQVA 4BO5A 1AXGA 4JN6B 4MVJP 3GN1A 5C7OO 1HSZA 3B1FA 5B12A 1ZEJA 4O5OA 5IN4A 1B16A 3BMQB 5TC4A 4MIYA 4PG7A 2D5CA 1T2EA 1BG6A 3NT4A 5BSHA 4PG4A 5A9SA 4XGIA 1BMDA 1I2ZA 3H2ZA 4RGBA 3QLJA 3PDUA 5GZ3A 2O3QA 1LC0A 4QQRA 4XYLA 3WLFA 3WTCA 1DAPA 4QFDA 2ZTVA 1HE2A 1SOVA 3OJFA 2PK3A 4H15A 3ZWVA 2G82A 3BMOB 4CL8A 1B15A 4IPTA 4Z0PA 2C5AA 4E2YA 2FZWA 3DWFA 1PJLA 4ILKA 4XDZA 5I7SA 1GFSA 1LRJA 3L07A 1YWGO 4YJFA 4AFNA 3NJ4A 1PL7A 4N7RA 4CM1A 4MINA 3QVSA 3GVXA 3PP8A 4PZCA 2JHGA 3L9WA 1JKFA 1J0XO 1QYDA 3DMTC 5HA5A 5TT0A 1OZAA 3GPIA 4TZKA 4YPOA 4OM8A 2YV2A 3PYMA 5CPFA 5DOZA 1OC2A 3WB9A 1PGPA 3WGGA 1KS9A 3AK4A 4YJHB 1I01A 1EUDA 3WIEA 3OICA 3ZHYA 4FBGA 7MDHA 4GSKA 3DHEA 2Y0EA 4LRTB 5K6AC 4CJXA 1U3UA 4EYEA 2HUNA 3H3JA 2PZMA 4E5KA 3ZWNA 4EEXA 4B7XA 4NNJA 4FOSA 1I36A 1P1KA 2HRBA 2Z1NA 3KM0A 5T8KA 2AQKA 3U4DA 4XQEA 1E5QA 4AJHA 1NASA 4P8RA 1GYRA 1Z6ZA 2DBQA 3KSDO 5TLSA 1F06A 4ZJUA 4BKRA 1ZKMA 1F8GA 4Q9NA 1XR3A 1NFFA 1PS0A 4M54A 4WLNA 4E5NA 5DBGA 1I2CA 4ITUA 4D7AA 4EJMA 5T67A 2BI8A 1ENOA 3G79A 3FHLA 5T6BA 3RJ9A 1FDWA 4JJFA 3WBFA 3ONFA 4D44A 3HB5X 5HM8A 3MJVA 1UP7A 5DT9A 1QYXA 4RF3A 2JAPA 4RF5A 3WYCA 4OKIA 3VH4A 1MFPA 4M55A 4J7XA 1T25A 2A35A 1VJ1A 1XU9A 5MDHA 1V3VA 3GQVA 1K5HA 1YQXA 3HWRA 4FJ2A 4B4OA 4CMCA 3IP1A 3VVBA 2HK7A 3QWBA 3AUSA 4IDAA 5G4KA 2I3AA 4DREA 2GDZA 5ITVA 2BI7A 5JY1A 2J3KA 4MVJE 2PH5A 3FWZA 1VPDA 4M89A 3SLKA 4B79A 4UUPA 1TT5B 4DVJA 1HE3A 1ULUA 2C2XA 1M75A 1KY4A 1QYVA 4YBZA 4CQMA 2WWRA 4EUFA 4ZRNA 4AJJA 3EUWA 3GK3A 4U5QA 3KEOA 4BKPA 3ZV6A 3LF1A 1IPFA 2D5AA 4DLAA 3WGZA 1X0XA 4CLXA 4YJGB 3QV1A 5JYEA 4JNKA 3PXXA 2ZB4A 4INAA 2Z1MA 1E6UA 1LRKA 1NTOA 1FXSA 3PIIA 5IXYA 4FJ1A 1HDXA 2E48A 4J1SA 3WNQA 4WKGA 2GYYA 1JAXA 3BMOA 3GZNA 2AW5A 2GCGA 4QXMA
chains in the Genus database with same CATH superfamily
4UBOA 1AF7A 2VHWA 4W1QA 1N5RA 4MRRA 4EO4A 1KC1A 1KEEA 2QTZA 5TF4A 3ME5A 1QX4A 3BZBA 3V2HA 1NX9A 4HLUC 5JTUA 3JASB 2GK6A 2WJYA 4FHDA 1T2CA 3RVPA 1UZUA 4QBHA 5IFLA 3FSJX 3QNUA 1LU9A 1Z08A 2HWKA 4RQBA 4IIEA 5JNLA 4IJUA 4V0RA 1Q83A 1UBOS 5H02A 4YUWA 1E9BA 1UQUA 1LW6E 2DVMA 1YUNA 2X9LA 1BS2A 3Q2IA 3GBSA 1XA3A 1SD1A 1K27A 4A8JC 2WKRA 2E37A 1FYEA 4DLWA 1OZ0A 2HQBA 3Q85A 4PYNA 1Z25A 2FSUA 1W25A 5KAMA 3RVMA 3RWBA 3TECE 2KM1A 1JQAA 3W2HA 5KCZA 3QQPA 5IYZB 2UZIR 3KOXA 3PRJA 5IYZA 3KSUA 4PE5B 1GCAA 4XE5A 1IZYA 3ZTWA 3UK2A 1MAVA 1I94B 1MB9A 3D7SA 4LTMA 821PA 1NVFA 1Y9EA 4GGMX 4F9EA 3NAGA 1OHHD 3LWBA 1AUQA 4I50A 3DB1A 3QTBA 3UUFA 3ZJ4A 3ZU3A 5JBNA 3HHPA 5AJVB 3L6EA 5EP2A 1FFBA 2CJPA 1JAHA 3AY0A 2B2CA 3IPXA 3C1OA 3LV8A 5CIQA 4HB0A 1NN1A 1JXMA 2IRWA 1OMOA 4ZOLF 4N0DA 1NUQA 3AXSA 1IBMB 