2BGKA

X-ray structure of apo-secoisolariciresinol dehydrogenase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
267
Chain Sequence
b'TNRLQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADIADDHGQKVCNNIGSPDVISFVHCDVTKDEDVRNLVDTTIAKHGKLDIMFGNVGVLSTTPYSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAKKGSIVFTASISSFTAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDVFGVDSSRVEELAHQAANLKGTLLRAEDVADAVAYLAGDESKYVSGLNLVIDGGYTRTNPAFPTALKHGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
molecule tags Oxidoreductase
source organism Podophyllum peltatum
publication title Crystal Structures of Apo-Form and Binary/Ternary Complexes of Podophyllum Secoisolariciresinol Dehydrogenase, an Enzyme Involved in Formation of Health-Protecting and Plant Defense Lignans
pubmed doi rcsb
total genus 89
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 1.1.1.331: Secoisolariciresinol dehydrogenase.
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bgkA00
4BS9A 4GLLA 4P4GA 1JA9A 3HHPA 1BXGB 3AJRA 3KHUA 4NI5A 4DVJA 3JQDA 5KKCA 1ZEJA 1UP7A 1F8FA 4TMFA 4N7RA 1T1SA 2ZYGA 1PJBA 2PY6A 3QWFA 1BTOA 3DFZA 3ST7A 2ZYAA 4RLSA 4XIYA 1VE9A 5K6AC 5ICMA 1JKIA 2CF5A 4JQCA 3ANLA 1I36A 2NTVA 1PZEA 4CM8A 3RUDA 3RUAA 5TF4A 3AI2A 3K2BA 2NSDA 4I5FA 5A4DA 1HDYA 4OKIA 1P1JA 2Q1WA 4MVJG 5JMPA 3PHJA 4CMEC 1JVSA 1GZ4A 1PJLA 3KLMX 3GNTA 1NQTA 2X1HA 2VZ9A 2HDHA 4YJGA 3QY9A 3ZWXA 3NTOA 2IZZA 4TROA 2WMDA 4G81A 3AOEA 1P77A 3NEPX 2W98A 3PLNA 3QVXA 3H5NA 5F1OA 3DR3A 4EYEA 4YAKA 4E0BA 1LC0A 3F4BA 1ZVMA 1XLTA 2B5WA 3VTZA 4R5MA 4OO3A 4EUFA 1B15A 4Q3NA 1WWKA 3O8QA 5H83A 1GPJA 3L6OO 1E6EA 2Y0EA 4IGFA 5DDIP 4ALNA 2VCYA 3G49A 5FI5A 2DBZA 4HP8A 1HDGO 3LK7A 4A7PA 3BMOA 1QYWA 2WD7B 1EE2A 4JJIA 4NNJA 4QT0A 3SEFA 1E3WA 3VPSA 4HFRA 1HZZA 3ZU3A 5I9NA 1CQJA 1VPDA 3H9UA 1HLDA 5F5LA 3I9JA 3OQ6A 3HDYA 2OL4A 7MDHA 5GZ6A 2CF6A 1NTOA 3GEDA 5T8KC 4AJPA 2BLLA 3A06A 3JQFC 4PLZA 3ZWPA 4IIVA 3L4BA 1XYGA 1E7SA 2PZLA 3G1TA 5EL0A 3O9ZA 1KVUA 3GVHA 3ZHXA 2AE2A 1H93A 3VPGA 2PK3A 2EXXA 1SCUA 1Z74A 3UCFA 4IIUA 3WIEA 3DTTA 5TJ9A 1M2WA 5F3RA 1PR3A 5JY1A 1UUFA 2O4CA 5DT9A 2YY7A 3GRPA 4LSWA 4CPDA 2VYVD 4HV4A 5CFZA 4URFA 1YB1A 1B7GO 1QP8A 3PWSA 1HDOA 5FYDA 2C07A 2O3UA 3AUUA 1T24A 2AQ8A 5THKA 4MVJE 2ZCUA 3ITKA 1GD1O 2DU8A 4Y6PA 2GN8A 3TQHA 1JTVA 1UJMA 1SOVA 2CDCA 4YAGA 1RWBA 2O3TA 4WLNA 3ABIA 1KERA 3H65A 4NK4A 2CDAA 3UCXA 1I2CA 4RPGA 3U9LA 4RF3A 3RFTA 3DOJA 1IPFA 2OFPA 4JX8A 1P33A 2Y93A 4M55A 5DBIA 5A05A 1N7HA 1GUYA 4YWJA 1NHWA 3IMFA 4L4RA 3WX0A 3BTSA 4BNYA 5KWEA 3JD1A 2HKIA 2R6JA 3WGQA 4FR5A 3AUAA 3CPSA 3GN1A 3VKVA 1GZ3A 5G4KB 3WJAA 4DC1A 3O38A 3DMTA 5JE8A 2YDYA 1JQBA 4BNUA 3KV3O 3UN1A 1QORA 4A73A 1LSJA 4XJSA 2CVOA 1P74A 3PRJA 1Q1NA 3RU9A 4BMNA 2YHIA 1CIVA 1DB3A 2FPIA 3QVWA 4OSPA 4XRRA 4RPLA 4ZQGA 2SCUA 3DBVO 3BMNB 4KDEA 2GNAA 1E92A 3QW2A 5TNXA 1YRLA 2GZ1A 3W8DA 4CM9D 2Q2VA 2Q1UA 4J0FA 2YYYA 3C8MA 5JW6A 4JBGA 1Y6JA 1ZKMA 1GFSA 1NWCA 3C7DB 1PZFA 2JHFA 3ADOA 9LDBA 1NR7A 3I9NA 4ZD6A 2Q50A 2YFHA 1ZBQA 2AW5A 3GLQA 4FOOA 4H16A 4RVDA 3WB9A 4HWKA 2VTDA 1UXKA 4LCEA 2YV3A 3JQ9A 4XX0A 5G4KA 3IJRA 3JQ7A 1EUCA 5A03A 3B1JA 2EGHA 3NDIA 1BXKA 4MJLA 2TMDA 1EVZA 4F3YA 1JAXA 3H5AA 4QTZA 1R4NB 2UVDA 1E7QA 5JMWA 3LQFA 3INGA 3IJPA 2NU8A 3WLFA 1B0AA 3KUXA 4ID9A 5K9ZA 4RVHA 1W6UA 3AOEC 1YQDA 5CPBA 3D5QA 3F9IA 2V7PA 4RQTA 3BMOB 4OH1A 3F47A 1YB4A 1J6UA 1GTMA 4KUHA 2DTDA 5AOVA 4EEZA 3IC5A 5LCXA 4CLOB 5A5EA 2NUAA 3IIEA 1BWSA 4J7XA 3NJ4A 4WOJA 3OIDA 5CHEA 1WPQA 3U4IA 1G0NA 3C7CB 3V2HA 4MVJP 4E5MA 5L53A 3GUYA 3I4CA 2Y1OA 3B1KA 2IXAA 5JDIC 1LQTA 1QV6A 4MVJD 3ASUA 1GAEO 5F1PA 3H2ZA 1HWYA 1LJ8A 3UUWA 5JDIA 3ANNA 1PQWA 1X0VA 1UDAA 3RC1A 4E3ZA 5A9SA 3H5RA 1YDWA 3ZU5A 4IJUA 4FQ8A 4PN3A 5A06A 1T1RA 3TZQA 1R6DA 4CMJA 1O9BA 1ULSA 4J1NA 4BO7A 4MVJF 5DCYA 2GF2A 1GQYA 3I9MA 1PWZA 2VOEA 3AM3A 3GVCA 4E21A 4FGSA 1GL3A 3BMQB 4DBZA 1C1XB 4DA9A 4XDZA 5U1PA 3DMYA 3K30A 2VWGA 4ND2A 1HE3A 1B8VA 3PDUA 5K6AA 3FNHA 2C2YA 2IDZA 4BNFA 4Y98A 1QR6A 1F12A 4E33A 2O3RA 4H15A 3OP4A 4XB2A 4ZHSA 3RUIA 2ZB4A 3WSVA 1K89A 1M75A 1F14A 4XQGA 4QO7A 5DZSA 1NP3A 2DBRA 3V2UA 1IHXA 3ZWOA 1IL0A 4E2YA 2Q3EA 4QSMA 1VRWA 5TGDA 2BFPA 5JCJD 2B4RO 3PWZA 3W4IA 1P0FA 4ND5A 5JCXA 3CKYA 1U5AA 3RUHA 3DQPA 4B7CA 2JFGA 4BKRA 2CZCA 1M67A 4RQUA 2RHCA 1H6AA 4J6FA 3DO5A 1MV8A 4J4TA 4DREA 3CINA 5CDUA 4YAJA 4WLEA 4FFPA 4GSLA 1I2BA 5DP2A 3ZU2A 1VL8A 4FCCA 2Y1EA 2BF7A 4YCAA 3RUFA 2HK7A 2ZB8A 4BQRA 3EUWA 4WLFA 2G76A 2VN8A 1ZW1A 2HUNA 2IODA 3PIDA 4Q3CA 1B2LA 1R4MA 4PZCA 3JCZA 1S7CA 1KEWA 4YJFB 3M1AA 1BG6A 4GKBA 3LDHA 3H6KA 1UXHA 3M2PA 4GX0A 1DC4A 1ZEMA 2X5OA 4RPKA 1T2DA 2V6MA 2V6GA 4J90A 4BNWA 4UEKA 4D41A 3ITDA 1KY5A 3TZ6A 3WGTA 4B8ZA 3IAHA 1E77A 1QLJA 2JKVA 1U4SA 1ORRA 2QYSA 3KYCA 1ZUD1 4LISA 2FSVA 3D4PA 5CDTA 4TSKA 5KJFA 4IDFA 4LVUA 3PHGA 5EJ2A 5AXBA 3L4BC 2DTEA 3F5QA 4TVBA 2P4HX 4AJNA 2NWQA 1Q7BA 2E48A 4W7HA 2PH3A 1OBFO 5JNLA 3HADA 1LXCA 3L6EA 3D0OA 4DMLA 4IZHA 4YT4A 4L8VA 1LLDA 1BW9B 4BHTA 4TKMA 5GY7A 3JQGB 2B35A 3PIIA 6ADHA 5A3JA 1JWAB 1E3EA 4PLCA 4YBZA 3MJVA 5AQ1A 3RJ9A 3EZLA 3PJFA 4TVOA 3JQ9C 1L1FA 1SB8A 3H3JA 3GRKA 1XEAA 2E6UX 4ZQBA 