2BGOA

Mannan binding module from man5c
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
116
structure length
116
Chain Sequence
SWTYTAASASITAPAQLVGNVGELQGAGSAVIWNVDVPVTGEYRINLTWSSPYSSKVNTLVMDGTALSYAFAEATVPVTYVQTKTLSAGNHSFGVRVGSSDWGYMNVHSLKLELLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Mannan-Specific Family 35 Carbohydrate-Binding Module: Evidence for Significant Conformational Changes Upon Ligand Binding
pubmed doi rcsb
source organism Cellvibrio japonicus
molecule tags Carbohydrate binding protein
molecule keywords ENDO-B1,4-MANNANASE 5C
total genus 12
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2bgoA00
2XONA 4CU8A 2X10A 5A1AA 1H6YA 4FI9A 1JZ2A 5CYYA 3HNMA 3MBWA 4QPWA 3ACHA 2QBXA 4PT6A 3WNKA 4A44A 2QQKA 5I0DA 5JXJA 5DPNA 3HNYM 4MGQA 4CUAA 3DYOA 2EIDA 2VCAA 3ETPA 3K4AA 2VZTA 4DEVA 2DCJA 3FL7A 1H6XA 4QB1A 4DEQA 5DMYA 2QQNA 2Y6HA 3C7GA 3A21A 2WAOA 3K4DA 2W91A 3LEIA 2BGPA 3K75B 2W94A 1JZ6A 3HJRA 3ACFA 5F7UA 1JYVA 3UESA 1KEXA 3OGSA 5LA0A 5IJRA 1SHWB 4TXWA 3C7OA 5JMOA 1US3A 4E8DA 2WO1A 1XNAA 2C4XA 4QX3A 2WUHA 3CKHA 4AG4A 1UZ0A 2BERA 3I3EA 4CVUA 1OD3A 2HLEA 2RJ2A 1CIYA 3FHAA 4LQRA 1GNYA 3THDA 2ORZA 2VMDA 2OKXA 2VTFA 3W5MA 2VMCA 3ACIA 1GOHA 1P8JA 1O59A 1WCQA 4GWJA 4JKKA 4CUCA 3OGRA 2C26A 2VZUA 3VD3A 3JXSA 3I2JA 1JYNA 4QAWA 1JZ5A 2WO3A 1UWWA 1RYYA 1GOGA 4A3ZA 2Y6KA 5HXMA 1OF4A 4CU6A 3ABZA 1YQ2A 4UAPA 2X09A 3P1IA 2QQLA 1UYXA 4GWIA 4AAXA 4QX0A 3UNPA 4P02B 4QDQA 5EJ1B 2E33A 3AC0A 1K12A 3FN9A 2QQOA 1GOFA 2J1SA 3CMGA 3WNMA 4QB2A 2X05A 5C71A 2DDUA 4BK5A 3I97A 3IAQA 1I5PA 2QQMA 2XQXA 5IFPA 2LW8A 3CIHA 1NKGA 1UY3A 2WABA 2VQUA 1JHJA 1HN1A 3WQBA 5JXIA 3OG2A 2Y6LA 3HNBM 1UY0A 4BXSV 3K4ZA 4P08A 3NNGA 2WZEA 2VMFA 2CDOA 1PMHX 5G05L 1D7PM 2W9XA 3VD5A 1W9SA 2E26A 3THCA 1O8PA 1XC6A 3IAPA 3UETA 2VZ3A 1J84A 4RYDA 2C9KA 5JXHA 4QX2A 3HEIA 3T2PA 3WF0A 4HG6B 4XZUG 2PQSA 3OEBA 3ZM8A 3J7HA 3F2ZA 2Y64A 3GM8A 2V4VA 2VC9A 3DECA 1UYYA 2JE8A 1XPWA 2YG0A 4MGSA 1W99A 4CU7A 3WF4A 2J1TA 4D0QA 3I2FA 2ZXQA 1LNSA 2J1RA 3HPNA 3WSOA 4RN5A 1DLCA 4DXRA 3MO4A 1JZ3A 1SDDB 4ZZ8A 4GZ9A 3DYPA 3CQOA 1L7QA 3IIIA 3K77A 2HYXA 3K46A 2W92A 3CZUA 2VOTA 4Z2AA 3SKJE 2J1AA 5J1XA 5FUIA 1DYOA 3EYPA 1K42A 2BGOA 2V72A 1F4HA 2WYSA 2QQJA 5C70A 2W1QA 1UMIA 2VQTA 2Y6GA 3VD9A 2V5DA 3T2QA 3VDCA 1CX1A 1UY2A 3SKVA 1UXZA 1JZ4A 3MV11 1W9TA 3I3BA 2DCKA 4XUNA 2Z4FA 3WF1A 1F4AA 3DYMA 2WAAA 2EICA 2RV9A 4TTGA 1K3IA 1K45A 3T0BA 5CZKA 4CU9A 1DP0A 2JDAA 3T0DA 4MOAA 5EIYB 4M4RA 4LHSA 2Y6JA 3SEEA 1UXXX 4ZXEA 2XOMA 4OMDA 3IDAA 1JU3A 2VZOA 3HOBA 2B4KA 3WF2A 3D3AA 2J7MA 2J1VA 1J83A 2XHNA 4M4PA 5B4XA 3PUIA 3NRUA 1W8OA 3PUHA 2Y8KA 4IUGA 3P6BA 4A41A 1PX3A 3NQHA 3A22A 4L0PA 4XUOA 2ZEYA 3LQCA 3CZJA 4JKLA 1KGYA 2W46A 5JXGA 2VJXA 2YFUA 2KD7A 3NJVA 4W8JA 2VM9A 4BK4A 5HPOA 3C7HA 1TVGA 4A45A 5IYYA 1UX7A 1OT5A 1EUUA 2W47A 4CUBA 4JHZA 2RVAA 2VZVA 2VZSA 5EJZB 3WNLA 1JU4A 2WDBA 2QQIA 3ECQA 4XUTA 1WKYA 3OB8A 1CZSA 4LKSA 3U37A 2R7EB 4XUPA 4JX0A 3C7EA 3WNPA 3OEAA 1UMHA 5IFTA 3IB3A 3C7FA 4DUXA 2YFZA 4XUQA 2JD9A 2J1EA 1CZTA 4DXTA 1W8NA 5LCWL 2J1UA 3A7QA 5B4NA 1SG3A 1O8SA 4KMQA 1T2XA 4UI9L 2ZEXA 2BZDA 3A23A 1GU3A 1OH4A 1UY4A 3VD7A 4QDRA 2E31A 3GDBA 2BBAA 2YC4A 3T0AA 3MUY1 3WNNA 3GXUA 1UYZA 3HN3A 4QB6A 4QDSA 3OGVA 4DXSA 1L7RA 2VL4A 3VDAA 2VR4A 2WN2A 2VZ1A 3I2GA 5C7GA 1NUKA 3I2HA 4OUEA 2W95A 4PF1A 2ZEZA 1JZ8A 5LA1A 1NAEA 2VMEA 2EIEA 3OBAA 2L9LA 3I2IA 1GQPA 2VZRA 5DN2A 3LEGA 3T09A 5JUVA 1GUIA 3FHQA 4P00B 4BDVB 1PX4A 4ARYA 1JI6A 1TG7A 1PMJX 1MPXA 4PQQA 4DUWA 3SEPA 4W4ZA 2VZPA 4MO3M 3T08A 2ZEWA 1OF3A 3VD4A 3LPGA 2LS6A 2B9VA 3WNOA 4DUVA 3C8XA 3I2KA 4ZZ5A 4XURA 4XVHA 2WZ8A 4LPLA 3BGAA 4BJ0A 1W0NA 3W5NA 1NX9A 4UOJA 1IQDC 3T2OA 4A4AA 2E32A 5IHRA 2YC2A 2W5FA 3LE0A 3WEZA 2W1SA 2VCBA 3ACGA 4OYUA 4QX1A 1CZVA 4KI5M 3E1F1 2W87A 4OMCA 5JR2A 1XNTA 3VDBA 3MV01 1US2A 1BHGA 2WN3A 3I3DA 4ET7A 2W1UA 4YPJA 3WF3A 2WQ8A 2WBKA 4KWUA 2JKXA 2CDPA 3NJXA 1R64A 3GGLA 4ZY9A 1JYXA 3LPFA 2ORXA 1ULOA 2EIBA 4A6OA 1GMMA 4A42A 1JYWA 3BN6A 2VZQA 4P5YA 2WO2A 2VO5A 5DQ0A 1JZ7A 2W1WA 4OZOA 4MADA 4JKMA 3MUZ1 3CDZB 5LA2A 2ID4A 1W9WA 2YB7A 1EUTA 2J22A 1ULPA 3LEKA 4W50A 4ARXA 3EB7A 2W3JA 1UY1A 4E8CA 5G04L 2VCCA 4D8MA
chains in the Genus database with same CATH superfamily
3ZXJA 1FV2A 1REFA 4HPKB 4FPGA 3SH3A 2JIJA 4BIFA 4MV2A 2X10A 4C0HA 1H6YA 3NL1A 2YBSA 3JBG2 2LROA 4UF0B 3HNMA 1H8TA 2SLIA 1ND2B 1C8M1 1CAUA 4FFFA 5AC92 5F5AA 3KF5A 3LSDA 5DPNA 3RGBA 5F8PA 1XU1A 3ZX7A 4CUAA 1U12A 2JDPA 2ZGOA 1AVBA 2VCAA 1VE0A 5LY1A 3AM2A 1PZ9A 2ZX0A 5JSRA 1POV1 3T1MA 1DGRN 3OD0A 4AYUA 4FOQA 5CIRA 4Q4X2 4YM1A 3VBFB 5F37A 4DEVA 1PGW1 4RR3A 3B5LB 5ACA1 2Y0OA 1KJRA 5GZDA 4CDUC 1H4GA 1SCRA 5FKBA 4AW7A 3WVJA 3ZFFA 5IATA 3FX3A 1HXS1 4G9SB 4Q0PA 5DMYA 1OLMA 3V0AB 4M3CF 3AYAA 1O3TA 3PVNA 2MEV2 2BGPA 1ASJ1 3NO8A 5F2SA 4CCDA 1OXCA 1Y43B 3CHXA 3NW4A 4RHV1 4V2WA 4YW2A 1X36A 2ET1A 4UXAA 2P3IA 1QQP1 5D8AC 3WZ1A 4YM3A 2E63A 2WRAA 4RSUA 3HR9A 3KQ4B 1YJLA 4KBBA 4L97A 4XMAA 5AC91 1YEWA 5BNOB 5BYNA 3ME2A 4YYOA 1MS4A 4TLFA 1US3A 2A3YA 4ISQA 4E8DA 2YHJA 3KV6A 2OW4A 3D6EA 1WMFA 1C8NA 1MEC2 1Y3TA 4AGRA 3T30A 3ZDVA 3PHMA 4E2QA 4YVSC 3POSA 3AZXA 4LQRA 1GNYA 5GLTA 3VV1A 2XVLA 3OYWA 4Y26A 1SCSA 3KWVA 2YU1A 4XC9A 4CA9A 3KGZA 2UY9A 5KXDA 3ZMNA 3TAYA 1R082 5LA9A 4UFKA 4D7TA 5LBBA 1AXKA 2DU1A 2EXHA 2PFWA 4MHUA 2IZWA 4ZU4A 1W39A 1NG0A 3DXUA 5K0UB 1O59A 4JKKA 2JXAA 2ARCA 2TBVA 2C26A 1TNRA 3TEWA 4XHBA 3LIHA 5FPXA 5LZ6A 2OXBA 1B09A 3S5QA 1BZWA 1QXPA 2EXIA 4FPJA 1W06A 2FDHA 3QLQA 5LWBA 1RUI1 2JEMA 4YGBA 3FUOA 1UWWA 4HFSA 2A71A 3N7MA 4URTA 5FP8A 1K5MC 3IBMA 2R043 4IEQA 3ENRA 4NJ4A 2I2SA 1ZRIA 4IERA 3P1IA 3JCIA 1CQ9A 3A0NA 1RUJ3 1RVF3 2D5HA 4LBKA 2ZX3A 3TN93 4W6WA 4TSVA 1QJX2 4GWIA 4AAXA 3RYKA 4QPIA 3Q8EA 4XXAA 2V73A 5FZMA 4FQZA 4XMIA 3TRSB 2QQOA 1AZDA 1UU5A 1XB9A 2GAUA 4WVMA 3DPRA 4HN1A 1U5IA 3WG4A 3QOPA 3VHRA 1DLLA 3TWIA 2FCVA 1QY4A 2OZ6A 4Q1RA 5FP4A 3TEXA 4AHXA 3J4UH 2W2IA 1LOGA 3AB0A 1UOFA 3UYJA 2UWCA 1FNZA 1LOCA 2ZACA 1UY3A 2ZA9A 3WW4A 4AE2A 4ZU7A 4QHBA 1GWLA 1NY71 1HN1A 3RWKX 2B7YA 3WQBA 1XSRA 2J42A 5C4WA 5DUVA 4Y24A 1J1LA 4AVVA 1O4TA 3BU7A 5FMDA 4N9IA 2HWE1 3OG2A 4GIQA 4B29A 1C28A 2WZPP 4HXCA 3ZIXA 1EPWA 3VZNA 4AQSA 4V2VA 3CEWA 4OQ8A 1XE0A 1YRZA 2VOKA 4BXSV 5JSOA 4XZPA 4PDWA 2Q0AA 2FMYA 1W6QA 2CDOA 2VMFA 3LGRA 4QU2A 2PAMA 1D7PM 3RVHA 4FPEA 1W9SA 1VBB3 2PHDA 1O8PA 5IW0A 5T54A 3U07A 4QKFA 4FSJA 4AEDB 2DVFA 3PJYA 4CDQA 3OGGA 4RYDA 2UYAA 5FY0A 3UGFA 2VOXA 1E57A 2XLGA 3I2OA 2IFWA 3HEIA 3WF0A 2P3KA 4AQ2A 4CXWA 4MXWB 1MZ6A 3OEBA 3ZM8A 1GNZA 4RGKA 5FP3A 1FOD2 3JB4C 5HCAA 4RD7A 3CNAA 3HQRA 5HCHA 2V4VA 4LOSA 1WLTA 1UYYA 2JE8A 1LOFA 1RUJ1 1RVF1 1XPWA 4LHNA 4P9XA 3NNJA 1W99A 2C24A 5I0SA 2J1TA 3UV9A 1AR83 2EAKA 4D0QA 1K5MA 3THTA 1AR93 2AC1A 2J1RA 5FLJA 3WSOA 1UU6A 3NJZA 1ALYA 4DXRA 4HPKA 3NKGA 4ZZ8A 3DYPA 4Y33A 3CO2A 1HB4A 3IIIA 4LXLA 2DUQA 1RUC3 5F5QA 5FXVA 4DQAA 5C5TA 4NWWA 4CEYB 4NVPA 4XILA 4AVCA 4LUMA 3MEPA 5KHIA 2ARAA 2YYOA 3VZLA 2V72A 3I54A 3ZYFA 2RMU2 4GALA 1Y9QA 3B9IA 1V6OA 1KD7A 3NV2A 4O9EA 4XTPA 5DDJ3 2AUYA 2A6XA 3H1YA 2A7AA 3ILNA 2RE9A 3OSDA 1VBA1 1T6GC 2Y6GA 1CD3G 4XABA 5DZFA 5FMOL 1S2EA 3ZXFA 3VDCA 3EJKA 1IS3A 4YG0A 5EQUA 1CX4A 1AX2A 4N43A 2JKBA 1UY2A 4QD2A 4FXGB 5I0TA 3S7EA 2ERFA 3SKVA 4MZUA 3AKQA 4XF4A 4N53A 3VKOA 1ZZ7A 3BIWE 2PYTA 3MV11 3VBSB 2TEPA 2DCKA 5DAQA 5BNPC 1UW8A 2RS11 1RUG1 3AKTA 1ODMA 5KBFA 2N7GA 5L73A 1F15A 1F4AA 2GMPA 4YSFA 1EY2A 3AP4A 3DYMA 4I2OA 3KB5A 3R6SA 3KMHA 3PTYA 2NPIA 4U36A 4Q4W3 5AFEA 3PUAA 4TTGA 1VLNA 3MGUA 4PIXA 2R1BA 4FOYA 4CU9A 5FZKA 1VMHA 2ZABA 5EIYB 4Q29A 3B02A 1VBA2 1F31A 3JQXA 3N36A 4CXXA 4FTBA 3POJA 2SBAA 1G8WA 2HWF3 1LCLA 4OHWA 2JG9C 1VBB2 5ACA2 4IE0A 5A7PA 1ZBE3 2P1BA 4ZXEA 2YU2A 4OMDA 5DG1A 3IDAA 3WLUA 4FPFA 4COZA 4DRVA 2ZX4A 1IS5A 2XVGA 3HOBA 3BPZA 4LR4A 2ZGUA 5D2AA 5DUXA 1LHOA 4HKWA 5KHJA 3WX5A 2BOIA 3H3LA 4JQTA 1RC6A 1WBFA 4QPYA 4BM8A 2R041 3FHIB 3JBG1 4K40A 2ZZQA 4PBPA 1S0DA 2B9UA 1W8OA 4UW6A 5JIUA 1F5FA 3WG1A 1A8MA 4JDNA 3N9NA 4IUGA 3P6BA 4V1PA 4IEXA 2E7AA 2G4IA 4RR3B 2R32A 2BBVA 2PLV2 4AI0A 4XUOA 5LRSA 1JBCA 4GKXA 4DRRA 3PL0A 3LQCA 1QOTA 1DZTA 5T3NA 1G7YA 1XYNA 2IWGB 3LD8A 5JXGA 4CCEA 3U0ZA 1H8TC 1RGSA 3MW4A 1V9U2 5KC6A 1DGWA 4GKYA 1LESA 2RHPA 1VRH2 2ZX2A 1IKQA 3M2MA 3NJVA 2KD7A 2LTNA 2UWAA 3ZYIB 4MXWA 2VM9A 1VRBA 1X33A 4M3CA 3C7HA 1BXHA 1ASJ2 2A73B 3PVBB 3HMYA 1QF3A 5CFDB 3I3MA 3SH5A 3KGLA 1U5XA 1KDMA 2W47A 4IXLA 4HOOA 1OC1A 4JHZA 1VBC2 2HWD3 1VBD1 2HBTA 2JG8B 2VZSA 3POFA 1W6QB 3GBWA 4KNCA 5EJZB 1W8WA 4HKLA 3ECQA 1V6IA 3OB8A 4LKSA 4DZGA 3NAPB 1CAXB 2EA7A 3MIHA 1LHVA 4N7IA 3Q8BA 3OEAA 3LAGA 1UMHA 4DMIA 2O8QA 2IUWA 3C7FA 1DIWA 2BPA2 2YFZA 4RS5A 1C3HA 1S55A 4ZXKA 3JD72 4OULA 4NIGA 3S30A 1VRH1 5BNNA 1GNHA 1W8NA 3WXPA 5IT6A 3VBFC 1CAUB 1W90A 2X8KA 3S57A 3HVDA 2AGSA 1QJX1 3A7QA 3PURA 1SG3A 4QKDA 4L99A 5CFDA 3AX4A 3H8OA 1AYN2 2Z69A 1D4VB 4WVMB 5F3EA 4E4DX 3X29B 3A23A 1QJU3 5KXEA 1HRV1 4AOCA 4LBQB 3VUOA 4YVSA 4QM8A 2CWMA 1U5ZA 1NCRC 4LKEA 4PDWC 2BWCA 2DV9A 4QDRA 1GSLA 2BBAA 2XPJA 2OQ6A 5C3SA 2ADDA 4P9IA 2WO7A 1NCQA 2VUDA 2JDHA 3T0AA 1O7FA 3E5QA 3GXUA 5J37A 4LO8A 1MEC1 3JQWA 5APAA 1H8VA 1LR5A 3NV4A 4QDSA 1WCSA 1PNFA 1YFWA 4Q0UA 5F3GA 2YBPA 2VR4A 1RHI1 2RJKA 2WN2A 4N90A 5FZ0A 4FXKB 4AEKA 3JD73 4R4ZA 5C7GA 4Y1UA 1OLQA 1R1A3 4Q4V3 2C9AA 3DCQA 4CEWC 1NLSA 4Z8BA 4LUKA 5LA1A 1XYPA 2VTXJ 5L19A 1NAEA 1RXFA 1O4YA 3OBAA 1GANA 4QM9A 2IXIA 4O9GA 1UZVA 5FMBA 3ITQA 4UW5A 1ZX5A 1OD5A 3FHQA 4KWKA 4BDVB 1PX4A 1NZIA 1YNAA 1Q5OA 3U4SA 1PMJX 1MPXA 4QKBA 1ND3A 2JICA 1YQ5A 5F3IA 4F8AA 5CA6A 2Q1MA 1ZYBA 3IZOA 1W2AX 3HD8B 3WINE 2G9GA 2UU8A 3AXEA 2IXJA 4MO3M 4AGGA 5CKMA 4CDWB 4Q8KA 1I1EA 1DGRA 2P6HA 5K0UA 4B1MA 1YC61 2XUEA 2DTYA 1SBFA 2ZGTA 4BHPA 1BMV2 1WUVA 2Q5TA 4YRDA 3LPGA 1V6NA 1AR92 2FMDA 4LIVA 4DUVA 1F2NA 5HBAA 3MLJA 3OBTA 2WZ8A 4I01A 4LPLA 3DL3A 5FJHA 1W0NA 1SPPB 5KXBA 4UBHA 3FFQA 1ZBA1 3QH7A 5FMOS 2WA4A 2E32A 1WWYA 3K3NA 4LEJA 2YC2A 5FZDA 4QX8A 1QH6A 1RMU2 5IHRA 3O0XA 4EN7B 5A6XA 5I0RA 5C9AC 1TME2 4ZS3A 3J8F2 3WQ7A 4N43B 1H2NA 1FOD1 3O1SA 1RUOA 3KV9A 3N3HA 1PGSA 1US2A 4C1WA 2FBEA 3QBQA 3UJOA 1RHI3 4KG8A 5FPVA 5A3UA 2XL9A 3OUHA 2WJSA 5J7MA 2VVFA 2WQ8A 5FXZA 4XIKA 1VMJA 4YZ3A 3AXDA 1YWKA 3J9SA 5JMCA 1PIV1 1O3SA 4IGQA 5EXOA 4HVOA 2AENA 3LPFA 4NE9A 1J1TA 1ULOA 1HKDA 4PDWB 1BBT3 1ZBA2 4RQPA 5FZCA 4QQPA 4NIHA 4AWDA 1OOPB 5L7OB 2VZQA 2VO5A 3HWJA 1HRV3 1QKQA 1HV1A 3J8F1 1EV13 4OUMA 4Q4W2 3S0MA 1KDKA 4A7ZA 4ZU5A 4JKMA 3A0KA 3CDZB 5LA2A 4OUSA 2WA3A 2CGOA 3V0BB 4NPLA 3VBUB 4DXZA 1AR61 3IDCB 2J22A 5JSPA 3LEKA 4W50A 5FY9A 3SCGA 4ARXA 