2BGPA

Mannan binding module from man5c in bound conformation
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
116
structure length
116
Chain Sequence
b'SWTYTAASASITAPAQLVGNVGELQGAGSAVIWNVDVPVTGEYRINLTWSSPYSSKVNTLVMDGTALSYAFAEATVPVTYVQTKTLSAGNHSFGVRVGSSDWGYMNVHSLKLELLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-B1,4-MANNANASE 5C
publication title Structure of a Mannan-Specific Family 35 Carbohydrate-Binding Module: Evidence for Significant Conformational Changes Upon Ligand Binding
pubmed doi rcsb
source organism Cellvibrio japonicus
molecule tags Carbohydrate binding protein
total genus 12
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2bgpA00
2W95A 2VZQA 3ETPA 3FHQA 1UMHA 2YFZA 1IQDC 1XNTA 2WUHA 4KI5M 3T2QA 4TTGA 3HPNA 2LW8A 2L9LA 2X05A 2W5FA 1UY3A 4JKKA 2CDOA 3I2KA 2VMCA 2HLEA 1NX9A 3VD4A 3IB3A 5IFTA 2BBAA 1P8JA 3CIHA 3WNLA 2J1UA 3GGLA 3T08A 2QQNA 4HG6B 4XUQA 2KD7A 4PT6A 4QDQA 1JYXA 4OZOA 3MUZ1 1UY1A 4GZ9A 4AAXA 4CU9A 1SG3A 3VD9A 2VMDA 5DN2A 4A41A 3HNMA 4KWUA 1OD3A 2RVAA 4CVUA 1WCQA 1D7PM 2XHNA 3FN9A 1K3IA 2Z4FA 3OGRA 5CYYA 3I2HA 1GQPA 3FL7A 5HXMA 1GOHA 3W5MA 4UAPA 4CUAA 5LA0A 3MO4A 5LA1A 4W4ZA 2EIDA 2QQOA 5EJ1B 4PF1A 3MV11 1W9SA 2Y8KA 2W47A 2WN2A 4D8MA 2Y6KA 2WDBA 4AG4A 3BN6A 4BJ0A 2W91A 3OGSA 2VZ3A 4ET7A 5EJZB 4JKMA 4PQQA 1W8OA 4DXTA 5DMYA 1H6XA 1CZVA 4L0PA 2HYXA 2VZ1A 1NKGA 2WAAA 2PQSA 2WAOA 2J1EA 3SEPA 2W1SA 2YG0A 3E1F1 4FI9A 4CU6A 2WO3A 4A42A 3WF3A 4A44A 4BK5A 3WNKA 2J22A 5JXJA 1O8SA 3K4ZA 4QB2A 4LQRA 3UNPA 3SKVA 3WNMA 3DYMA 1US2A 4MOAA 3HOBA 1JZ6A 4DUVA 1W9WA 4RYDA 4ARYA 2VCAA 3P6BA 2J1AA 2WO1A 4A45A 1UWWA 3T0BA 3NRUA 4JHZA 1UXZA 2WO2A 4QX0A 4DXSA 2VL4A 4BXSV 2QQKA 2J1SA 1XPWA 1JZ2A 4A4AA 3A22A 4CU7A 3HNBM 4D0QA 