2H52A 1ODKA 2NSJA 3E7PA 3RI3A 1UJ4A 1LJ8A 3GT0A 4E22A 2R751 1G9SA 2HCTA 1Z7GA 2HIAA 1J07A 3OM0A 4HVLA 2DOKA 1C30B 1P2SA 2XHZA 4OQLA 1X3SA 1SAYA 4JOSA 3N8IA 3VDXA 1NXVA 1W34A 5EAIA 5ALTA 3N2YA 3K8QA 2EJWA 3B1WA 2GPSA 2A4MA 2ETXA 2PXCA 2ZRPA 4OU5A 4H1HA 4V2IA 3BCUA 2BBTA 4V39A 3WI7A 2WB2A 4BFXA 3U4AA 4B75A 5K3BA 3HZHA 3MYYA 1Q2XA 1TM5E 3LT4A 4MEAA 4NZOA 3VGPA 5K8UA 4TSRA 2R6DA 3EIEA 2DTXA 4M1KA 2IWRA 1CUVA 5IEJA 5FL7A 2ZIUB 2QSJA 1QDEA 5H8WA 2VDVE 3KU4A 4CDNA 1IBSA 2VEDA 4REOA 2PMWB 2AC7A 2ENUA 1QRSA 1UKYA 2NO0A 4MGYR 4B1FA 3OO0A 2NUTB 3JZDA 3E3NA 2Q2OA 5FL7D 4Q12A 3KOWA 2GXQA 3JRXA 3M83A 3ZY3A 4CIVA 1G8SA 4BRZA 5BN5B 1EP2B 1LBIA 2Q5LA 1KJYA 2DWCA 2A6PA 5H4HA 2W8BB 1Z22A 1O9HA 2QGNA 4MEBA 4K40A 1N32B 3JQDA 4PRZA 1ZAYA 2BOVA 5DULA 4ZO4A 4HTAA 2GEVA 4Q3AA 4BFUA 3K73O 3UEOA 1E94E 2C7BA 4KXQA 2FE4A 3ZHSA 1X7WB 1RI5A 1S9DA 4D2IA 2P35A 1SD5A 2JFZA 1PHRA 4Y1RA 4I1IA 2GCOA 1HL3A 1NATA 1U1FA 1P5HA 4NZ9A 3UT5A 1QORA 1ZH0A 4HGQA 1USWA 2QTNA 3T7IA 3VR6H 1E6WA 3R0IA 4QTXA 4F60A 1TI7A 1ZXXA 3EOZA 3ITEA 2N42A 1VL5A 3HCCA 3HN7A 3EFBA 3EIWA 3IT2A 4NE7A 2C95A 3ZIUA 1LZKA 3DFUA 8ADHA 1XCMA 3T9CA 4K3VA 3QG1A 4WXEA 1E1QA 5CDSA 1EQ2A 4IZHA 3KETA 2IXAA 3PF9A 4HG2A 1T1GA 4IDGA 4OGLA 1RFGE 3ZIAA 1ECBA 5HHTA 1TRKA 1QC5B 1M54A 3IMEA 4YI5A 2VKQA 1ZCZA 4CR7A 1W5BA 2VNSA 2ZSJA 3LBHA 3PGMA 2UUAB 3AJ9A 2W00A 2CVZA 2PKYX 2WWWA 2V55B 4I55A 5F1KA 1FTSA 5TQ2B 1U3CA 1EK0A 5D01A 1M2VB 2ZBUA 5BP7A 1PVVA 4ENUA 2ZULA 3X2FA 5IC5A 3CPJB 1W0KA 1SN7A 2TSYB 1TQHA 3FNHA 5FOXA 1NVBA 3RREA 2ID8A 1JN0A 1XTKA 2FTKE 1HNXB 2Y6UA 3AUXA 5FP0A 1QVVA 5IP5A 4B6PA 1Z2EA 3QPVA 3LDHA 1EXDA 1W0KD 1ONSA 1IEQA 1K97A 2DHEA 3NTVA 3AJAA 4X1YB 1XELA 5DZSA 3SY8A 4RGQA 4NMHA 4XWKA 3ZHVA 4YCDA 1MEEA 2GD6A 5G1NA 1CUGA 1V8BA 1DJMA 1D1TA 2VP5A 3TRHA 7REQA 5AI5A 3H0EA 4Z2YA 5KS2A 4IKOA 4O2AB 1P4JA 2OGWA 3UJBA 5LQNA 2YS7A 1J22A 1QH1B 4A2WA 3L8HA 4C0XA 3GG9A 2O8BB 2PUJA 3G2KA 4HDNA 1VI2A 5A3SA 5HZKA 4LYFA 3BRSA 3D7MA 2M1XA 2QORA 2C92A 3IJ5A 1G7CA 3UJ3X 2VHZA 1R6VA 4TLEA 3X43A 3MS4A 2YOFA 2I1LA 1XZCA 2QV0A 4D0RA 3A3YA 1X42A 2F43A 3NASA 4ZCPA 1SWVA 5H5JA 3A70A 3ACDA 2V6FA 1KO4A 1N5IA 1ONBA 1WXIA 4HFMA 4UMDA 3RHZA 1ZZGA 3WIDA 5A03A 3AVOA 4IMPA 2DPHA 2ZS9A 5HM6A 2IYTA 3SNHA 4N65A 2VCHA 3P0EA 1YZQA 2Z4TA 3QITA 3KYCB 3UWSA 2XBLA 4F1KA 3UAOA 1O77A 4WXHA 3RROA 4ZV9A 3VR1A 2HH9A 2WJVA 3K05A 2XDQB 1XRNA 3DEJA 3LFHA 4TVBA 3VU0A 2O19A 3I2JA 4GL4A 3ZZTA 1GTL1 2HHLA 4J90A 4UFOA 5EIWA 1OZHA 4N8DA 5J63A 3GARA 2WWIA 4PCAA 3R74A 4MMYB 1LDBA 1NFRA 2AOTB 1FTYA 3ZG6A 3QYAA 3QLTA 1G6HA 3AHHA 1KNXA 2QXTA 1XCGB 3WY9A 2AV6A 1Z5PA 5FBWB 1QH8B 3SYKA 