1IS4A 1MS8A 1OHFA 3B94A 3SC7X 4YGCA 1QU0A 2XWBB 5FZGA 3U14A 3ZKUA 1N1SA 1XU2A 4YM0A 4BQ3A 2E7QA 1BK0A 1W8UA 4NRMA 4CSWA 2BNMA 4HVQA 4IE4A 3OOXA 1LOFC 4XJ8A 4QPIB 1SBDA 5C3RA 4CU8A 2Y33A 1BEV1 4FI9A 5CYYA 3R0RA 2D44A 1NT0A 2QBXA 4QQHA 1PZ8A 1VBD3 4Q26A 5LK7B 5DAPA 4YW5A 5I0DA 5JXJA 1W28A 2DYCA 5BNPB 5EFUA 3R4UA 4LLOA 3DYOA 2QDRA 4O7XA 3ZYPA 2ATFA 4MSVA 1BBT1 1I3HA 1V6KA 2JENA 1RUC2 3I59A 3NNFA 1W2OA 3FBMA 4D94A 3AYCA 5B2GB 5FAXA 1N47A 3FL7A 1H6XA 1PIV3 4WM8C 1RJ7A 4LOTA 1URXA 3LKJA 5JR7B 2YGMA 2OIIA 3GHNA 4FAGA 3C7GA 3WDVA 2WAOA 4E2SA 3LEIA 2Q8OA 1BK1A 1U0AA 1WCKA 4AI8A 3ZYJB 1RUG2 4IV3B 4IDZA 2W94A 4WZCA 5A3MA 4JV4A 4AF9A 2UYBA 3R4DB 2DF7A 3MFCA 1JYVA 2HYKA 3O0WA 4B7KA 3OGSA 1KQRA 4AFBA 1SHWB 4GQ7A 2X29A 4FQ4A 4JAAA 4NPRA 3C7OA 3OPTA 2FQPA 4HSJA 2ZHLA 2WUHA 3UJQA 2V5YA 3CKHA 1CVNA 4EQVA 5DAWA 1UZ0A 2BERA 2H0VA 3JB8A 1MZFA 1OUXA 2B46X 2HLEA 2MHFA 3I3EA 4UYBA 3ZPYA 4BQWA 4L92A 1GKBA 3VBRC 4R9CA 2JDMA 3WP3A 2RJ2A 1CIYA 3MICA 2OZJA 4E4ZA 4XJZA 5F39A 1V9U1 4Y1VA 5JPNB 1MQTA 1YFYA 2QQWA 1UYPA 3THDA 4F83A 3TEZA 3VBSA 1JUHA 2A6WA 5JOYA 1YQ8A 1AR73 3PU3A 3WP4A 2WR9A 3AVRA 3RI9A 2XR4A 1UX6A 3O12A 2JDUA 1UZZA 2PLV3 2RG4A 3W5MA 3MLKA 3ACIA 2R042 4IE7A 4W6YA 5EP9A 5FUNA 1O6UA 1RUD3 3M4FA 4CUCA 5BNNB 4XQDA 2PHXA 5KR7A 1FYUA 2ZOEB 4IEUA 4P9WA 1G9BA 3B93A 3OY8B 5FP7A 5FWEA 1PK6A 4AEDC 4DY3A 1RUG3 3DV8A 4QAWA 3ROUA 4HVRA 3E6BA 2WO3A 4HSLA 2YPDA 4I0AA 2PA7A 3LFIA 1WLWA 4A3ZA 2Y6KA 1D0GA 1UN1A 4OCTA 4NAOA 4XFGA 1EAH1 1OF4A 3EXUA 4OLLA 1YQ2A 4UAPA 2JG8A 5SV8A 3PTRB 1HRI2 1XNKA 4G3YC 5BNOA 1RUH3 2PHFA 3IMMA 5C3PA 3TOJA 3PMEA 1WD3A 2OX0A 3UNPA 4QDQA 1ULFA 2VPVA 3IPVB 1GOFA 1WBLA 2J1SA 3AL6A 3WOGA 3KHCA 2RR12 1XSQA 2DDUA 4U2AA 3RYPA 2TUNA 4FPCA 2EXKA 1KFXL 1ZZBA 1FX5A 2OA2A 4NHYA 4LBLA 2CV6A 2WABA 5EYXA 3VBFA 5L9VA 1QJU1 4JC1A 4A7KA 3ZN4A 2BGCA 3ZXGA 1DGLA 2AREA 1F8VA 5FXXA 1D4M2 2DWRA 4GJZA 5FZ4A 3BTYA 1ODNA 2VH9A 1EAH2 3MW3A 1UO9A 1PGW2 1C57A 5JXIA 2XDVA 5LY2A 2QDNA 3FE5A 5A7QA 1UCXA 1XXNA 5IVBA 4GD4A 3VN4A 4D6RA 2F4PA 2FCTA 3K4ZA 4KGGA 2ZGKA 2WZEA 3NNGA 3WV6A 1FPN3 2V09A 3VD5A 2E26A 1LECA 1XC6A 1NCRB 2F17A 4IEWA 3THCA 1JUIA 4DS0A 2A70A 3MW2A 1JYIA 5TSWA 1QXJA 5EWSA 4FAHA 2C9KA 2KR2A 5GZFA 5KXCA 2ZGQA 4XJ9A 1E5HA 2ZBJA 2D6OX 4LE4A 4QPGA 1OPOA 2WT1A 2D6LX 3WHTA 3H42B 2JDZA 4H14A 2E9QA 4OI1A 2NP0A 1AYM2 2PELA 3GF6A 4WM8B 2Q8CA 2VC9A 3LA2A 1VB4A 4CCKA 4S2GA 3H9AA 3POGA 5CNAA 3NKTA 4COUA 4LE3A 3ETQA 2AR6A 1G9CA 4LO6B 4MGSA 4I02A 4INDA 5J98B 1SLLA 5BV6A 3ZDSA 3SMHA 5LB6A 2ZXQA 1YQCA 2HWE3 3RZHA 1LEMA 1VIWB 2G19A 2GC2A 3HPNA 1S0IA 4LBMA 3UT0A 2BP6A 2ETEA 2ARXA 2CY6A 2OPWA 3HN1A 1YIFA 1JZ3A 4UW3A 4J1WA 1ND2C 1FXZA 4XCAA 3VKNA 4CRQA 1JS9A 2HYXA 3JZVA 3LSEA 4NR1A 2VMIA 5FK7A 2W92A 3GJBA 5FFOC 3VZMA 4Z2AA 3MDPA 2W52A 5KWRA 5DDJ2 5LW9A 4YFZA 1TME1 1IQAA 2MNGA 1C1LA 1H9PA 3EYPA 5FPBA 4PQ9A 1EV12 3MLLA 5T55A 1OA3A 2EVXA 4CE8A 1QMJA 3AZWA 3JBG3 5FZFA 4BMEA 2FHRA 2RM23 1NXD1 1LHUA 2DFBA 4HBNA 3SHRA 2GALA 2V5DA 2WWSA 1JYCA 4CDXA 2ZAHA 4LNVA 4Q0VA 1J58A 5FZ1A 3PJQA 2XBO1 1ND3C 3AYDA 3M3IA 4Q4Y1 5HCBA 2RM22 3VL8A 5I8TA 2IVJA 3ZFFC 2D98A 1TZOA 4XACA 2HWF1 3NVCA 3ZKYA 4D7SA 3O1RA 4XUNA 5ABJC 1R1ZA 2Z4FA 4CP9A 1E5IA 1S0BA 2IXKA 5IVJA 4OI4A 5FZOA 1W9YA 4N7UA 2YDEA 4GMP1 2RS31 4NRQA 4UBGA 4A2UA 1LU1A 2AH2A 1V6JA 3RG0A 4BOWA 1CESA 1UAIA 1LENA 1IPKA 2RV9A 2JIGA 4Q4W1 1Y4WA 5J48A 4K9SA 3JU9A 1TQ5A 1RUE2 3T0BA 1M4WA 1DP0A 2JG9B 2WFPA 4CXYA 4MOAA 1APNA 4CPBA 4LHSA 2XVKA 5C9AA 2QFEA 2BV4A 2Y6JA 4XF1A 3PUQA 3SNMA 4BMBA 5LEJA 1DG6A 1J3RA 3ATGA 5I0UA 2HWB1 1NE6A 4X8PA 5FYCA 2C6SA 2VU9A 1JU3A 5ERLA 2B4KA 3WF2A 5K8SA 3D3AA 3EHKA 4TYSA 3G7DA 2J7MA 1DBNA 2P34A 1UZYA 2OS2A 2K0GA 4UFLA 2HWF2 4MGTA 2R16A 3RYRA 1VBA3 5B4XA 4K3UA 3VBRA 1JODA 1JYTA 2VNVA 4Q27A 1H2MA 2W68A 3PUHA 3THPA 4ISRA 2WIIB 2Y8KA 1LHWA 1PZ7A 1YI9A 2ZGPA 3BVCA 3Q8FA 3TYJA 4XOGA 2CHHA 1PX3A 4LKDA 1YYNA 4YLZA 5E1RA 3SCFA 2XJRA 3I49A 5FZAA 3A22A 3NNLA 3MYXA 1B35B 4JRLA 1XE7A 2ZEYA 4IGOA 4BLJA 1G9AA 3USUA 4UFHA 1NA1A 1QDCA 3T3YA 1Q56A 1RUC1 3IWZA 5A7WB 3CZJA 4YARA 1TMF2 5CFCC 4JKLA 1KGYA 5JAXA 4O65A 2XH6A 1DZQA 2YBKA 3OD4A 2VOVA 3VB9A 4EN8B 4D6SA 3ZXAC 5CVRA 4QHOA 5ACA3 3IKWA 3ZFEC 3O1OA 5FQ0B 1FAYA 4LHLA 3CLPA 4QKNA 3PNAA 4BK4A 2Y0IA 3V0AA 5I8SA 4K8FA 5ANQA 2Z2SB 5K4LA 3WDYA 4DPNA 4H3WA 1LOEA 4AXOA 3RMXA 1GQHA 3ZOIA 2BDRA 2GNTA 4GULA 1V6LA 2ENRA 5L9BA 4NHMA 2VZVA 2GDFA 3WNLA 4YW7A 4UWDA 2B39A 4BB3A 2HWC3 2VW2A 1HQLA 2WDBA 4XUTA 1WKYA 1SDWA 5CU1A 3ZLIA 4JX0A 4JGYB 5C8CB 4PI0A 4X8NA 5FLIA 1FV3A 5FWJA 3WNPA 2OPKA 2RS52 3B9CA 5LBEA 1WW4A 3VDDA 1W3VA 3IB3A 4LTAA 4DUXA 2XJQA 4NMIA 3KV4A 4Q1PA 1ZRRA 4FFGA 1LGBA 3LA3A 1GZTA 1DYPA 1EAH3 5FMCA 3RDIA 1ZM1A 2J1EA 5FZ9A 5A3OA 2BVBA 1W04A 2VY0A 3JUUA 3ZXLA 5FBZA 4M3CE 5CADA 2Q1ZB 4P9YA 4AI9A 4BE3A 1W6NA 2J1UA 4K20A 3OF1A 3ZN6B 5LCWL 2BVVA 1O8SA 2VMHA 1WW5A 4JTNA 4BCUA 3ZR5A 3CF6E 1UIJA 4ZHNA 2ZEXA 1VBE3 2BZDA 3EMRA 2HWC1 4ATEA 4NHLA 2CGNA 1QQP2 4ZKTB 1O3RA 3C3VA 1GU3A 1RUE3 2RR13 3AMHA 1OH4A 1RUD1 5HXVA 4YW4A 4QX7A 3VD7A 2D3SA 1AF9A 5IAXA 5H9PA 3ZXDA 3ZYHA 2ZMNA 4BXFA 4JQRA 2DVAA 4ORFA 1QJU2 3WNNA 4QMAA 4AK3A 1UYZA 2RS51 4BIOA 1GZ9A 1HIXA 3VBHB 4YM2A 1IG0A 2ZMLA 3HN3A 4Y4RA 1V9U3 4QB6A 4NHXA 4CCLA 2WS93 1Z78A 1AHSA 4PHZA 4DXSA 1CR7A 1QJX3 4K7JA 2WLPA 1CONA 1GICA 2EXJA 4MH0E 3AVSA 4R9AA 1N1TA 3PLQA 5BUVA 3M3EA 4EWAA 2GH8A 3I2HA 1R081 2ZKLA 4JDMA 5FYYA 5J09A 2O14A 1UD1A 4AGVA 3LDKA 4EN6B 3G6JB 1GFF2 3OBRA 3U4XA 2PHTA 1HB2A 2GNDA 4LBNA 3W21A 2FZ2A 3IM0A 1HRV2 1PO22 4Y20B 4MLOA 1GQPA 1CAWB 1X9TA 5E88A 2W0XA 4CCMA 1DCSA 2V4AA 3CU7A 3LEGA 3T09A 1GUIA 5AFBA 3K3OA 2VUJA 4NPMA 1JI6A 4XJWA 1W05A 1BCXA 3ALQA 4HK9A 3HT1A 3J7LA 2Q30A 3OBZA 3I8TA 3ZSMA 4H7MA 3ZYBA 3IT8A 4PIZA 1SLAA 3SEPA 3O7OA 4Q4X1 5HV4A 1XOYA 2VNGA 4W4ZA 2ZZJA 4HL0A 3GBFA 4FP2A 5GM0A 5F6KA 5FP9A 3W20A 3MF6A 3WG2A 3VDDC 1HRI1 3FZ3A 4AFAA 1QJFA 4TN7A 2XHKA 3H7YA 2GC3A 3LCPA 1HB1A 5JZGB 2B9VA 3HBKA 3C8XA 4C91A 4ZZ5A 5BNNC 4XURA 4C0BA 4XVHA 5F6LB 3BGAA 5FY7A 3SISA 4BJ0A 4UOJA 1IQDC 3AJZA 3E6CC 3ZMOA 1PGL2 1D0HA 4PI2A 5GALA 2XJUA 3RJRA 1XNDA 2W5FA 3LE0A 4GMP3 4NO4A 2VCBA 4QX1A 4M01A 3UK9A 5A3PA 4DNYA 1ENSA 3ZSEA 3FLTA 3ACLA 2W87A 4OMCA 1DYKA 3VDBA 3TEYA 1BHGA 3AK0A 4UT5A 4FCAA 2NQYA 4Q0SA 4ET7A 2W1UA 2W39A 2VD7A 3KD4A 4M0HA 4FTSA 4OVEA 1DHKB 4ZONA 2WBKA 4KWUA 2PAEA 1CJPA 3T4VA 3VHNA 4AQTA 1L3JA 1NZCA 1SFPA 1X82A 2RM21 4ES9A 3VBOB 4JCKA 3OY8A 1JYXA 4XXPA 2FD8A 1W8ZA 5D8AB 5FYUA 4CCNA 2R1DA 2R6QA 1AYM3 1SLTA 3HAGA 4ES8A 1UPSA 1ZREA 4J6GA 3W9AA 2EIBA 2RS53 3H3UA 1GMMA 4YZ4A 4XBLA 2BNOA 1DQ2A 4P5HA 4E4SA 4P5YA 5DQ0A 1QDOA 2D93A 5FUPA 2W1WA 1KRIA 4OZOA 4MADA 1OFNA 2VTXA 3GJAA 3GHMA 2K2SA 3MF9A 2BNNA 1RUE1 1AX1A 2IXHA 2BU9A 4UW4A 2XJSA 4OI2A 2BWAA 1EUTA 2LRPA 1COV3 3I2DA 1ULPA 4META 4YVWA 1D2SA 1LKNA 4UF0A 3VZKA 1N1VA 2PN5A 4TLGA 5EZWA 4IEPA 4SLIA 4UFIA 4NN0A 5F5IA 5G04L 3H8XA 2XGXA 4IESA 1UKRA 1S1AA 1W8FA 2ARBA 4FPHA 4XAEA 4EYUA 2FDKA 1PVC1 1SFYA 3SCHA 4XF3A 2XONA 3P5BA 5FCCA 1WGPA 1HN0A 1QOSA 1C5HA 4CP9B 3WP6A 4LO5B 4F3JA 2P3JA 5A1AA 3CJXA 2JDKA 1JZ2A 3DXTA 5IUQA 4DFSA 1WW7A 4LMFA 4QX5A 1Q8PA 4PLMA 3ACHA 5DDJ1 5JWPA 4PT6A 4RA0A 1VJ2A 1WCUA 2JB4A 1XYOA 1PHMA 2I45A 3K48A 4I30A 3HNYM 3RZGA 4YWAA 3S5AA 1AYN3 1REEA 4W65A 4FP3A 4XDPA 5FZIA 3WT3A 1NE4A 3ZVXA 4OZXA 5FXWA 1YUDA 3ETPA 3K4AA 2VZTA 1GWKA 1VB2A 5DUWA 4DOUA 2WLQA 2NMOA 5ABJA 3HT2A 4HANA 2DCJA 3PVEA 2O8OA 4WZFA 4E4HA 2R071 1DQ4A 4K1ZA 3VKMA 2HWB2 5T50A 4D69A 2WNVC 2CWSA 2LUWA 5IVYA 3GZUC 4Y22A 4DEQA 1BVVA 1YXWA 1PVC2 1QXRA 3J7NA 3N7KA 3U10A 1AR91 3A21A 2WSUA 1UOBA 4ASKA 5C8WA 1SQ4A 1HQNA 4EN9B 1YFUA 3AP7A 3I3QA 4CDXC 4KL1A 3KVBA 3K75B 3KQRA 3INAA 4R52A 5H9SA 3B01A 3HJRA 3Q9OA 4MGZE 5F7UA 2E6VA 2X53S 2HJIA 2ZHNA 1YHFA 1PO13 1KEXA 2Z79A 3ILRA 5IJRA 1OQDA 4NRPA 3UESA 2GN3A 5LA0A 5JMOA 4HK8A 2WO1A 3H0OA 1XNAA 5E89A 1I6XA 5LBCA 1LAJA 3FC0A 1OUSA 4GH4A 2JJ6A 1AR72 3RPQA 3TN92 5IK7A 2DU0A 3L2YA 2D6KA 2JD4A 5T5OA 2HEWF 3URFA 1VBB1 3FHAA 4HLTA 4P9JA 4YZ1A 3RMYA 1UIKA 4XFBA 4Y5Z0 1SZBA 5AVAA 2WNUB 2VMDA 4E27A 3T4HB 2HWB3 1GP6A 1OLME 1Z0HA 5GZCA 4A3XA 5CBLA 1C1FA 1OOPA 2VMCA 5L7OA 4RQPB 2CU5A 1P8JA 4AR2A 4BQ4A 5CKNA 4CEWA 3POEA 5GLVA 4CCJA 4MGIE 1OH3A 1W6MA 1A3KA 2BOJA 4P14A 1JYNA 5C33A 1QHDA 4BPZA 1DU3D 1KS4A 4YW6A 2PMWB 3TB0A 2PLV1 3NV3A 1GZCA 4I0BA 1WA4A 5EYYA 3AKSA 4IEZA 2UWBA 4RGGA 1ZRDA 1G6NA 1RYYA 1GOGA 2JDNA 1SMVA 1AR71 1PM4A 3CJIB 4ASLA 3V65A 4QXHA 5A80A 4GB31 3WW3A 1RXGA 1M06G 2X09A 4AI2A 2VNOA 4XYXA 1LJ7A 2XLFA 1D2QA 1NA1C 2NZ9A 2WKKA 4PCRA 4KU7A 4QX0A 4P02B 5LBFA 5EJ1B 3BU0A 2E33A 4BQ5A 1K12A 1RUF3 3IMNA 1JXNA 5A7OA 4Z07A 2A3XA 3GCWA 1WW6A 3B3QE 3QD6A 4BQ1A 3BIEA 3WNMA 3M3QA 4QB2A 2X05A 3U1XA 5C71A 1G9DA 4JRAA 1E5SA 1VBD2 3I97A 1RUI3 1I5PA 3IAQA 2X5IB 4EROA 5C3OA 3OPWA 5IFPA 4LLFA 3BI3A 5GLZA 4BQ2A 2ZGRA 4IE5A 1JHJA 1DGWX 3HQXA 3KSCA 5LASA 2D7FA 1GZWA 5K7PA 1BBT2 3ZO0B 3V64A 4B7EA 1JOJA 1XBFA 3FLPA 3KT7A 4B8EA 3RS6A 2VAUA 2YMZA 4GB32 2MEV3 2PTMA 4OFGA 3AMMA 2D3RA 2ZHKA 4MUVA 1QNWA 1UY0A 1ONAA 3MIFA 2K46A 2WC2A 1CAWA 2IC1A 1XE8A 2GNMA 2W9XA 3WDUA 4EE2A 3BTXA 1UF2C 3IAPA 2XL7A 1Z7S1 1J84A 2VZ3A 5FZEA 5FOJB 4RS5C 1H4HA 2CNAA 3NSTA 3WD5A 5FY1A 4ONUA 5FRAA 4JDOA 1W8HA 3RZMA 2DCYA 3FUQA 4QX2A 4CP1A 2GZWA 3HBZA 2YGLA 4RQPC 2Q8EA 4JZRA 4XZUG 3LA7A 3J7HA 4LK6A 4YG6A 2Y64A 4E2GA 1RB8G 5FYZA 2VOWA 1OMIA 2A75A 1BVP1 1W8TA 3DECA 3N9QA 1PK6C 2IXLA 2LALA 2OVUA 4FOWA 2QQPA 3OGJA 4CU7A 3WHUA 2WWJA 5FPLA 4RFT0 3NAPC 2Z42A 1FPN1 3I2FA 5DUUA 3RJ2X 3S7IA 1ZRCA 1LRHA 3GNEA 3BPSA 3KF3A 3RZZA 1NLQA 4RN5A 1NCQC 1TNFA 3VL9A 5D21A 4DY5A 1RTVA 3AKPA 1ZA7A 4WM7B 4OHXA 4GZ9A 4LIUA 5BNOC 2Y34A 1V00A 3BYWA 3ZR6A 4LBQA 3K77A 4YVWC 5CB7A 4LORA 3U75A 1BJQA 2HBUA 2OQ7A 2VOTA 5JOWA 3SKJE 3J8F3 1AXYA 2ZGSA 2J1AA 4IQPA 5FPZA 1ZNPA 4CP2A 2ZPXA 3H8UA 1I5ZA 1O5UA 1I9RA 1ULCA 2GN7A 4K6BA 4PLOA 2WFF2 2BGOA 4MVTA 3EO6A 1F4HA 1VBC3 2HWD2 2QQJA 3N9LA 4MYEA 4QGNA 4XQWA 4HKOA 3V56A 4CTEA 1KITA 1A6CA 2HKXA 2GNBA 4XDQA 4KWLA 4A6SA 4COWA 3CBNA 5CISA 1UMIA 3AZYA 4X6RB 1GLHA 3AZVA 3WP5A 5C8CA 2YUEA 1N1YA 4GAZA 1HX6A 3ST7A 4YGEA 2VUAA 5T5JA 4BZ4A 1OFSA 2IFRA 2C1FA 2ADEA 3AMPA 4D7YA 1BKZA 4CDUA 1GBGA 4L8QA 5JOZA 2D5FA 2A5ZA 4Y1YA 1QNYA 3ES1A 4XFHA 3VBRB 2MEV1 1ZZ6A 5JDBA 5KHGA 3IIAA 4FPKA 5DG2A 3NWKA 3WDWA 4MG2A 4BLIA 2CYFA 1CIWA 4YZ2A 1KJLA 4AAPA 5FO9B 2WAAA 5GLWA 2EICA 1VR3A 1OKOA 1V6MA 2PHLA 2VW1A 5GZGA 5M0TA 2JDYA 4I3PA 1UOGA 4QXBA 3VHOA 2YROA 3M8LA 1K45A 5A6YA 2BTVC 4KH9A 3KS7A 4R4XA 3QACA 2JB8A 2JDAA 4QPGC 1AL22 4QWNA 1CJDA 1NQDA 2ZAAA 2XKPA 1NA1B 1HB3A 5IWFA 3BOPA 