2VTFA 2V72A 1JI6A 2VZVA 2WN3A 2ZEZA 4P00B 1UMIA 2ORXA 1W9TA 4DEVA 5IYYA 1JZ7A 1UYXA 3LEIA 3C7GA 5IFPA 4XVHA 4DUWA 4ZZ8A 2Y6GA 5JMOA 5B4NA 4XUPA 1JZ4A 3ACHA 5C70A 5DQ0A 4A6OA 3HN3A 1JZ5A 1PX4A 5EIYB 4P08A 2XOMA 1OH4A 3A21A 2W92A 5FUIA 2W1WA 5C71A 4QB6A 2QQMA 3C7FA 1JYNA 3LPFA 2VR4A 3D3AA 1MPXA 1J83A 4GWIA 3C7HA 2VZTA 3UESA 4BK4A 1SDDB 3VDAA 1PX3A 3I2IA 3P1IA 2W94A 2DDUA 1DP0A 4E8DA 3WF0A 2OKXA 1BHGA 1OF3A 3NNGA 1YQ2A 3CKHA 3WEZA 2E26A 3DYPA 5CZKA 1O8PA 2W1QA 3OGVA 2QQLA 4XZUG 3IAQA 2VO5A 2VMFA 2VZSA 1UX7A 2J1RA 3VD5A 2J1VA 2RJ2A 1OF4A 1UZ0A 4ZY9A 4ARXA 4MGQA 5JXGA 1CZTA 3CZUA 4P5YA 2W1UA 2LS6A 5I0DA 4DEQA 4ZZ5A 4TXWA 3OEAA 1GOFA 1CZSA 2ZXQA 2YB7A 1R64A 4OMDA 3NJVA 1UXXX 4UI9L 4OUEA 1JYVA 3GXUA 5B4XA 2BERA 1CIYA 4QPWA 2W46A 4UOJA 5J1XA 1W8NA 2JD9A 1HN1A 1US3A 2J7MA 3F2ZA 4DXRA 1GUIA 3WF1A 2EIBA 2VCBA 2XONA 2X10A 1RYYA 1W0NA 5G04L 1NUKA 2VMEA 1JZ8A 3OEBA 5JXIA 2YC4A 3A7QA 2RV9A 3WF2A 2DCKA 4QX2A 1GMMA 1T2XA 3CDZB 3SEEA 4OYUA 3NQHA 1UY4A 2C4XA 1JU4A 1JU3A 2BGOA 3GDBA 4W50A 2WBKA 1K12A 1UYZA 2C26A 4IUGA 1PMJX 2BGPA 2EIEA 1XNAA 4CUCA 3VDCA 1GU3A 2WZEA 1F4HA 3GM8A 3EB7A 4KMQA 2ZEYA 5JR2A 3K4DA 5C7GA 3K75B 3T2PA 3I3DA 4QX1A 2BZDA 2VZUA 3LEKA 3VDBA 2VCCA 1JHJA 2ID4A 5LA2A 3ZM8A 2V4VA 3I2JA 2JDAA 3EYPA 3I97A 3WNPA 3ACFA 4QB1A 2ORZA 5G05L 2VOTA 1TG7A 2CDPA 2VQTA 1L7QA 2R7EB 3I3BA 2WQ8A 1K45A 3OBAA 3T09A 4MO3M 2VM9A 2VZRA 2VC9A 2Y6JA 2E33A 5IHRA 3THDA 1JZ3A 1NAEA 4XUTA 3IDAA 1KGYA 1F4AA 4W8JA 1DLCA 2J1TA 3PUIA 3ABZA 2W9XA 3ACGA 1GOGA 3I2GA 3LE0A 3DYOA 4M4RA 2XQXA 3WQBA 4BDVB 3AC0A 3W5NA 2Y6LA 1KEXA 3I2FA 4M4PA 2WYSA 3J7HA 2WABA 3HNYM 4Z2AA 1OT5A 3LEGA 1UY2A 1CX1A 5JUVA 2JKXA 4XUOA 2JE8A 4MADA 2C9KA 2ZEXA 3THCA 3NJXA 2X09A 2Y64A 3U37A 4QDSA 1K42A 