1H6BA 3K5PA 1EUZA 1FXSA 1R12A 2WE7A 3DXFA 4JP3A 3DHYA 3KYCB 3OFSA 5TX7A 3I9KA 1KYQA 5L4LA 3HB4X 1GYPA 3GG2A 5JYDA 2JD1A 4MO2A 1CETA 4RORA 2FZEA 4AJKA 3D3WB 4OM8A 2EKPA 4FJ0A 2PD6A 5TSDA 3X2FA 3VDQA 3Q6IA 5TIIA 3SLGA 2IZ0A 4J9VA 4HUJA 4CV1A 1YQXA 1O95A 5A9SB 3SC4A 4F6LA 3HFSA 2PA3A 1R0LA 1B3RA 4CMCA 2Y0DA 3KVOA 2YW9A 2ZB7A 1FMCA 1Z7BA 1NPTO 2QW8A 4LMPA 5JCJA 1PZHA 4XDYA 3T7CA 1ISFA 4OYRA 4J2HA 4XKJA 2J3IA 1T26A 3AK4A 1Y5MA 5EIOA 1MFPA 2WM3A 1DPGA 4UAGA 2A9FA 4IUYA 3EDMA 2XXJA 4NK5A 4BO2A 1KC3A 1Z75A 5KVVA 4GI2A 4P38A 3AW9A 4FIZA 3CMCO 3Q2KA 1U2DA 3EK2A 4G2NA 3EMKA 4Y67A 4PLYA 1ZMOA 5CP8A 4LSMA 2B83A 4M89A 4B8WA 2A4KA 2DFVA 1NPYA 2I5PO 3MOGA 4DQVA 3GT0A 3ENNA 1Y81A 1E7YA 1H9BA 3NKLA 3OSUA 1QMGA 5G0UA 4MPDA 4PLHA 1HZJA 1AXEA 1HSOA 3RQSA 2BFAA 2ILTA 3HQ4O 1V3UA 4E31A 2C7GA 2EEZA 2X0JA 5B12A 1FDTA 2PR2A 1ZJYA 3TN7A 2OO5A 1Z6ZA 1Q0QA 5G0VA 2Y0CA 2NTNA 2EGGA 2YHUA 5T6BA 3C24A 3NGXA 1F8GA 5JDCA 2VOJA 3GDGA 2VWHA 1A71A 1A9ZA 4CMEA 1LRKA 3FBTA 2ZJ0A 3FNGA 1HE4A 5IDYA 4DRYA 1K6JA 4BKPA 2PGLA 4FPXA 4AJ4A 2Q45A 4W99A 3E18A 1WMAA 2JCVA 4JBIA 1I8TA 1J49A 4R9SA 3ZNPA 2RH4A 1NQAO 3NT2A 4RV9A 1MC4A 3BTOA 3PXXA 3JD3A 4HFNA 4MVJH 4DTIA 4MKXA 2YQ4A 3WFIA 1DIHA 2EHDA 1AE1A 4B4OA 2C7VA 3EVTA 3QLJA 4MP3A 4ZQHA 5KOIA 1EFLA 2X5KO 1NFRA 5JLAA 3WWYA 4PG8A 3B20A 4EJ6A 3SC6A 2O2SA 3MJ4A 5COBA 3WLEA 1IHYA 2O23A 4CLDA 3VH4A 2AE1A 4LK3A 3GPIA 4WCFA 4JGBA 2RAFA 2HMWA 1AHHA 3QRWA 3BTVA 1NPDA 4G65A 1Y9AA 2XF8A 2QYTA 2YDXA 4CQMD 4CUZA 4NJMB 3BMCA 1H0KA 5DN9A 4FSHA 4PIVA 1UH5A 1V0JA 4ROSA 1RM3A 2AA3A 4MIYA 1VLLA 4EW6A 3ZI0A 1VSVA 5CG2A 5I7FA 1X1EA 2EP5A 4HKTA 1HT0A 1GADO 3GFGA 3G0OA 4JK3A 2D1YA 3UKOA 4EITA 3C85A 1XR3A 2OBNA 4WGGA 1DLJA 1ID1A 1V9LA 3GFBA 4ITUA 2JAHA 3E5RA 3PQFA 1PQUA 3TJRA 2R00A 4YT2A 3P5SA 3P2OA 1XU7A 1HDRA 4Z3KA 3IUSA 4GAEA 4XGIA 1PGJA 3WMXA 2X0RA 1KVRA 1LLQA 1KVQA 5H81A 2QIOA 4WNCA 2NM0A 4YDRA 4B7UA 2AG8A 3DDNA 3PJEA 5DP1A 1TLTA 3KBOA 3TRIA 3DWFA 4RL6A 3SBOA 1C0KA 3LT4A 3W8EA 3WQQA 1O0SA 4CR7A 1NM5A 4CR8A 4YT8A 2QHXA 3OICA 2JCYA 3ZV6A 3DZBA 4CUKA 1D7OA 2OOSA 2XAAA 2Z1NA 1GV1A 5BNIA 4YT5A 2BKAA 3E03A 4P22A 4IQ8A 5I8ZA 1RYEA 4FJ1A 4OQYA 4UVIA 1IZ0A 4B3IA 1R16A 5IN5A 2VHVA 4ZRMA 1E3WB 3SX2A 4F6CA 2BH9A 1LSUA 2NVWA 4MOWA 4TZKA 3T4EA 4DLLA 5FF9A 3V1UA 1U4OA 1VL0A 3KRTA 1UAYA 4IQ0A 1Y7TA 3FTNA 1GPDG 2JJYA 2Y05A 2GPTA 1LDMA 2E4AA 5TQVA 3RD5A 4XEHA 3DZIA 4HBGA 3EVNA 5BQFA 4BO5A 3VAZA 2C82A 3GOHA 2VWPA 3ZWCA 1O94A 3JQAD 3VC7A 4DBVO 1YH3A 5G0TA 5F5NA 3DB2A 4U0KA 3O26A 4CM7A 2PZMA 3BHJA 3WGIA 4HFJA 4XQEA 1HXHA 5ES3A 1DDOA 1XG5A 3WICA 1ADBA 2HLPA 3PPIA 2J5QA 2BELA 2HAEA 3BHMA 2B5VA 2VHXA 2VYND 3WFJA 3QP9A 5L3ZA 1R4MB 3I6QA 3DHEA 3DFUA 4WLOA 1PS9A 5C3MA 2B36A 3DAPA 3STHA 2Y1DA 1EMDA 2H1SA 1QRRA 2DBQA 3IKVA 5F1KA 3WIDA 4Z9XA 1I10A 4BKUA 5IJZA 3NGLA 1PL7A 3P19A 2X9VA 4B7XA 4BNMA 3M1LA 5DCWA 4XJTA 3VH2A 2YFQA 5CPFA 1GDHA 2WE8A 4C7KA 3QWBA 4I08A 4DXHA 2UYYA 3K8ZA 4JCOA 4NZ9A 2YV2A 4RVUA 4QX6A 3K2EA 2FR1A 2AEMA 1QV7A 5A9RA 2C0CA 1FK8A 1EE9A 1I3KA 3FF4A 4PRKA 3QIVA 1ISHA 3RC2A 1ADGA 1AHIA 3WYBA 3WS7A 4K6FA 3OH8A 1VKOA 2J3JA 2FR8A 4E5NA 1KVTA 4IJWA 3RJ5A 4IS3A 3DOOA 4NJMA 3WSWA 4TQGA 1E3LA 1U3WA 4CODB 3FCOA 2X0NA 3CXRA 4ND1A 1C1XA 1DFIA 2D8AA 3AWDA 3LF1A 3K31A 1U3UA 4LN1A 3WGHA 3PP8A 2CSUA 4HFMA 3ZWMA 1VM6A 4WKGA 4DL9A 1D3AA 1BDBA 4AG3A 3K92A 3IDSA 2GERA 3OJLA 3E8XA 2A92A 2BMAA 2JAPA 2EIHA 3ANMA 2FP4A 1PJTA 2Q1SA 4TRMA 5DBGA 4RZIA 1U28A 5CDGA 3OBBA 3C1OA 1ADCA 1GEGA 5JAIA 1PGQA 4RVSA 4CUJA 2C54A 3GNSA 3JQ7B 3QE3A 3WR5A 4AJOA 3EYWA 2PKQP 4K9DA 3U4CA 1DIRA 2PV7A 1LDEA 1NAIA 3DZHA 3P7MA 3DMTC 4D3DA 4R3WA 4MIOA 1NX6A 1HF3A 2D4AA 4EDFA 1UR5A 4DIOA 4ZQEA 1Q0LA 4I5DA 4XD2A 3RSHA 3VPXA 3HN7A 1B14A 1E5LA 3QVTA 4BGVA 3IP3A 1G6KA 3OIFA 2X5JO 1GR0A 2UUPA 2PGDA 4Q3DA 4EI2A 5I8WA 3HDHA 3PHLA 1OZAA 4MKZA 3ZNNA 4D0RA 4FBGA 4EUHA 1LRLA 3ZN2A 2B37A 1J5PA 3ONEA 1YE3A 2O4UX 4W9NC 1H9AA 2C2XA 3OMLA 4TWRA 2DAPA 4NR0A 4D3FA 4CV0A 3VH3A 4UVHA 3VVCA 4GX2A 5DCUA 1NBOA 3DHNA 4R1SA 1KY4A 4DYDA 2P91A 2FHSA 1GYQA 1GQ2A 1QYVA 3VPHA 4R51A 3QSGA 3CUKA 1H6CA 3NYWA 2QRKA 1E6UA 4A0SA 2GUGA 3IKTA 1PGOA 1X13A 3PTZA 1IZ9A 3EGOA 5L7TA 3L07A 1YOVA 1XQ6A 3JQ8A 5T67A 3AFNA 4YJHA 2IYOA 4KZPA 2GO1A 3GHHA 3MTJA 4ALMA 5LDHA 3S2EA 5ER6A 1EK6A 4OSOA 3L9XA 1BXGA 3TOZA 4QECA 4XQ9A 3NAQA 8LDHA 3D1LA 3F4LA 3LU1A 4CR6A 3QVOA 1YJQA 5DOZA 1KETA 5TS3A 5TT0A 4EJMA 4B4UA 1IUKA 1NVTA 3SXPA 1SNYA 3GC6A 2V6BA 3TWOA 3UICA 4R1UA 3U0BA 4FC7A 3GMSA 1OC4A 4NHEA 4S1VA 2ET6A 4KUEA 3SJ7A 2AXQA 4NFYA 1MGOA 5KJ6A 1Q2XA 1I3NA 4QQRA 4DIFA 4UVGA 1YDEA 3GGPA 3NRCA 2ZTLA 4M8SA 1PGPA 5CG1A 2PD4A 5AXCA 1GQQA 4FS3A 5JC8A 5U9CA 1U8FO 2BGLA 3H4VA 3UFXA 3QJ5A 3RBXA 4J43A 2X4GA 1GCUA 4J3FA 2O50A 5IFLA 5ILGA 4CM4A 4BNIA 4Z6KA 4P4LA 3GY0A 3AM4A 2HJRA 4OXYA 4WEOA 4XB1A 5K0ZA 5JXWA 3OJOA 1JU9A 1R15A 4J16A 1HDCA 4BO4A 4GMGA 4R5HA 4EZBA 4RPHA 1NYTA 4MP8A 3L6DA 4TKLA 3EZYA 5CEJA 4LCJA 2VUSA 1DIGA 5LC1A 1FF9A 3GG9A 4MIEA 4FFNA 2X7HA 4B4WA 3CZRA 3ROKA 5JDCC 1PTJA 2C20A 4NJOA 4WCDA 3DEYX 1N8KA 3H8VA 4GVXA 4ALKA 4BMSA 1ENOA 3CE6A 5BSGA 4HNGA 2HRZA 1PIWA 2DPHA 5JYEA 1QYXA 4L73A 3FR8A 3ZHBA 2PD3A 1QG6A 3OF2A 4AJLA 