3R05A 1PMIA 3SEEA 2HWE2 1PM7A 5FYTA 1YCIA 1QJY2 5T5LA 2XOMA 4BQYA 1H2KA 5J3UA 2BUKA 4GWNA 4H7LA 5E16A 3O1TA 2CL2A 3O1MA 2DBNA 1TEIA 3DEMA 3BUCA 5FKCA 1J83A 4ZS2A 2XHNA 1KFUL 4NWVA 4XE9A 3P3NA 1YJKA 2VE1A 4LK7A 2G9FA 3POIA 2E7TA 3NRUA 4Y22B 1LODA 3W58A 4WM7A 3K51A 5A70A 5FZBA 2XUMA 4CDXB 1OKQA 4GWMA 2YC0A 4L0PA 1A78A 4TWTA 5K9YA 1ULEA 3VLBB 5DZGA 3RZLA 5ANNA 5T52A 3OJBA 1LEDA 1HJGA 1IG3A 2FDFA 2WINB 5DABA 4CDQB 2ZX1A 3MFAA 1MR5A 3RFRA 3FJSA 2ZKNA 4LA3A 1UOJA 4D3WA 1D4M3 4UFJA 1OSGA 4W8JA 4AVSA 5HPOA 4AVBA 4H55A 3S6PA 2B42B 1FATA 1TVGA 4EZ4A 5BY5A 1MZEA 4FPOB 1BYHA 3DN7A 1TMF3 3H50A 5JIAA 4CUBA 3J7MA 2KA3A 1QJZA 3DPRC 1JH5A 2GH2A 5HV0A 1JU4A 4PLNA 2QQIA 2WNVA 1LGCA 4AL9A 3FMGA 3U37A 1UZWA 2H6CA 4FOVA 4HT1T 4IV1B 4XUPA 5A7NA 3VGIA 5GKAC 3FWEA 4TZDA 1VMFA 3TN91 4AVAA 1BEV3 2Z5WA 1FNYA 4WVZA 4WM8A 3VZJA 4IV1A 5IFTA 1NLRA 4C1XA 1JOPA 1XNCA 2R072 4XUQA 4MGKE 1O91A 1ENRA 3WDTA 3WQ1A 1CZTA 1KXGA 2QVSB 3WDXA 1EP0A 1RIRA 4JGZC 3BALA 2D6MA 3KCXA 2ZJCA 4B4QA 4WVWA 5A1LA 5L36A 1QJY3 5A33A 3AL5A 2BYVE 2R073 5B4NA 5JVVA 3NJYA 5D8AA 5FR3A 4FTEA 2EAAA 1T2XA 5KHKA 1AR63 3MIGA 2WFF3 1R091 3VBOA 1GQGA 1REDA 3BCWA 3M3OA 5JPMB 2HH9A 5FV3A 2Y26A 3UKTA 5J36A 3WCSA 2HEYF 3WQ0A 3Q8CA 4YG3A 1X8MA 2E31A 1Q8QA 4BA6A 4DIQA 4FT8A 1Q8VA 4YFWA 3LB9A 5F5CA 2OT7A 1MACA 3MUY1 1JW6A 1X8EA 4XFFA 1RUJ2 1RVF2 1MS9A 4N9HA 1HRI3 1G86A 2GMMA 3LWCA 3P3PA 3T1LA 3MZHA 4EN0A 3VBSC 1L7RA 2QCSB 4FFHA 3VDAA 5A3TA 3WNXA 3KZ4C 2VZ1A 2R061 2UY8A 3I2GA 4FFIA 4Q8LA 4XBNA 5IK8A 1OVPA 1WLCA 1DF0A 2W95A 3LDBA 4PF1A 2BFUS 1JZ8A 1LHNA 3GYDA 1HJFA 3FFZA 2VMEA 3AFGA 4R9DA 3LEMA 4AEDA 4B4PA 4PJYA 1C8M2 3WW1A 1FMD2 1QQP3 3HQUA 1JOBA 4XTMA 2H0BA 5DN2A 3POYA 4ARYA 1TG7A 4RS5B 3O1VA 1R083 2XLAA 2XXZA 4XQ4A 4WBBA 1S2KA 5EHDA 4DUWA 4B4RA 4N53C 2JG8C 3LZZA 4COYA 2WNUC 3PU8A 5JZGC 4IV1C 3T08A 2ZEWA 1JHNA 4QPIC 1LULA 1ZZ8A 1POV3 1AR82 1JN2P 1OA4A 1OQ1A 5J96B 2LS6A 2ZTNA 2XQRA 5IVVA 3I2KA 2P2KA 4MXVA 1IPSA 3W5NA 3IPVA 1NX9A 4RHV2 1S0JA 1ULGA 2P17A 3GCXA 1AL23 2WQ4A 2D6NA 1PO21 2RR11 2GP3A 3M70A 4AHZA 3WEZA 2ZGLA 4OYUA 3ACGA 3VBUC 1NQJA 4UFMA 3E1F1 1AJKA 2RS13 1RL3A 3GALA 1MS3A 4IGPA 5JR2A 1GWMA 1XNTA 1RUF2 3H7JA 3N9PA 1SLCA 3MV01 4XJUA 1BLZA 4Z82A 5LK5A 3I3DA 5A7SA 5A32A 2G9ZA 3LIGA 3ZIWA 3TNPB 1W6OA 4QXKA 1FPN2 2D3PA 4YPJA 3JD71 3WF3A 1AJOA 1AL0G 2JKXA 4CVUA 3NJXA 4PIYA 3SQOA 5FO7B 1AXZA 3HIFA 4RGAA 5JLVA 2FDIA 4IW3A 1R64A 2G1MA 2DURA 3KT1A 4ZY9A 3UL2A 5IK4A 4ASMB 2BEOA 4Q5OA 1VPHA 2ORXA 1CAVA 2RDQA 2KM2A 2DCZA 1DQ5A 3BB6A 2DFCA 3O5SA 5FJKA 3KHBA 1IS6A 4LBJA 4QXCA 5HCFA 4F7ZA 1OI6A 4OQ9A 4QQLA 1QH7A 3N7LA 3N9OA 2WO2A 3BOWA 4LO7A 4CZSA 2I74A 3IDBB 4PF5A 2WYFA 3E97A 4AI3A 1WD4A 1R093 2WFF1 1VALA 2GSYA 4CCOA 1E5RA 1YI7A 2ZGMA 3MUZ1 5A32B 2ID4A 1RUI2 3ZXEA 3I59B 3VBHA 3ES4A 4HONA 4BWOA 5IAVA 3KM5A 4D6QA 1J59A 3SH4A 3ZFEB 1Y9MA 1H1MA 4WM7C 3WUCA 3N35A 1K5JA 1UY1A 4E8CA 4OHYA 3OUIA 1RHI2 5BPXA 5CFCB 5FLHA 3GZAA 4Q0QA 2A3WA 4IEYA 2WS91 4HZFA 3ILFA 4IV3A 2YPJA 4FBFA 2Q1FA 2FZ1A 1MS5A 1VP6A 4CCCA 3WY6A 5FK8A 1B35C 1YIPA 1YO8A 2TNFA 3MBWA 1PO12 2WQZC 4QPWA 5A3WA 2W08A 4AFDA 5C8CC 3WNKA 3R4SA 4A44A 2QQKA 4RFRB 4FPLA 3VZOA 4EWDA 1VAVA 4G4FA 1HW5A 2WZR1 3RSJA 3IN9A 4AEMA 4MGQA 2EIDA 2HWD1 4MGYE 2A1XA 4PBOA 3VBUA 4BH9A 1W2UA 1VBE1 2FCUA 4ZPIA 1D4M1 2QE3A 4YW3A 2PQQA 2C5DA 2NN8A 5FY8A 4FPYA 2R0FA 2AZ5A 1H2LA 5A6ZA 2ZS6B 3MIDA 1QJEA 2NMNA 2R0HA 1LTEA 4QB1A 2QQNA 2Y6HA 4QGMA 3ZXKA 1NCRA 1U5YA 1TE1B 1V0AA 4XEZA 3K4DA 2W91A 1C4RA 1MZ5A 1UNBA 1H8TB 1W0PA 5JI9A 1PGL1 2PHUA 4XW3A 1JZ6A 2CSGA 4I09A 3I4IA 2RS33 3ACFA 3ZSKA 2VNRA 2VXJA 4DO0A 5FQ0A 1NOVA 3E5XA 3UKVA 4C90A 3L2HA 2Q4SA 4TXWA 2EALA 2XG3A 3H3ZA 1RJ8A 2C4XA 3DGTA 1OVSA 1H1AA 4QX3A 4AHWA 5D1IA 3CJIA 5BXXA 4IE6A 4LITA 5FO8B 4AG4A 2JG9A 4I0WB 1VBE2 4IL7A 2CGPA 1OD3A 4K1YA 1EPZA 2XBO3 2DUOA 4Q4Y3 4EV0A 5CG8A 4AVTA 3AZZA 1IPJA 1IGOA 1EYBA 1W6MB 2ORZA 5GZEA 3WCRA 3H1MA 1DZRA 1PIV2 1ZBE1 4AQ6A 2OKXA 2VTFA 2MPFA 4L2NA 5A33B 2P3YA 1Q3EA 1RUNA 1Q43A 1GOHA 1R092 1WCQA 4GWJA 3OGRA 3MIBA 2VZUA 2WL1A 1OQEA 4OHVA 3JXSA 3VD3A 5CAZA 1IHMA 4QQOA 4XBQA 3I2JA 2P6CA 3NNMA 4OI0A 3AMNA 2QNKA 5ABJB 1O4ZA 4NAMA 2JWPA 1HV0A 1JZ5A 1POV0 3OTFA 2RMU1 4J25A 3AMQA 4GH4B 5C4WB 4NUBA 2VBBA 2QKDA 4Z92B 2DUPA 4H2AA 4Y5TA 5HXMA 4CU6A 2CAVA 3ABZA 3SLIA 3DF0A 3O0VA 4XFIA 1H1IA 2R063 4LULA 1FI2A 5FYSA 2QQLA 1UYXA 5K0UC 3L9JT 2QQUA 2AYHA 5CFCA 5A3NA 5FZHA 1QGLA 1O5LA 3AC0A 4GA9A 5IK5A 2IVIB 3FN9A 4Y1XA 1LOBA 1QWRA 3CMGA 5JI7A 4JTOA 4NIIA 1RMU1 4BK5A 1XNBA 1ENQA 3DUIA 3ZFEA 5DAVA 5AC93 1LU2A 1OURA 2HEVF 2QQMA 2XQXA 3E5UA 3AJYA 4FVVA 4Y4YA 1DQ6A 4YVWB 2LW8A 3CIHA 4SBVA 1Y9GA 1W6PA 1NKGA 3ON7A 2VQUA 2XJTA 1ASJ3 1F9KA 4WV8A 3O14A 3FBYA 3U11A 1HXS3 1ND3B 1F5JA 2VVEA 3Q8AA 3VBOC 3H8RA 4GH4C 3UGGA 1G9FA 5C3QA 2Y6LA 3HNBM 1CAVB 5IVCA 1AX0A 5IVEA 4YZ5A 4P08A 4QQ2A 5BNPA 3D8CA 5CFDC 1AR81 4NIDA 1PMHX 1W3XA 2ET7A 5KC5A 2GC1A 2PHWA 1DQ1A 1FT9A 1AUYA 3PDQA 5G05L 3A4UA 5FZ8A 3UETA 3RQ0A 1GYKA 3MPBA 5CG9A 4BU2A 1RINA 4Z2WA 2PAKA 5JXHA 1W6OB 2O1QA 4QT6A 4WVVA 2Y38A 4KQ7A 3T2PA 4HG6B 1C8M3 3MIEA 1PNGA 2PQSA 1GV9A 2GU9A 1GZWB 1NXMA 2ZCWA 3F2ZA 1Z7S3 2BJSA 3BTAA 1TME3 3GM8A 5F1RA 5F3CA 4ATFA 3TBDA 1WMXA 1GR3A 1WZXA 4AHYA 3PIGA 2YG0A 3W59A 4NIAA 2ZMKA 5GLUA 1NCQB 5A7WA 3RNSA 4LT5A 3WF4A 3USUB 2JECA 4Y5SA 4QPGB 5EPAA 1LNSA 2WNOA 4HN0A 5FOBB 1W9FA 4IETA 5FPAA 1MVQA 3VKFC 4EJRA 1DLCA 4XFAA 4BQXA 3POWA 5LEKA 3VBHC 3MO4A 1SDDB 2JE9A 2GMEA 3CQOA 2X5IC 4CDWC 3PIJA 1L7QA 3ZN5A 4B1LA 5AVPA 1XJAA 3ELNA 1WMEA 3K46A 3GZEA 1S2BA 3CZUA 3AP6A 4M3CB 3ZFGC 2XJVA 5J1XA 2PXJA 1FMD1 2BFUL 5FUIA 1DYOA 2QQVA 1K42A 4NHKA 1SBEA 4XFCA 5FZ7A 3BKZA 2WYSA 3B7MA 1RUF1 1DFQA 2FDGA 4AEJA 5JOXA 4AZZA 5C9AB 5C70A 2B45X 2W1QA 2VQTA 5DXDA 4XCBA 3VD9A 1POQA 1CAXA 3T2QA 2D6PA 3BTZA 4CEWB 4XDOA 5HI0A 1STMA 1CX1A 3WR0A 2JE7A 4GB33 1W2TA 2XKOA 1UXZA 1HQWA 1S0CA 3OPZA 4X6QB 2P5BA 3NMBA 3WW2A 1JZ4A 1IZ3A 1A8DA 2BW8A 4MHRA 5FZ6A 2WS92 1F35A 1W9TA 3B69A 1QEXA 3I3BA 5FZOB 2WNUA 1WMDA 1WLDA 2C0ZA 4GJYA 3WF1A 5JZGA 3O1UA 1ENXA 2HWC2 4GXLA 4C8DA 2UURA 3MPPG 3SITA 4CPBD 2EF6A 3I7DA 3EQEA 4DINB 1UL9A 1OLRA 2AEZA 1L7LA 4LBOA 1K3IA 3D0JA 5CZKA 5CEHA 3T0DA 5F32A 4KWJA 3WUDA 2WT0A 5FDBA 5ISLA 2VULA 5I93A 4M4RA 3N4MA 2DBIA 2CTVA 3WG3A 1ZRFA 1N3QA 3UGHA 4EZHA 1UXXX 1H30A 2D43A 2VZOA 1SPPA 4P9GA 1RUH1 2F4LA 2H6BA 3CJIC 2J1VA 1HDKA 2QUOA 2NLRA 1QIQA 3AKRA 4QHZA 2ZGNA 3ZFGB 1W0OA 4M4PA 2VMGA 2Y60A 1O3QA 1SLIA 3PUIA 1PO11 4CDWA 1VBC1 2R30A 3TNQA 2VUCA 4EWEA 2DCTA 2VXRA 2QTWB 1JTZX 2WT2A 1MQTB 3ZFGA 4A41A 1X9PA 3NQHA 4LA2A 5EV7A 3OYWB 2A6YA 4BISA 1RITA 2FDJA 4AFMA 3PMSA 2Q8DA 1SACA 2WNVB 1PO23 3KV5A 1AL21 1MS0A 1SLBA 4RHV3 5FYIA 3M7AA 2W46A 4R8HA 2ILMA 2ZHMA 2OUHA 2WSVA 4KU8A 1W2NA 4IEVA 2VJXA 4XAAA 2VGDA 2YFUA 3LOBA 1UKGA 2BRTA 2XJPA 1X50A 3DKWA 5FYBA 4A45A 3KLSA 1ST8A 5IYYA 1UX7A 2NYYA 1OT5A 3AYEA 3N9MA 1AYN1 1EUUA 2D40A 4JGZB 2LM3A 4A7YA 5KHHA 3ZYGA 4FO9A 4XF0A 3RWNA 2RVAA 1RMU3 3UKNA 4Y3OA 2E53A 1K5MB 3LFMA 2K9ZA 2OUJA 2WZR2 3AP9A 3D0SA 4IV3C 1CZSA 2R7EB 2PHRA 5EJ3A 2WWUA 3K2OA 3VDDB 4JHTA 4N8MA 3C7EA 3D5OA 3QH6A 4LKFA 5E6HA 4L9BA 1B35A 5F2WA 3ZSLA 4J1XA 4XJAA 4E9KA 3PVOA 4JGYA 3GZTB 5A1FA 1ZA4A 5C5UA 5FZ3A 2O0OA 4XIOA 3AFKA 4CDQC 2QZ2A 2JD9A 1BQPA 5LRRA 1LB2A 2RDNA 2P4EA 4DXTA 1ZBE2 2GC0A 3POBA 1COV1 2B8MA 1WA6X 2RMU3 2VVDA 1UPIA 5FY5A 3ZPOA 3D4KA 4KMQA 4YNIA 2VCMA 4AI1A 4UI9L 1ACCA 4P9LA 3E6DA 1SFNA 2Y6FA 1J3PA 3H1WA 1CN1A 3J26N 4LJHA 2YY1A 1UY4A 4O61A 5DAXA 3GBGA 1OBNA 1IKPA 1S0EA 3KVAA 4Q2FA 3F95A 4YW1A 3APBA 1YLLA 3D82A 3GDBA 5LATA 2RDSA 3AP5A 1AYM1 1R1A2 4Q4V2 2F6BA 2VBDA 2VQ0A 2YC4A 4HMZA 1MS1A 1HLCA 1Y7BA 3LDRA 3M3CA 1ULDA 1CPNA 1NY72 1CGPA 2NM1A 1AR62 4HETA 5FY4A 3ZYRA 3V0BA 1WCDJ 1DQ0A 1MQTC 1N3PA 1MVEA 2OYZA 5FBJA 3OGVA 3MHZA 5FTTC 2RDRA 1J3QA 1QJY1 2DVGA 2VL4A 5BNQA 4B3NA 5DZEA 4M0NA 5C6CA 4YGDA 1PK6B 1XQNA 2VW0A 1BMV1 1T6BX 3NV1A 1COV2 4S2FA 1NUKA 4MX3A 4K21A 3DPRB 4KBZA 4OUEA 4CDUB 2ZEZA 4NOTA 4RL7A 1IOAA 5JCTA 2AACA 2EIEA 5IVFA 2I07B 2L9LA 2VG9A 2XWJB 3I2IA 4CUGA 3IDEA 2YZ4A 1UMZA 2B5HA 4S2DA 2VZRA 4XPVA 2BQPA 1QOOA 1OA2A 1SEFA 1YQ6A 1ZZCA 1EV11 1UQXA 4P00B 4XF9A 5JUVA 4ITCA 4BYYA 2DVBA 1GP5A 1R1A1 3LF7A 4PQQA 1OOPC 3BODA 4Q4V1 5L7OC 1CWPA 2VECA 4M00A 4CEYC 2WNEA 1TMF1 5I8YA 2XMLA 3LOIA 3OUJA 4Y20A 2VZPA 1Q8SA 1A34A 4LHKA 5F9TA 1OPMA 2A6ZA 3EBRA 4KG0A 5FIXA 1ZVFA 4JGYC 2XBO2 4Q4Y2 1OF3A 4LO4B 4Q4X3 1MEC3 1ZZ9A 1W6PB 2GP5A 3VD4A 4R9BA 4URAA 3KT4A 3WNOA 3QCWA 2JX9A 2E51A 3RRDA 1S4CA 1H0BA 2RS12 2WZR3 4JGZA 5FYHA 3M1HA 3T2OA 3OCPA 4JVAA 1VAMA 3T2TA 4A4AA 1N3OA 1JMUB 4N43C 1UU4A 4QU1A 2YXSA 5C4WC 2RS32 4OHZA 1PVXA 2W1SA 3B00A 3RI8A 4DB5A 4N53B 1DDLA 1CZVA 1FOD3 3KCYA 4KI5M 3CL1A 3MI8A 5FREA 3FLRA 3KCCA 3RZKA 3ASIA 1H9WA 2DVDA 4S2HA 3U78A 2QJVA 4RR3C 2KXLA 2VQAA 1C5IA 1ZBA3 2WN3A 4LBQD 4W6XA 1VRH3 1S0GA 5L9RA 1CPMA 2D97A 4CP0A 2YV8A 4Y1ZA 1W03A 5GJ6A 2DTWA 2CAUA 5FYMA 2CDPA 1KS5A 5A3LA 3SXWA 1Q8OA 3ORJA 4AFCA 3DKQA 5SV5A 5I91A 3GGLA 1W6NB 2VBPA 3ZN6A 3RZJA 3PUSA 2QZ3A 5H9RA 3N7JA 3ZSJA 5FYVA 5A6QA 5E8AA 5CKQA 1Z7S2 5T5PA 1BEV2 1NYWA 2EIGA 1LOAA 3C2UA 3VHPA 2IXCA 4L11A 4A6OA 4A42A 1JYWA 5FZLA 3BN6A 1FMD3 2ES3A 2RJLA 4NROA 1RUD2 3ZFFB 4Z1VA 1JZ7A 1VAKA 4IEOA 5H9QA 3O1PA 4QGLA 2R49A 4K8RB 2AEYA 4CYDA 3VKLA 1GP4A 1W9WA 1LGNA 2YB7A 1X7NA 3USSA 4I3GA 2X5IA 3NAPA 1XRUA 4XHXA 2XB6C 4GMP0 4COVA 2A6VA 1V70A 3EB7A 4XETA 2W3JA 4CEYA 1PVC3 5FPUA 2VCCA 4D8MA 1HXS2 1ND2A 1YFXA 2R062 2P37A 1S0FA 4KGQA 4YVSB 1RUH2
chains in the Genus database with same CATH topology