1J84A 2QQJA 2YC2A 4XUNA 3IIIA 4XURA 5JXHA 2V5DA 3VD3A 3HJRA 5DPNA 4GWJA 3C7OA 2ZEWA 1W99A 5IJRA 4QDRA 3C8XA 4QAWA 3K77A 4YPJA 3K46A 4JX0A 2WZ8A 3LPGA 1H6YA 3JXSA 3IAPA 3MUY1 1DYOA 4MGSA 3WSOA 3UETA 4E8CA 3PUHA 3HEIA 2B4KA 3T2OA 4CUBA 3LQCA 3I3EA 3OG2A 1L7RA 5LCWL 2QQIA 4CU8A 1ULPA 2VJXA 4LHSA 2EICA 2B9VA 3FHAA 1UY0A 3ACIA 4LKSA 3WNOA 3MV01 1EUUA 2W3JA 4RN5A 2E31A 3WF4A 1O59A 3ECQA 1I5PA 4OMCA 3DECA 2E32A 3A23A 5A1AA 4DUXA 3VD7A 1XC6A 2DCJA 3K4AA 1PMHX 1LNSA 3BGAA 5HPOA 4P02B 3T0AA 2VZOA 1WKYA 4ZXEA 3WNNA 2VZPA 3CZJA 2VQUA 1UYYA 2Y6HA 2W87A 1EUTA 3T0DA 4A3ZA 4JKLA 1TVGA 3MBWA 5F7UA 3SKJE 2YFUA 3OB8A 3CMGA 3CQOA 1JYWA 2QBXA 3C7EA 1SHWB 1ULOA 1GNYA 4QX3A 4LPLA
chains in the Genus database with same CATH superfamily
1W6QA 1WW7A 4FP2A 4NHXA 5A3MA 1ODNA 1RIRA 2D6PA 5C5TA 3OGJA 1WD3A 2GMPA 4GULA 1H9WA 4OUMA 3KT4A 5ANNA 1GZ9A 5H9QA 4YVWA 4YM0A 3VL8A 5K0UB 1HB1A 1UY3A 2D5HA 3POFA 3MEPA 2WQ4A 4AEDC 3PU3A 2XG3A 3LD8A 3VBFA 4CDXB 4TZDA 2P2KA 2HLEA 3T1MA 2GP5A 3GCWA 1NX9A 4E2SA 3CJIA 3IPVB 3VD4A 1TMF3 5FO8B 4AE2A 5FZCA 3VBHA 3MLKA 1G9CA 2XUEA 2A6WA 1B09A 1OD5A 1VAKA 3CIHA 3IT8A 2J1UA 3BTXA 4DZGA 2Q8OA 2AYHA 3GGLA 1VJ2A 1YFWA 4AFCA 4XFHA 4YVSC 5HXVA 4AI3A 1PIV1 4XJ8A 2VBPA 4F7ZA 1JTZX 1QJY3 5ACA2 5GZCA 4YW3A 3JBG2 2ZKLA 2ADEA 3MPBA 2JG9C 5GZFA 5GZEA 5CEHA 4Y5Z0 1RINA 2E7QA 3O1SA 5D1IA 4OZOA 2ZGKA 2E6VA 3G6JB 1OLQA 1I1EA 4WM8A 4AAXA 3E6DA 2OT7A 1RVF2 1SG3A 1AJKA 4JRAA 5F3GA 3VD9A 3AZYA 4AGGA 2HWE1 5GJ6A 3V0AA 2IXCA 1DHKB 5LEKA 1V6KA 2PLV1 2WR9A 3LDRA 2VOKA 3LZZA 3U1XA 1LGCA 4CVUA 1YC61 1HQNA 1E5HA 2E9QA 1AR81 4BQXA 4AR2A 1K5MB 2HWC3 4WVMB 5CU1A 4BCUA 5CISA 2FDJA 1YJKA 3PMEA 2R0FA 2YPDA 2XVGA 1NY71 5LRRA 3FL7A 4A7KA 5ABJA 1R091 4EE2A 4UAPA 4UW5A 4RQPB 1MS3A 