4QUKA 1ZK4A 4Y6RA 4NG5A 4R9RA 5IDXA 4CM4B 1NNUA 1I3MA 1CRWG 4WECA 3HN2A 4LGVA 4FDAA 5EPOA 1YWGO 1FJHA 1UP4A 2GN9A 4BV8A 2RIRA 4I9NA 4IM7A 2DC1A 2EG9A 5A04A 4CL3A 4IDGA 3BMCB 3GGGA 2NU9A 2JD2A 2CY0A 1T25A 4C4OA 4LRTB 4N5MA 2UV8A 4DWVA 1ZXBA 2EWMA 3AU8A 1PS0A 3L77A 3HUDA 3RROA 1UZMA 3Q11A 3JD4A 4I5GA 3TZKA 1ENPA 1ONNA 1Y8RB 2FPPA 4ZICA 1Q7GA 5KTKA 4RCVA 1IOLA 2VNAA 3VVBA 1UXJA 1D8AA 2Y66A 4ZVVA 2WYVA 4Y8VA 2DLDA 4KUGA 4ONEA 1H6DA 2VWQA 3PWKA 1B8PA 1X7GA 1YVEI 3JQBC 4R54A 3WYEA 3UVEA 2EKLA 1YO6A 3A14A 5ADHA 1MB4A 2VYNA 3G1UA 4FFLA 3JQ6A 1LBEA 3R3SA 4L0QA 2DUUA 4J7UA 3GHYA 1Z73A 4QFCA 3ZHZA 5KJEA 2FY8A 5C37A 1U3VA 2FOIA 1EFKA 2OZPA 3B70A 3GEGA 3O03A 3F6YA 3ONDA 4E12A 4XZ3A 4NIMA 2DVMA 5IXSA 2OGUA 1GZ6A 4W82A 2HSDA 4WPGA 3M2TA 3AY6A 3VZSA 4D45A 2PLAA 3CIFA 3FR7A 2D3TA 3MZ0A 4J4BA 3LT2A 4JLWA 1HSZA 1EVIA 3WG9A 2VUTA 1P31A 5JAQA 3TFQA 4XYGA 1NXQA 3G79A 1B8UA 1PR9A 3TZHA 2QRJA 3UXYA 1X1TA 2HRBA 4QXMA 2Q4BA 2QRLA 5FI3A 5HA5A 2NVUB 3O8QB 3GAFA 4UULA 1K5HA 2IXBA 4FJ2A 4YTEA 2VHWA 1YQGA 1ISMA 4GWGA 4GLOA 3V8BA 2AEFA 1PJQA 5CEEA 3ETGA 4II2A 1LC3A 3RBVA 3ICCA 3K73O 3NDRA 3EW7A 4RDIA 3OIGA 2XXBA 2FN7A 5COAA 4PVCA 1PL6A 1XCBA 3GK3A 1DFHA 4ESOA 1GCOA 4N5LA 4OL9A 1C1DA 2I76A 4CLRB 1JLLA 1JAYA 3BTUA 2NQTA 3AFMA 3JTMA 1OOEA 3RASA 1VJTA 1VL6A 4OXKA 1H2HA 2BGMA 3VOSA 1CEQA 1PL8A 4W6ZA 2W90A 4ALIA 1PWXA 5JSFA 2CFCA 9LDTA 4J7CA 1WVGA 3PVZA 4W9NA 3KXDA 3F5SA 1QLHA 2DUWA 1I24A 4MDHA 4BNHA 2H6EA 3TSCA 4M49A 1LQUA 2VTEA 5IN4A 5G0SA 1JKJA 4IZIA 3A9WA 4CL8A 3NT4A 2VHZA 1YB5A 2WYWA 5BSFA 4L4SA 3TFOA 1X7HA 4OJNA 3GEMA 4MKRA 3GA0A 4U7WA 3DBRB 3U49A 1I3LA 4AL4A 3GQVA 3ZV3A 5T8KA 1PGNA 4II3A 2NVBA 3LLSA 3L0DA 1MP0A 2NNLD 4BO8A 3JYQA 4P8RA 3VZPA 4CLOA 3UAGA 1NQ5A 2NVUA 2X86A 3H9GA 2HMSA 5DULA 1DHRA 1WXDA 5DBFA 5THQA 5JY6A 4WASA 2PZKA 3DBLA 2VZ8A 4AJIA 1V8BA 3JD0A 2DTXA 3RIHA 4N5NA 4YEDA 3FWNA 3WWZA 3I6IA 4BOYA 4PLFA 4CMIB 4Q39A 2AG5A 2B4TO 3HWRA 5A5FA 4WUVA 3FD8A 2G1UA 5KKAA 1IPEA 2FR0A 1CQIA 3MTGA 4PVDA 1BSVA 4MVJM 5L4SA 2I66A 4UUNA 2ZQYA 2P9EA 2NACA 4EGFA 4IGEA 2X0IA 3LT1A 2YUTA 1YONA 4YQZA 3E1KA 5JC1A 4WOKA 3AY7A 3BMQA 4IDEA 1M76A 4BO1A 4GPD1 4CM9A 1P0CA 3OETA 1ZSNA 1NAHA 3QWHA 5L51A 1U3TA 3PGXA 1PZGA 1CJCA 1EVJA 3JV7A 4K1LA 3TL3A 2D59A 2YZ7A 2BGKA 3KO8A 3A4VA 1RM4A 4D42A 1HEUA 2Y1FA 1FDUA 3JQBA 4IDAA 3I23A 4J2OA 2CDBA 1BW9A 4E5KA 5A3VA 4RLHA 4JN6B 1OC2A 3QV1A 1DAOA 3HG7A 4GX1A 4EBFA 2G17A 3ZW9A 4J91A 4R68A 1WMBA 2BHLA 3R1IA 1R66A 5C7LO 4I8XA 8ADHA 1NFQA 3DAFA 3GDOA 3ROPA 1P9LA 1LDBA 1DOHA 1H94A 3TOXA 3PK0A 1A5ZA 2PH5A 3ZWYA 4CLXA 2QZZA 2E49A 4OAQA 1XWFA 4B79A 1I0ZA 2FWMX 3BAZA 5EESA 1YXMA 3WTBA 2WWRA 4QEDA 1LDYA 2GRAA 1CERA 1GUZA 4YJFA 1T2EA 1C14A 2PFGA 4FGWA 1RM5A 5JAZA 2BI8A 5LDGA 4OQZA 4U6QA 4CMHA 5DF1A 2Q1TA 3HE3A 4AICA 4E5PA 3ZWVA 1FDSA 1DBVO 2H9IA 3DZGA 3I4FA 3O4RA 3ULKA 1RYDA 2GLXA 3AU9A 1V3VA 4PLGA 4D0SA 2ZK7A 1QXSA 3F46A 4IINA 4WLUA 2X6TA 3GN2A 3ZH2A 1T2FA 1DRVA 5CDSA 4NQZA 3WGZA 2ZQZA 3FRJA 2X9NA 4KDFA 4UUOA 4RJTA 1WZIA 2YQ5A 2R2GA 1DRUA 1A27A 3RUCA 2X23A 2HQ1A 3WJ7A 2DPGA 3IL2A 1HDZA 4PG7A 3UF0A 1PJ3A 2IZ1A 1PSDA 4BNGA 1P44A 3H3FA 3KLPX 2J3KA 2P2SA 3C1TA 4PZDA 4IPTA 2LDXA 3CH6A 4R1TA 5KIAA 2GSDA 1UXGA 2TMGA 1N92A 1VI2A 3ZDFA 4U5QA 3I3OA 4I5EA 1DC5A 4KWHA 4A03A 3RBZA 1J4AA 3DBHB 2VRBA 2OP1A 3OHSX 1GU7A 4BKQA 4BNKA 3NJ8A 1EBUA 3OQBA 1Y9EA 3JSAA 4CV3A 5JO0A 4OOEA 4J4HA 5L40A 1KS9A 1RPNA 3AOGA 1W73A 5G4LA 5IAAA 3S55A 1EQUA 1XGKA 3I9OA 1O6ZA 4DC0A 1LRJA 2Z1MA 4I1IA 1VKNA 5H82A 1Y1PA 2QZ9A 2J3HA 2I3GA 3VZQA 3GZ4A 2C5AA 1MX3A 4BNVA 3RUEA 4XRGA 4DPMA 4H7PA 3TPCA 4Z0PA 4OHUA 1L7EA 3WQRA 2OBYA 4DQUA 3BYZA 3DZFA 5EN4A 2DM6A 3W4KA 3OQ1A 3JYLA 1YBAA 4PLPA 5KVCA 2X58A 3P2YA 4MVJI 3U09A 3ZU4A 4O63O 2P68A 2RBEA 4EJ0A 1QYCA 4KWIA 3A1NA 1NQOA 4CM6A 5ENDA 4GVLA 3WBFA 2HMVA 1UZNA 3PFWO 2I65A 4J9UE 1XU9A 3ZNQA 2JD0A 1PJSA 3LC2O 3OA2A 3N7UA 2ZTMA 2DQ4A 3Q9UA 4CMKA 4JBHA 1SZJG 5BNTA 3JYPA 4OXNA 1PU2A 2G82A 3C3XA 2ZATA 4IJVA 4BO9A 4WLVA 5B4UA 3Q9NA 1CDOA 4Z9FA 3SLKA 3HDJA 3GZNA 1VJ1A 1ZSYA 1U2GA 2I3AA 1WAMA 4UEOA 4YXFA 5A02A 1ENZA 1QYDA 3I5MA 4I9UA 4JXKA 3NUGA 4GGOA 5ILOA 1XA0A 3I9LA 3KYDB 3K9QO 5KCZA 5L45A 4Z0HO 2PKRA 2EW2A 4C7JA 5L4NA 1DSSG 5G2OA 4A2CA 4ILKA 2DFDA 2GZ2A 3S2GA 1A7AA 2WD7A 3WGOA 4CJXA 1YGYA 3WYCA 2E82A 1CF2O 1Z82A 4FFMA 1C1DB 4FC6A 4FW8A 4RF5A 3PQEA 4ZQFA 1O5IA 1E3JA 1EEHA 5TJHA 2WYUA 4RF2A 1F06A 1SEPA 4CM1A 2HJSA 3KYDA 2A94A 5EERA 3WXBA 1KEPA 4PGFA 2CD9A 1WW8A 1UDCA 2X8LA 3CTMA 1M6WA 3GR6A 3N74A 1NHGA 2C5EA 5C5IA 4UUPA 1BHSA 4RZHA 4KTTE 3ONFA 1FDWA 3PHIA 3KSDO 4YJGB 2OXIA 1KBZA 4D3SA 3ZV4A 4B3JA 2WEKA 1KVSA 2Y1GA 4R01A 5KJ1A 4ND4A 2Z5LA 2WJPA 2JFHA 4R41A 4R1NA 4HADA 1U8XX 1R0KA 3GZNB 4D79A 1E1NA 3BIOA 3MJEA 4L75A 4PLVA 3MCVA 4Z3DA 4I9HA 1HYHA 1XDWA 2GN4A 3TNLA 1HDXA 1KIFA 3K96A 1ISIA 3E48A 3FHLA 3N58A 3R6DA 4IJKA 1B26A 1LI4A 4IMPA 2H5LA 2JFFA 1BMDA 3GGOA 1IE3A 2NQ8A 4WCFC 3ROMA 4Y9DA 3DBRA 3DZKA 3HB5X 3KETA 5AYVA 5T64A 1C0LA 3OJEA 1N9GA 3GDFA 3QQPA 3GUCA 4HNHA 3U4DA 4A26A 4BNTA 1N2SA 4D43A 3KYBA 4E2WA 4M87A 1DC3A 2OORA 4XR9A 5I7SA 4YVFA 4KTVE 1I01A 1BRMA 2JHGA 4E4YA 5FWNA 5ICSA 2O7SA 3JQ8B 3ROQA 5GZ3A 