1R9GA 4EABA 4TSFA 3IUBA 5J43A 2IYWA 4IMIB 1J8QA 4Q03A 2XQFA 1G8MA 3ESCA 4RO0A 4S12A 4M83A 3PFBA 4DL9A 5GIPE 3EVAA 2PJRA 1JR6A 2Q1TA 2F7SA 1W9HA 3FROA 4D0NA 4YBRA 3ZGOA 4AQ7A 4AP5A 2MYPA 5HFAA 1NQXA 5L3ZA 3ZVLA 3T54A 1DC3A 2XUAA 3AU9A 4E3ZA 5KNBD 1KTIA 4QLOA 3VPDA 3HCDA 1SH7A 3EQZA 3SC2A 2XRZA 1JIJA 3CPEA 2NM0A 2LZ0A 1L4MA 5KVSA 4E13A 1I5OA 1OAAA 2BE9A 2RCNA 3VOAA 1DAFA 121PA 1PR3A 4PG5A 4XJVA 3SX0A 2X58A 5LVAA 3D6AA 4Q93A 4WOPA 2G80A 5DCUA 4C7XA 3W5BA 4L08A 3K5PA 2P3OA 2WU4A 3JZAA 1F1BA 3LIPA 4CCSA 5C5DA 4J49A 4EKDA 4A91A 5TEVA 3DTTA 3PQ8A 3QPUA 4RQUA 1RKUA 3R09A 4O4IF 4TLLB 2RGNC 3LG2A 3MB5A 4ZDIA 3OA2A 5T3UA 4QRDA 3MYRA 1XDZA 4G5SA 5JG7A 4EHBA 3IQHX 5E0OA 4QXPA 4RHXA 2I4LA 1K4KA 1Y6QA 2OWDA 1ZK4A 1F2VA 3U4GA 3CGWA 1I32A 1A5SB 1U2GC 3NM6B 3PSAA 2C29D 3PR1A 3U16A 2CNLA 3BGVA 2XCQA 1VKNA 2HT6A 4EY6A 3B5EA 3E8SA 2YL2A 5KWJA 3MLBA 2C04A 1Y98A 3LRTA 1KAEA 2PWZA 2PX6A 7MHTA 2OOSA 5CEEA 4E5DA 2B8JA 1JHMA 3ZXSA 4G0MA 1HYBA 1JG3A 2Q4RA 5CU7A 4YAKA 1MC5A 3NTXA 3REGA 3VR5D 2JLRA 2VZ9A 5AJHA 1Z5VA 2VYNA 5AM5A 2O59A 5CDUA 4ZHQB 4HDKA 2ECQA 4QRIA 3NYIA 1SZDA 3U5TA 5E38A 4R8RA 3CT6A 4QTZA 1ZH2A 3KHKA 1XZBA 2PA3A 2QIOA 2FMFA 2Q99A 4E5SA 3CONA 3OBIA 4EJSA 3W4IA 2YV4A 2UUPA 3D02A 4ADSG 3NPMA 1A9XB 3SQNA 3GMTA 4TGLA 5J4VA 3C3MA 4MV6A 4NR0A 1RJFA 4YMTA 2ZB2A 3BIFA 3SHQA 1Z74A 2ZJOA 3QUTA 3RC2A 2WW8A 3PUXA 5AICA 5EEHA 3JWGA 4Q9LA 2Q27A 3DKRA 3VR3D 4B8WA 2NQ2C 3RUDA 1QNLA 1QZ3A 2C3UA 3HXQA 5EZ6B 3RH0A 1IK4A 2YRFA 1N5JA 4EPTA 1NPTO 2Y9PB 2P6RA 4ATNA 1XCLA 5JXJA 2P9BA 3KUCA 1T1SA 1NI5A 3GGSA 4M36A 2NU8A 3LCUA 1NBMD 4LQCA 5SY4A 2OP0A 4O6VA 1VXRA 5ICFA 1GZHB 2BKVA 1L5VA 4OFXA 4TV8A 4M6WB 1I4WA 4P4LA 1SZCA 4US0R 5IJAA 3SM3A 3JYQA 2Y2UA 3RU2A 4TX1A 1HFJA 3FCSB 3DLAA 3TRFA 1DARA 1LA2A 1P9NA 1R9NA 1THZA 1YASA 2B7LA 1WY5A 2YV3A 3A3NA 3AUTA 4KL8S 1R0BA 4TTRA 1EUCB 3NVAA 1GITA 2B9VA 3BWDD 3EXEA 1VE6A 3OZUA 3VYRB 1NXSA 2UVPA 3G5AA 3ZWBA 1YBMA 2FPUA 4RTRA 1JJFA 2AN9A 3MJEA 4NU0A 3VXKA 3U09A 3IUMA 2H65A 4YV7A 2AH5A 1Z4PX 1C7JA 1W36B 5EKSA 4JYAB 2DKFA 1MOZA 5FD8A 3VO2A 2M1ZA 1Z39A 1I1OA 2R44A 3NDPA 4BJ5A 4BMCA 1FNDA 3GDOA 2V54A 4KK4A 2GUWA 4ML3A 1CQPA 2CL7X 2DSTA 1Y5LA 2VTEA 2D5BA 2DKNA 2WF9A 3LH5A 4TL9A 5IUKC 5DO9A 4ZEVA 5I9TA 4XPZA 5LMUB 4QPZA 4BCBA 4HWPA 4TPKA 2O48X 1Y7TA 3OTGA 1FLNA 3WJ2A 4Y0VA 1KQGA 2RH9B 3O8OA 3QBVA 4KH0A 3WLHA 2W11A 2LCIA 4DM3A 1LK7A 4QSHA 1YC2A 2BFCA 2EAUA 2P8JA 1MOSA 3KK0A 1UMKA 4FZJA 1CIPA 1EFDN 1EVIA 3JQGB 4HBGA 1ISSA 1K8XB 5TVKA 3JQQA 1NUAA 3VVCA 4B9AA 1VG9B 2ZYWX 3GUZA 1CNMA 3EVCA 4EF6A 1U3FA 2I1VB 3RPEA 4OQNA 1U0NA 3CVUA 1P9OA 4PXAA 3UXYA 1CB0A 1NJGA 3KOMA 