3M70A 4CYDA 2VU9A 4W4ZA 1IPSA 1Z7S3 2QQOA 5EJ1B 4AXOA 5IT6A 3GJAA 3V64A 2BWCA 1UX6A 4YGBA 3WP3A 1WZXA 1QXPA 4PF1A 4BMEA 5TSWA 2W47A 2Y0IA 4CEYB 5FZ4A 1S0DA 4ITCA 3AJZA 1J58A 2XL9A 5A3TA 2N7GA 3VKLA 1SLCA 1PGL1 3OGSA 3ZKYA 1UYPA 2AH2A 4HSLA 1V9U3 1H1AA 5JOYA 1TME1 5L36A 2V5YA 2HWF2 4E4ZA 4PQQA 3L2YA 2ES3A 1W8OA 4DXTA 3KCYA 5IK4A 3TN91 4PDWC 2F17A 2WQZC 1U5IA 5BXXA 1AUYA 4QPIC 2JG8A 2WAAA 2VQ0A 1F15A 5EYXA 3J26N 2W39A 1DDLA 4M3CE 2BNMA 4MGYE 2RMU1 1OXCA 1Q43A 1NXMA 3OPZA 4EN7B 3VHNA 3DV8A 4QU1A 1NQDA 1RHI1 2GDFA 4FI9A 3ZN6B 4DRVA 5CNAA 3O1RA 1ZZBA 3JZVA 4Y5TA 5C4WA 4BK5A 3SCGA 5C3PA 3ILFA 1NA1B 2J22A 4KBBA 4AGVA 4COVA 4XF4A 4IEPA 1M4WA 2RS51 3EHKA 1NQJA 1XYNA 3LDBA 3LSDA 2ZTNA 4QQHA 1XBFA 3JBG3 4AEMA 4BQ3A 1YCIA 3H8RA 2JD4A 4RYDA 4ARYA 3AYDA 1CJPA 1R1A1 4GMP1 3VZMA 4UYBA 2P3IA 1PIV2 2JENA 4PCRA 4DIQA 2Y60A 1CAUA 5GLTA 2VTXA 1W6MA 2WO7A 5J09A 1C57A 1BBT3 1D4VB 1JYTA 4JHZA 4UBGA 4Q8KA 4QX0A 1HB2A 3D8CA 4JGZB 2A5ZA 1LOEA 3OCPA 3VDDB 3KCXA 5JIUA 4BXSV 4O61A 4IEZA 2A3YA 1VBA1 4C1WA 2AUYA 4AOCA 1CQ9A 2ZGNA 4LBJA 4A4AA 3H8OA 2A1XA 3AMNA 4ZS2A 2VTFA 2DWRA 1EP0A 2A7AA 5FYYA 1SFNA 4YW1A 3ZIXA 1RUF3 2D6OX 1UMIA 2ORXA 5EWSA 2QTWB 3HQUA 5FPAA 5FZMA 3PVNA 2NM1A 3APBA 3JD71 4AZZA 1OA2A 5FKBA 2ENRA 1S1AA 5A6XA 2R061 1F35A 2AC1A 4XPVA 5K0UA 1CJDA 1HXS1 1GQHA 2QQUA 3NAPC 1VBD1 4CDXA 5FWJA 4DUWA 1PGW1 1GWLA 1BLZA 1STMA 2Y6GA 1AL23 5A3UA 1WGPA 1HB4A 5BNPC 1JUIA 2I07B 5T3NA 5T54A 1DFQA 3IPVA 4BQ1A 4C90A 4YG6A 1VP6A 4A6OA 5KXDA 1JYIA 4LHLA 1QJX2 2V73A 2ZMKA 4LBQB 4LO6B 4AEJA 2F4PA 3W9AA 4WM7B 2WFF3 3ZYJB 3AK0A 4IESA 1YI7A 4LO7A 4QGLA 5T5LA 1JN2P 5FR3A 5L7OB 1JYNA 1VALA 3LPFA 2VR4A 1MZEA 1AXZA 1J83A 1O5LA 1ULCA 3C7HA 4NJ4A 4OVEA 4LNVA 4GMP0 4JVAA 4BK4A 1SDDB 2PN5A 