2XONA 4CU8A 2X10A 5A1AA 1H6YA 4FI9A 1JZ2A 5CYYA 3HNMA 3MBWA 4QPWA 3ACHA 2QBXA 4PT6A 3WNKA 4A44A 2QQKA 5I0DA 5JXJA 5DPNA 3HNYM 4MGQA 4CUAA 3DYOA 2EIDA 2VCAA 3ETPA 3K4AA 2VZTA 4DEVA 2DCJA 3FL7A 1H6XA 4QB1A 4DEQA 5DMYA 2QQNA 2Y6HA 3C7GA 3A21A 2WAOA 3K4DA 2W91A 3LEIA 2BGPA 3K75B 2W94A 1JZ6A 3HJRA 3ACFA 5F7UA 1JYVA 3UESA 1KEXA 3OGSA 5LA0A 5IJRA 1SHWB 4TXWA 3C7OA 5JMOA 1US3A 4E8DA 2WO1A 1XNAA 2C4XA 4QX3A 2WUHA 3CKHA 4AG4A 1UZ0A 2BERA 3I3EA 4CVUA 1OD3A 2HLEA 2RJ2A 1CIYA 3FHAA 4LQRA 1GNYA 3THDA 2ORZA 2VMDA 2OKXA 2VTFA 3W5MA 2VMCA 3ACIA 1GOHA 1P8JA 1O59A 1WCQA 4GWJA 4JKKA 4CUCA 3OGRA 2C26A 2VZUA 3VD3A 3JXSA 3I2JA 1JYNA 4QAWA 1JZ5A 2WO3A 1UWWA 1RYYA 1GOGA 4A3ZA 2Y6KA 5HXMA 1OF4A 4CU6A 3ABZA 1YQ2A 4UAPA 2X09A 3P1IA 2QQLA 1UYXA 4GWIA 4AAXA 4QX0A 3UNPA 4P02B 4QDQA 5EJ1B 2E33A 3AC0A 1K12A 3FN9A 2QQOA 1GOFA 2J1SA 3CMGA 3WNMA 4QB2A 2X05A 5C71A 2DDUA 4BK5A 3I97A 3IAQA 1I5PA 2QQMA 2XQXA 5IFPA 2LW8A 3CIHA 1NKGA 1UY3A 2WABA 2VQUA 1JHJA 1HN1A 3WQBA 5JXIA 3OG2A 2Y6LA 3HNBM 1UY0A 4BXSV 3K4ZA 4P08A 3NNGA 2WZEA 2VMFA 2CDOA 1PMHX 5G05L 1D7PM 2W9XA 3VD5A 1W9SA 2E26A 3THCA 1O8PA 1XC6A 3IAPA 3UETA 2VZ3A 1J84A 4RYDA 2C9KA 5JXHA 4QX2A 3HEIA 3T2PA 3WF0A 4HG6B 4XZUG 2PQSA 3OEBA 3ZM8A 3J7HA 3F2ZA 2Y64A 3GM8A 2V4VA 2VC9A 3DECA 1UYYA 2JE8A 1XPWA 2YG0A 4MGSA 1W99A 4CU7A 3WF4A 2J1TA 4D0QA 3I2FA 2ZXQA 1LNSA 2J1RA 3HPNA 3WSOA 4RN5A 1DLCA 4DXRA 3MO4A 1JZ3A 1SDDB 4ZZ8A 4GZ9A 3DYPA 3CQOA 1L7QA 3IIIA 3K77A 2HYXA 3K46A 2W92A 3CZUA 2VOTA 4Z2AA 3SKJE 2J1AA 5J1XA 5FUIA 1DYOA 3EYPA 1K42A 2BGOA 2V72A 1F4HA 2WYSA 2QQJA 5C70A 2W1QA 1UMIA 2VQTA 2Y6GA 3VD9A 2V5DA 3T2QA 3VDCA 1CX1A 1UY2A 3SKVA 1UXZA 1JZ4A 3MV11 1W9TA 3I3BA 2DCKA 4XUNA 2Z4FA 3WF1A 1F4AA 3DYMA 2WAAA 2EICA 2RV9A 4TTGA 1K3IA 1K45A 3T0BA 5CZKA 4CU9A 1DP0A 2JDAA 3T0DA 4MOAA 5EIYB 4M4RA 4LHSA 2Y6JA 3SEEA 1UXXX 4ZXEA 2XOMA 4OMDA 3IDAA 1JU3A 2VZOA 3HOBA 2B4KA 3WF2A 3D3AA 2J7MA 2J1VA 1J83A 2XHNA 4M4PA 5B4XA 3PUIA 3NRUA 1W8OA 3PUHA 2Y8KA 4IUGA 3P6BA 4A41A 1PX3A 3NQHA 3A22A 4L0PA 4XUOA 2ZEYA 3LQCA 3CZJA 4JKLA 1KGYA 2W46A 5JXGA 2VJXA 2YFUA 2KD7A 3NJVA 4W8JA 2VM9A 4BK4A 5HPOA 3C7HA 1TVGA 4A45A 5IYYA 1UX7A 1OT5A 1EUUA 2W47A 4CUBA 4JHZA 2RVAA 2VZVA 2VZSA 5EJZB 3WNLA 1JU4A 2WDBA 2QQIA 3ECQA 4XUTA 1WKYA 3OB8A 1CZSA 4LKSA 3U37A 2R7EB 4XUPA 4JX0A 3C7EA 3WNPA 3OEAA 1UMHA 5IFTA 3IB3A 3C7FA 4DUXA 2YFZA 4XUQA 2JD9A 2J1EA 1CZTA 4DXTA 1W8NA 5LCWL 2J1UA 3A7QA 5B4NA 1SG3A 1O8SA 4KMQA 1T2XA 4UI9L 2ZEXA 2BZDA 3A23A 1GU3A 1OH4A 1UY4A 3VD7A 4QDRA 2E31A 3GDBA 2BBAA 2YC4A 3T0AA 3MUY1 3WNNA 3GXUA 1UYZA 3HN3A 4QB6A 4QDSA 3OGVA 4DXSA 1L7RA 2VL4A 3VDAA 2VR4A 2WN2A 2VZ1A 3I2GA 5C7GA 1NUKA 3I2HA 4OUEA 2W95A 4PF1A 2ZEZA 1JZ8A 5LA1A 1NAEA 2VMEA 2EIEA 3OBAA 2L9LA 3I2IA 1GQPA 2VZRA 5DN2A 3LEGA 3T09A 5JUVA 1GUIA 3FHQA 4P00B 4BDVB 1PX4A 4ARYA 1JI6A 1TG7A 1PMJX 1MPXA 4PQQA 4DUWA 3SEPA 4W4ZA 2VZPA 4MO3M 3T08A 2ZEWA 1OF3A 3VD4A 3LPGA 2LS6A 2B9VA 3WNOA 4DUVA 3C8XA 3I2KA 4ZZ5A 4XURA 4XVHA 2WZ8A 4LPLA 3BGAA 4BJ0A 1W0NA 3W5NA 1NX9A 4UOJA 1IQDC 3T2OA 4A4AA 2E32A 5IHRA 2YC2A 2W5FA 3LE0A 3WEZA 2W1SA 2VCBA 3ACGA 4OYUA 4QX1A 1CZVA 4KI5M 3E1F1 2W87A 4OMCA 5JR2A 1XNTA 3VDBA 3MV01 1US2A 1BHGA 2WN3A 3I3DA 4ET7A 2W1UA 4YPJA 3WF3A 2WQ8A 2WBKA 4KWUA 2JKXA 2CDPA 3NJXA 1R64A 3GGLA 4ZY9A 1JYXA 3LPFA 2ORXA 1ULOA 2EIBA 4A6OA 1GMMA 4A42A 1JYWA 3BN6A 2VZQA 4P5YA 2WO2A 2VO5A 5DQ0A 1JZ7A 2W1WA 4OZOA 4MADA 4JKMA 3MUZ1 3CDZB 5LA2A 2ID4A 1W9WA 2YB7A 1EUTA 2J22A 1ULPA 3LEKA 4W50A 4ARXA 3EB7A 2W3JA 1UY1A 4E8CA 5G04L 2VCCA 4D8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XON A;  4CU8 A;  2X10 A;  5A1A A;  1H6Y A;  4FI9 A;  1JZ2 A;  5CYY A;  3HNM A;  3MBW A;  4QPW A;  3ACH A;  2QBX A;  4PT6 A;  3WNK A;  4A44 A;  2QQK A;  5I0D A;  5JXJ A;  5DPN A;  3HNY M;  4MGQ A;  4CUA A;  3DYO A;  2EID A;  2VCA A;  3ETP A;  3K4A A;  2VZT A;  4DEV A;  2DCJ A;  3FL7 A;  1H6X A;  4QB1 A;  4DEQ A;  5DMY A;  2QQN A;  2Y6H A;  3C7G A;  3A21 A;  2WAO A;  3K4D A;  2W91 A;  3LEI A;  2BGP A;  3K75 B;  2W94 A;  1JZ6 A;  3HJR A;  3ACF A;  5F7U A;  1JYV A;  3UES A;  1KEX A;  3OGS A;  5LA0 A;  5IJR A;  1SHW B;  4TXW A;  3C7O A;  5JMO A;  1US3 A;  4E8D A;  2WO1 A;  1XNA A;  2C4X A;  4QX3 A;  2WUH A;  3CKH A;  4AG4 A;  1UZ0 A;  2BER A;  3I3E A;  4CVU A;  1OD3 A;  2HLE A;  2RJ2 A;  1CIY A;  3FHA A;  4LQR A;  1GNY A;  3THD A;  2ORZ A;  2VMD A;  2OKX A;  2VTF A;  3W5M A;  2VMC A;  3ACI A;  1GOH A;  1P8J A;  1O59 A;  1WCQ A;  4GWJ A;  4JKK A;  4CUC A;  3OGR A;  2C26 A;  2VZU A;  3VD3 A;  3JXS A;  3I2J A;  1JYN A;  4QAW A;  1JZ5 A;  2WO3 A;  1UWW A;  1RYY A;  1GOG A;  4A3Z A;  2Y6K A;  5HXM A;  1OF4 A;  4CU6 A;  3ABZ A;  1YQ2 A;  4UAP A;  2X09 A;  3P1I A;  2QQL A;  1UYX A;  4GWI A;  4AAX A;  4QX0 A;  3UNP A;  4P02 B;  4QDQ A;  5EJ1 B;  2E33 A;  3AC0 A;  1K12 A;  3FN9 A;  2QQO A;  1GOF A;  2J1S A;  3CMG A;  3WNM A;  4QB2 A;  2X05 A;  5C71 A;  2DDU A;  4BK5 A;  3I97 A;  3IAQ A;  1I5P A;  2QQM A;  2XQX A;  5IFP A;  2LW8 A;  3CIH A;  1NKG A;  1UY3 A;  2WAB A;  2VQU A;  1JHJ A;  1HN1 A;  3WQB A;  5JXI A;  3OG2 A;  2Y6L A;  3HNB M;  1UY0 A;  4BXS V;  3K4Z A;  4P08 A;  3NNG A;  2WZE A;  2VMF A;  2CDO A;  1PMH X;  5G05 L;  1D7P M;  2W9X A;  3VD5 A;  1W9S A;  2E26 A;  3THC A;  1O8P A;  1XC6 A;  3IAP A;  3UET A;  2VZ3 A;  1J84 A;  4RYD A;  2C9K A;  5JXH A;  4QX2 A;  3HEI A;  3T2P A;  3WF0 A;  4HG6 B;  4XZU G;  2PQS A;  3OEB A;  3ZM8 A;  3J7H A;  3F2Z A;  2Y64 A;  3GM8 A;  2V4V A;  2VC9 A;  3DEC A;  1UYY A;  2JE8 A;  1XPW A;  2YG0 A;  4MGS A;  1W99 A;  4CU7 A;  3WF4 A;  2J1T A;  4D0Q A;  3I2F A;  2ZXQ A;  1LNS A;  2J1R A;  3HPN A;  3WSO A;  4RN5 A;  1DLC A;  4DXR A;  3MO4 A;  1JZ3 A;  1SDD B;  4ZZ8 A;  4GZ9 A;  3DYP A;  3CQO A;  1L7Q A;  3III A;  3K77 A;  2HYX A;  3K46 A;  2W92 A;  3CZU A;  2VOT A;  4Z2A A;  3SKJ E;  2J1A A;  5J1X A;  5FUI A;  1DYO A;  3EYP A;  1K42 A;  2BGO A;  2V72 A;  1F4H A;  2WYS A;  2QQJ A;  5C70 A;  2W1Q A;  1UMI A;  2VQT A;  2Y6G A;  3VD9 A;  2V5D A;  3T2Q A;  3VDC A;  1CX1 A;  1UY2 A;  3SKV A;  1UXZ A;  1JZ4 A;  3MV1 1;  1W9T A;  3I3B A;  2DCK A;  4XUN A;  2Z4F A;  3WF1 A;  1F4A A;  3DYM A;  2WAA A;  2EIC A;  2RV9 A;  4TTG A;  1K3I A;  1K45 A;  3T0B A;  5CZK A;  4CU9 A;  1DP0 A;  2JDA A;  3T0D A;  4MOA A;  5EIY B;  4M4R A;  4LHS A;  2Y6J A;  3SEE A;  1UXX X;  4ZXE A;  2XOM A;  4OMD A;  3IDA A;  1JU3 A;  2VZO A;  3HOB A;  2B4K A;  3WF2 A;  3D3A A;  2J7M A;  2J1V A;  1J83 A;  2XHN A;  4M4P A;  5B4X A;  3PUI A;  3NRU A;  1W8O A;  3PUH A;  2Y8K A;  4IUG A;  3P6B A;  4A41 A;  1PX3 A;  3NQH A;  3A22 A;  4L0P A;  4XUO A;  2ZEY A;  3LQC A;  3CZJ A;  4JKL A;  1KGY A;  2W46 A;  5JXG A;  2VJX A;  2YFU A;  2KD7 A;  3NJV A;  4W8J A;  2VM9 A;  4BK4 A;  5HPO A;  3C7H A;  1TVG A;  4A45 A;  5IYY A;  1UX7 A;  1OT5 A;  1EUU A;  2W47 A;  4CUB A;  4JHZ A;  2RVA A;  2VZV A;  2VZS A;  5EJZ B;  3WNL A;  1JU4 A;  2WDB A;  2QQI A;  3ECQ A;  4XUT A;  1WKY A;  3OB8 A;  1CZS A;  4LKS A;  3U37 A;  2R7E B;  4XUP A;  4JX0 A;  3C7E A;  3WNP A;  3OEA A;  1UMH A;  5IFT A;  3IB3 A;  3C7F A;  4DUX A;  2YFZ A;  4XUQ A;  2JD9 A;  2J1E A;  1CZT A;  4DXT A;  1W8N A;  5LCW L;  2J1U A;  3A7Q A;  5B4N A;  1SG3 A;  1O8S A;  4KMQ A;  1T2X A;  4UI9 L;  2ZEX A;  2BZD A;  3A23 A;  1GU3 A;  1OH4 A;  1UY4 A;  3VD7 A;  4QDR A;  2E31 A;  3GDB A;  2BBA A;  2YC4 A;  3T0A A;  3MUY 1;  3WNN A;  3GXU A;  1UYZ A;  3HN3 A;  4QB6 A;  4QDS A;  3OGV A;  4DXS A;  1L7R A;  2VL4 A;  3VDA A;  2VR4 A;  2WN2 A;  2VZ1 A;  3I2G A;  5C7G A;  1NUK A;  3I2H A;  4OUE A;  2W95 A;  4PF1 A;  2ZEZ A;  1JZ8 A;  5LA1 A;  1NAE A;  2VME A;  2EIE A;  3OBA A;  2L9L A;  3I2I A;  1GQP A;  2VZR A;  5DN2 A;  3LEG A;  3T09 A;  5JUV A;  1GUI A;  3FHQ A;  4P00 B;  4BDV B;  1PX4 A;  4ARY A;  1JI6 A;  1TG7 A;  1PMJ X;  1MPX A;  4PQQ A;  4DUW A;  3SEP A;  4W4Z A;  2VZP A;  4MO3 M;  3T08 A;  2ZEW A;  1OF3 A;  3VD4 A;  3LPG A;  2LS6 A;  2B9V A;  3WNO A;  4DUV A;  3C8X A;  3I2K A;  4ZZ5 A;  4XUR A;  4XVH A;  2WZ8 A;  4LPL A;  3BGA A;  4BJ0 A;  1W0N A;  3W5N A;  1NX9 A;  4UOJ A;  1IQD C;  3T2O A;  4A4A A;  2E32 A;  5IHR A;  2YC2 A;  2W5F A;  3LE0 A;  3WEZ A;  2W1S A;  2VCB A;  3ACG A;  4OYU A;  4QX1 A;  1CZV A;  4KI5 M;  3E1F 1;  2W87 A;  4OMC A;  5JR2 A;  1XNT A;  3VDB A;  3MV0 1;  1US2 A;  1BHG A;  2WN3 A;  3I3D A;  4ET7 A;  2W1U A;  4YPJ A;  3WF3 A;  2WQ8 A;  2WBK A;  4KWU A;  2JKX A;  2CDP A;  3NJX A;  1R64 A;  3GGL A;  4ZY9 A;  1JYX A;  3LPF A;  2ORX A;  1ULO A;  2EIB A;  4A6O A;  1GMM A;  4A42 A;  1JYW A;  3BN6 A;  2VZQ A;  4P5Y A;  2WO2 A;  2VO5 A;  5DQ0 A;  1JZ7 A;  2W1W A;  4OZO A;  4MAD A;  4JKM A;  3MUZ 1;  3CDZ B;  5LA2 A;  2ID4 A;  1W9W A;  2YB7 A;  1EUT A;  2J22 A;  1ULP A;  3LEK A;  4W50 A;  4ARX A;  3EB7 A;  2W3J A;  1UY1 A;  4E8C A;  5G04 L;  2VCC A;  4D8M A; 
#chains in the Genus database with same CATH topology
 3ZXJ A;  1FV2 A;  1REF A;  4HPK B;  4FPG A;  3SH3 A;  2JIJ A;  4BIF A;  4MV2 A;  2X10 A;  4C0H A;  1H6Y A;  3NL1 A;  2YBS A;  3JBG 2;  2LRO A;  4UF0 B;  3HNM A;  1H8T A;  2SLI A;  1ND2 B;  1C8M 1;  1CAU A;  4FFF A;  5AC9 2;  5F5A A;  3KF5 A;  3LSD A;  5DPN A;  3RGB A;  5F8P A;  1XU1 A;  3ZX7 A;  4CUA A;  1U12 A;  2JDP A;  2ZGO A;  1AVB A;  2VCA A;  1VE0 A;  5LY1 A;  3AM2 A;  1PZ9 A;  2ZX0 A;  5JSR A;  1POV 1;  3T1M A;  1DGR N;  3OD0 A;  4AYU A;  4FOQ A;  5CIR A;  4Q4X 2;  4YM1 A;  3VBF B;  5F37 A;  4DEV A;  1PGW 1;  4RR3 A;  3B5L B;  5ACA 1;  2Y0O A;  1KJR A;  5GZD A;  4CDU C;  1H4G A;  1SCR A;  5FKB A;  4AW7 A;  3WVJ A;  3ZFF A;  5IAT A;  3FX3 A;  1HXS 1;  4G9S B;  4Q0P A;  5DMY A;  1OLM A;  3V0A B;  4M3C F;  3AYA A;  1O3T A;  3PVN A;  2MEV 2;  2BGP A;  1ASJ 1;  3NO8 A;  5F2S A;  4CCD A;  1OXC A;  1Y43 B;  3CHX A;  3NW4 A;  4RHV 1;  4V2W A;  4YW2 A;  1X36 A;  2ET1 A;  4UXA A;  2P3I A;  1QQP 1;  5D8A C;  3WZ1 A;  4YM3 A;  2E63 A;  2WRA A;  4RSU A;  3HR9 A;  3KQ4 B;  1YJL A;  4KBB A;  4L97 A;  4XMA A;  5AC9 1;  1YEW A;  5BNO B;  5BYN A;  3ME2 A;  4YYO A;  1MS4 A;  4TLF A;  1US3 A;  2A3Y A;  4ISQ A;  4E8D A;  2YHJ A;  3KV6 A;  2OW4 A;  3D6E A;  1WMF A;  1C8N A;  1MEC 2;  1Y3T A;  4AGR A;  3T30 A;  3ZDV A;  3PHM A;  4E2Q A;  4YVS C;  3POS A;  3AZX A;  4LQR A;  1GNY A;  5GLT A;  3VV1 A;  2XVL A;  3OYW A;  4Y26 A;  1SCS A;  3KWV A;  2YU1 A;  4XC9 A;  4CA9 A;  3KGZ A;  2UY9 A;  5KXD A;  3ZMN A;  3TAY A;  1R08 2;  5LA9 A;  4UFK A;  4D7T A;  5LBB A;  1AXK A;  2DU1 A;  2EXH A;  2PFW A;  4MHU A;  2IZW A;  4ZU4 A;  1W39 A;  1NG0 A;  3DXU A;  5K0U B;  1O59 A;  4JKK A;  2JXA A;  2ARC A;  2TBV A;  2C26 A;  1TNR A;  3TEW A;  4XHB A;  3LIH A;  5FPX A;  5LZ6 A;  2OXB A;  1B09 A;  3S5Q A;  1BZW A;  1QXP A;  2EXI A;  4FPJ A;  1W06 A;  2FDH A;  3QLQ A;  5LWB A;  1RUI 1;  2JEM A;  4YGB A;  3FUO A;  1UWW A;  4HFS A;  2A71 A;  3N7M A;  4URT A;  5FP8 A;  1K5M C;  3IBM A;  2R04 3;  4IEQ A;  3ENR A;  4NJ4 A;  2I2S A;  1ZRI A;  4IER A;  3P1I A;  3JCI A;  1CQ9 A;  3A0N A;  1RUJ 3;  1RVF 3;  2D5H A;  4LBK A;  2ZX3 A;  3TN9 3;  4W6W A;  4TSV A;  1QJX 2;  4GWI A;  4AAX A;  3RYK A;  4QPI A;  3Q8E A;  4XXA A;  2V73 A;  5FZM A;  4FQZ A;  4XMI A;  3TRS B;  2QQO A;  1AZD A;  1UU5 A;  1XB9 A;  2GAU A;  4WVM A;  3DPR A;  4HN1 A;  1U5I A;  3WG4 A;  3QOP A;  3VHR A;  1DLL A;  3TWI A;  2FCV A;  1QY4 A;  2OZ6 A;  4Q1R A;  5FP4 A;  3TEX A;  4AHX A;  3J4U H;  2W2I A;  1LOG A;  3AB0 A;  1UOF A;  3UYJ A;  2UWC A;  1FNZ A;  1LOC A;  2ZAC A;  1UY3 A;  2ZA9 A;  3WW4 A;  4AE2 A;  4ZU7 A;  4QHB A;  1GWL A;  1NY7 