4E30A 4YAEA 3RCBA 3FPCA 1E1LA 1VSUA 1LA2A 1NASA 3UCEA 4DPLA 2NV6A 4XIJA 4LVCA 2G0TA 5F21A 1Y8RA 3LC1O 5HM8A 4XR4A 4YA6A 3DOCA 3VZRA 1EUDA 4CLEA 3GVXA 2DBVO 5L9AA 1Z7EA 1B16A 3C7AA 2JL1A 3GVIA 5IDWA 1Z45A 5HS4A 3PHHA 3ADPA 4LMRA 1V3TA 3TDKA 1Q7CA 4MINA 1T2AA 3GPDG 3IS3A 4FOSA 3DBHA 4O59O 1E7RA 1U5CA 4BUCA 4CMGA 1YJ8A 2NADA 1RKXA 4NBUA 1ZSVA 1W8DA 1ZXLA 2J6IA 1M6HA 3OEYA 2O7QA 4OIMA 1WDMA 3HFGA 2BD0A 1PS8A 3JQAB 3HDQA 3PGJA 3RVDA 1WNTA 3MJCA 3DBLB 4IS2A 2F00A 4Z9YA 3FBGA 5TRTA 5ER9A 1ULUA 4E13A 3GVPA 3H9JA 4E5YA 5A1TA 2I67A 2RH8A 4NMHA 5CDYA 2W2KB 2D0IA 1PEDA 1TT5B 5EQFA 3WBBA 2GZ3A 3I83A 4RVFA 5CAEA 3ZWWA 4CQLB 3NDJA 1U1IA 1S6YA 2FZWA 3FI9A 4N18A 1ZNQO 3DZJA 3ZHYA 4U8GA 1DIBA 2VZ0A 3TF5A 3IUPA 1LDNA 4W4TA 4Q3EA 3DONA 2VT3A 2PZJA 2Z95A 4IXTA 2P9GA 5IG2A 3OA0A 1LUAA 2VYVA 1GV0A 1I32A 3Q0EA 4NFSA 1Q0HA 5KNLA 3PYLA 3PJGA 1HLPA 1P1IA 2IE0A 3MOIA 1E6WA 1YL7A 2Q2QA 4Y6SA 4AJ1A 1QSGA 1DLIA 1PJ2A 1O8CA 1GEEA 4JROA 1DFGA 3OM9A 5EMHA 3T4XA 3VTFA 3RI3A 4CMBA 4WEQA 2GR9A 3PYXA 2X9GA 4DYVA 1HRDA 5L95A 2EKQA 4BMVA 3ZNOA 3JQCA 5BT9A 4BO3A 1TT5A 4W7IA 1K3TA 4YRBA 4CLRA 4RO0A 3W6ZA 1DEHA 4NBVA 3E6AA 4BV9A 4O1MA 4NDNE 1A72A 2YV1A 1P1HA 2VNSA 2E37A 3W6UA 4BNJA 1DJNA 4D44A 3RWBA 2ZYDA 1DHTA 4IBOA 1HETA 3KEQA 3LSYA 5C7IO 4UUMA 3DC2A 1OAAA 3JQFA 4UEJA 1P1RA 4YRAA 2PKQO 4KP7A 2IEDA 1K2WA 3NV9A 2X22A 3H7AA 4DLBA 3BMNA 1KC1A 3GH3A 5JO9A 1H2BA 3TL2A 1LSSA 2ZB3A 4BL5A 4HY3A 2FRDA 2GYYA 3D4NA 3R3JA 1ZO8A 2IYPA 2YJZA 1ONPA 2Q49A 3BA1A 2P5UA 1BGVA 3AI3A 2I99A 5COQA 4D7AA 1SEVA 2I9PA 4PRLA 1NFFA 3LVFO 3CSDA 1N7GA 1LLUA 1X7DA 3U3XA 4CQLA 1U7TA 4TRRA 3EC7A 1ARZA 3RFXA 2W2LD 4AJEA 1AN9A 1K6XA 3LT0A 4A10A 4DPKA 3GMDA 2NU7A 2HO5A 1E3SA 3H9EO 1ZFNA 1KEVA 1R37A 2CUKA 2XPCA 4NU6A 4U6SA 3FNEA 1EVYA 5IZCA 1X14A 4KQWA 1XIVA 3ZZNA 2HK9A 4XYBA 4BGIA 4HXYA 5MGBA 4EUEA 4OGWA 2Y1CA 2Y67A 2ZIZA 3FWZA 4ZJUA 2C29D 3Q3CA 5EQDA 1C0IA 2RCYA 5HS6A 3QVSA 5J23A 1DRWA 4O6VA 4BKOA 3F3SA 2XOXA 3F1KA 3WMWA 1JDJA 2J5KA 5GZ1A 5IDQA 4GL4A 2BFMA 3VH1A 3IP1A 1AUPA 2GCGA 3AI1A 4M1QA 2LDBA 5ITWA 2OHXA 5HTOA 3GAZA 3B1FA 4JJGA 5CEFA 2CVQA 2B4QA 1HYGA 3QHAA 4IDBA 4K6CA 5EINA 1X15A 3S8MA 3WNVA 4XCVA 2AMFA 1M66A 3ZV5A 1SB9A 2GGSA 5ENVA 1PX0A 2HU2A 3FPLA 1UZLA 5AVOA 2IEBA 4BGEA 3W1VA 4CM3A 3KB6A 4FN4A 2WDZA 4IXWA 4TZTA 4B3HA 1PJCA 1YKFA 2O3QA 1HKUA 2FMUA 2OMEA 4LW8A 2IRWA 3IOYA 1NVMB 3B6ZA 3PLRA 4O0LA 1EZ4A 5JFOA 1L7DA 2EJVA 1EBFA 1MFZA 4BO0A 2WD8A 4RDHA 4FB5A 4NBRA 3ETDA 4PG5A 1DC6A 3ZWNA 5KVSA 4OMUA 3E9QA 4IQGA 4U0JA 1CWUA 4BB6A 5HWSA 4A27A 2EF1A 1KOLA 1IY8A 4WJZA 4NH4A 1P1FA 4NPCA 2BFOA 1TT7A 4YJHB 1ZZEA 2CNBA 1LU9A 2POQX 4FFOA 3G3EA 3PJDA 3SJUA 2UDPA 3E9MA 3D4OA 4CM5A 4F45A 1BDMA 5AXDA 2O3JA 5HRUA 3MWEB 5IZ4A 4XYEA 1E1MA 4L74A 3ZGYA 4BNZA 3AY3A 4J1SA 1C0PA 2AEJA 3OECA 2YHIB 1D1TA 1UAGA 2AHRA 6LDHA 3UGKA 1CYDA 2DKNA 1ZJZA 4YB8A 2V6FA 3GNQA 1XHLA 3PFFA 1PQPA 1R4NA 3RAJA 4BVAA 2HCTA 4UVDA 1P3DA 3F1LA 1ENYA 2NTJA 3ICPA 4CM8B 2ZKLA 2CVZA 3UW3A 2AQKA 1V6AA 3PEFA 4P4NA 1ZIDA 3V2GA 2B0JA 3WOHA 1AXGA 2HMTA 5I9MA 1HYEA 1WDLA 4CMAA 1N9GB 1UP6A 1N5DA 3EHEA 2O48X 3TZCA 3DL2A 2RHRA 1JN0A 1XKQA 1LTHR 1E3IA 3HSKA 2VQ3A 2WTBA 4KMSA 4YR9A 4ZGWA 3WNQA 1PJ4A 1HE2A 4PZEA 4D46A 3PYMA 3CZMA 3K6JA 1T4BA 1HTBA 4AFNA 3HNPA 2EP7A 1O89A 1VJ0A 1EDOA 5DOVA 4YAIA 3OEWA 3WQSB 1TVEA 5JBIA 3L9WA 1GUFA 1EDZA 1MLDA 4L4XA 3UHAA 4JP2A 1TEHA 1T4DA 1A4UA 3D3WA 1YL6A 5I7VA 3U5TA 1SOWA 1I2ZA 3BZUA 4E32A 2D2IA 5B4TA 1ML3A 1TA4A 3D64A 3D7LA 2R00C 5JS6A 1P45A 1Y8QB 5TT1A 4YQYA 5IF3A 3FSRA 4DQXA 3WDSA 3JYNA 2G5CA 5A9TA 3NX4A 2EW8A 1JWBB 3Q1LA 4JNKA 1LDGA 5I9LA 3INRA 1DAPA 2ZJ1A 1OFGA 3MWDB 5C7OO 4XGKA 3QWAA 3NT5A 1G0OA 2EJWA 4GQAA 4J49A 1MXFA 4K28A 1FDVA 3QA9A 1IB6A 4MP6A 4RVGA 4XYMA 1LX6A 1DIAA 4IDDA 3H9QA 1F17A 4Z0TA 2VRCD 1UDBA 5BSEA 5B1YA 5JAMA 1SO8A 3PDJA 4BQPA 3DAGA 4GSKA 1I30A 2HK8A 3C1AA 4DLAA 1QKIA 3RC9A 3LF2A 2F1KA 2AQIA 2W4QA 3ORFA 1A7KA 1A4IA 3QWIA 4UVEA 5DNAA 2NU6A 3I52A 3EAGA 4JJFA 4ZU3A 1DJQA 2BI7A 1LEHA 4UREA 3ZCXA 1MC5A 1D4FA 4XA8A 1K6IA 4WCFB 1WZEA 4PLTA 4ZN6A 4R3NA 3ETEA 1OMOA 3RC7A 1T2CA 1SC6A 3H2SA 3RU7A 3VHRA 1SPXA 5B4VA 2HMUA 1JW9B 4BB5A 4XWYA 1ADFA 4BIIA 1K0UA 3KEOA 4FD3A 4E2ZA 4GWKA 1TXGA 1EK5A 2O2YA 3U62A 4AJJA 3LYLA 3E82A 1LNQA 4PFJA 5BNFA 1HE5A 2J5RA 1RM0A 3JQAA 4J0EA 3V1TC 3WGYA 3GF4A 2C59A 2UAGA 4CMIA 4L9RA 2W8ZA 2EERA 4GMFA 4DMMA 3NTQA 1YL5A 1BVRA 3DTYA 3JQGA 2W2KA 3RKRA 2WSBA 4PG4A 3SVTA 4KQXA 4OKNA 3FTPA 1ZMTA 3WTCA 1A9YA 1F0YA 4DUPA 1ZH8A 4TRJA 2H63A 4AJ2A 5L7WA 1YBMA 2PNFA 1XQ1A 1YS4A 4CQMA 3PQDA 1D1SA 1ZK3A 2VRCA 5T5QA 3VDRA 4YPOA 2QX7A 4Q3BA 3JYOA 4RPJA 3ZWAA 2P9CA 2VT2A 3G17A 2PTGA 3OJ0A 4XGNA 4RGBA 4AJHA 2FPGA 1HL3A 2GASA 1R0SA 1Y5RA 4M54A 4ZRNA 3V5NA 4XYLA 5TLSA 3RFVA 4YYZA 3Q2IA 4Q9NA 4QO8A 4HX5A 2Q99A 1YBVA 3W8FA 1N1EA 1W0CA 4L76A 3S1LA 1ZK1A 3MJSA 4G5HA 2ZTVA 1IULA 3S2IA 1VC2A 3CMMA 4KOAA 5BSHA 1JKFA 4WE3A 1XSEA 4EEXA 2W2LA 4IDCA 3S2FA 1NR1A 4N54A 1NVGA 4YRDA 1MUUA 1SAYA 2Q4EA 4F46A 1ONOA 4LRSB 5AXAA 2BRUA 3M6IA 3CEAA 4JIGA 4NBTA 5B37A 1I33A 4BGUA 1XELA 4INAA 4GGPA 4WK6A 3U4HA 1I5RA 5HBRA 3VKUA 4FFRA 4PLWA 5FFFA 3FNFA 1UXIA 4A5OA 2I6TA 3T7EA 3MEQA 4J1QA 