1PZNA 4LV8B 4BIIA 3QXSA 1WJGA 4BJ6A 3BEDA 4PZ9A 3VX4A 3GJZA 3WQQA 4KXVA 1F3LA 3BWCA 3NV9A 4NZZA 1YQDA 2OG1A 3TOSA 3R3HA 2BGRA 4MYSA 3I4CA 1OH8A 3N9IA 4J1TC 4JUFA 1VRWA 2R25B 2Z98A 3HEBA 4UJ5A 3W5CA 1UZAA 1THTA 2WYOA 4HYTA 1QGUB 2F8LA 4W5QA 5IVKA 1O6GA 2EFYA 2JBAB 1IWPB 4ZI7F 1QR2A 1X1DA 1CQWA 1DEAA 3S2UA 1RE1A 2HJWA 5EIXA 2VHEA 5KYNA 3MLEA 1QFJA 3PLAE 1UWVA 1SBYA 2MMGA 1N7JA 2R8BA 3Q10A 1EUZA 3B89A 3GFBA 3UHOA 1AO3A 4Q4CA 3AR6A 4RE5A 1W0JA 3RU7A 4EFMA 2EYQA 1L5HB 2JLYA 1K0UA 5EA2A 1E1YA 1Z0SA 3H2SA 1DRWA 3LFTA 5DWVA 4IGFA 3GLTA 5I7EA 5JIBA 3MRTA 2K7FA 1MZVA 3TH5A 1U8AA 4TM8A 1A0OA 2OCYC 3M0EA 1JZQA 2F64A 1BE8A 1AM4D 1OTXA 1S4MA 3NGXA 4F4IA 4KE9A 1GIAA 4HAZA 1RWQA 5CHEA 3SYRA 3BRWD 4UUOA 1K9VF 3RIEA 3Q3IA 3V8BA 1N5MA 4F3RA 4G81A 4EG3A 5IHPA 2C0CA 2E55A 4K5QA 8MHTA 3YASA 3NHMA 3IP3A 4TTPA 5EWJB 3JD1A 2BFDB 2OBBA 1MQSA 2Q8QA 1G4HA 3ESQA 3KZMA 2OCGA 3OZXA 4OYLA 3JAMA 5E3HA 2E5LB 2HSZA 1W47A 4KQMA 4BLSA 1L3CA 5ITZB 4FMCF 5GP1A 3A1SA 2QI9C 2XT6A 1GZ7A 1JV2B 1M72A 4TLAA 2XGJA 4BJ1A 2GEJA 1PQPA 2BEWB 3P5BA 4PHGA 3KLOA 1Q0HA 4AKEA 4B48A 5AUOB 2QJTA 3OTWA 2GHQA 1OWOA 4HVCA 3VISA 1BRTA 1PQWA 1VFPA 2VYFA 4LSWA 4IHJB 4F45A 2W2KB 5JQGA 3HR8A 1XNJA 3S2SA 2OD7A 2ZWMA 3P2MA 3UPUA 4XIJA 5EHGA 1MT0A 2VAWA 4R6XA 1VGVA 3WJ7A 4BJHB 1ZC3A 3GLGE 3D54D 2G09A 3H2BA 4KBFA 2J33A 3FYUA 2YWRA 2IDMA 3F97A 3REQB 5DH9A 4G5OA 1MHPA 4IO1A 4XI9A 1JDSA 2OBXA 3W2IA 1Z37A 2RGYA 2FPIA 2YN4A 1GEGA 4XM2A 4KWIA 1SOAA 1U8UA 2WF8A 3Q5EA 2Z5LA 2O2XA 3RJ5A 4B3MB 4MI3A 2WF6A 3UJHA 2DM6A 1QFYA 2VKTA 3K6RA 3IR7A 4Y6SA 5EE5B 1SXPA 1MPXA 4KUHA 3OMWA 3EEOA 3RRFA 4C9BA 5HNKA 3JWPA 3Q8KA 2BELA 3F90A 3D6TB 4IZIA 1YB5A 1WUJS 4M4SA 3V1NA 1T4GA 2B7CA 2HDOA 3MJDA 1AB5A 3OPNA 3UOGA 1A8UA 4ZCIA 3OIVA 3AVYA 3KJFA 2OECA 1VJRA 4TKMA 2NAFA 4YIHA 3FYTA 5I7RA 4GM0A 2IGBA 3FPAA 1QTNA 1YACA 2FN7A 1NVVR 2VJNA 2YW9A 1M2GA 1N2CE 4RFVA 5E7MA 3V7FA 4JJ4A 1WX1A 2Q5JA 4ARVA 1N1DA 3DXYA 1PR1A 2VWHA 3PG5A 4IUCS 3A36A 3F1KA 1B42A 4JBIA 4C03A 1MC4A 1M5TA 3HYCA 4FI3F 3JTMA 2BR5A 2ZRMA 5CH3A 3NTRA 4IFBA 5AK0A 3LGAA 4TLCA 4EKGA 4FU0A 4RTPA 1RACA 1NPDA 3N2IA 2V59A 1I13A 3PGXA 3T15A 3FSGD 3KXPA 4TT8A 1W4LA 5LOVA 2ZU6A 1JNXX 1SOUA 2C83A 3LQ4A 3BD9A 4XKJA 3C74A 3FGNA 1O94A 3TOCA 1C7RA 3TIIA 3WGYA 4COOA 4EYKA 3A6DA 1NGSA 2V0CA 4BPRA 3URKA 1VLHA 1K3TA 1N5DA 4HJXA 3TE7A 2F55A 4OJNA 2GF9A 2YH2A 4JK3A 4Z9AA 3QVVA 1JZSA 3V4LA 4ARIA 2MSNA 1GGFA 5REQB 1MA3A 1NE2A 2DPMA 4M2LA 1RPZA 1E9DA 5G0SA 2QYHA 4DQKA 1TEVA 4OQYA 1GKLA 5AQEA 3C7KA 4E5PA 4MQMA 4YK7A 3TR5A 1S9HA 4KXXA 3U7RA 2QRZA 3AF1A 3UATA 4J4BA 2OK7A 3RS5A 2R60A 1BNCA 4Q9IA 4EYQA 1GR1A 