4IETA 4XBNA 4EV0A 5IVBA 3ZDSA 2XMLA 3ASIA 1KJRA 1PX3A 3K51A 1QIQA 2ARXA 4CP2A 5JZGB 1N3PA 2EALA 4Q4W1 4KG8A 1X8MA 5JDBA 5T5PA 1OQEA 3WF0A 5C3OA 2YGLA 1TNRA 1E5SA 3D6EA 3RRDA 2OKXA 4J6GA 5E16A 4TLFA 3WEZA 4Z92B 1YQ2A 2E26A 4XFBA 1SFPA 1GNHA 1BK1A 2W1QA 3OUIA 4JHTA 4PIXA 4CSWA 3KHCA 3PTYA 4J1XA 2HEVF 1EYBA 3O5SA 4UF0B 4B4PA 2VZSA 1ULEA 4OHVA 1O4YA 3FLPA 1G9DA 1K5MA 4WVMA 1OF4A 3VD5A 1QOOA 4ZY9A 1PIV3 2HBTA 2Q1FA 4MGQA 1CZTA 1UOBA 2VMIA 3CZUA 3WDWA 1BEV1 2LRPA 2W1UA 4IW3A 5FMBA 4XQ4A 1H8TC 1ND3C 5I0DA 4R4ZA 4RQPA 3IDCB 3OEAA 4OHYA 2HBUA 3POIA 1JS9A 3B69A 3LFMA 2CSGA 4G3YC 5FOBB 5I93A 2QDNA 3BUCA 2DCTA 4OMDA 4QQ2A 1KJLA 3PUQA 4HVOA 5EP9A 5IVYA 4B8EA 3NJVA 5JIAA 4CEYA 1AXYA 1HLCA 2HWE3 4CEWB 1MACA 3GXUA 4XF1A 3N9OA 4K8RB 2D6KA 2PLV3 5JOXA 3O12A 4DRRA 2G9FA 5FZ9A 4XMIA 3JUUA 5J1XA 3GZAA 4U36A 2PXJA 4YW7A 5JOZA 1HN1A 5KXBA 2J7MA 1Y7BA 2BW8A 3CEWA 4H2AA 3F2ZA 5FZDA 1PK6C 1QJZA 3GBWA 2E53A 1IS6A 4N43C 4C91A 4WZCA 4YZ5A 1AYN2 3HN1A 2WC2A 3W59A 1HRI1 1XNCA 4NRMA 1XRUA 2K2SA 2P5BA 2NPIA 1SZBA 4OHXA 2YUEA 2BTVC 4LTAA 1R093 1RYYA 4XJZA 3V56A 4E4DX 1WCSA 1NUKA 2DCZA 5IVVA 1VBB1 4NPMA 1JZ8A 1PM7A 4EWEA 3VN4A 4JTNA 3A7QA 3ZFGB 3ZN6A 5FMCA 3TOJA 2C6SA 2PHTA 3WQ1A 3EBRA 3I2OA 1HXS2 1URXA 1CAWB 3I7DA 1VBD2 4P9JA 5KHGA 3NQHA 4JCKA 3K48A 2HJIA 1NA1A 3L9JT 1PVC1 1RUC1 1UY4A 4MG2A 4DNYA 1A8MA 1AYM2 3T4VA 3WZ1A 5HI0A 5JOWA 2PQQA 1UOJA 3KD4A 1W9YA 2HWD2 2BGOA 3GDBA 2BUKA 1TME3 1WCUA 4N53B 4IE7A 1PMJX 4LJHA 3FFQA 4K6BA 4CUCA 3H1WA 1RITA 1IS4A 5KWRA 1F4HA 4R9CA 3EB7A 4KMQA 5I0TA 4LKEA 5KXEA 2XQRA 2ZZQA 3K75B 5H9PA 1GR3A 3I3DA 5LB6A 2RMU3 2MEV1 4QX1A 1SLAA 4CDWB 1AR61 5DZGA 5FWEA 4JGZA 3VDDA 3U14A 2D3RA 5KC6A 3LEMA 4PQ9A 4GH4A 1AX1A 1WA4A 1D4M2 4HANA 1S55A 2I45A 1JH5A 