1X0XA 4CV2A 3ENKA 3E5MA 2FSSA 3D5TA 3FN4A 2JCXA 2VUUA 1YOVB 5GMOA 1EQ2A 3D3EA 3AUTA 3AUSA 4S3MA 1H5QA 2O3SA 4TRNA 2DT5A 2PWZA 3BXXA 3EY4A 2GDZA 4GKVA 7ADHA 4YACA 5KJCA 1MA0A 3LZ6A 1MXHA 3AM5A 4NBWA 4RF4A 1E7MA 2P5YA 1TI7A 3COSA 4Q3AA 3ZW8A 4YJDA 4DGSA 1MG5A 1E0DA 4R69A 4QFDA 4IMRA 5ITVA 1ZCJA 5FEUA 1E5QA 1GYRA 2B69A 1W4ZA 2A35A 2AQHA 1WP4A 5TC4A 1ZK0A 1KEUA 1E1KA 4ALLA 3KZVA 4DIBA 4NU5A 5T57A 1TB4A 4MVJA 4ZA2A 5U4QA 4XQCA 2OUIA 3JQEA 1SMKA 3INTA 3KOUA 3KSUA 4NFHA 1WLYA 5KVQA 4CLHA 3PI7A 4H3VA 1AGNA 5BR7A 1DXYA 5JPIA 2Y99A 4GX5A 1G1AA 2VHYA 4BO6A 1LLCA 4E6PA 3NTRA 3HJAA 4R4JA 4ND3A 4BNNA 3L4SO 2UUOA 3BHIA 1MG0A 1U9JA 3VPFA 3I1JA 1ISJA 4PCVA 5L7YA 3HZZA 5IZCC 3UOGA 4O5OA 1P1KA 1B3BA 3W4JA 3UH1A 3ZWBA 2ZTUA 3WGGA 3A28A 2ZCVA 2EV9A 1BVUA 2D5AA 3IQDB 4E2XA 4BNXA 1RJWA 3ASVA 3KTDA 3ON5A 1OI7A 1WDKA 5G0WA 4GBJA 2PGJA 2D5CA 3PZBA 4B4VA 5IXYA 4M86A 2QG4A 2Y68A 2V65A 1DO8A 1C3VA 1Y8QA 1J0XO 5MDHA 1N1GA 4IY1A 4J1TA 2J8ZA 3MJTA 1ZK2A 3KSZO 1NWHA 4WNIA 3LLVA 3KM0A 1GY8A 2OP0A 5I7EA 4GH5A 1IYZA 2CMDA 3JD2A 3OJFA 4BNLA 2Q2WA 3PZRA 4CQMB 2P4QA 1U7HA 4K26A 1JVBA 1SBYA 3X2EA 4ALJA 4AVYA 2Q46A 1V35A 2NLOA 1ISGA 1BXZA 2GD1O 3RKUA 2GN6A 4OOFA 4X54A 3V1YA 1LSOA 3LC7O 3R0IA 4R16A 2QQ5A 4PG6A 3E9NA 1E7WA
chains in the Genus database with same CATH superfamily
1CUJA 5AVJA 5K09A 4P4GA 1JA9A 2DFPA 2O8VA 2I6SA 3AJRA 5FV7A 4DVJA 3MF4A 3JQDA 3ZXUB 2A1IA 1ZEJA 1Y4AE 4ZAFA 2AFHE 1KI7A 3ISJA 4G07A 2HSZA 5L3RA 1J24A 4AT1A 3WO0A 1Y1RA 3I2JA 2CWWA 5D01A 4N01A 5F78A 4LBVA 1IH8A 3NTXA 1EGAA 4EF6A 2JJ2D 1T4MA 4M9XA 2ZXEA 4Q48A 1MW8X 1MOSA 1N0IA 1I36A 1YFKA 3RUDA 4LNUA 1P9NA 5TF4A 1OX5A 3AI2A 3D59A 5BR1A 4JLDA 4Y6GB 2VPQA 3P9RA 3PWTA 4Z2AA 4BCBA 1DJPA 1P1JA 2H4XA 4NKRA 1T3TA 2IYLD 3KLMX 2CL7X 1KJNA 2JA1A 2ZVDA 1F1BA 3ZWXA 4EG1A 1TW2A 1IUOA 2HH9A 3NTOA 3E7PA 2IZZA 4DEXA 3AOEA 3M4YA 1P77A 1NL3A 3A6ZA 4MHOA 3OX1A 4HZGA 2ZULA 1EA5A 1LC0A 2B5OA 1ZVMA 2B5WA 2I03A 1PBNA 4IIHA 4HLUA 4R2LA 5TQ0A 2IP2A 4XLTA 1IVSA 2P3OA 4HGPA 4AUMA 3ICQB 2DUJA 4DUGD 3LIIA 5HPYB 2BFNA 4TT3A 2Z8XA 5EKDA 4FP9A 3RRNA 3AO0B 3VR2D 4UJ3A 4LZPA 3FPSA 5L3QA 4DR4B 4IIDA 1V96A 1ODLA 2L2QA 5C53B 5FI5A 3G0CA 3PUWA 3A31A 2WILA 1HDGO 4MS1A 1D9XA 1EFRA 1JWLA 2PRYA 4UASA 1VMDA 4LG1A 2PXHA 4GUDA 1Z8NA 4UEQA 4JJIA 4NNJA 1UF9A 3UYLA 3SEFA 2E5LB 1HT3A 5I9NA 5ES4B 4D8TA 2FETA 4LJSA 5EKXA 1CY8A 1ILEA 4GKAA 3H9UA 4F60A 1FRVA 1HLDA 3X1JA 3H13A 3I9JA 4EM6A 2RKOA 3HA3A 4PZLA 1ODSA 4O2BF 2OL4A 4ZYWA 5BW5A 7MDHA 3DSRA 2CF6A 5GZ6A 1OJLA 2OSBA 5ARDA 1X42A 2GUWA 1TQ2A 4AJPA 5AVRA 2VPPA 2P6NA 3V7NA 3H0EA 1PWYE 3OZUA 4YHBA 4L4YA 1E7SA 4ER3A 1G5HA 1OGJA 1L4EA 2YMLA 3G1TA 4E22A 5EL0A 3O9ZA 2FMKA 2CUTA 3HDGA 3H2KA 4K9NA 1H93A 2PK3A 3KT8A 2RGAA 3LX6A 1Z13A 2ZUSA 4WD3A 5BN3A 2HSEA 4JU9A 3SZUA 3MTBA 4AX8A 3KQVA 4OK5A 3VR5H 4HG2A 5I9SA 3O4GA 3UCFA 4FYKA 3DVAB 1X3LA 3C3MA 2IKSA 4UUAA 1XZCA 1QF9A 5F3RA 1QF6A 3PC4A 4LDJA 5JY1A 3VDNB 1VTKA 3GRPA 3UJ3X 3KTAA 5EJIA 4HV4A 4TL6A 5LXTA 3FOZA 1JHMA 1B7GO 1QP8A 3OLZA 1E2PA 1RJGA 3LVQE 1QFJA 2V7QD 4M1KA 4OP1A 3GLGA 2A3NA 1T24A 1DUSA 2F7SA 2FFAA 2WAOA 3N8GA 5THKA 4MVJE 2ZCUA 5DLEA 5DRYA 1Q0UA 4IUBS 3QTTA 3WA7A 1GD1O 1GPNA 1QDEA 2DULA 4FGLA 4Y6PA 4RMIA 3TSAA 5HRCA 1Z6QA 4L7QA 2P27A 4PPQA 4UOEA 3S4YA 3DR5A 1RWBA 2O3TA 2XQIA 3A3NA 3H65A 5ECWA 3UCXA 2QUAA 3DO6A 1I2CA 3JQQA 4RPGA 2NU8B 4A6EA 5LA6F 1PD1A 1OB5A 1F7UA 1F2TA 3RS0A 2G25A 1K7CA 1PNQA 3QELA 3PUKA 1WMDA 2DWCA 1UKVY 5A05A 1G8HA 1N7HA 2I6XA 1NHWA 4LJ4A 4YWJA 2J85A 4L4RA 3ITEA 1IJKA 1MV5A 3RSQA 3M4JA 2F8LA 2IHUA 3PL1A 4IDHA 5J4LA 4EF4A 1SKYB 2HKIA 1E3DA 2R87A 4KR9A 4P1ZA 1DWQA 1K6MA 1QHHB 3KJIA 4DA6A 3A1EA 3OOWA 2XH8A 1GZ3A 3RHZA 4F9EA 4DC1A 2VSXA 1I7DA 4EHAA 5JE8A 2YDYA 2WIAA 2WSIA 3UXHA 4D3XA 1XEFA 3R76A 3KV3O 4BNUA 1QORA 2QG6A 4LHSA 4AKEA 5DVZA 1AV6A 1XVLA 2CUZA 4A73A 3SWWA 5IM4A 2YWHA 3GLIB 1KP9A 2CVOA 1DQZA 2YTZA 3RU9A 3OUZA 3UV6A 3QVWA 3C5VA 2FPIA 4XRRA 1G5FA 4Q01A 3UWSA 4D6XA 3DBVO 3GCZA 4DCJA 1JU3A 3FYUA 2FPSA 1OCEA 4HVCA 1M0EA 3VSDA 3B8EA 4C7OA 2IYSA 4N9WA 2C9DA 1FTGA 1H23A 4CM9D 2Q1UA 5JW6A 4JBGA 5IH7A 1EDBA 4NJEB 1NWCA 1PZFA 4FNOA 4D9JA 1XJWA 2I34A 1RXVA 3PF8A 2EWVA 2FN4A 5D7BA 4ESHA 3WK4A 4RS4A 2W0MA 3OMXA 1JFSA 4PIMA 1Z25A 2YWRA 2EWWA 4OHWA 3ZI7A 3PNBA 2Z56A 4LJ9A 4FOOA 1ZBQA 2NG1A 1GA4A 4HWKA 4ZCPA 1NI4A 4LCEA 1ZU4A 2I4RA 2XYRA 2XTNA 3GEEA 4RZ2A 4W5TA 2JASA 4JOQA 3OJWA 4Z86A 5G4KA 4GFDA 4D8VA 3KKLA 3JQ7A 5A03A 2KBFA 5EQJB 3B1JA 3GOQA 1BXKA 1FNSA 1MTOA 3IAEA 3OC6A 5CH5A 3SZMA 5IKXA 5FLEX 5JNWA 4V24A 3ZXIA 1EVZA 1QTIA 2I1VB 1P2GA 4PAWA 3RTEA 1SXPA 2UVDA 3MJDA 3U7QA 4QXRA 4EVQA 4KWTA 5AVTA 3MT7A 2NU8A 2QMZA 2W6ID 2B8WA 3EWNA 3KUXA 3L8CA 3QHPA 1YRQA 5K9ZA 2AZXA 4BFZA 4HRAA 5E95A 2GPWA 4OFBA 5CPBA 1TCBA 2HNKA 4LNUB 3I32A 4P4SA 4F5DA 2TRSB 1GTMA 2D0PB 4OHMA 2KJQA 1A3CA 2LXNA 4OUDB 2R5FA 1BRTA 2W0SA 4OD0A 1UBGA 2YIVX 4UMEA 2JIBA 4UUQA 4DOMA 4ENQA 4CLOB 1Q15A 1SUDA 1UM8A 5FBWB 5A5EA 5IX8A 2P6MA 1Z7GA 4QYXA 1MPTA 5ESDA 2CJXA 2FSGA 3V2HA 3C6KA 3KKEA 3C7CB 4W5RA 4Q03A 1GAQA 1PR5A 2WFAA 3J7TA 3B1KA 3MMSA 4RXUA 4WZZA 4XSHA 3SEAA 1LQTA 1XTZA 4MVJD 3T3GA 3VDXA 5M2QA 5F1PA 2VHUA 4YIKA 1XRJA 1PJRA 