3G0HA 1XPRA 3RFXA 4GPTA 4KIUA 4DUGD 3TLAA 2EV9A 1U7WA 1CR4A 2Q21A 1XKTA 1RI3A 2ZBGA 3N39C 3N8DA 2EIHA 5B58T 3W34A 3T4EA 3U3RA 5C4MA 4CDMA 3D1JA 2WIFA 4YN3A 1S3GA 1QIGA 3PQ3A 4M1YA 3QHQA 1VDMA 4NOMA 4PIVA 4X94A 3EPLA 2G9ZA 3KE8A 2A2ZA 3T38A 4IWYA 5DTMA 5HR5A 3QXCA 5GV7A 2JASA 2BAGA 2CJYA 1UXOA 1MB0A 1SA0A 1R8SA 5A3VA 2BTQB 1OB2A 2Q49A 2XE7A 3RC3A 5DGHA 2ATXA 4DHEA 2FV8A 2BFFA 2H4FA 4W9NC 2A1IA 1QOQB 3HJRA 1I4OA 3QSYA 1DOAA 4E1BA 4JCCA 1R00A 4OGFA 2WP8J 1JHRA 4DA4A 2QY6A 3GMDA 4Z1MA 4E08A 1ABEA 3CJRA 1UJ2A 4PPQA 2ZXFA 3SC4A 4G1MB 1BX0A 1VG0B 1IHOA 4C78A 5LQMA 5TIIA 2XODA 3I2GA 4UULA 5FOUA 2Q7OE 4G5FA 5JT1A 4JB2A 3BTVA 3DV0B 1T15A 2GPBA 3F71A 1PNRA 3V4OA 1DUVG 1DHTA 2C4VA 3KT3A 1EVKA 2QTBA 4NABA 2DSNA 5HRAA 4A36A 5EHNA 4BLQA 4ENRA 2FFBA 3FFAA 2F43B 4H7KA 3IUYA 4P2GA 5EHIA 1XRQA 2WINI 3TPCA 2AOWA 2VJMA 3NHAA 1KDZA 3UWKA 3A6LA 4NYMQ 3H97A 3I9KA 3KB6A 1I4EB 4TN1A 3TVTA 3VDNB 3KOUA 3HLTA 4ENWA 5DU2A 1RAAA 5LLTA 4LFAB 5BWCA 3A26A 4FFBB 4QWWA 3ROXA 3RGGA 2GVDC 1GFWA 4K81B 4M1OA 1TM1E 3IAAA 1XLTC 3TSAA 5FAKA 3DHWC 3L0BA 3OT5A 4F6CA 2IPLA 2GX6A 4H7PA 3Q2KA 1RNLA 1VSBA 3TWOA 4EDHA 3WLNA 5K0LA 4MA5A 5ELXA 1K8ZB 3DEZA 3P7MA 3DVAA 1X8KA 3TZBA 3W8EA 1J6UA 2WT4A 1PFGA 2ZATA 3Q7RA 4WASA 3WGHA 2E4XA 2SKCA 1NV8A 1VKRA 2ZSFA 3QOWA 1JLRA 3KSZO 4GI7A 3QWIA 5KJEA 1DC8A 3CQ9A 1R4NA 5T5QA 1R15A 2OFOA 4W5WA 4XDHA 3ZIAD 5HGXA 2Q46A 3AP3A 4TMXA 1GT91 1W5TA 2FDXA 1NDHA 4TTJA 4YACA 5F7ZA 4ZVSA 3STHA 2NXNA 1MXFA 2PZLA 4AJIA 1ZMXA 3HKEA 3V4VB 3T7TA 1EZZA 1HLFA 4IUBS 3JARA 2YYSA 3EH1A 1XXHA 4B83A 1KP3A 4BVJA 1MVNA 4P36A 3BMXA 1T0HB 1V71A 1BEUB 1PWYE 3CRZA 1D4ZA 4FSHA 1XZFA 4XRGA 2B4AA 3ITNA 2E9SA 1IK6A 3DDOA 2BM8A 1CPYA 4G36A 5FBHA 1GR0A 5HVNA 4TT3D 3IFSA 4MJLA 3N28A 1O96B 2BR4A 3RAEC 2FYTA 3AUKA 3PBKA 3VFDA 3MMSA 1KMHB 2YIVX 1XWWA 4OUDA 2Z95A 4P92A 4LDAA 1WAMA 1JHAA 1UJ5A 1AN9A 4P7GA 4J9VA 1N2ZA 1NT2A 3PRYA 2XBUA 2ZIGA 3ITKA 1WB6A 3BYZA 1IPEA 4HN9A 4PLHA 4CM7A 4FGKA 1TU0A 4NENB 4LISA 1ESMA 4G5YA 1YQUA 1YJBA 3DVLA 4HHEA 3DCNA 3EK2A 4MWOA 4QYSA 3V1UA 5BWLA 4BCDA 1V37A 2I6QA 2MSCB 2PD4A 5IT0A 2FWMX 3HJFA 2BGGA 1BTOA 4EZIA 1GNVA 5J9FA 4GKBA 3OAAA 3KEFA 1ZK1A 3AONB 4D82A 4BB5A 1YQWA 1UMDA 3LWNA 3HGQA 3S5UA 3EZ9A 4F92B 2JI8A 3HDTA 1OROA 3QEMB 4US2R 3V9PA 4AG5A 2HPVA 5ELMA 3JAKB 5LYYA 4DWVA 1JU9A 1EWQA 3HYTA 3NWBA 4RVOA 2AA3A 2FE1A 1SCDA 1P7PA 3GJYA 4PNZA 2Y8EA 3GV0A 5FBZA 3WK9A 1IUOA 5AKZA 5I9LA 4KTTE 3F3MA 3TXXA 4EG0A 3KEQA 3I9V6 1VL2A 4GG1A 1SCBA 3I9V1 4DMUB 3OCWA 3FAZA 3JSXA 1U0OC 1YONA 2VDNB 4KLZA 3F5MA 2E4WA 1XI2A 5JU6A 1JHZA 2QRHA 2XD4A 2JFPA 4G6ZA 2A84A 1S0UA 1AY0A 1M33A 2FFAA 