1;  1HN1 A;  3RWK X;  2B7Y A;  3WQB A;  1XSR A;  2J42 A;  5C4W A;  5DUV A;  4Y24 A;  1J1L A;  4AVV A;  1O4T A;  3BU7 A;  5FMD A;  4N9I A;  2HWE 1;  3OG2 A;  4GIQ A;  4B29 A;  1C28 A;  2WZP P;  4HXC A;  3ZIX A;  1EPW A;  3VZN A;  4AQS A;  4V2V A;  3CEW A;  4OQ8 A;  1XE0 A;  1YRZ A;  2VOK A;  4BXS V;  5JSO A;  4XZP A;  4PDW A;  2Q0A A;  2FMY A;  1W6Q A;  2CDO A;  2VMF A;  3LGR A;  4QU2 A;  2PAM A;  1D7P M;  3RVH A;  4FPE A;  1W9S A;  1VBB 3;  2PHD A;  1O8P A;  5IW0 A;  5T54 A;  3U07 A;  4QKF A;  4FSJ A;  4AED B;  2DVF A;  3PJY A;  4CDQ A;  3OGG A;  4RYD A;  2UYA A;  5FY0 A;  3UGF A;  2VOX A;  1E57 A;  2XLG A;  3I2O A;  2IFW A;  3HEI A;  3WF0 A;  2P3K A;  4AQ2 A;  4CXW A;  4MXW B;  1MZ6 A;  3OEB A;  3ZM8 A;  1GNZ A;  4RGK A;  5FP3 A;  1FOD 2;  3JB4 C;  5HCA A;  4RD7 A;  3CNA A;  3HQR A;  5HCH A;  2V4V A;  4LOS A;  1WLT A;  1UYY A;  2JE8 A;  1LOF A;  1RUJ 1;  1RVF 1;  1XPW A;  4LHN A;  4P9X A;  3NNJ A;  1W99 A;  2C24 A;  5I0S A;  2J1T A;  3UV9 A;  1AR8 3;  2EAK A;  4D0Q A;  1K5M A;  3THT A;  1AR9 3;  2AC1 A;  2J1R A;  5FLJ A;  3WSO A;  1UU6 A;  3NJZ A;  1ALY A;  4DXR A;  4HPK A;  3NKG A;  4ZZ8 A;  3DYP A;  4Y33 A;  3CO2 A;  1HB4 A;  3III A;  4LXL A;  2DUQ A;  1RUC 3;  5F5Q A;  5FXV A;  4DQA A;  5C5T A;  4NWW A;  4CEY B;  4NVP A;  4XIL A;  4AVC A;  4LUM A;  3MEP A;  5KHI A;  2ARA A;  2YYO A;  3VZL A;  2V72 A;  3I54 A;  3ZYF A;  2RMU 2;  4GAL A;  1Y9Q A;  3B9I A;  1V6O A;  1KD7 A;  3NV2 A;  4O9E A;  4XTP A;  5DDJ 3;  2AUY A;  2A6X A;  3H1Y A;  2A7A A;  3ILN A;  2RE9 A;  3OSD A;  1VBA 1;  1T6G C;  2Y6G A;  1CD3 G;  4XAB A;  5DZF A;  5FMO L;  1S2E A;  3ZXF A;  3VDC A;  3EJK A;  1IS3 A;  4YG0 A;  5EQU A;  1CX4 A;  1AX2 A;  4N43 A;  2JKB A;  1UY2 A;  4QD2 A;  4FXG B;  5I0T A;  3S7E A;  2ERF A;  3SKV A;  4MZU A;  3AKQ A;  4XF4 A;  4N53 A;  3VKO A;  1ZZ7 A;  3BIW E;  2PYT A;  3MV1 1;  3VBS B;  2TEP A;  2DCK A;  5DAQ A;  5BNP C;  1UW8 A;  2RS1 1;  1RUG 1;  3AKT A;  1ODM A;  5KBF A;  2N7G A;  5L73 A;  1F15 A;  1F4A A;  2GMP A;  4YSF A;  1EY2 A;  3AP4 A;  3DYM A;  4I2O A;  3KB5 A;  3R6S A;  3KMH A;  3PTY A;  2NPI A;  4U36 A;  4Q4W 3;  5AFE A;  3PUA A;  4TTG A;  1VLN A;  3MGU A;  4PIX A;  2R1B A;  4FOY A;  4CU9 A;  5FZK A;  1VMH A;  2ZAB A;  5EIY B;  4Q29 A;  3B02 A;  1VBA 2;  1F31 A;  3JQX A;  3N36 A;  4CXX A;  4FTB A;  3POJ A;  2SBA A;  1G8W A;  2HWF 3;  1LCL A;  4OHW A;  2JG9 C;  1VBB 2;  5ACA 2;  4IE0 A;  5A7P A;  1ZBE 3;  2P1B A;  4ZXE A;  2YU2 A;  4OMD A;  5DG1 A;  3IDA A;  3WLU A;  4FPF A;  4COZ A;  4DRV A;  2ZX4 A;  1IS5 A;  2XVG A;  3HOB A;  3BPZ A;  4LR4 A;  2ZGU A;  5D2A A;  5DUX A;  1LHO A;  4HKW A;  5KHJ A;  3WX5 A;  2BOI A;  3H3L A;  4JQT A;  1RC6 A;  1WBF A;  4QPY A;  4BM8 A;  2R04 1;  3FHI B;  3JBG 1;  4K40 A;  2ZZQ A;  4PBP A;  1S0D A;  2B9U A;  1W8O A;  4UW6 A;  5JIU A;  1F5F A;  3WG1 A;  1A8M A;  4JDN A;  3N9N A;  4IUG A;  3P6B A;  4V1P A;  4IEX A;  2E7A A;  2G4I A;  4RR3 B;  2R32 A;  2BBV A;  2PLV 2;  4AI0 A;  4XUO A;  5LRS A;  1JBC A;  4GKX A;  4DRR A;  3PL0 A;  3LQC A;  1QOT A;  1DZT A;  5T3N A;  1G7Y A;  1XYN A;  2IWG B;  3LD8 A;  5JXG A;  4CCE A;  3U0Z A;  1H8T C;  1RGS A;  3MW4 A;  1V9U 2;  5KC6 A;  1DGW A;  4GKY A;  1LES A;  2RHP A;  1VRH 2;  2ZX2 A;  1IKQ A;  3M2M A;  3NJV A;  2KD7 A;  2LTN A;  2UWA A;  3ZYI B;  4MXW A;  2VM9 A;  1VRB A;  1X33 A;  4M3C A;  3C7H A;  1BXH A;  1ASJ 2;  2A73 B;  3PVB B;  3HMY A;  1QF3 A;  5CFD B;  3I3M A;  3SH5 A;  3KGL A;  1U5X A;  1KDM A;  2W47 A;  4IXL A;  4HOO A;  1OC1 A;  4JHZ A;  1VBC 2;  2HWD 3;  1VBD 1;  2HBT A;  2JG8 B;  2VZS A;  3POF A;  1W6Q B;  3GBW A;  4KNC A;  5EJZ B;  1W8W A;  4HKL A;  3ECQ A;  1V6I A;  3OB8 A;  4LKS A;  4DZG A;  3NAP B;  1CAX B;  2EA7 A;  3MIH A;  1LHV A;  4N7I A;  3Q8B A;  3OEA A;  3LAG A;  1UMH A;  4DMI A;  2O8Q A;  2IUW A;  3C7F A;  1DIW A;  2BPA 2;  2YFZ A;  4RS5 A;  1C3H A;  1S55 A;  4ZXK A;  3JD7 2;  4OUL A;  4NIG A;  3S30 A;  1VRH 1;  5BNN A;  1GNH A;  1W8N A;  3WXP A;  5IT6 A;  3VBF C;  1CAU B;  1W90 A;  2X8K A;  3S57 A;  3HVD A;  2AGS A;  1QJX 1;  3A7Q A;  3PUR A;  1SG3 A;  4QKD A;  4L99 A;  5CFD A;  3AX4 A;  3H8O A;  1AYN 2;  2Z69 A;  1D4V B;  4WVM B;  5F3E A;  4E4D X;  3X29 B;  3A23 A;  1QJU 3;  5KXE A;  1HRV 1;  4AOC A;  4LBQ B;  3VUO A;  4YVS A;  4QM8 A;  2CWM A;  1U5Z A;  1NCR C;  4LKE A;  4PDW C;  2BWC A;  2DV9 A;  4QDR A;  1GSL A;  2BBA A;  2XPJ A;  2OQ6 A;  5C3S A;  2ADD A;  4P9I A;  2WO7 A;  1NCQ A;  2VUD A;  2JDH A;  3T0A A;  1O7F A;  3E5Q A;  3GXU A;  5J37 A;  4LO8 A;  1MEC 1;  3JQW A;  5APA A;  1H8V A;  1LR5 A;  3NV4 A;  4QDS A;  1WCS A;  1PNF A;  1YFW A;  4Q0U A;  5F3G A;  2YBP A;  2VR4 A;  1RHI 1;  2RJK A;  2WN2 A;  4N90 A;  5FZ0 A;  4FXK B;  4AEK A;  3JD7 3;  4R4Z A;  5C7G A;  4Y1U A;  1OLQ A;  1R1A 3;  4Q4V 3;  2C9A A;  3DCQ A;  4CEW C;  1NLS A;  4Z8B A;  4LUK A;  5LA1 A;  1XYP A;  2VTX J;  5L19 A;  1NAE A;  1RXF A;  1O4Y A;  3OBA A;  1GAN A;  4QM9 A;  2IXI A;  4O9G A;  1UZV A;  5FMB A;  3ITQ A;  4UW5 A;  1ZX5 A;  1OD5 A;  3FHQ A;  4KWK A;  4BDV B;  1PX4 A;  1NZI A;  1YNA A;  1Q5O A;  3U4S A;  1PMJ X;  1MPX A;  4QKB A;  1ND3 A;  2JIC A;  1YQ5 A;  5F3I A;  4F8A A;  5CA6 A;  2Q1M A;  1ZYB A;  3IZO A;  1W2A X;  3HD8 B;  3WIN E;  2G9G A;  2UU8 A;  3AXE A;  2IXJ A;  4MO3 M;  4AGG A;  5CKM A;  4CDW B;  4Q8K A;  1I1E A;  1DGR A;  2P6H A;  5K0U A;  4B1M A;  1YC6 1;  2XUE A;  2DTY A;  1SBF A;  2ZGT A;  4BHP A;  1BMV 2;  1WUV A;  2Q5T A;  4YRD A;  3LPG A;  1V6N A;  1AR9 2;  2FMD A;  4LIV A;  4DUV A;  1F2N A;  5HBA A;  3MLJ A;  3OBT A;  2WZ8 A;  4I01 A;  4LPL A;  3DL3 A;  5FJH A;  1W0N A;  1SPP B;  5KXB A;  4UBH A;  3FFQ A;  1ZBA 1;  3QH7 A;  5FMO S;  2WA4 A;  2E32 A;  1WWY A;  3K3N A;  4LEJ A;  2YC2 A;  5FZD A;  4QX8 A;  1QH6 A;  1RMU 2;  5IHR A;  3O0X A;  4EN7 B;  5A6X A;  5I0R A;  5C9A C;  1TME 2;  4ZS3 A;  3J8F 2;  3WQ7 A;  4N43 B;  1H2N A;  1FOD 1;  3O1S A;  1RUO A;  3KV9 A;  3N3H A;  1PGS A;  1US2 A;  4C1W A;  2FBE A;  3QBQ A;  3UJO A;  1RHI 3;  4KG8 A;  5FPV A;  5A3U A;  2XL9 A;  3OUH A;  2WJS A;  5J7M A;  2VVF A;  2WQ8 A;  5FXZ A;  4XIK A;  1VMJ A;  4YZ3 A;  3AXD A;  1YWK A;  3J9S A;  5JMC A;  1PIV 1;  1O3S A;  4IGQ A;  5EXO A;  4HVO A;  2AEN A;  3LPF A;  4NE9 A;  1J1T A;  1ULO A;  1HKD A;  4PDW B;  1BBT 3;  1ZBA 2;  4RQP A;  5FZC A;  4QQP A;  4NIH A;  4AWD A;  1OOP B;  5L7O B;  2VZQ A;  2VO5 A;  3HWJ A;  1HRV 3;  1QKQ A;  1HV1 A;  3J8F 1;  1EV1 3;  4OUM A;  4Q4W 2;  3S0M A;  1KDK A;  4A7Z A;  4ZU5 A;  4JKM A;  3A0K A;  3CDZ B;  5LA2 A;  4OUS A;  2WA3 A;  2CGO A;  3V0B B;  4NPL A;  3VBU B;  4DXZ A;  1AR6 1;  3IDC B;  2J22 A;  5JSP A;  3LEK A;  4W50 A;  5FY9 A;  3SCG A;  4ARX A;  1IS4 A;  1MS8 A;  1OHF A;  3B94 A;  3SC7 X;  4YGC A;  1QU0 A;  2XWB B;  5FZG A;  3U14 A;  3ZKU A;  1N1S A;  1XU2 A;  4YM0 A;  4BQ3 A;  2E7Q A;  1BK0 A;  1W8U A;  4NRM A;  4CSW A;  2BNM A;  4HVQ A;  4IE4 A;  3OOX A;  1LOF C;  4XJ8 A;  4QPI B;  1SBD A;  5C3R A;  4CU8 A;  2Y33 A;  1BEV 1;  4FI9 A;  5CYY A;  3R0R A;  2D44 A;  1NT0 A;  2QBX A;  4QQH A;  1PZ8 A;  1VBD 3;  4Q26 A;  5LK7 B;  5DAP A;  4YW5 A;  5I0D A;  5JXJ A;  1W28 A;  2DYC A;  5BNP B;  5EFU A;  3R4U A;  4LLO A;  3DYO A;  2QDR A;  4O7X A;  3ZYP A;  2ATF A;  4MSV A;  1BBT 1;  1I3H A;  1V6K A;  2JEN A;  1RUC 2;  3I59 A;  3NNF A;  1W2O A;  3FBM A;  4D94 A;  3AYC A;  5B2G B;  5FAX A;  1N47 A;  3FL7 A;  1H6X A;  1PIV 3;  4WM8 C;  1RJ7 A;  4LOT A;  1URX A;  3LKJ A;  5JR7 B;  2YGM A;  2OII A;  3GHN A;  4FAG A;  3C7G A;  3WDV A;  2WAO A;  4E2S A;  3LEI A;  2Q8O A;  1BK1 A;  1U0A A;  1WCK A;  4AI8 A;  3ZYJ B;  1RUG 2;  4IV3 B;  4IDZ A;  2W94 A;  4WZC A;  5A3M A;  4JV4 A;  4AF9 A;  2UYB A;  3R4D B;  2DF7 A;  3MFC A;  1JYV A;  2HYK A;  3O0W A;  4B7K A;  3OGS A;  1KQR A;  4AFB A;  1SHW B;  4GQ7 A;  2X29 A;  4FQ4 A;  4JAA A;  4NPR A;  3C7O A;  3OPT A;  2FQP A;  4HSJ A;  2ZHL A;  2WUH A;  3UJQ A;  2V5Y A;  3CKH A;  1CVN A;  4EQV A;  5DAW A;  1UZ0 A;  2BER A;  2H0V A;  3JB8 A;  1MZF A;  1OUX A;  2B46 X;  2HLE A;  2MHF A;  3I3E A;  4UYB A;  3ZPY A;  4BQW A;  4L92 A;  1GKB A;  3VBR C;  4R9C A;  2JDM A;  3WP3 A;  2RJ2 A;  1CIY A;  3MIC A;  2OZJ A;  4E4Z A;  4XJZ A;  5F39 A;  1V9U 1;  4Y1V A;  5JPN B;  1MQT A;  1YFY A;  2QQW A;  1UYP A;  3THD A;  4F83 A;  3TEZ A;  3VBS A;  1JUH A;  2A6W A;  5JOY A;  1YQ8 A;  1AR7 3;  3PU3 A;  3WP4 A;  2WR9 A;  3AVR A;  3RI9 A;  2XR4 A;  1UX6 A;  3O12 A;  2JDU A;  1UZZ A;  2PLV 3;  2RG4 A;  3W5M A;  3MLK A;  3ACI A;  2R04 2;  4IE7 A;  4W6Y A;  5EP9 A;  5FUN A;  1O6U A;  1RUD 3;  3M4F A;  4CUC A;  5BNN B;  4XQD A;  2PHX A;  5KR7 A;  1FYU A;  2ZOE B;  4IEU A;  4P9W A;  1G9B A;  3B93 A;  3OY8 B;  5FP7 A;  5FWE A;  1PK6 A;  4AED C;  4DY3 A;  1RUG 3;  3DV8 A;  4QAW A;  3ROU A;  4HVR A;  3E6B A;  2WO3 A;  4HSL A;  2YPD A;  4I0A A;  2PA7 A;  3LFI A;  1WLW A;  4A3Z A;  2Y6K A;  1D0G A;  1UN1 A;  4OCT A;  4NAO A;  4XFG A;  1EAH 1;  1OF4 A;  3EXU A;  4OLL A;  1YQ2 A;  4UAP A;  2JG8 A;  5SV8 A;  3PTR B;  1HRI 2;  1XNK A;  4G3Y C;  5BNO A;  1RUH 3;  2PHF A;  3IMM A;  5C3P A;  3TOJ A;  3PME A;  1WD3 A;  2OX0 A;  3UNP A;  4QDQ A;  1ULF A;  2VPV A;  3IPV B;  1GOF A;  1WBL A;  2J1S A;  3AL6 A;  3WOG A;  3KHC A;  2RR1 2;  1XSQ A;  2DDU A;  4U2A A;  3RYP A;  2TUN A;  4FPC A;  2EXK A;  1KFX L;  1ZZB A;  1FX5 A;  2OA2 A;  4NHY A;  4LBL A;  2CV6 A;  2WAB A;  5EYX A;  3VBF A;  5L9V A;  1QJU 1;  4JC1 A;  4A7K A;  3ZN4 A;  2BGC A;  3ZXG A;  1DGL A;  2ARE A;  1F8V A;  5FXX A;  1D4M 2;  2DWR A;  4GJZ A;  5FZ4 A;  3BTY A;  1ODN A;  2VH9 A;  1EAH 2;  3MW3 A;  1UO9 A;  1PGW 2;  1C57 A;  5JXI A;  2XDV A;  5LY2 A;  2QDN A;  3FE5 A;  5A7Q A;  1UCX A;  1XXN A;  5IVB A;  4GD4 A;  3VN4 A;  4D6R A;  2F4P A;  2FCT A;  3K4Z A;  4KGG A;  2ZGK A;  2WZE A;  3NNG A;  3WV6 A;  1FPN 3;  2V09 A;  3VD5 A;  2E26 A;  1LEC A;  1XC6 A;  1NCR B;  2F17 A;  4IEW A;  3THC A;  1JUI A;  4DS0 A;  2A70 A;  3MW2 A;  1JYI A;  5TSW A;  1QXJ A;  5EWS A;  4FAH A;  2C9K A;  2KR2 A;  5GZF A;  5KXC A;  2ZGQ A;  4XJ9 A;  1E5H A;  2ZBJ A;  2D6O X;  4LE4 A;  4QPG A;  1OPO A;  2WT1 A;  2D6L X;  3WHT A;  3H42 B;  2JDZ A;  4H14 A;  2E9Q A;  4OI1 A;  2NP0 A;  1AYM 2;  2PEL A;  3GF6 A;  4WM8 B;  2Q8C A;  2VC9 A;  3LA2 A;  1VB4 A;  4CCK A;  4S2G A;  3H9A A;  3POG A;  5CNA A;  3NKT A;  4COU A;  4LE3 A;  3ETQ A;  2AR6 A;  1G9C A;  4LO6 B;  4MGS A;  4I02 A;  4IND A;  5J98 B;  1SLL A;  5BV6 A;  