4H08A 5FA8A 5G1NA 5JDIA 4LZAA 1U7OA 4JMLA 1OAOA 1UDAA 4L4ZA 1YDWA 5KBYA 4URWR 3RVQA 1F3LA 2XYQA 5A4AA 3N3AC 4FQ8A 5CXQA 4HQOA 5KQLA 1ULSA 3BE6A 1M54A 3GLVA 4Z54A 1Q6YA 4Y6QA 2A9KA 4EKYA 5K0TA 4OMFG 4YGXB 1Q84A 2GF2A 1GQYA 4HTFB 4JJAA 3AM3A 3I61A 2H1OA 1BE1A 2O57A 4Q34A 3T0IA 3BMQB 4Z3OA 2CD7A 3D3NA 1S8AA 4DBZA 1C1XB 5K6RA 2PUVA 1VIYA 3BUSA 3DAOA 3CF0A 3N39C 4HQNA 1T36A 2HHJA 4XDZA 5EXPA 5DW3A 3NCTA 3ZDYB 1YZHA 3PEWA 5D6OA 2FDRA 3AR4A 2C2YA 3PQ6A 4BNFA 2HMYB 4Y98A 4HDSA 1QR6A 5LQAA 4E33A 2D1SA 3NHFA 4H15A 4AQDA 4B3MB 5SV2A 3VZBA 4XB2A 2ROQA 2QMUA 3AVQA 3A2NA 1QQAA 1IRIA 3W9UA 2ZB4A 3VMFA 1U0FA 3BIWA 4JELA 3QLUC 1M75A 3WGKA 1ZMRA 4XQGA 3WSVA 3SFTA 1M10A 2DBRA 2XUKA 4ZCIA 3ZWOA 1XD2B 3DVRX 3EFBA 5EEGA 4IIYA 4IV0A 1OYVA 3JU3A 5LQUA 3IUQA 4L6IA 2PQ6A 1Y6QA 3EZXA 4LECA 1I80A 1P0FA 3BGSA 5JCXA 4OU4A 4B7CA 2JFGA 4BKRA 2HWXA 2CZCA 2IHTA 4ENRA 3N8IA 5BWMA 3CUTA 4JB0A 3L7YA 3PUYA 4RNDB 2ZIWB 1BWPA 4J6FA 1MV8A 3H2GA 1GUAA 2FQXA 1PT8A 2C2OA 4WLEA 3N28A 4BMPB 4QICA 4GSLA 1I2BA 4E5VA 2Q6KA 5TMPA 4MJ3A 1VL8A 1UZAA 2CBXA 2DUNA 3HU1A 1RMTA 4RADA 1J5XA 4TKUB 2EVWX 2ZB8A 1M2GA 2YIJA 3AG5A 1GG5A 1F20A 2RBKA 3EUWA 4GOND 4WLFA 1TA9A 2AFIA 2R6DA 1U28C 2IODA 3GJTA 5FFMA 1B2LA 5KU7A 4PZCA 2GJAA 1PDVA 2EFHB 4QGBA 1G5TA 5TVGA 4CIYA 1BG6A 2GH1A 2VYFA 4L8WB 5LB2A 2YXLA 4FMCF 1IBRA 4FVTA 4F91B 4Z1MD 4IVPA 1CS0A 2QL7A 1FXWF 4UQLA 2EW1A 1MAUA 1YAJA 2JJ2A 1WE2A 4LTMA 3HCAA 5ITVA 4A36A 4RPKA 3G2PA 4H18A 1TCCA 4UEKA 1FUEA 1KY5A 3WGTA 3IAHA 2MJLA 4MWEA 1E77A 4DYHA 1TK2A 1THMA 1BMQA 1ORRA 2QYSA 2WIKA 4GO1A 4R8SA 3OZ7A 1SK8A 3EOAI 3SICE 5FBZA 4NYMR 4HEA1 3KQTA 2F17A 2N1MA 4TSKA 1JILA 3UMJA 4LVUA 2GRJA 3PHGA 2RI6A 5EJ2A 1LLFA 3F5QA 2CCJA 2P4HX 2XCQA 3AEQB 2VJBA 1NXVA 3KWMA 3NORA 4MGKR 2BFEB 1Q50A 3N2KA 1OBFO 1OWMA 4DDVA 2AXPA 1LXCA 5LBUA 3T3HA 1WB6A 4IZHA 4YT4A 2F48A 4BHTA 1N0UA 4XLLA 3ZXYA 3EVAA 2YV4A 1RYZA 2C2KA 1CJUC 3URMA 3GLFE 2NYVA 1TZMA 1L7QA 4J94A 5K8CA 1VRCA 3KJQA 3MJVA 5AQ1A 5EHNA 3EZLA 3BHNA 2IX9A 5H3LA 3PJFA 3H6GA 4URXR 3ZCQA 3GRKA 5CB8A 1SKBA 3OCVA 5EE3A 1H6BA 5ELXA 1FXSA 2BGTA 1MCZA 1EXVA 1UCFA 1UPUA 5CFPA 1ESZA 3OE4A 1P4AA 2A5JA 2LR0A 1EB8A 2ZBQA 3AGQA 2X77A 3SG0A 2XCSB 4B6OA 3Q7RA 2F9FA 1KYQA 5L4LA 4FN5A 4DQKA 1QQ5A 1W0KD 3HBLA 1FFBA 1ZOLA 1DO2A 1YNSA 3HXPA 3KJXA 2FZEA 2Z9BA 1J8VA 1FOEB 2EZUA 2R62A 3BK7A 3GFRA 3HC7A 3D3WB 3OTIA 4I7EA 3JXEA 4PW0A 5DISB 3USZA 1Y5LA 5DBOA 4BFSA 2HHHB 4FJ0A 3ECSA 4F4CA 3PG5A 2YJNA 1TFRA 1JHAA 5AJZA 2PX8A 4J9VA 4QGHA 4HUJA 4CV1A 2NO7A 1YQXA 1O95A 5A9SB 3AVVA 4D3YA 5JCPA 3HFSA 4L9SA 2C2WA 3DJYA 2PA3A 4NOJA 5FPYA 1B3RA 1ULTA 1Z7BA 1PZHA 3M6MD 2FSIA 3T7CA 4M9RA 3O73A 2FVXA 3UJAA 3FBWA 1ZICA 2PAAA 4KQIA 2P4UA 5EIOA 2TMKA 1YZFA 2P78A 3IODA 2A6PA 4C05A 3NKFA 1DPFA 2DQZA 2XXJA 4NK5A 3ZVRA 3PUHA 1KAGA 3PPWA 5AW4A 3FCYA 1LI7A 3QU5A 2FKNA 2DKFA 1JAIA 5CITA 3FYUC 4TL8A 5KVVA 1IUNA 2VNHA 1KTIA 1IK6A 2H11A 4ASUD 4C04A 1O4WA 3GX1A 3W0LB 4QUDA 3N2EA 3L7BA 3TJMA 4YP0A 1P81A 3NAMA 4HYTA 3TXXA 3EMKA 3ND9A 1EX7A 4Y67A 2R6CA 2QBYA 2QJTA 3FHJA 1CEEA 4AP6A 2DFVA 2ORVA 1QH9A 1CS4C 2XUHA 3MOGA 5CT6A 4DV5B 1H69A 1QVRA 3GT0A 3KR1A 1Y81A 1TIBA 4TGLA 4X94A 5IYZF 4C0SA 1TW3A 3HM9A 3LO8A 1E4OA 4F1JA 1UXOA 3WQHA 3D4LA 4D9BA 5KNDA 2NSLA 2GZMA 2Z3ZA 1GILA 3R0VA 2ILTA 4E31A 1C3XA 4D9CA 2HBYA 1FDTA 2OAEA 2PR2A 3VOAA 1QPZA 1ZJYA 2OO5A 4C5CA 1JSZA 1V16A 5G0VA 1S8FA 5F9HA 4GPIB 2NXEA 4H1TA 4UEWA 2EGGA 3EWSA 1F8GA 5DRTA 4ZVLA 2VOJA 1C7RA 3AQ4A 3GGCA 2OILA 5IJWA 2VHTA 1ZN2A 1XX6A 4Q9JA 4CMEA 1BD3A 3CUSA 3IV6A 4WXHA 3FNGA 4PBSA 4DRYA 4RNCA 2B1JA 2JAOA 4H1UA 4ZODA 1CY2A 4PNHA 1EIWA 1V8DA 3ANTA 4AJ4A 4J07A 3RHFA 2ZJAA 3WLIA 1MRZA 1HC7A 2R7MA 5SYNA 4EKIA 4LXXA 3KELA 1NR5A 1F38A 1KSHA 1VHWA 1JLMA 3CA8A 4KX5A 3ZNPA 3T5PA 2XWPA 4MW4A 1ORVA 1ECPA 1MC4A 4FDUA 4RV9A 2RHOA 3PXXA 4J03A 1EFUA 3JD3A 1TC2A 4HFNA 4TMKA 5EIAA 3UYKA 4D4GA 3D7MA 1H9CA 1JNXX 3OF3A 2EHDA 1R64A 2IL1A 1R4AA 1KBOA 2NTYC 4HRYA 4PHTA 2C7VA 3EVTA 1B0UA 4GP6A 4NCIA 4QG3A 5J2TB 2JZOA 3A6GA 5TPZA 3WWYA 2J5XA 3DVAA 3SZGA 2ZIVB 3SFVA 1XXHA 4K2AA 1AKMA 3SC6A 3MJ4A 4N0QA 1IHYA 1RQ7A 2BEUA 3S44A 5K8TA 1GKIA 2AE1A 3F8WA 1LWOA 5C5EA 4KQCA 2FEKA 4RHFA 4WCFA 4JGBA 1ZD9A 4QQKA 3QRWA 1NPDA 3D2LA 2VYQA 1UKAA 2WC1A 5BUCA 4JQSA 3ICVA 1C9EA 1L7PA 2GZAA 1B6GA 4X3PA 4X84A 4BRUA 4DCSA 3EPLA 1JDBC 1MABB 1YZLA 4OB6A 2A57A 2WAMA 1H0KA 5DN9A 2XUGA 2NPOA 4PIVA 5TF0A 4MRPA 3B9RA 4PHGA 1IHDA 4G84A 2IBSA 1I7LA 1VBKA 4N0MA 3OCJA 4OP3A 4JC0A 3ZUPA 2XZLA 2AUMA 2EP5A 4HKTA 4CDGA 2MR6A 3G7NA 3MK31 4KLAA 1KI6B 4DHWA 3AF2A 4JK3A 2XCOA 3ZYZA 4EITA 2XCLA 5A4MS 5FV4A 2WSMA 1XR3A 3CWQA 5FLYA 1EEXB 2AF4C 4R7GA 3W2EA 3ZJTA 4BNDA 3C3YA 3PQFA 4II7A 4U39A 3TJRA 5H80A 3AHIA 1IK4A 4L72A 1XU7A 3IP6A 5EJ5A 5LNK1 3DNPA 4BE4A 1U8UA 4QVKA 4B76A 3QU4A 3FPGA 1YFLA 4XFKA 1MZVA 4AULA 3MLBA 2LIVA 4WV3A 3HJGA 3SHTA 3NTVA 2G72A 1ZJWA 1OLXB 5EUCA 2HREA 4QOJA 1ECLA 4B7UA 1GTZA 3PJEA 5DP1A 4DAOA 5CNJA 3KBOA 3HI6A 5DKFA 2JZNA 4WBXC 1LD3A 2PYZA 3D3KA 3H17A 3LT4A 4M88A 4F2WA 2WF8A 2Y8EA 4CR7A 1RFGE 4RGVA 4E1BA 4YT8A 1LFAA 2MMGA 4P84A 3MJRA 3E7DA 1AUXA 1M8KA 1NW7A 1LW6E 1PV1A 2JCYA 3BRCA 2PUBA 4N4AA 3ZV6A 1DRKA 2FFRA 5HR5A 