2JFGA 4MVCA 2HJSA 3WQBA 3UT0A 1GTSA 3OJEA 3W1VA 2QMEA 2YOGA 3HWX1 1Y6JA 4KW7A 4LF7B 2PXXA 4P31A 4PC2A 4MNTA 1JDBB 2ZEJA 4F1WA 1E1RD 3KB2A 3QFTA 5K03A 2BDUA 4LRSB 2YXBA 5FHRA 4YJFB 2DY0A 2X6RA 1B93A 3RT1A 1G16A 1GUAA 3BHNA 3EVZA 4QOHA 3CKMA 5KJ1A 4N0MA 4I0WB 4TN5A 1ESCA 3LDGA 5AKKA 1GUYA 2HPHA 3FUUA 3O38A 4KZPA 3ETNA 3KLMX 1MAAA 4X5OA 3UQYS 2VFAA 1WKVA 1UKCA 1WD5A 1F6WA 5EMKA 2OGUA 2W37A 1N0VC 5KNDD 4DWWA 5BWOA 1ORVA 1R1DA 4S0ZA 3GAAA 5FADA 5HKBA 2Y1LA 4HRAA 1QU3A 1V7QA 2QENA 2VDWB 3H17A 1DJNA 4BQOA 1EM8A 1TVCA 5GTDA 2WPDD 3WS7A 1NRWA 5KX5B 3OVMA 1UXJA 1XEWY 1XCJA 3ES9A 1WWKA 3T7KA 1DP4A 3DKKA 1F0YA 2AWOA 2J5XA 1X7GA 5BR1A 1QPZA 4NS1A 3Q9LA 4P4TA 1GPLA 4O1MA 3KQQA 4AS2A 5C35A 1Z68A 2X2OA 3ZYZA 5TY0A 4TTVA 1OKKD 5B2ZA 2X2EA 1RKBA 1XMPA 3Q0TA 5DNEA 4DUZB 4I4TA 3JQ9C 1YQ9A 4MCAA 1QGZA 1TMGE 2QLBA 1K8RA 1DG9A 3RIMA 1Z82A 3A10A 3ZY4A 1QV6A 4ZZIA 2PBRA 3HS3A 1EZ4A 2ZR0A 5GV8A 3UBMA 3BDAA 1NF3A 3U1BA 2HMTA 4FVTA 4HGOA 4GP7A 5CJ2A 5C8XA 1RLTA 4A15A 3PGKA 1XZLA 2ZUWA 3FSGA 3OU2A 2RH4A 2YVLA 4YP5A 1LXCA 1MR3F 4D6XA 3BWXA 4RA6A 2DFPA 4EB8A 3K6KA 1D4FA 1E4VA 2BT4A 2VOEA 3C8DA 3MUEA 5HIKA 4FUTA 3ELBA 5EKXA 5JCPA 3HXKA 4JLKA 2EKZA 3HYSA 2IE0A 1EVYA 5B6JA 4XWYA 2RAFA 2QWXA 5LJLA 5LB4A 5B3JC 3WLRA 2AW3A 2I3ZA 1ECLA 2DWQA 3GC6A 4M9QA 1RIFA 1JB1A 3OLVA 4KLNA 1J8DA 3B82A 3LKZA 1BHJA 4GNKA 3VC3A 1ZBDA 5CNJA 1FBTA 2GCIA 1M0EA 3CH7A 1RM0A 3C97A 3G13A 4AMZA 3IIKA 5EINA 3Q2OA 4RJIA 4OO3A 3DLCA 4BVBA 1PFKA 1MO3A 1KHHA 3BXPA 2O4UX 5LOVB 4ZI5A 1G8JA 5LQRA 2YXNA 3OFVA 3P0IA 4OHOA 1YKFA 1ZUHA 4Q1EA 3T0IA 1IBLB 2WTMA 2RC5A 1TM3E 1CR0A 1RWBA 1SXJB 3F46A 4ZVLA 3LY5A 3V8QA 4B3SB 1AURA 1SB8A 3GUVA 3RU9A 4BO0A 4Y3UA 4C4YA 4MR7B 3W79A 1AU9A 5TGTA 4ZP1A 4TZTA 4MVJI 2BWJA 3BD6A 4OX9B 4UM7A 3T4UA 1J5XA 2H0AA 1KJ8A 1FNSA 2FJPA 1DO8A 4GDMA 5HP4A 1Y5MA 3N6XA 2IEAA 1V9CA 2WUGA 3E84A 3OE5A 3EVTA 4PFKA 4UQPA 1GGJA 3T0GA 2G83A 4BVKA 5I5EA 4E09A 3MC1A 2DFKB 2NO5A 2RK4A 3U39A 3SDBA 1R6DA 3VBEA 2AD1A 5CG1A 4LBWA 4MZDA 3VZDA 4TYYA 1P44A 5FI5A 1UMBA 5ADHA 2PVCA 2H85A 3SJ7A 5ED4A 2NZ2A 5HKLA 1WSAA 3FMOB 3RYTC 2XCIA 2Q9UA 1NSTA 2C4TA 2IPMA 4KQ6A 1G0NA 2Y4NA 2BPOA 4RZXA 3VNAA 4CZ2A 2WUVA 2OO3A 3MSXA 4G8DA 3DDZX 2AFHA 2MJLA 3PHCA 2WE7A 4ND8A 3O75A 4PZDA 1QAMA 2FGJA 4K9SA 4PYKA 4AJKA 3JARB 5BSKA 2SBTA 3VHXA 1XE3A 4FYMA 2XWSA 4N3GA 5LFAA 4MRNA 5EIHA 2D3TA 3G1WA 1P3Y1 2ORVA 5KQRA 2XTAA 3SSMA 2DBVO 4KX3A 3T3PB 3GNQA 5D84A 1U3VA 4XGNA 5K8JB 1WMDA 1MN6A 4M9RA 2IV3A 3WDLA 3ZCXA 1JHXA 4ARZB 4YMHA 1H2YA 2W98A 1DCKA 4NMWA 4QYXA 5HCIA 2HB6A 1YBAA 2CEAA 5FWYB 3ZGZA 5LQKA 1P5ZB 1O5IA 2QF7A 3D8UA 4H1TA 3WAGA 4EJ2A 