3ZDS A;  3SMH A;  5LB6 A;  2ZXQ A;  1YQC A;  2HWE 3;  3RZH A;  1LEM A;  1VIW B;  2G19 A;  2GC2 A;  3HPN A;  1S0I A;  4LBM A;  3UT0 A;  2BP6 A;  2ETE A;  2ARX A;  2CY6 A;  2OPW A;  3HN1 A;  1YIF A;  1JZ3 A;  4UW3 A;  4J1W A;  1ND2 C;  1FXZ A;  4XCA A;  3VKN A;  4CRQ A;  1JS9 A;  2HYX A;  3JZV A;  3LSE A;  4NR1 A;  2VMI A;  5FK7 A;  2W92 A;  3GJB A;  5FFO C;  3VZM A;  4Z2A A;  3MDP A;  2W52 A;  5KWR A;  5DDJ 2;  5LW9 A;  4YFZ A;  1TME 1;  1IQA A;  2MNG A;  1C1L A;  1H9P A;  3EYP A;  5FPB A;  4PQ9 A;  1EV1 2;  3MLL A;  5T55 A;  1OA3 A;  2EVX A;  4CE8 A;  1QMJ A;  3AZW A;  3JBG 3;  5FZF A;  4BME A;  2FHR A;  2RM2 3;  1NXD 1;  1LHU A;  2DFB A;  4HBN A;  3SHR A;  2GAL A;  2V5D A;  2WWS A;  1JYC A;  4CDX A;  2ZAH A;  4LNV A;  4Q0V A;  1J58 A;  5FZ1 A;  3PJQ A;  2XBO 1;  1ND3 C;  3AYD A;  3M3I A;  4Q4Y 1;  5HCB A;  2RM2 2;  3VL8 A;  5I8T A;  2IVJ A;  3ZFF C;  2D98 A;  1TZO A;  4XAC A;  2HWF 1;  3NVC A;  3ZKY A;  4D7S A;  3O1R A;  4XUN A;  5ABJ C;  1R1Z A;  2Z4F A;  4CP9 A;  1E5I A;  1S0B A;  2IXK A;  5IVJ A;  4OI4 A;  5FZO A;  1W9Y A;  4N7U A;  2YDE A;  4GMP 1;  2RS3 1;  4NRQ A;  4UBG A;  4A2U A;  1LU1 A;  2AH2 A;  1V6J A;  3RG0 A;  4BOW A;  1CES A;  1UAI A;  1LEN A;  1IPK A;  2RV9 A;  2JIG A;  4Q4W 1;  1Y4W A;  5J48 A;  4K9S A;  3JU9 A;  1TQ5 A;  1RUE 2;  3T0B A;  1M4W A;  1DP0 A;  2JG9 B;  2WFP A;  4CXY A;  4MOA A;  1APN A;  4CPB A;  4LHS A;  2XVK A;  5C9A A;  2QFE A;  2BV4 A;  2Y6J A;  4XF1 A;  3PUQ A;  3SNM A;  4BMB A;  5LEJ A;  1DG6 A;  1J3R A;  3ATG A;  5I0U A;  2HWB 1;  1NE6 A;  4X8P A;  5FYC A;  2C6S A;  2VU9 A;  1JU3 A;  5ERL A;  2B4K A;  3WF2 A;  5K8S A;  3D3A A;  3EHK A;  4TYS A;  3G7D A;  2J7M A;  1DBN A;  2P34 A;  1UZY A;  2OS2 A;  2K0G A;  4UFL A;  2HWF 2;  4MGT A;  2R16 A;  3RYR A;  1VBA 3;  5B4X A;  4K3U A;  3VBR A;  1JOD A;  1JYT A;  2VNV A;  4Q27 A;  1H2M A;  2W68 A;  3PUH A;  3THP A;  4ISR A;  2WII B;  2Y8K A;  1LHW A;  1PZ7 A;  1YI9 A;  2ZGP A;  3BVC A;  3Q8F A;  3TYJ A;  4XOG A;  2CHH A;  1PX3 A;  4LKD A;  1YYN A;  4YLZ A;  5E1R A;  3SCF A;  2XJR A;  3I49 A;  5FZA A;  3A22 A;  3NNL A;  3MYX A;  1B35 B;  4JRL A;  1XE7 A;  2ZEY A;  4IGO A;  4BLJ A;  1G9A A;  3USU A;  4UFH A;  1NA1 A;  1QDC A;  3T3Y A;  1Q56 A;  1RUC 1;  3IWZ A;  5A7W B;  3CZJ A;  4YAR A;  1TMF 2;  5CFC C;  4JKL A;  1KGY A;  5JAX A;  4O65 A;  2XH6 A;  1DZQ A;  2YBK A;  3OD4 A;  2VOV A;  3VB9 A;  4EN8 B;  4D6S A;  3ZXA C;  5CVR A;  4QHO A;  5ACA 3;  3IKW A;  3ZFE C;  3O1O A;  5FQ0 B;  1FAY A;  4LHL A;  3CLP A;  4QKN A;  3PNA A;  4BK4 A;  2Y0I A;  3V0A A;  5I8S A;  4K8F A;  5ANQ A;  2Z2S B;  5K4L A;  3WDY A;  4DPN A;  4H3W A;  1LOE A;  4AXO A;  3RMX A;  1GQH A;  3ZOI A;  2BDR A;  2GNT A;  4GUL A;  1V6L A;  2ENR A;  5L9B A;  4NHM A;  2VZV A;  2GDF A;  3WNL A;  4YW7 A;  4UWD A;  2B39 A;  4BB3 A;  2HWC 3;  2VW2 A;  1HQL A;  2WDB A;  4XUT A;  1WKY A;  1SDW A;  5CU1 A;  3ZLI A;  4JX0 A;  4JGY B;  5C8C B;  4PI0 A;  4X8N A;  5FLI A;  1FV3 A;  5FWJ A;  3WNP A;  2OPK A;  2RS5 2;  3B9C A;  5LBE A;  1WW4 A;  3VDD A;  1W3V A;  3IB3 A;  4LTA A;  4DUX A;  2XJQ A;  4NMI A;  3KV4 A;  4Q1P A;  1ZRR A;  4FFG A;  1LGB A;  3LA3 A;  1GZT A;  1DYP A;  1EAH 3;  5FMC A;  3RDI A;  1ZM1 A;  2J1E A;  5FZ9 A;  5A3O A;  2BVB A;  1W04 A;  2VY0 A;  3JUU A;  3ZXL A;  5FBZ A;  4M3C E;  5CAD A;  2Q1Z B;  4P9Y A;  4AI9 A;  4BE3 A;  1W6N A;  2J1U A;  4K20 A;  3OF1 A;  3ZN6 B;  5LCW L;  2BVV A;  1O8S A;  2VMH A;  1WW5 A;  4JTN A;  4BCU A;  3ZR5 A;  3CF6 E;  1UIJ A;  4ZHN A;  2ZEX A;  1VBE 3;  2BZD A;  3EMR A;  2HWC 1;  4ATE A;  4NHL A;  2CGN A;  1QQP 2;  4ZKT B;  1O3R A;  3C3V A;  1GU3 A;  1RUE 3;  2RR1 3;  3AMH A;  1OH4 A;  1RUD 1;  5HXV A;  4YW4 A;  4QX7 A;  3VD7 A;  2D3S A;  1AF9 A;  5IAX A;  5H9P A;  3ZXD A;  3ZYH A;  2ZMN A;  4BXF A;  4JQR A;  2DVA A;  4ORF A;  1QJU 2;  3WNN A;  4QMA A;  4AK3 A;  1UYZ A;  2RS5 1;  4BIO A;  1GZ9 A;  1HIX A;  3VBH B;  4YM2 A;  1IG0 A;  2ZML A;  3HN3 A;  4Y4R A;  1V9U 3;  4QB6 A;  4NHX A;  4CCL A;  2WS9 3;  1Z78 A;  1AHS A;  4PHZ A;  4DXS A;  1CR7 A;  1QJX 3;  4K7J A;  2WLP A;  1CON A;  1GIC A;  2EXJ A;  4MH0 E;  3AVS A;  4R9A A;  1N1T A;  3PLQ A;  5BUV A;  3M3E A;  4EWA A;  2GH8 A;  3I2H A;  1R08 1;  2ZKL A;  4JDM A;  5FYY A;  5J09 A;  2O14 A;  1UD1 A;  4AGV A;  3LDK A;  4EN6 B;  3G6J B;  1GFF 2;  3OBR A;  3U4X A;  2PHT A;  1HB2 A;  2GND A;  4LBN A;  3W21 A;  2FZ2 A;  3IM0 A;  1HRV 2;  1PO2 2;  4Y20 B;  4MLO A;  1GQP A;  1CAW B;  1X9T A;  5E88 A;  2W0X A;  4CCM A;  1DCS A;  2V4A A;  3CU7 A;  3LEG A;  3T09 A;  1GUI A;  5AFB A;  3K3O A;  2VUJ A;  4NPM A;  1JI6 A;  4XJW A;  1W05 A;  1BCX A;  3ALQ A;  4HK9 A;  3HT1 A;  3J7L A;  2Q30 A;  3OBZ A;  3I8T A;  3ZSM A;  4H7M A;  3ZYB A;  3IT8 A;  4PIZ A;  1SLA A;  3SEP A;  3O7O A;  4Q4X 1;  5HV4 A;  1XOY A;  2VNG A;  4W4Z A;  2ZZJ A;  4HL0 A;  3GBF A;  4FP2 A;  5GM0 A;  5F6K A;  5FP9 A;  3W20 A;  3MF6 A;  3WG2 A;  3VDD C;  1HRI 1;  3FZ3 A;  4AFA A;  1QJF A;  4TN7 A;  2XHK A;  3H7Y A;  2GC3 A;  3LCP A;  1HB1 A;  5JZG B;  2B9V A;  3HBK A;  3C8X A;  4C91 A;  4ZZ5 A;  5BNN C;  4XUR A;  4C0B A;  4XVH A;  5F6L B;  3BGA A;  5FY7 A;  3SIS A;  4BJ0 A;  4UOJ A;  1IQD C;  3AJZ A;  3E6C C;  3ZMO A;  1PGL 2;  1D0H A;  4PI2 A;  5GAL A;  2XJU A;  3RJR A;  1XND A;  2W5F A;  3LE0 A;  4GMP 3;  4NO4 A;  2VCB A;  4QX1 A;  4M01 A;  3UK9 A;  5A3P A;  4DNY A;  1ENS A;  3ZSE A;  3FLT A;  3ACL A;  2W87 A;  4OMC A;  1DYK A;  3VDB A;  3TEY A;  1BHG A;  3AK0 A;  4UT5 A;  4FCA A;  2NQY A;  4Q0S A;  4ET7 A;  2W1U A;  2W39 A;  2VD7 A;  3KD4 A;  4M0H A;  4FTS A;  4OVE A;  1DHK B;  4ZON A;  2WBK A;  4KWU A;  2PAE A;  1CJP A;  3T4V A;  3VHN A;  4AQT A;  1L3J A;  1NZC A;  1SFP A;  1X82 A;  2RM2 1;  4ES9 A;  3VBO B;  4JCK A;  3OY8 A;  1JYX A;  4XXP A;  2FD8 A;  1W8Z A;  5D8A B;  5FYU A;  4CCN A;  2R1D A;  2R6Q A;  1AYM 3;  1SLT A;  3HAG A;  4ES8 A;  1UPS A;  1ZRE A;  4J6G A;  3W9A A;  2EIB A;  2RS5 3;  3H3U A;  1GMM A;  4YZ4 A;  4XBL A;  2BNO A;  1DQ2 A;  4P5H A;  4E4S A;  4P5Y A;  5DQ0 A;  1QDO A;  2D93 A;  5FUP A;  2W1W A;  1KRI A;  4OZO A;  4MAD A;  1OFN A;  2VTX A;  3GJA A;  3GHM A;  2K2S A;  3MF9 A;  2BNN A;  1RUE 1;  1AX1 A;  2IXH A;  2BU9 A;  4UW4 A;  2XJS A;  4OI2 A;  2BWA A;  1EUT A;  2LRP A;  1COV 3;  3I2D A;  1ULP A;  4MET A;  4YVW A;  1D2S A;  1LKN A;  4UF0 A;  3VZK A;  1N1V A;  2PN5 A;  4TLG A;  5EZW A;  4IEP A;  4SLI A;  4UFI A;  4NN0 A;  5F5I A;  5G04 L;  3H8X A;  2XGX A;  4IES A;  1UKR A;  1S1A A;  1W8F A;  2ARB A;  4FPH A;  4XAE A;  4EYU A;  2FDK A;  1PVC 1;  1SFY A;  3SCH A;  4XF3 A;  2XON A;  3P5B A;  5FCC A;  1WGP A;  1HN0 A;  1QOS A;  1C5H A;  4CP9 B;  3WP6 A;  4LO5 B;  4F3J A;  2P3J A;  5A1A A;  3CJX A;  2JDK A;  1JZ2 A;  3DXT A;  5IUQ A;  4DFS A;  1WW7 A;  4LMF A;  4QX5 A;  1Q8P A;  4PLM A;  3ACH A;  5DDJ 1;  5JWP A;  4PT6 A;  4RA0 A;  1VJ2 A;  1WCU A;  2JB4 A;  1XYO A;  1PHM A;  2I45 A;  3K48 A;  4I30 A;  3HNY M;  3RZG A;  4YWA A;  3S5A A;  1AYN 3;  1REE A;  4W65 A;  4FP3 A;  4XDP A;  5FZI A;  3WT3 A;  1NE4 A;  3ZVX A;  4OZX A;  5FXW A;  1YUD A;  3ETP A;  3K4A A;  2VZT A;  1GWK A;  1VB2 A;  5DUW A;  4DOU A;  2WLQ A;  2NMO A;  5ABJ A;  3HT2 A;  4HAN A;  2DCJ A;  3PVE A;  2O8O A;  4WZF A;  4E4H A;  2R07 1;  1DQ4 A;  4K1Z A;  3VKM A;  2HWB 2;  5T50 A;  4D69 A;  2WNV C;  2CWS A;  2LUW A;  5IVY A;  3GZU C;  4Y22 A;  4DEQ A;  1BVV A;  1YXW A;  1PVC 2;  1QXR A;  3J7N A;  3N7K A;  3U10 A;  1AR9 1;  3A21 A;  2WSU A;  1UOB A;  4ASK A;  5C8W A;  1SQ4 A;  1HQN A;  4EN9 B;  1YFU A;  3AP7 A;  3I3Q A;  4CDX C;  4KL1 A;  3KVB A;  3K75 B;  3KQR A;  3INA A;  4R52 A;  5H9S A;  3B01 A;  3HJR A;  3Q9O A;  4MGZ E;  5F7U A;  2E6V A;  2X53 S;  2HJI A;  2ZHN A;  1YHF A;  1PO1 3;  1KEX A;  2Z79 A;  3ILR A;  5IJR A;  1OQD A;  4NRP A;  3UES A;  2GN3 A;  5LA0 A;  5JMO A;  4HK8 A;  2WO1 A;  3H0O A;  1XNA A;  5E89 A;  1I6X A;  5LBC A;  1LAJ A;  3FC0 A;  1OUS A;  4GH4 A;  2JJ6 A;  1AR7 2;  3RPQ A;  3TN9 2;  5IK7 A;  2DU0 A;  3L2Y A;  2D6K A;  2JD4 A;  5T5O A;  2HEW F;  3URF A;  1VBB 1;  3FHA A;  4HLT A;  4P9J A;  4YZ1 A;  3RMY A;  1UIK A;  4XFB A;  4Y5Z 0;  1SZB A;  5AVA A;  2WNU B;  2VMD A;  4E27 A;  3T4H B;  2HWB 3;  1GP6 A;  1OLM E;  1Z0H A;  5GZC A;  4A3X A;  5CBL A;  1C1F A;  1OOP A;  2VMC A;  5L7O A;  4RQP B;  2CU5 A;  1P8J A;  4AR2 A;  4BQ4 A;  5CKN A;  4CEW A;  3POE A;  5GLV A;  4CCJ A;  4MGI E;  1OH3 A;  1W6M A;  1A3K A;  2BOJ A;  4P14 A;  1JYN A;  5C33 A;  1QHD A;  4BPZ A;  1DU3 D;  1KS4 A;  4YW6 A;  2PMW B;  3TB0 A;  2PLV 1;  3NV3 A;  1GZC A;  4I0B A;  1WA4 A;  5EYY A;  3AKS A;  4IEZ A;  2UWB A;  4RGG A;  1ZRD A;  1G6N A;  1RYY A;  1GOG A;  2JDN A;  1SMV A;  1AR7 1;  1PM4 A;  3CJI B;  4ASL A;  3V65 A;  4QXH A;  5A80 A;  4GB3 1;  3WW3 A;  1RXG A;  1M06 G;  2X09 A;  4AI2 A;  2VNO A;  4XYX A;  1LJ7 A;  2XLF A;  1D2Q A;  1NA1 C;  2NZ9 A;  2WKK A;  4PCR A;  4KU7 A;  4QX0 A;  4P02 B;  5LBF A;  5EJ1 B;  3BU0 A;  2E33 A;  4BQ5 A;  1K12 A;  1RUF 3;  3IMN A;  1JXN A;  5A7O A;  4Z07 A;  2A3X A;  3GCW A;  1WW6 A;  3B3Q E;  3QD6 A;  4BQ1 A;  3BIE A;  3WNM A;  3M3Q A;  4QB2 A;  2X05 A;  3U1X A;  5C71 A;  1G9D A;  4JRA A;  1E5S A;  1VBD 2;  3I97 A;  1RUI 3;  1I5P A;  3IAQ A;  2X5I B;  4ERO A;  5C3O A;  3OPW A;  5IFP A;  4LLF A;  3BI3 A;  5GLZ A;  4BQ2 A;  2ZGR A;  4IE5 A;  1JHJ A;  1DGW X;  3HQX A;  3KSC A;  5LAS A;  2D7F A;  1GZW A;  5K7P A;  1BBT 2;  3ZO0 B;  3V64 A;  4B7E A;  1JOJ A;  1XBF A;  3FLP A;  3KT7 A;  4B8E A;  3RS6 A;  2VAU A;  2YMZ A;  4GB3 2;  2MEV 3;  2PTM A;  4OFG A;  3AMM A;  2D3R A;  2ZHK A;  4MUV A;  1QNW A;  1UY0 A;  1ONA A;  3MIF A;  2K46 A;  2WC2 A;  1CAW A;  2IC1 A;  1XE8 A;  2GNM A;  2W9X A;  3WDU A;  4EE2 A;  3BTX A;  1UF2 C;  3IAP A;  2XL7 A;  1Z7S 1;  1J84 A;  2VZ3 A;  5FZE A;  5FOJ B;  4RS5 C;  1H4H A;  2CNA A;  3NST A;  3WD5 A;  5FY1 A;  4ONU A;  5FRA A;  4JDO A;  1W8H A;  3RZM A;  2DCY A;  3FUQ A;  4QX2 A;  4CP1 A;  2GZW A;  3HBZ A;  2YGL A;  4RQP C;  2Q8E A;  4JZR A;  4XZU G;  3LA7 A;  3J7H A;  4LK6 A;  4YG6 A;  2Y64 A;  4E2G A;  1RB8 G;  5FYZ A;  2VOW A;  1OMI A;  2A75 A;  1BVP 1;  1W8T A;  3DEC A;  3N9Q A;  1PK6 C;  2IXL A;  2LAL A;  2OVU A;  4FOW A;  2QQP A;  3OGJ A;  4CU7 A;  3WHU A;  2WWJ A;  5FPL A;  4RFT 0;  3NAP C;  2Z42 A;  1FPN 1;  3I2F A;  5DUU A;  3RJ2 X;  3S7I A;  1ZRC A;  1LRH A;  3GNE A;  3BPS A;  3KF3 A;  3RZZ A;  1NLQ A;  4RN5 A;  1NCQ C;  1TNF