4RA6B 2I29A 2OOSA 3M5WA 5KS2A 4L5IA 3QX8A 4DSNA 2B34A 1YS6A 4YT5A 3T0FA 4ZCTA 2DQKA 2CXNA 4UVIA 2EEPA 2PS3A 4OI2A 4OJMX 1K9VF 1Z2CA 4X85A 3ZBUA 5JZMA 3MG9A 5IN5A 2VLIA 2FG6C 2R751 3SX2A 4OQ4A 2QNBA 2OXEA 2PVPA 4O2BA 4XTCS 2KM1A 2NVWA 2ZR0A 2VRNA 3LQ4A 4MOWA 1IAVA 2AFIE 3ZY3A 2TECE 4RJLA 4JZYA 3ESYA 3L1KA 5GV8A 2PN1A 3P52A 3FTNA 4C1BA 2LIPA 1GPDG 2JJYA 2PPVA 1R6BX 1W0KA 2VXOA 3MAJA 4LKOA 4C2UA 2F3SA 2EC5A 1V7PC 1X77A 3FUUA 2GETA 4WQMA 1UPTA 2QAJA 2E4AA 2JB9A 4K6GA 4MXDA 3TPZA 3OEEA 1NONA 2IE8A 3I12A 3TLXA 4DV6B 3FNQA 3IAM6 3EVNA 3I2YX 2QDXA 2VP2A 3OZXA 3VAZA 4EGCB 5BQFA 4QLBA 1FW6A 1EWTA 1XRSB 3CQ9A 1O94A 3JQAD 1H4QA 5K8IA 3ORSA 1E8DA 4KFRA 2I6QA 5G0TA 4XW2A 2J4FA 2QPTA 4M99A 3MS2A 2AZDA 2H2IA 4WOCA 2PZMA 2A84A 3BHJA 4D4HA 4NDZA 3WMGA 3IIJA 3VJRA 4YJ3F 1XRMA 4KRXA 4I4IA 3PPIA 4ZP1A 3R3VA 1V7ZA 2HAEA 3BHMA 1YR3A 1ZOSA 2IY8A 4UTOA 4D9GA 3HUUA 4I81A 1ZWKA 4HN9A 3QP9A 5L3ZA 3I6QA 5KNBH 2QUHA 1VIMA 1TD1A 2GTPA 3DHEA 4XARA 3RF7A 2OZLB 1GN8A 2R6HA 2B36A 4A8JC 3M5PA 2ISCA 2Y1DA 2OO5C 4R1PA 1NU6A 3UANA 3P9SA 1A50B 1X8KA 5G1PA 3IKVA 3GQBA 3WIDA 2FG7C 2FP3A 2I6FA 1XQWA 1XZMA 4GHWA 3U3JA 4MR8B 5TR9A 2X76A 3F78A 2GQ0A 2B7LA 3RO7A 2W2PA 5EIBD 3BCSA 1GDHA 4W5WA 1M6VB 3QJYA 3QWBA 4KWCA 1KMCA 1AZSC 3K8ZA 4O4JF 5KO2A 3EQ2A 1G3RA 4MUHA 1YR1A 4RVUA 3K2EA 5D3ZA 3I6YA 2X0DA 1NI4B 2Y6VA 1FK8A 3LY8A 3W8RA 3FF4A 4F9FA 2V7VA 4PRKA 2WAYA 3WKDA 4D4LA 1ESNA 3DLPX 3OH8A 1T8YA 2A88A 4QE3A 1OLSB 2XI4A 3QLUA 3UWOA 3K1ZA 3IAUA 4E5NA 4WNAA 2C3OA 3KV1A 4KI0A 2HK6A 1DG9A 3QPCA 4DR1B 3K3PA 1NA5A 2JH8A 4C6RA 1N2OA 1VFPA 3DOOA 1FFXB 4TQGA 4WA8A 2EYUA 4RH3A 3VNSA 3FCOA 5DGIA 2OHGA 2DWPA 2JIZA 4UPDA 5B3KA 3FYUB 1FFDA 1NQWA 4V0RA 3BPSA 4ND1A 1C1XA 5CFLA 3L40A 4F4DA 3FMPB 3LF1A 4UTNA 4HT3B 3WGHA 1ONBA 3VKHA 5D5HA 2P7HA 3LUFA 1AS2A 1S2NA 3SSOA 5CVTA 1W0JA 1UKZA 2ZIFA 3K92A 4QYSA 4OGLA 3BH6A 5EE0A 4G0NA 3A3OA 5E3HA 1MIOB 4MR9A 2Q1SA 3DKKA 3P8ZA 4TRMA 3EVZA 1JHZA 4MDYA 4JS0A 1RE1A 1M6NA 3OBBA 1VJCA 4AXXA 2J0UA 1E59A 1NY6A 4Y2TA 4G85A 4RA6A 1RAEA 4KSBA 5KI6A 1F8YA 4RVSA 4TX1A 4CUJA 2VCEA 4E94A 1A9OA 1SZCA 2C54A 4QM7A 4D8UA 2P11A 3JQ7B 1XUOA 3QE3A 3EYWA 2PKQP 3HP7A 3AW8A 1C81A 3A2MA 1NBIA 1LDEA 1M6YA 3SDBA 3DZHA 3VBCA 3WRXA 3ZV7A 3T3PB 1CQZA 1EWQA 1Z26A 4L4UA 5T3UA 5EUBA 1I5OA 3R9KA 1NX6A 1HF3A 4LOAA 3OZCA 4C6SA 2ZUFA 1YR9A 1QQBA 5LB4A 1ULZA 1SUPA 2R47A 4FGKA 4JY7A 4TQAA 5B36A 1TYEB 1YB2A 1INLA 2Q9BA 1B14A 2PZBA 3IP3A 1PW5A 1S5PA 3JZFA 4J0DA 3P9NA 3OIFA 2X5JO 2YXEA 3D6JA 3T8YA 2NV2B 2VH2A 1AO0A 1X7WB 4O2AA 5IKOA 3MD0A 1RFLA 2X2OA 1I3OA 3R24A 4BP9A 3PHLA 2RHBA 3N2GB 1RE0A 1MAHA 4J6EA 2O4UX 3B78A 2EU8A 1GKLA 3GJYA 2CSXA 3OMLA 4TWRA 3SIXA 1I0LA 3E61A 3DZDA 4GBMA 2QM8A 1IZ8A 2H9YA 3ASYA 2VJDA 3E2MA 4U7TB 5DCUA 5GADl 1U63A 1Z18A 2PL9A 2Q21A 3A6DA 3AMVA 3ZKAA 2HJHA 1GYQA 3H0KA 4ER0A 4J29A 1QYVA 1OHHD 4R51A 3S2SA 2CNDA 3VPDA 4HB4A 2W2XA 4JUCA 1H6CA 5A62A 2ODPA 4CIWA 2FA9A 2VJMA 1FS4A 2QRKA 3AVTA 4DCGA 1DAEA 3IKTA 2CKDA 2J87A 3ZQ4A 5K3DA 4K46A 2JLCA 4Y18A 2O06A 4LHVA 1JEYB 1LVUA 2MR5A 3KOYA 4U4AA 4HZUA 3NYQA 4Q00A 3H2YA 3Q7SA 5D3MA 1FNCA 5L7TA 1WL8A 3CX8A 3FVTA 3O82A 1JA1A 1JVNA 2OR3A 3LKDA 3HUTA 3VMMA 1VBFA 5DXJA 4UMVA 1U3GA 4YJHA 2X4LA 4WBNA 2GO1A 4BBJA 3PT9A 4DJAA 4FONA 4ARZA 1U0LA 4M1SA 2E4ZA 2N9UA 3OWHA 4KLCA 5C4IA 3DMHA 1TMGE 1HNNA 2VT7A 3V1LA 1NUUA 1EJ2A 1YJQA 5TS3A 3QYFA 1OX6A 1NVTA 2J0SA 2ZJYA 2HT6A 4Y2XA 2RGGA 4B3BA 3K6KA 1XKTA 3O0DA 3GMSA 4NHEA 2GPJA 2Z2ZA 2AXQA 3GZJA 5TARA 1J1ZA 3QKWA 2JLYA 2W71A 1JSCA 3DUWA 1KK2A 2C2HA 1QZXA 4MW0A 1MGOA 1DRJA 1E94E 3HCOA 2H8KA 4UNSA 1B74A 1VMKA 1ICEA 3BEOA 3UB3A 3CT6A 5AVXA 3GGPA 3NRCA 1JG3A 1M6VA 2ZTLA 2I7DA 3PITA 4GRDA 1ACJA 3AKYA 3CLTC 4M1ZA 4TMZA 2FLWA 1O7JA 4NNOA 5JC8A 1P2FA 1U0SY 1ETHA 1U8FO 2BGLA 5HDQA 2FI1A 3RBXA 4Q1BA 1PO7A 1SWVA 1GCUA 4M9SA 3W5VA 4HGNA 3HS3A 4DUGA 3IUEA 2G09A 4CM4A 2GD2A 4P82A 5BNWA 2FN8A 2JGDB 3D02A 2WIFA 3I9FA 3MCWA 4FMCB 1TUGA 2B20A 3AZQA 1T6XA 3GY0A 2R65A 4P4LA 1FMTA 4FYVA 4MS4B 3FTQA 2JFWA 2FXVA 1R15A 2ACVA 4ZV9A 4F12A 5ALMA 1ACMA 2PT5A 2AWNA 1Q1AA 3MVEA 4GMGA 1YVPA 3NM5A 3P71T 5E3JA 1SHTX 2REOA 4MP8A 1SN7A 4ZCLA 5IBRA 2J9YB 1GPMA 2ATCA 4LCJA 2VUSA 1Y4DE 2A1TS 1FF9A 4UXHA 5AK0A 1FXUA 2H57A 3TRJA 2X7HA 2ZRHA 4KRYA 5JROA 3LCJA 3WV4A 2GFQA 3X1MA 2AH5A 2C20A 5ALQA 4HI0E 4XM1A 3DNMA 4IUDS 2H1WA 1ZJ4A 4OBBA 4N41A 1QGUA 3H8VA 3L01A 4GVXA 3ZBQA 5FHQA 3IESA 4JLVA 4P2GA 1U0RA 3BRWA 4B6PA 1BS9A 5LMCA 1O6CA 4L73A 5G41A 4JV5B 3STTA 2WM2A 2IUYA 2RAPA 3F6PA 3OOHA 1ZM9A 1QMPA 3OOSA 3RU2A 5I8PA 3Q8LA 1MHTA 4M21A 4C43A 1WSBA 1ZDMA 2P4EA 1STOA 4WZBE 1XNJA 4FDAA 2V8OA 1O6FA 2MSDB 2NNWB 1TJ4A 4IM7A 1WBJB 1SM4A 2EG9A 4U00A 5AI4A 4RSGA 5FYQA 4GF5A 2H4YA 3GGGA 2FP4B 1RZ3A 2NU9A 4HPXB 4D9IA 3U61B 4LZLA 3G8DA 1ND5A 2C4HA 3GIWA 3HJRA 1BWRA 4R3UC 4LQ4A 3VC2A 3K7EA 3HUDA 4FHZA 2FSHA 4IFTA 5B6PA 3TZKA 2BHSA 1CUBA 2FPPA 2WBLC 3LP8A 2WYIA 1Y6FA 2VNAA 4FFBB 1XB2A 1B1CA 2VPIA 5LZ2A 3HCBA 2WYVA 1Q0TA 1HNXB 2VWQA 1OXVA 3PWKA 1B8PA 2MTBA 5K03A 2XNCA 4HLNA 1X7GA 1YVEI 5HKKD 3CG0A 4KITB 2IPAB 3LX8A 4IOJA 2ANBA 2PSHA 5AI9A 4KPUA 1T0IA 1MB4A 3T7SA 4K6KA 2FTKE 2O8NA 2VNIA 2ZSIA 5B1EA 1DQSA 1XTSA 