2QK4A 3DLPX 4URWR 1YO6A 1TZBA 2OQ2A 3F6PA 5CM9C 2OYSA 5FL3A 4EVRA 1P1FA 4ZYUA 3I9NA 1N2BA 1T2UA 4LSGA 4PU0A 3FVVA 3BDIA 4MWSA 2GJAA 3GLFE 2R66A 3NBMA 1CE8A 1H9BA 2BCGY 3JQ6A 4H6PA 1FDUA 4BQQA 5CVUA 1C29B 2AXPA 3DAGA 2QVGA 3RVBA 5HQ3A 4C7VA 2HM7A 4K3UA 4AROA 2C9MA 4HATA 4RPKA 3M1IA 1H5NA 2O8VA 4B2LA 2XNDD 1XDWA 5ELLA 2HTFA 4D9KA 1CDDA 4KO2S 4IJWA 4CKBA 1U2TA 3X0DA 1AK2A 4NAHA 1EEXB 1XQVA 2J6HA 4IYRA 5DOVA 3UMGA 1AKUA 1XNHA 2VBGA 3FUVA 4HSEA 4GI2A 4J0GA 3LS2A 1USVA 4MWGA 3T9DA 3UK0A 4C7OB 1U5AA 2OPHA 1IXZA 3ZXXA 3JCZA 4XD2A 4YFVA 5EIBD 2G9NA 1RHJA 4BAUA 3BHIA 4MQ4A 3Q11A 4I5DA 1DVRA 2QW1A 4OQEA 3MTQA 1YFZA 1HXHA 4GSLA 2IH5A 1I0LA 1GGVA 1VG1A 3EARA 2YFYA 2YFKA 3DOEA 5LBIA 3QOXA 4H0FA 4EY3A 3I2YX 1N6RA 1XFDA 3IQFA 4CF4A 1FDVA 3RVJA 4DC9A 4A8TA 1RSZA 3R7NA 5JDCA 1HEUA 1FMLA 4WXPA 5F9HA 1ZY2A 1UK6A 4HQLA 1DCFA 5EJMA 1ICIA 5KQPA 1RZRA 5GVSA 4CEJB 3F98A 1CJTC 3ZR4B 4AG6A 3K9LA 4RQAA 2BZSA 5DEIA 4WZBE 2B3TA 5EQTA 4A1FA 1ZK0A 4CMEA 5LCXA 3FDFA 3IJEB 4B7AA 2REOA 1WUYA 1TQ8A 2F3TA 4YYZA 1IN1A 1VLZA 4HAYA 3PB3A 4J0HA 2OYCA 4WZBB 4CEIB 3BJEA 1T9HA 1Y5NA 1N0UA 1OILA 3L7IA 1YR1A 4QDUA 5CNKA 5CB8A 2WABA 4HP8A 1XMSA 4QFCA 4C6RA 2GCPA 3PFIA 1QU2A 1JSXA 2LTAA 1CR1A 3SICE 2XMDA 4BAZA 5CLLA 4YALA 4L8WB 5AJZA 4DMGA 1T3LA 2E7ZA 2B99A 3GRPA 1MENA 1PG5A 1PJSA 2J9FA 4KQHA 4O4LF 4OQXA 3SJUA 3CUEF 4CM8A 1U0JA 5LQJA 2I4NA 3TXYA 5JZOA 5EE9A 1HFEL 4EY5A 3D7NA 1GPMA 2R85A 1JDZA 4HRVA 3ZS8A 4YFYA 5TE9A 2FWBA 4HDCA 5B7PA 1H9CA 4BV9A 4YRKA 1BKSB 2FPGB 1N3BA 1U7UA 4MH0R 4DEVA 4I1SA 2H1OA 4ARCA 3OOEA 4HWTA 4IGEA 4DG5A 3B12A 3NEPX 4J8PA 1H2ZA 4OFZA 2IZ6A 1A9ZA 3FKQA 1FFYA 4PBSA 3O26A 3E1SA 3P5SA 4ZYYA 3FPKA 3I12A 2TMDA 1OI4A 5IVIA 4WOCA 1ZGHA 2J87A 1TCUA 2PSEA 1L1RA 3BRWA 4N1AA 2L19A 3TM4A 1GAEO 1F17A 4JJAA 2D2FA 1QM5A 2ST1A 3DUFA 1JGTA 1U9IC 3C1AA 5HJ7A 3BREA 3DA8A 3TGWA 1IY2A 1DQPA 1VCNA 1NM5C 4LZNA 2JFBA 4RAOA 1QHEA 2B94A 2ZRAA 1OGIA 2R3SA 4C0QC 4JGIA 1URPA 3MJSA 4AUNA 4PW0A 4UHCA 3UYKA 3FMFA 4U6SA 3QLUC 1W4CA 4AMYA 4LHWA 5IBRA 1Z4OA 4BU0A 4YMUA 4C0JA 1XSEA 2X0RA 4FK8A 3PNLA 5CA1A 4YCJA 3RSQA 2EATA 1GPBA 4X7RA 2D00A 2GRAA 3ODPA 4ETMA 5ALYA 3NWJA 3TL2A 2WYIA 2Y05A 3VZSA 4EW1A 5IZCC 1NWHA 1Z4JA 1H4QA 4JI4B 4JYBA 3SKVA 3IEKA 2G4CA 4RM2A 4XQCA 1Q0RA 1XXLA 4KNVA 1JFLA 4G4IA 1PTJA 4H7EA 1XT6A 3V1KA 2ZBRA 3KWMA 5ES3A 5I3CA 1BFDA 4CN9A 3IUQA 4UEKA 2VJYA 4UTNA 1GZVA 1KAOA 3ELDA 5IK2A 5GINE 1TFRA 4FNGA 3D6HA 1JIQA 3S8MA 1G4AE 2FEWB 13PKA 1SC9A 2H4ZA 2RC6A 2JARA 3IE0A 4ZT5A 5KVQA 3SX2A 4DRYA 2JCXA 3HHEA 2ZJAA 5FLYA 4N41A 1NMXA 1QTIA 4J3FA 3COWA 2H06A 1I6KA 1IRXA 1Z18A 2PD6A 8ABPA 1V4VA 3ANLA 5ITWA 