A;  3VL9 A;  5D21 A;  4DY5 A;  1RTV A;  3AKP A;  1ZA7 A;  4WM7 B;  4OHX A;  4GZ9 A;  4LIU A;  5BNO C;  2Y34 A;  1V00 A;  3BYW A;  3ZR6 A;  4LBQ A;  3K77 A;  4YVW C;  5CB7 A;  4LOR A;  3U75 A;  1BJQ A;  2HBU A;  2OQ7 A;  2VOT A;  5JOW A;  3SKJ E;  3J8F 3;  1AXY A;  2ZGS A;  2J1A A;  4IQP A;  5FPZ A;  1ZNP A;  4CP2 A;  2ZPX A;  3H8U A;  1I5Z A;  1O5U A;  1I9R A;  1ULC A;  2GN7 A;  4K6B A;  4PLO A;  2WFF 2;  2BGO A;  4MVT A;  3EO6 A;  1F4H A;  1VBC 3;  2HWD 2;  2QQJ A;  3N9L A;  4MYE A;  4QGN A;  4XQW A;  4HKO A;  3V56 A;  4CTE A;  1KIT A;  1A6C A;  2HKX A;  2GNB A;  4XDQ A;  4KWL A;  4A6S A;  4COW A;  3CBN A;  5CIS A;  1UMI A;  3AZY A;  4X6R B;  1GLH A;  3AZV A;  3WP5 A;  5C8C A;  2YUE A;  1N1Y A;  4GAZ A;  1HX6 A;  3ST7 A;  4YGE A;  2VUA A;  5T5J A;  4BZ4 A;  1OFS A;  2IFR A;  2C1F A;  2ADE A;  3AMP A;  4D7Y A;  1BKZ A;  4CDU A;  1GBG A;  4L8Q A;  5JOZ A;  2D5F A;  2A5Z A;  4Y1Y A;  1QNY A;  3ES1 A;  4XFH A;  3VBR B;  2MEV 1;  1ZZ6 A;  5JDB A;  5KHG A;  3IIA A;  4FPK A;  5DG2 A;  3NWK A;  3WDW A;  4MG2 A;  4BLI A;  2CYF A;  1CIW A;  4YZ2 A;  1KJL A;  4AAP A;  5FO9 B;  2WAA A;  5GLW A;  2EIC A;  1VR3 A;  1OKO A;  1V6M A;  2PHL A;  2VW1 A;  5GZG A;  5M0T A;  2JDY A;  4I3P A;  1UOG A;  4QXB A;  3VHO A;  2YRO A;  3M8L A;  1K45 A;  5A6Y A;  2BTV C;  4KH9 A;  3KS7 A;  4R4X A;  3QAC A;  2JB8 A;  2JDA A;  4QPG C;  1AL2 2;  4QWN A;  1CJD A;  1NQD A;  2ZAA A;  2XKP A;  1NA1 B;  1HB3 A;  5IWF A;  3BOP A;  3R05 A;  1PMI A;  3SEE A;  2HWE 2;  1PM7 A;  5FYT A;  1YCI A;  1QJY 2;  5T5L A;  2XOM A;  4BQY A;  1H2K A;  5J3U A;  2BUK A;  4GWN A;  4H7L A;  5E16 A;  3O1T A;  2CL2 A;  3O1M A;  2DBN A;  1TEI A;  3DEM A;  3BUC A;  5FKC A;  1J83 A;  4ZS2 A;  2XHN A;  1KFU L;  4NWV A;  4XE9 A;  3P3N A;  1YJK A;  2VE1 A;  4LK7 A;  2G9F A;  3POI A;  2E7T A;  3NRU A;  4Y22 B;  1LOD A;  3W58 A;  4WM7 A;  3K51 A;  5A70 A;  5FZB A;  2XUM A;  4CDX B;  1OKQ A;  4GWM A;  2YC0 A;  4L0P A;  1A78 A;  4TWT A;  5K9Y A;  1ULE A;  3VLB B;  5DZG A;  3RZL A;  5ANN A;  5T52 A;  3OJB A;  1LED A;  1HJG A;  1IG3 A;  2FDF A;  2WIN B;  5DAB A;  4CDQ B;  2ZX1 A;  3MFA A;  1MR5 A;  3RFR A;  3FJS A;  2ZKN A;  4LA3 A;  1UOJ A;  4D3W A;  1D4M 3;  4UFJ A;  1OSG A;  4W8J A;  4AVS A;  5HPO A;  4AVB A;  4H55 A;  3S6P A;  2B42 B;  1FAT A;  1TVG A;  4EZ4 A;  5BY5 A;  1MZE A;  4FPO B;  1BYH A;  3DN7 A;  1TMF 3;  3H50 A;  5JIA A;  4CUB A;  3J7M A;  2KA3 A;  1QJZ A;  3DPR C;  1JH5 A;  2GH2 A;  5HV0 A;  1JU4 A;  4PLN A;  2QQI A;  2WNV A;  1LGC A;  4AL9 A;  3FMG A;  3U37 A;  1UZW A;  2H6C A;  4FOV A;  4HT1 T;  4IV1 B;  4XUP A;  5A7N A;  3VGI A;  5GKA C;  3FWE A;  4TZD A;  1VMF A;  3TN9 1;  4AVA A;  1BEV 3;  2Z5W A;  1FNY A;  4WVZ A;  4WM8 A;  3VZJ A;  4IV1 A;  5IFT A;  1NLR A;  4C1X A;  1JOP A;  1XNC A;  2R07 2;  4XUQ A;  4MGK E;  1O91 A;  1ENR A;  3WDT A;  3WQ1 A;  1CZT A;  1KXG A;  2QVS B;  3WDX A;  1EP0 A;  1RIR A;  4JGZ C;  3BAL A;  2D6M A;  3KCX A;  2ZJC A;  4B4Q A;  4WVW A;  5A1L A;  5L36 A;  1QJY 3;  5A33 A;  3AL5 A;  2BYV E;  2R07 3;  5B4N A;  5JVV A;  3NJY A;  5D8A A;  5FR3 A;  4FTE A;  2EAA A;  1T2X A;  5KHK A;  1AR6 3;  3MIG A;  2WFF 3;  1R09 1;  3VBO A;  1GQG A;  1RED A;  3BCW A;  3M3O A;  5JPM B;  2HH9 A;  5FV3 A;  2Y26 A;  3UKT A;  5J36 A;  3WCS A;  2HEY F;  3WQ0 A;  3Q8C A;  4YG3 A;  1X8M A;  2E31 A;  1Q8Q A;  4BA6 A;  4DIQ A;  4FT8 A;  1Q8V A;  4YFW A;  3LB9 A;  5F5C A;  2OT7 A;  1MAC A;  3MUY 1;  1JW6 A;  1X8E A;  4XFF A;  1RUJ 2;  1RVF 2;  1MS9 A;  4N9H A;  1HRI 3;  1G86 A;  2GMM A;  3LWC A;  3P3P A;  3T1L A;  3MZH A;  4EN0 A;  3VBS C;  1L7R A;  2QCS B;  4FFH A;  3VDA A;  5A3T A;  3WNX A;  3KZ4 C;  2VZ1 A;  2R06 1;  2UY8 A;  3I2G A;  4FFI A;  4Q8L A;  4XBN A;  5IK8 A;  1OVP A;  1WLC A;  1DF0 A;  2W95 A;  3LDB A;  4PF1 A;  2BFU S;  1JZ8 A;  1LHN A;  3GYD A;  1HJF A;  3FFZ A;  2VME A;  3AFG A;  4R9D A;  3LEM A;  4AED A;  4B4P A;  4PJY A;  1C8M 2;  3WW1 A;  1FMD 2;  1QQP 3;  3HQU A;  1JOB A;  4XTM A;  2H0B A;  5DN2 A;  3POY A;  4ARY A;  1TG7 A;  4RS5 B;  3O1V A;  1R08 3;  2XLA A;  2XXZ A;  4XQ4 A;  4WBB A;  1S2K A;  5EHD A;  4DUW A;  4B4R A;  4N53 C;  2JG8 C;  3LZZ A;  4COY A;  2WNU C;  3PU8 A;  5JZG C;  4IV1 C;  3T08 A;  2ZEW A;  1JHN A;  4QPI C;  1LUL A;  1ZZ8 A;  1POV 3;  1AR8 2;  1JN2 P;  1OA4 A;  1OQ1 A;  5J96 B;  2LS6 A;  2ZTN A;  2XQR A;  5IVV A;  3I2K A;  2P2K A;  4MXV A;  1IPS A;  3W5N A;  3IPV A;  1NX9 A;  4RHV 2;  1S0J A;  1ULG A;  2P17 A;  3GCX A;  1AL2 3;  2WQ4 A;  2D6N A;  1PO2 1;  2RR1 1;  2GP3 A;  3M70 A;  4AHZ A;  3WEZ A;  2ZGL A;  4OYU A;  3ACG A;  3VBU C;  1NQJ A;  4UFM A;  3E1F 1;  1AJK A;  2RS1 3;  1RL3 A;  3GAL A;  1MS3 A;  4IGP A;  5JR2 A;  1GWM A;  1XNT A;  1RUF 2;  3H7J A;  3N9P A;  1SLC A;  3MV0 1;  4XJU A;  1BLZ A;  4Z82 A;  5LK5 A;  3I3D A;  5A7S A;  5A32 A;  2G9Z A;  3LIG A;  3ZIW A;  3TNP B;  1W6O A;  4QXK A;  1FPN 2;  2D3P A;  4YPJ A;  3JD7 1;  3WF3 A;  1AJO A;  1AL0 G;  2JKX A;  4CVU A;  3NJX A;  4PIY A;  3SQO A;  5FO7 B;  1AXZ A;  3HIF A;  4RGA A;  5JLV A;  2FDI A;  4IW3 A;  1R64 A;  2G1M A;  2DUR A;  3KT1 A;  4ZY9 A;  3UL2 A;  5IK4 A;  4ASM B;  2BEO A;  4Q5O A;  1VPH A;  2ORX A;  1CAV A;  2RDQ A;  2KM2 A;  2DCZ A;  1DQ5 A;  3BB6 A;  2DFC A;  3O5S A;  5FJK A;  3KHB A;  1IS6 A;  4LBJ A;  4QXC A;  5HCF A;  4F7Z A;  1OI6 A;  4OQ9 A;  4QQL A;  1QH7 A;  3N7L A;  3N9O A;  2WO2 A;  3BOW A;  4LO7 A;  4CZS A;  2I74 A;  3IDB B;  4PF5 A;  2WYF A;  3E97 A;  4AI3 A;  1WD4 A;  1R09 3;  2WFF 1;  1VAL A;  2GSY A;  4CCO A;  1E5R A;  1YI7 A;  2ZGM A;  3MUZ 1;  5A32 B;  2ID4 A;  1RUI 2;  3ZXE A;  3I59 B;  3VBH A;  3ES4 A;  4HON A;  4BWO A;  5IAV A;  3KM5 A;  4D6Q A;  1J59 A;  3SH4 A;  3ZFE B;  1Y9M A;  1H1M A;  4WM7 C;  3WUC A;  3N35 A;  1K5J A;  1UY1 A;  4E8C A;  4OHY A;  3OUI A;  1RHI 2;  5BPX A;  5CFC B;  5FLH A;  3GZA A;  4Q0Q A;  2A3W A;  4IEY A;  2WS9 1;  4HZF A;  3ILF A;  4IV3 A;  2YPJ A;  4FBF A;  2Q1F A;  2FZ1 A;  1MS5 A;  1VP6 A;  4CCC A;  3WY6 A;  5FK8 A;  1B35 C;  1YIP A;  1YO8 A;  2TNF A;  3MBW A;  1PO1 2;  2WQZ C;  4QPW A;  5A3W A;  2W08 A;  4AFD A;  5C8C C;  3WNK A;  3R4S A;  4A44 A;  2QQK A;  4RFR B;  4FPL A;  3VZO A;  4EWD A;  1VAV A;  4G4F A;  1HW5 A;  2WZR 1;  3RSJ A;  3IN9 A;  4AEM A;  4MGQ A;  2EID A;  2HWD 1;  4MGY E;  2A1X A;  4PBO A;  3VBU A;  4BH9 A;  1W2U A;  1VBE 1;  2FCU A;  4ZPI A;  1D4M 1;  2QE3 A;  4YW3 A;  2PQQ A;  2C5D A;  2NN8 A;  5FY8 A;  4FPY A;  2R0F A;  2AZ5 A;  1H2L A;  5A6Z A;  2ZS6 B;  3MID A;  1QJE A;  2NMN A;  2R0H A;  1LTE A;  4QB1 A;  2QQN A;  2Y6H A;  4QGM A;  3ZXK A;  1NCR A;  1U5Y A;  1TE1 B;  1V0A A;  4XEZ A;  3K4D A;  2W91 A;  1C4R A;  1MZ5 A;  1UNB A;  1H8T B;  1W0P A;  5JI9 A;  1PGL 1;  2PHU A;  4XW3 A;  1JZ6 A;  2CSG A;  4I09 A;  3I4I A;  2RS3 3;  3ACF A;  3ZSK A;  2VNR A;  2VXJ A;  4DO0 A;  5FQ0 A;  1NOV A;  3E5X A;  3UKV A;  4C90 A;  3L2H A;  2Q4S A;  4TXW A;  2EAL A;  2XG3 A;  3H3Z A;  1RJ8 A;  2C4X A;  3DGT A;  1OVS A;  1H1A A;  4QX3 A;  4AHW A;  5D1I A;  3CJI A;  5BXX A;  4IE6 A;  4LIT A;  5FO8 B;  4AG4 A;  2JG9 A;  4I0W B;  1VBE 2;  4IL7 A;  2CGP A;  1OD3 A;  4K1Y A;  1EPZ A;  2XBO 3;  2DUO A;  4Q4Y 3;  4EV0 A;  5CG8 A;  4AVT A;  3AZZ A;  1IPJ A;  1IGO A;  1EYB A;  1W6M B;  2ORZ A;  5GZE A;  3WCR A;  3H1M A;  1DZR A;  1PIV 2;  1ZBE 1;  4AQ6 A;  2OKX A;  2VTF A;  2MPF A;  4L2N A;  5A33 B;  2P3Y A;  1Q3E A;  1RUN A;  1Q43 A;  1GOH A;  1R09 2;  1WCQ A;  4GWJ A;  3OGR A;  3MIB A;  2VZU A;  2WL1 A;  1OQE A;  4OHV A;  3JXS A;  3VD3 A;  5CAZ A;  1IHM A;  4QQO A;  4XBQ A;  3I2J A;  2P6C A;  3NNM A;  4OI0 A;  3AMN A;  2QNK A;  5ABJ B;  1O4Z A;  4NAM A;  2JWP A;  1HV0 A;  1JZ5 A;  1POV 0;  3OTF A;  2RMU 1;  4J25 A;  3AMQ A;  4GH4 B;  5C4W B;  4NUB A;  2VBB A;  2QKD A;  4Z92 B;  2DUP A;  4H2A A;  4Y5T A;  5HXM A;  4CU6 A;  2CAV A;  3ABZ A;  3SLI A;  3DF0 A;  3O0V A;  4XFI A;  1H1I A;  2R06 3;  4LUL A;  1FI2 A;  5FYS A;  2QQL A;  1UYX A;  5K0U C;  3L9J T;  2QQU A;  2AYH A;  5CFC A;  5A3N A;  5FZH A;  1QGL A;  1O5L A;  3AC0 A;  4GA9 A;  5IK5 A;  2IVI B;  3FN9 A;  4Y1X A;  1LOB A;  1QWR A;  3CMG A;  5JI7 A;  4JTO A;  4NII A;  1RMU 1;  4BK5 A;  1XNB A;  1ENQ A;  3DUI A;  3ZFE A;  5DAV A;  5AC9 3;  1LU2 A;  1OUR A;  2HEV F;  2QQM A;  2XQX A;  3E5U A;  3AJY A;  4FVV A;  4Y4Y A;  1DQ6 A;  4YVW B;  2LW8 A;  3CIH A;  4SBV A;  1Y9G A;  1W6P A;  1NKG A;  3ON7 A;  2VQU A;  2XJT A;  1ASJ 3;  1F9K A;  4WV8 A;  3O14 A;  3FBY A;  3U11 A;  1HXS 3;  1ND3 B;  1F5J A;  2VVE A;  3Q8A A;  3VBO C;  3H8R A;  4GH4 C;  3UGG A;  1G9F A;  5C3Q A;  2Y6L A;  3HNB M;  1CAV B;  5IVC A;  1AX0 A;  5IVE A;  4YZ5 A;  4P08 A;  4QQ2 A;  5BNP A;  3D8C A;  5CFD C;  1AR8 1;  4NID A;  1PMH X;  1W3X A;  2ET7 A;  5KC5 A;  2GC1 A;  2PHW A;  1DQ1 A;  1FT9 A;  1AUY A;  3PDQ A;  5G05 L;  3A4U A;  5FZ8 A;  3UET A;  3RQ0 A;  1GYK A;  3MPB A;  5CG9 A;  4BU2 A;  1RIN A;  4Z2W A;  2PAK A;  5JXH A;  1W6O B;  2O1Q A;  4QT6 A;  4WVV A;  2Y38 A;  4KQ7 A;  3T2P A;  4HG6 B;  1C8M 3;  3MIE A;  1PNG A;  2PQS A;  1GV9 A;  2GU9 A;  1GZW B;  1NXM A;  2ZCW A;  3F2Z A;  1Z7S 3;  2BJS A;  3BTA A;  1TME 3;  3GM8 A;  5F1R A;  5F3C A;  4ATF A;  3TBD A;  1WMX A;  1GR3 A;  1WZX A;  4AHY A;  3PIG A;  2YG0 A;  3W59 A;  4NIA A;  2ZMK A;  5GLU A;  1NCQ B;  5A7W A;  3RNS A;  4LT5 A;  3WF4 A;  3USU B;  2JEC A;  4Y5S A;  4QPG B;  5EPA A;  1LNS A;  2WNO A;  4HN0 A;  5FOB B;  1W9F A;  4IET A;  5FPA A;  1MVQ A;  3VKF C;  4EJR A;  1DLC A;  4XFA A;  4BQX A;  3POW A;  5LEK A;  3VBH C;  3MO4 A;  1SDD B;  2JE9 A;  2GME A;  3CQO A;  2X5I C;  4CDW C;  3PIJ A;  1L7Q A;  3ZN5 A;  4B1L A;  5AVP A;  1XJA A;  3ELN A;  1WME A;  3K46 A;  3GZE A;  1S2B A;  3CZU A;  3AP6 A;  4M3C B;  3ZFG C;  2XJV A;  5J1X A;  2PXJ A;  1FMD 1;  2BFU L;  5FUI A;  1DYO A;  2QQV A;  1K42 A;  4NHK A;  1SBE A;  4XFC A;  5FZ7 A;  3BKZ A;  2WYS A;  3B7M A;  1RUF 1;  1DFQ A;  2FDG A;  4AEJ A;  5JOX A;  4AZZ A;  5C9A B;  5C70 A;  2B45 X;  2W1Q A;  2VQT A;  5DXD A;  4XCB A;  3VD9 A;  1POQ A;  1CAX A;  3T2Q A;  2D6P A;  3BTZ A;  4CEW B;  4XDO A;  5HI0 A;  1STM A;  1CX1 A;  3WR0 A;  2JE7 A;  4GB3 3;  1W2T A;  2XKO A;  1UXZ A;  1HQW A;  1S0C A;  3OPZ A;  4X6Q B;  2P5B A;  3NMB A;  3WW2 A;  1JZ4 A;  1IZ3 A;  1A8D A;  2BW8 A;  4MHR A;  5FZ6 A;  2WS9 2;  1F35 A;  1W9T A;  3B69 A;  1QEX A;  3I3B A;  5FZO B;  2WNU A;  1WMD A;  1WLD A;  2C0Z A;  4GJY A;  3WF1 A;  5JZG A;  3O1U A;  