4FFLA 1VPTA 2FPWA 2PGIA 3JQ6A 1HEIA 3DMFA 1G38A 3EZ7A 4LHYA 2COEA 5AKLA 3HKEA 1QE3A 2DUUA 3OPNA 5IKEA 3DFFA 2VRWA 4HB2A 3VR5D 1QGOA 3P9KA 3HB7A 3TPFA 3B48A 3ZHZA 2X5XA 2QAGB 4TWJA 5KJEA 2V1UA 3LLCA 1DBPA 5K0GA 3CRMA 4MA4A 5I3CA 4TKVB 3M83A 3U3MA 1C9NA 3OZEA 1PEKE 5IBQA 5IW8A 3PXAA 1E8MA 3S8EA 1I7QB 4E12A 2ZGVA 5DH9A 1M0SA 4CGYA 3HH8A 3BBPA 3MWGA 4NIMA 5JALA 1XZAA 1EA7A 2A58A 5IXSA 3TQCA 4PPYA 3HVKA 2CXHA 4BJ6A 4D45A 2ZTHA 3CIFA 3MZ0A 5CFQA 4C89A 4PQEA 3H05A 1EVIA 1Z3IX 1GPH1 4EKEA 1DDIA 2BKLA 3A9SA 5KMGA 2YWXA 3SSAA 3B12A 3TFQA 2A9JA 1ZINA 1DBWA 1NG1A 1NXQA 1E0JA 1UFVA 3KHKA 5IF9A 1NVFA 1L0BA 2EZ8A 3TZHA 5LQJA 2C9CA 2D5BA 1JLLB 1OQAA 1OGIA 2HRBA 2YY6A 4W5NA 4EFMA 3G0GA 5F2OA 4OXIA 4GUAA 1X74A 4B7AA 5AIAA 3VAAA 4LZZA 1T4GA 1LF0A 3GAFA 1H42A 4UULA 1BE0A 1C80A 1I2DA 2HF7A 1YQGA 2CZGA 4GWGA 1WCV1 5GV7A 4C7BA 3V8BA 1TIPA 3HBMA 4D7AA 3ETGA 4HDKB 3S2YA 4C5AA 1J5EB 3K73O 1OFVA 5ITZB 4RDIA 4OHCA 5COAA 3T35A 3AVUA 5HCUA 1WIWA 2DPMA 4MROA 1G21E 1X7ZB 2I76A 4CLRB 4K9LA 3VNVA 1P72A 2WB4A 3EGDB 5IVHA 2RJOA 4CEIB 1PEYA 3HMKA 4N8DA 3WL4A 2PXAA 4NZNA 4YRKA 3TTXA 1OXMA 1VL6A 1JQAA 2XMDA 2BGMA 4HEJA 4XI9A 5KTNA 3VNUA 4BVEA 1CEQA 1PL8A 4ZIRA 3JZDA 2QLBA 1PWXA 2VSFA 3KUKA 2PUEA 1WVGA 3AP3A 3WWDA 5IAGA 3W78A 3KXDA 2IW3A 1X86B 5JECA 1GVHA 5FNVF 2DUWA 4MDHA 1I24A 1LV7A 1VHJA 2W8BA 1Q20A 2H6EA 4M49A 5LYYA 3I8SA 4X62B 5C8ZA 1Z6GA 3TRKA 1P4RA 4CL8A 1GA6A 4RD2A 4TVSA 4E03A 2PZGA 1J9GA 1HZZC 2JCGA 2AJ8A 3BF8A 2ZYWX 2FG5A 1PUJA 3AERB 4IFBA 4U7WA 4DARA 3T9BA 4Q4JA 4H31A 1J2TA 4OVKA 2G83A 2ZBRA 3DW3X 1EUYA 3W79A 4DGQA 1MDFA 2J59A 3ONVA 2NNLD 4QOEA 3EVBA 4BO8A 2HRDA 3AEQA 4OQFA 5B1IA 2I78A 5A3RA 5I47A 4CEIA 4FFDA 1WB5A 4NCKA 1XP5A 2X86A 3N0WA 3DDHA 2HMSA 5BO5A 4AMGA 3FAKA 1IBKB 5DBFA 5KYUB 4AP9A 4ARCA 1XTPA 4WASA 2PZKA 1G4AE 5CK4A 2VZ8A 2BP7B 3AEUA 1J56A 2CBZA 5FD8A 4XIGS 3BE5A 4ZDWA 2A1TR 1P9WA 3WWZA 3I6IA 4FLEA 1D2AA 5JS7A 1EAYA 3LKVA 3NRBA 3F6BX 4C3UA 5A5FA 4WUVA 3CW8X 5D8DA 1V1JA 1DT3A 3BIXA 3FPBA 2QW0X 1A8UA 4HO1X 5L4SA 2I66A 3QBTA 4PTLA 2RK3A 2W4MA 4UUNA 5DYGA 1NUHA 2NACA 2P9EA 5LA6B 1ESMA 3KE8A 4IGEA 4N8SA 2J7KA 4RK7A 4EGFA 2BFCA 2DHDA 2FYTA 2FWNA 1MO6A 3HTXA 2X3YA 1J9ZA 2BHNA 2QL9A 2VBCA 3IIMA 1X7XA 2UYQA 1UBJS 1U8EA 3E1KA 2QTLA 5DSZA 2IDJA 4CF3A 3BMQA 2IS6A 4TKUA 4BO1A 2V4MA 1P0CA 3U7GA 3UT0A 3QWHA 5ECGC 5K4GA 4AC9A 1RQ2A 1WMFA 3FIUA 2CLOB 1CJCA 2AJBA 2XOKD 2JFNA 3C7TA 4K1LA 1W93A 4PTZA 5K3FA 3M70A 1G19A 2D59A 4HH1A 1J23A 3KNZA 4IF4A 4BRWA 2WWHA 3SMQA 5BVGA 5C3UA 1OH8A 5E8RA 1FFHA 4Q4HB 4JHXA 2QRQA 3A4LA 1G3UA 4CWAA 3KFXA 2Z09A 3RAPR 1SBCA 2HZ7A 1DAOA 2X0EA 2XWSA 1Y34E 2G17A 2NZYA 4LS3A 4N47A 2FX5A 3VO1A 4KK4A 5CJPA 2DSNA 3LP6A 4RWEA 5C7LO 1RTKA 2RGCA 2NU7B 3CF2A 4TSFA 1NFQA 3ROPA 3ABOB 3T7KA 1P9LA 1T5BA 1RBZA 1LDBA 1H94A 4QOFA 5CX4A 1A5ZA 3B89A 5FB3A 3CM0A 2JFQA 2ZIXA 4CLXA 1KJJA 1YUMA 2QZZA 1XAIA 2RHMA 4LRQA 2P6UA 1H3NA 1GTVA 4WOPA 2CLLB 1CD5A 4FYWA 5FLXA 5ECDA 2QSUA 2VDRB 3KAKA 4GMXA 4KC0A 5IYZA 1GPYA 1YZGA 1GUZA 5G40A 1ETUA 4ZREA 3EMDA 4FGWA 3T1YB 4BZWA 1J1IA 1MQSA 4OQZA 1PL0A 1J22A 4HJRA 2BGIA 2CMGA 5A7FA 4L7VA 3HE3A 1Z5GA 4M0PA 2IWHA 3WLJA 1MC8A 2R4TA 3F98A 4YMVA 1XJQA 4KVGA 4Q6WA 2VDMB 5SYAA 3SE7A 4NCBA 3I4FA 1HDEA 4MQ4A 3ULKA 3B6JA 3RT1A 2DB3A 3CISA 4MCHA 3FYSA 1ZQ1A 4D0SA 3V1MA 1TEVA 3N0RA 3EBOA 3GN2A 1T4CA 1T2FA 2C3MA 3KKZA 3ZC3A 2HWKA 2ZI3A 4UXJA 3KKQA 2C8KA 1WO8A 1QX3A 2QVCA 3T4PA 1X1RA 5M04A 4I9FA 4IXNA 4UUOA 5LIPA 2QUIA 2E6KA 1DRUA 2VDJA 1A27A 4MRMA 3ZI4A 3ESAA 2HQ1A 3KWJA 3LY9A 1RXIA 3DEJA 3MPUA 4PYIA 1HNWB 4HATA 4OLAA 3ZGXA 1LPBB 5KWSA 3MFQA 3TCKA 7MHTA 1E1QA 3VPAA 1EYZA 1PSDA 3K2QA 4KIGA 4MRVA 4LY3A 2J3KA 1XCMA 2P2SA 4LBWA 2X6QA 4EY7A 4ZGGA 4LYHA 2OLEA 4PZDA 5IM5A 3KVYA 1U7WA 5KIAA 1QKJA 3BOSA 3L7JA 2NXNA 1C7JA 5FNZA 1FNNA 1E18A 1N1MA 2WJWA 2ZB2A 3CNQS 4IEEA 3KTFA 3MRXA 4U5QA 4XWTA 4D6PA 1QRSA 4IH4A 4KWHA 5EEHA 2FMIA 2XVAA 1J4AA 3DBHB 1SKUA 3EQZA 3NJ8A 1EBUA 2II6A 3ES9A 3QKIA 5T3YA 1QVVA 3BFVA 2GD6A 4ABYA 4CV3A 3HPQA 4OOEA 2GK7A 3CVVA 5EC8A 3AOGA 5HKLA 1PDOA 1Z0DA 4BTVA 5IAAA 1O4VA 4KXMA 3DDWA 1F9EA 1AGRA 2A5YB 2PZFA 1UK9A 4GMKA 4R8LA 4G24A 4G4SO 3A3KA 4O4LF 4DC0A 1LRJA 4I1IA 2QBYB 4UPVA 1LTKA 3AIOA 3C97A 4EHIA 4XUDA 3H1GA 1MX3A 1XCOA 1URPA 4LJ6A 2FUKA 3KB1A 5AKHA 4GP9A 3RUEA 4QJ3A 1X7WA 2I33A 4O2AB 4EW2A 1SXIA 3CRZA 4ZT2A 3BB1A 3PUZA 3BYZA 1H2RS 1R1DA 5EN4A 2GM4A 4UBMA 1L5LA 1VLJA 2WVHA 5JFGA 4AZTA 3AQIA 3HNRA 1C8VB 4MVJI 3DE3X 4C88A 4C0WA 2Y1WA 4QYIA 3V6MA 4AY4A 5ULLA 3TW8B 4O63O 5KOHB 2YRWA 1G16A 3NBXX 3CVXA 3U81A 3OCWA 1H2EA 2CFTA 1ZCZA 3OFNA 3W6NA 4CM6A 2HMVA 1PX2A 1UZNA 4YAFA 3ROGA 4ZAXA 3PVSA 3FFXA 2XNDD 2Z83A 3TQIA 3EGXB 2JD0A 2J7PD 2WIDA 1SCNE 1DEXA 3N7UA 3LKBA 2DQ4A 8ATCA 1YIOA 2CMHA 4GOJA 2VAPA 3O2JA 4H4DA 5SZJA 3TB6A 1N57A 2ZQ5A 2ECQA 5DNDA 2C7QA 3B7PA 2Z4RA 4LVOA 1A77A 3LW7A 3VC3A 1GTL1 2PT9A 2BGGA 2FHPA 4IJVA 4K88A 5CLGA 4BV2A 2XBUA 4E6EA 3Q9NA 4LV6A 1CDOA 2A5FA 5DHUA 3HDJA 2MCFA 5F4BA 3SLKA 2R6GA 2GVZC 4C7XA 5HIIA 5CM2Z 6YASA 1ZSYA 5EJ9A 2XRFA 3ZX4A 2FUG6 1YDFA 2I3AA 1P8JA 3AM1A 2FJUA 4IVQA 2B99A 4DIUA 5LR6A 2SICE 3ZDBA 4K6HA 4JYPA 3U7QB 2GLUA 2H1CA 4YP7A 2ZRMA 4I9UA 2Q6LA