4RZHA 3E9EA 3ZVMA 1V6AA 1M6VB 3FOAA 1RKQA 4GPEA 4JLPA 1TAGA 2C9CA 3B36A 1D04A 3GEHA 4RFSB 5AKIA 2GK3A 2C5EA 3CN9A 3ZHOA 4TMVA 3WZLA 1STOA 5CITA 1GEEA 3VBCA 4J2OA 2AFIE 1YTLA 1YFJA 1VJCA 4GOJA 2J59A 2O52A 4RMNA 6REQA 3ILHA 2W7TA 4PZAA 4XVHA 4OKSA 1Z83A 2UYYA 1AO0A 3U48A 4ND6A 2IUTA 3DVRX 2RBEA 4G0QA 3NKLA 1ITZA 1MX5A 1R5BA 2BEVB 2HJRA 2W6ID 2YVQA 3EGOA 3IHTA 4KIGA 3TLYA 3PXGA 3W5IA 4D80A 4AKHA 6GPBA 1KYTA 3GIDA 2HMYB 1A8HA 4Y6PA 2UYGA 4UEOA 4FFLA 5LZ9A 2OZPA 2C8KA 2G1JA 1G291 5AK4A 2B5WA 1D03A 4P83A 3D8NA 1W48A 3H1FA 5JHGB 3TB4A 5CYGA 1CY8A 1I3NA 2WTAA 4NJEA 1UCFA 2FWJA 3KHSA 3R23A 2I3GA 2N47A 1CDOA 2V5UA 5KDLA 1AB6A 1WCWA 3MK31 4HFJA 4DMMA 1QJ4A 5KDDA 4DQUA 2IS4A 3D4LA 4W7SA 4MICA 3BRQA 4ZPJA 2H6EA 4IH1A 1OX4B 4Y6RA 3DZJA 4EYOA 5JQWA 3THWA 5AVWA 1T9AA 4ND3A 5JFGA 1UADA 1ZH4A 3G0OA 3O95A 2LIVA 3I30X 4UBLA 4NDNE 3ZW9A 2W6PA 2Y0DA 3O8CA 1NV9A 3AI3A 4W9RA 5T4HA 1YZ3A 3LDUA 3NFYA 1V39A 4JBNA 3TLCA 1VB3A 3R3SA 3EQ6A 4LWPA 4PWZA 2HAEA 3CF4G 2XY4A 3T1QA 4KN6A 2ZM5A 4LFBB 4Q4HB 2XUKA 3KKKA 4IIFA 1OV4A 4XWAA 2PRJA 5IBQA 3FCEA 5KQMA 3PUZA 4Q34A 3V2GA 1EX7A 1PD0A 1J0DA 3MOIA 1M1NB 4QX6A 4EF5A 1TVMA 2I2FA 4WERA 2J85A 1DXQA 2FQXA 1NNI1 3QVOA 3FNIA 2C82A 4RJJA 2PWAA 5JH7B 1U1EA 3OECA 2JGRA 1WMAA 5HTOA 1LI7A 1RYBA 3A3PA 5T7BA 1FU8A 1FLDA 1XZIA 3JQCA 1A9SA 4FDTA 3HUEA 1EVJA 1FSGA 4HC4A 4CMHA 3M3DA 4F3CA 3H13A 1E3DA 3EB9A 1QV9A 1SVNA 2ZCUA 3E2PA 1T13A 3CR7A 3HFSA 4Y2TA 4AG3A 3EBLA 1JJIA 1RBYA 3LPLA 4K87A 4CNQA 1LY1A 2F3PA 4YO7A 3M9WA 3PDIA 3RAPR 2XCSB 1QO0D 2C61A 3AOEC 4UHJA 1O94C 1M2WA 4QDTA 2QQEA 4G9GA 1ARZA 2N1BA 3E4CA 2YVUA 5AVJA 3S68A 3VDQA 1PWZA 3VU1A 3WYNA 2CT8A 1WZ2A 1UZMA 3B1XA 3THXA 5AXCA 1G2PA 3URMA 4ER7A 1N5OX 1Z0UA 1FX0A 3A6ZA 1OJ7A 3D81A 3K15A 4JJ8A 2W6MA 1N7IA 1Q19A 5FWXB 5IULC 1H6CA 4K28A 3GLGB 2OV3A 3Q4GA 4GYKA 1J5EB 5IDVA 1DPFA 1Q77A 1TZ2A 5FLEX 3AFIA 5E6RB 4CM9A 3AOGA 3R7WA 1Q91A 1P31A 1WXXA 1N2XA 2R1TB 3C4QA 3CLTD 1QH1A 4XR4A 5ALEA 3X1XA 1GFZA 4KLAA 5THKA 1KETA 4NBSA 2B1IA 4A27A 4QJIA 3BX1A 2D62A 2J5KA 1A7JA 4P3KA 2C3YA 1VBKA 2OA0A 4Z54A 3B3GA 4OXYA 1TO2E 2O2YA 4YWHA 3PSHA 4RDCA 3S1LA 1YJAA 1ZN7A 1YXMA 3HNPA 4IXWA 4G25A 4Y9DA 2Q5FA 2BFNA 4Z9FA 3EZ2A 3UAZA 1M5RA 3DW1X 3MCZA 4NH4A 2F90A 3C6MA 3AHIA 3D1LA 3WL3A 4K0RA 5IW8A 1YZUA 3PGVA 2XWBF 1IVNA 3DLIA 3FB1A 4WLVA 1BWQA 3G85A 3M8KA 4TKZA 3R4CA 5FOSA 4XVRA 5F4BA 1Q44A 4J0QA 2ZRCA 2VEOA 3MA0A 1BKYA 4QC2A 5KOIA 1F8FA 3FDJA 4HKTA 5EUQB 1LLUA 1PNVA 1Z0ZA 3MPUA 2R4TA 2WAAA 4RXMA 3OMLA 2NU7B 5JHHB 2FW6A 2VQ3A 1VG8A 2ZRHA 1Q0ZA 2FP4A 5BYBA 5KYUA 4QNRA 1C8LA 3HCFA 2NLOA 3G8BA 4HQKA 2QPLA 1Z4NA 1G8AA 5GOZA