1ENX A;  2HWC 2;  4GXL A;  4C8D A;  2UUR A;  3MPP G;  3SIT A;  4CPB D;  2EF6 A;  3I7D A;  3EQE A;  4DIN B;  1UL9 A;  1OLR A;  2AEZ A;  1L7L A;  4LBO A;  1K3I A;  3D0J A;  5CZK A;  5CEH A;  3T0D A;  5F32 A;  4KWJ A;  3WUD A;  2WT0 A;  5FDB A;  5ISL A;  2VUL A;  5I93 A;  4M4R A;  3N4M A;  2DBI A;  2CTV A;  3WG3 A;  1ZRF A;  1N3Q A;  3UGH A;  4EZH A;  1UXX X;  1H30 A;  2D43 A;  2VZO A;  1SPP A;  4P9G A;  1RUH 1;  2F4L A;  2H6B A;  3CJI C;  2J1V A;  1HDK A;  2QUO A;  2NLR A;  1QIQ A;  3AKR A;  4QHZ A;  2ZGN A;  3ZFG B;  1W0O A;  4M4P A;  2VMG A;  2Y60 A;  1O3Q A;  1SLI A;  3PUI A;  1PO1 1;  4CDW A;  1VBC 1;  2R30 A;  3TNQ A;  2VUC A;  4EWE A;  2DCT A;  2VXR A;  2QTW B;  1JTZ X;  2WT2 A;  1MQT B;  3ZFG A;  4A41 A;  1X9P A;  3NQH A;  4LA2 A;  5EV7 A;  3OYW B;  2A6Y A;  4BIS A;  1RIT A;  2FDJ A;  4AFM A;  3PMS A;  2Q8D A;  1SAC A;  2WNV B;  1PO2 3;  3KV5 A;  1AL2 1;  1MS0 A;  1SLB A;  4RHV 3;  5FYI A;  3M7A A;  2W46 A;  4R8H A;  2ILM A;  2ZHM A;  2OUH A;  2WSV A;  4KU8 A;  1W2N A;  4IEV A;  2VJX A;  4XAA A;  2VGD A;  2YFU A;  3LOB A;  1UKG A;  2BRT A;  2XJP A;  1X50 A;  3DKW A;  5FYB A;  4A45 A;  3KLS A;  1ST8 A;  5IYY A;  1UX7 A;  2NYY A;  1OT5 A;  3AYE A;  3N9M A;  1AYN 1;  1EUU A;  2D40 A;  4JGZ B;  2LM3 A;  4A7Y A;  5KHH A;  3ZYG A;  4FO9 A;  4XF0 A;  3RWN A;  2RVA A;  1RMU 3;  3UKN A;  4Y3O A;  2E53 A;  1K5M B;  3LFM A;  2K9Z A;  2OUJ A;  2WZR 2;  3AP9 A;  3D0S A;  4IV3 C;  1CZS A;  2R7E B;  2PHR A;  5EJ3 A;  2WWU A;  3K2O A;  3VDD B;  4JHT A;  4N8M A;  3C7E A;  3D5O A;  3QH6 A;  4LKF A;  5E6H A;  4L9B A;  1B35 A;  5F2W A;  3ZSL A;  4J1X A;  4XJA A;  4E9K A;  3PVO A;  4JGY A;  3GZT B;  5A1F A;  1ZA4 A;  5C5U A;  5FZ3 A;  2O0O A;  4XIO A;  3AFK A;  4CDQ C;  2QZ2 A;  2JD9 A;  1BQP A;  5LRR A;  1LB2 A;  2RDN A;  2P4E A;  4DXT A;  1ZBE 2;  2GC0 A;  3POB A;  1COV 1;  2B8M A;  1WA6 X;  2RMU 3;  2VVD A;  1UPI A;  5FY5 A;  3ZPO A;  3D4K A;  4KMQ A;  4YNI A;  2VCM A;  4AI1 A;  4UI9 L;  1ACC A;  4P9L A;  3E6D A;  1SFN A;  2Y6F A;  1J3P A;  3H1W A;  1CN1 A;  3J26 N;  4LJH A;  2YY1 A;  1UY4 A;  4O61 A;  5DAX A;  3GBG A;  1OBN A;  1IKP A;  1S0E A;  3KVA A;  4Q2F A;  3F95 A;  4YW1 A;  3APB A;  1YLL A;  3D82 A;  3GDB A;  5LAT A;  2RDS A;  3AP5 A;  1AYM 1;  1R1A 2;  4Q4V 2;  2F6B A;  2VBD A;  2VQ0 A;  2YC4 A;  4HMZ A;  1MS1 A;  1HLC A;  1Y7B A;  3LDR A;  3M3C A;  1ULD A;  1CPN A;  1NY7 2;  1CGP A;  2NM1 A;  1AR6 2;  4HET A;  5FY4 A;  3ZYR A;  3V0B A;  1WCD J;  1DQ0 A;  1MQT C;  1N3P A;  1MVE A;  2OYZ A;  5FBJ A;  3OGV A;  3MHZ A;  5FTT C;  2RDR A;  1J3Q A;  1QJY 1;  2DVG A;  2VL4 A;  5BNQ A;  4B3N A;  5DZE A;  4M0N A;  5C6C A;  4YGD A;  1PK6 B;  1XQN A;  2VW0 A;  1BMV 1;  1T6B X;  3NV1 A;  1COV 2;  4S2F A;  1NUK A;  4MX3 A;  4K21 A;  3DPR B;  4KBZ A;  4OUE A;  4CDU B;  2ZEZ A;  4NOT A;  4RL7 A;  1IOA A;  5JCT A;  2AAC A;  2EIE A;  5IVF A;  2I07 B;  2L9L A;  2VG9 A;  2XWJ B;  3I2I A;  4CUG A;  3IDE A;  2YZ4 A;  1UMZ A;  2B5H A;  4S2D A;  2VZR A;  4XPV A;  2BQP A;  1QOO A;  1OA2 A;  1SEF A;  1YQ6 A;  1ZZC A;  1EV1 1;  1UQX A;  4P00 B;  4XF9 A;  5JUV A;  4ITC A;  4BYY A;  2DVB A;  1GP5 A;  1R1A 1;  3LF7 A;  4PQQ A;  1OOP C;  3BOD A;  4Q4V 1;  5L7O C;  1CWP A;  2VEC A;  4M00 A;  4CEY C;  2WNE A;  1TMF 1;  5I8Y A;  2XML A;  3LOI A;  3OUJ A;  4Y20 A;  2VZP A;  1Q8S A;  1A34 A;  4LHK A;  5F9T A;  1OPM A;  2A6Z A;  3EBR A;  4KG0 A;  5FIX A;  1ZVF A;  4JGY C;  2XBO 2;  4Q4Y 2;  1OF3 A;  4LO4 B;  4Q4X 3;  1MEC 3;  1ZZ9 A;  1W6P B;  2GP5 A;  3VD4 A;  4R9B A;  4URA A;  3KT4 A;  3WNO A;  3QCW A;  2JX9 A;  2E51 A;  3RRD A;  1S4C A;  1H0B A;  2RS1 2;  2WZR 3;  4JGZ A;  5FYH A;  3M1H A;  3T2O A;  3OCP A;  4JVA A;  1VAM A;  3T2T A;  4A4A A;  1N3O A;  1JMU B;  4N43 C;  1UU4 A;  4QU1 A;  2YXS A;  5C4W C;  2RS3 2;  4OHZ A;  1PVX A;  2W1S A;  3B00 A;  3RI8 A;  4DB5 A;  4N53 B;  1DDL A;  1CZV A;  1FOD 3;  3KCY A;  4KI5 M;  3CL1 A;  3MI8 A;  5FRE A;  3FLR A;  3KCC A;  3RZK A;  3ASI A;  1H9W A;  2DVD A;  4S2H A;  3U78 A;  2QJV A;  4RR3 C;  2KXL A;  2VQA A;  1C5I A;  1ZBA 3;  2WN3 A;  4LBQ D;  4W6X A;  1VRH 3;  1S0G A;  5L9R A;  1CPM A;  2D97 A;  4CP0 A;  2YV8 A;  4Y1Z A;  1W03 A;  5GJ6 A;  2DTW A;  2CAU A;  5FYM A;  2CDP A;  1KS5 A;  5A3L A;  3SXW A;  1Q8O A;  3ORJ A;  4AFC A;  3DKQ A;  5SV5 A;  5I91 A;  3GGL A;  1W6N B;  2VBP A;  3ZN6 A;  3RZJ A;  3PUS A;  2QZ3 A;  5H9R A;  3N7J A;  3ZSJ A;  5FYV A;  5A6Q A;  5E8A A;  5CKQ A;  1Z7S 2;  5T5P A;  1BEV 2;  1NYW A;  2EIG A;  1LOA A;  3C2U A;  3VHP A;  2IXC A;  4L11 A;  4A6O A;  4A42 A;  1JYW A;  5FZL A;  3BN6 A;  1FMD 3;  2ES3 A;  2RJL A;  4NRO A;  1RUD 2;  3ZFF B;  4Z1V A;  1JZ7 A;  1VAK A;  4IEO A;  5H9Q A;  3O1P A;  4QGL A;  2R49 A;  4K8R B;  2AEY A;  4CYD A;  3VKL A;  1GP4 A;  1W9W A;  1LGN A;  2YB7 A;  1X7N A;  3USS A;  4I3G A;  2X5I A;  3NAP A;  1XRU A;  4XHX A;  2XB6 C;  4GMP 0;  4COV A;  2A6V A;  1V70 A;  3EB7 A;  4XET A;  2W3J A;  4CEY A;  1PVC 3;  5FPU A;  2VCC A;  4D8M A;  1HXS 2;  1ND2 A;  1YFX A;  2R06 2;  2P37 A;  1S0F A;  4KGQ A;  4YVS B;  1RUH 2; 
#chains in the Genus database with same CATH homology
 2XON A;  4CU8 A;  2X10 A;  5A1A A;  1H6Y A;  4FI9 A;  1JZ2 A;  5CYY A;  3HNM A;  3MBW A;  4QPW A;  3ACH A;  2QBX A;  4PT6 A;  3WNK A;  4A44 A;  2QQK A;  5I0D A;  5JXJ A;  5DPN A;  3HNY M;  4MGQ A;  4CUA A;  3DYO A;  2EID A;  2VCA A;  3ETP A;  3K4A A;  2VZT A;  4DEV A;  2DCJ A;  3FL7 A;  1H6X A;  4QB1 A;  4DEQ A;  5DMY A;  2QQN A;  2Y6H A;  3C7G A;  3A21 A;  2WAO A;  3K4D A;  2W91 A;  3LEI A;  2BGP A;  3K75 B;  2W94 A;  1JZ6 A;  3HJR A;  3ACF A;  5F7U A;  1JYV A;  3UES A;  1KEX A;  3OGS A;  5LA0 A;  5IJR A;  1SHW B;  4TXW A;  3C7O A;  5JMO A;  1US3 A;  4E8D A;  2WO1 A;  1XNA A;  2C4X A;  4QX3 A;  2WUH A;  3CKH A;  4AG4 A;  1UZ0 A;  2BER A;  3I3E A;  4CVU A;  1OD3 A;  2HLE A;  2RJ2 A;  1CIY A;  3FHA A;  4LQR A;  1GNY A;  3THD A;  2ORZ A;  2VMD A;  2OKX A;  2VTF A;  3W5M A;  2VMC A;  3ACI A;  1GOH A;  1P8J A;  1O59 A;  1WCQ A;  4GWJ A;  4JKK A;  4CUC A;  3OGR A;  2C26 A;  2VZU A;  3VD3 A;  3JXS A;  3I2J A;  1JYN A;  4QAW A;  1JZ5 A;  2WO3 A;  1UWW A;  1RYY A;  1GOG A;  4A3Z A;  2Y6K A;  5HXM A;  1OF4 A;  4CU6 A;  3ABZ A;  1YQ2 A;  4UAP A;  2X09 A;  3P1I A;  2QQL A;  1UYX A;  4GWI A;  4AAX A;  4QX0 A;  3UNP A;  4P02 B;  4QDQ A;  5EJ1 B;  2E33 A;  3AC0 A;  1K12 A;  3FN9 A;  2QQO A;  1GOF A;  2J1S A;  3CMG A;  3WNM A;  4QB2 A;  2X05 A;  5C71 A;  2DDU A;  4BK5 A;  3I97 A;  3IAQ A;  1I5P A;  2QQM A;  2XQX A;  5IFP A;  2LW8 A;  3CIH A;  1NKG A;  1UY3 A;  2WAB A;  2VQU A;  1JHJ A;  1HN1 A;  3WQB A;  5JXI A;  3OG2 A;  2Y6L A;  3HNB M;  1UY0 A;  4BXS V;  3K4Z A;  4P08 A;  3NNG A;  2WZE A;  2VMF A;  2CDO A;  1PMH X;  5G05 L;  1D7P M;  2W9X A;  3VD5 A;  1W9S A;  2E26 A;  3THC A;  1O8P A;  1XC6 A;  3IAP A;  3UET A;  2VZ3 A;  1J84 A;  4RYD A;  2C9K A;  5JXH A;  4QX2 A;  3HEI A;  3T2P A;  3WF0 A;  4HG6 B;  4XZU G;  2PQS A;  3OEB A;  3ZM8 A;  3J7H A;  3F2Z A;  2Y64 A;  3GM8 A;  2V4V A;  2VC9 A;  3DEC A;  1UYY A;  2JE8 A;  1XPW A;  2YG0 A;  4MGS A;  1W99 A;  4CU7 A;  3WF4 A;  2J1T A;  4D0Q A;  3I2F A;  2ZXQ A;  1LNS A;  2J1R A;  3HPN A;  3WSO A;  4RN5 A;  1DLC A;  4DXR A;  3MO4 A;  1JZ3 A;  1SDD B;  4ZZ8 A;  4GZ9 A;  3DYP A;  3CQO A;  1L7Q A;  3III A;  3K77 A;  2HYX A;  3K46 A;  2W92 A;  3CZU A;  2VOT A;  4Z2A A;  3SKJ E;  2J1A A;  5J1X A;  5FUI A;  1DYO A;  3EYP A;  1K42 A;  2BGO A;  2V72 A;  1F4H A;  2WYS A;  2QQJ A;  5C70 A;  2W1Q A;  1UMI A;  2VQT A;  2Y6G A;  3VD9 A;  2V5D A;  3T2Q A;  3VDC A;  1CX1 A;  1UY2 A;  3SKV A;  1UXZ A;  1JZ4 A;  3MV1 1;  1W9T A;  3I3B A;  2DCK A;  4XUN A;  2Z4F A;  3WF1 A;  1F4A A;  3DYM A;  2WAA A;  2EIC A;  2RV9 A;  4TTG A;  1K3I A;  1K45 A;  3T0B A;  5CZK A;  4CU9 A;  1DP0 A;  2JDA A;  3T0D A;  4MOA A;  5EIY B;  4M4R A;  4LHS A;  2Y6J A;  3SEE A;  1UXX X;  4ZXE A;  2XOM A;  4OMD A;  3IDA A;  1JU3 A;  2VZO A;  3HOB A;  2B4K A;  3WF2 A;  3D3A A;  2J7M A;  2J1V A;  1J83 A;  2XHN A;  4M4P A;  5B4X A;  3PUI A;  3NRU A;  1W8O A;  3PUH A;  2Y8K A;  4IUG A;  3P6B A;  4A41 A;  1PX3 A;  3NQH A;  3A22 A;  4L0P A;  4XUO A;  2ZEY A;  3LQC A;  3CZJ A;  4JKL A;  1KGY A;  2W46 A;  5JXG A;  2VJX A;  2YFU A;  2KD7 A;  3NJV A;  4W8J A;  2VM9 A;  4BK4 A;  5HPO A;  3C7H A;  1TVG A;  4A45 A;  5IYY A;  1UX7 A;  1OT5 A;  1EUU A;  2W47 A;  4CUB A;  4JHZ A;  2RVA A;  2VZV A;  2VZS A;  5EJZ B;  3WNL A;  1JU4 A;  2WDB A;  2QQI A;  3ECQ A;  4XUT A;  1WKY A;  3OB8 A;  1CZS A;  4LKS A;  3U37 A;  2R7E B;  4XUP A;  4JX0 A;  3C7E A;  3WNP A;  3OEA A;  1UMH A;  5IFT A;  3IB3 A;  3C7F A;  4DUX A;  2YFZ A;  4XUQ A;  2JD9 A;  2J1E A;  1CZT A;  4DXT A;  1W8N A;  5LCW L;  2J1U A;  3A7Q A;  5B4N A;  1SG3 A;  1O8S A;  4KMQ A;  1T2X A;  4UI9 L;  2ZEX A;  2BZD A;  3A23 A;  1GU3 A;  1OH4 A;  1UY4 A;  3VD7 A;  4QDR A;  2E31 A;  3GDB A;  2BBA A;  2YC4 A;  3T0A A;  3MUY 1;  3WNN A;  3GXU A;  1UYZ A;  3HN3 A;  4QB6 A;  4QDS A;  3OGV A;  4DXS A;  1L7R A;  2VL4 A;  3VDA A;  2VR4 A;  2WN2 A;  2VZ1 A;  3I2G A;  5C7G A;  1NUK A;  3I2H A;  4OUE A;  2W95 A;  4PF1 A;  2ZEZ A;  1JZ8 A;  5LA1 A;  1NAE A;  2VME A;  2EIE A;  3OBA A;  2L9L A;  3I2I A;  1GQP A;  2VZR A;  5DN2 A;  3LEG A;  3T09 A;  5JUV A;  1GUI A;  3FHQ A;  4P00 B;  4BDV B;  1PX4 A;  4ARY A;  1JI6 A;  1TG7 A;  1PMJ X;  1MPX A;  4PQQ A;  4DUW A;  3SEP A;  4W4Z A;  2VZP A;  4MO3 M;  3T08 A;  2ZEW A;  1OF3 A;  3VD4 A;  3LPG A;  2LS6 A;  2B9V A;  3WNO A;  4DUV A;  3C8X A;  3I2K A;  4ZZ5 A;  4XUR A;  4XVH A;  2WZ8 A;  4LPL A;  3BGA A;  4BJ0 A;  1W0N A;  3W5N A;  1NX9 A;  4UOJ A;  1IQD C;  3T2O A;  4A4A A;  2E32 A;  5IHR A;  2YC2 A;  2W5F A;  3LE0 A;  3WEZ A;  2W1S A;  2VCB A;  3ACG A;  4OYU A;  4QX1 A;  1CZV A;  4KI5 M;  3E1F 1;  2W87 A;  4OMC A;  5JR2 A;  1XNT A;  3VDB A;  3MV0 1;  1US2 A;  1BHG A;  2WN3 A;  3I3D A;  4ET7 A;  2W1U A;  4YPJ A;  3WF3 A;  2WQ8 A;  2WBK A;  4KWU A;  2JKX A;  2CDP A;  3NJX A;  1R64 A;  3GGL A;  4ZY9 A;  1JYX A;  3LPF A;  2ORX A;  1ULO A;  2EIB A;  4A6O A;  1GMM A;  4A42 A;  1JYW A;  3BN6 A;  2VZQ A;  4P5Y A;  2WO2 A;  2VO5 A;  5DQ0 A;  1JZ7 A;  2W1W A;  4OZO A;  4MAD A;  4JKM A;  3MUZ 1;  3CDZ B;  5LA2 A;  2ID4 A;  1W9W A;  2YB7 A;  1EUT A;  2J22 A;  1ULP A;  3LEK A;  4W50 A;  4ARX A;  3EB7 A;  2W3J A;  1UY1 A;  4E8C A;  5G04 L;  2VCC A;  4D8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...