2NYYA 4QHBA 1BCXA 4R9DA 1GICA 2P37A 2ID4A 5A80A 2CHHA 2V4VA 5DXDA 3ZM8A 3AKQA 3AP7A 4PJYA 2RS53 3RMXA 3CO2A 2IC1A 2FBEA 3TNQA 1BZWA 2CV6A 2VOTA 1TG7A 2VQTA 5JR7B 3ZMNA 5FO9B 1POV1 4QQLA 2R7EB 3SQOA 4MGTA 5F9TA 2OA2A 3GHNA 2WQ8A 3H1YA 5BPXA 4A3XA 1YQ6A 3BOPA 4DXZA 1R1A3 3J9SA 4GMP3 3ZO0B 1ZZ7A 3KQRA 2VC9A 2PYTA 3THTA 2ZABA 1RC6A 4NO4A 4KH9A 4EN6B 2RR11 4GKXA 3E97A 5F5CA 4XQWA 3MFCA 4BQ4A 3THDA 3CBNA 1RGSA 3LIGA 5JSPA 1Y3TA 2XKOA 1C8NA 4Y33A 1Q5OA 1NAEA 1JZ3A 3IDAA 1KGYA 2EAAA 2E7AA 4W8JA 5F6LB 1DLCA 3PUIA 3WT3A 3UK9A 3RDIA 4HXCA 1GNZA 4N90A 3PDQA 4RR3B 1ZREA 1KRIA 1VBA3 4XHBA 4LBQA 1VRH2 3I2GA 1AYN3 4IDZA 5CFCA 3DYOA 4PBOA 1GFF2 1XE7A 3N7MA 1YQCA 3NJYA 1PMIA 4WM7A 3RI8A 3WQBA 4BDVB 4HL0A 3O1OA 2E7TA 5FZ6A 3LA7A 2WABA 2ZAAA 3AKPA 1G86A 3M3CA 5GLWA 5I0UA 3LEGA 4Z2AA 5A32B 3T4HB 5JUVA 5L7OA 1H30A 4A7ZA 3RZZA 3SITA 3PVBB 4XUOA 2JDNA 3U07A 1V00A 2C9KA 2P6HA 3BODA 4FAGA 1ULFA 1Q8VA 2JECA 2ZEXA 4LK6A 5AVPA 2R063 2DVDA 3U37A 4QDSA 2R1BA 3IKWA 2GN3A 3D4KA 5JZGA 1FMD2 1PZ7A 1HXS3 2BQPA 2QQJA 4LOSA 4YGDA 4XFFA 4QXBA 1VBD3 1YQ5A 2YXSA 2ZAHA 3CNAA 4RGKA 4XURA 2V5DA 3D0JA 4QXCA 3VD3A 1ZZCA 2RM21 3VBUB 2QE3A 2VOVA 3C7OA 3NKGA 2XH6A 3C8XA 1LOGA 2JE7A 2R32A 4ORFA 5F5IA 5FY8A 2NMOA 1UD1A 2A71A 1FV3A 2VPVA 4GIQA 1J1TA 4J25A 4UF0A 5L7OC 4RS5C 4AQTA 2VUJA 1LHVA 3BB6A 3DEMA 1MVQA 1XE8A 2R072 4OFGA 2EVXA 4UWDA 2X5IC 1POV0 2UURA 3J8F1 4GWMA 1UIJA 3TBDA 1CIWA 2B4KA 4PHZA 3PVOA 4CUBA 1OVSA 3EJKA 3I3EA 2RS12 3OG2A 4OQ8A 1UMZA 5LCWL 4CU8A 3I49A 1DCSA 4FFGA 5FV3A 2B9VA 1NLSA 3RZKA 4BYYA 4Q4W3 2R49A 2X53S 3H0OA 1ZYBA 4CEWA 1OSGA 3PU8A 2GN7A 3WG4A 1CPNA 2ZGQA 1TZOA 5HCBA 1N47A 3LOIA 1ODMA 1OH3A 5FPUA 3KZ4C 3THPA 4RN5A 2E31A 3WF4A 3UT0A 1I5PA 3TEYA 1NT0A 4H7LA 4MVTA 1CAXB 3IDBB 4URTA 4YW5A 4W65A 1TMF1 3DECA 3KV4A 1UPSA 1DZRA 2E32A 2FCUA 1LECA 5A1AA 4MLOA 1LEMA 1IZ3A 1PO22 3AL5A 3PIGA 4GD4A 4M0HA 3WX5A 1XC6A 3MICA 3OSDA 4E27A 4RHV2 3T0AA 1RMU1 3BIWE 2TUNA 2WIIB 1HQWA 4PI0A 1WKYA 4CCLA 1Z78A 4COZA 5JPNB 5LWBA 2VULA 2DVAA 4LA2A 1NLRA 3WNNA 2VZPA 5FJKA 2VQUA 1TQ5A 1UYYA 2LUWA 1DQ2A 3ENRA 2W87A 2D5FA 3B01A 4SBVA 5F39A 5FP7A 3N9PA 3ZFGA 5HV4A 5JI9A 5LW9A 1GKBA 1RUH1 1TVGA 2ET1A 1OQ1A 5F7UA 1IQAA 3OB8A 1CAWA 1LOAA 2Q30A 2XBO1 4C0HA 3C7EA 3PUAA 1ULOA 1FNZA 4K3UA 5C9AA 1YFYA 3DF0A 4SLIA 4UW6A 4IE4A 3LOBA 2PHUA 2Y6FA 5BNNB 5A6QA 5FP4A 1XSQA 4N53A 3FHQA 4Y4RA 1UMHA 2YFZA 1GV9A 4AAPA 4P9YA 1CN1A 1XNTA 3QD6A 2HWC1 2WUHA 1HRI3 3T2QA 4B4RA 3HPNA 1W28A 1W2NA 1N3OA 5C8CC 2X05A 1FMD3 3CLPA 1X8EA 4HKWA 4Q0UA 4B1MA 2X8KA 3I2KA 5A7PA 4Y5SA 1IPJA 5APAA 1BMV1 4CDWA 4AEDB 5FP9A 4XDQA 1C8M1 4C1XA 1MEC2 3IB3A 4AVCA 4YZ1A 3ZPOA 4E2GA 1P8JA 1H4GA 1SCRA 2Y34A 1OLME 3HAGA 1KS5A 5FZOB 3INAA 3U4XA 3T08A 4OHWA 5M0TA 1PVC3 3H3ZA 1RUC3 4GKYA 3OPWA 4BQWA 3VZNA 4L92A 2QNKA 4XC9A 5HBAA 4MX3A 1QNWA 3OF1A 4RD7A 2VW1A 2PHLA 4XUQA 2G9GA 4XJAA 2VUDA 2RS13 2UYAA 3BTZA 1JYXA 4XDOA 4OI4A 4D69A 1EV12 2JX9A 2JG9B 1UZZA 1WWYA 2PTMA 2NZ9A 4PLMA 4QU2A 1GZWB 4Z07A 3WW1A 5JLVA 2VMDA 5FY7A 4QPGC 4FPLA 2ADDA 3M8LA 1COV2 2MEV3 1OPOA 3PJQA 1H9PA 1AR63 1NZIA 1X36A 2XJRA 2XXZA 1ZBE2 2OPKA 2YPJA 3HNMA 1RUE2 4KWUA 5F5QA 1DGWA 1WCQA 5FZ8A 4RR3A 3X29B 1FYUA 4QQPA 5FKCA 3AX4A 5BNOC 1OUSA 1PO23 2DBIA 2DBNA 1ND2C 4FPFA 4UFLA 1Q8QA 1WBFA 3EO6A 4KWJA 4UFJA 2CGPA 1FPN2 1GQPA 5FXXA 1OOPA 1ZBA2 5ACA1 2FDGA 1OFSA 1POV3 4CUAA 3JBG1 5A32A 1ENQA 3MO4A 5LA1A 3MYXA 1EPZA 4M3CB 3OUHA 4CRQA 2VW0A 2OIIA 1Y9QA 4P9IA 4XABA 4HONA 5IATA 5J3UA 1E5IA 3HR9A 1QXRA 2Y38A 4QX8A 3MV11 4FXGB 4LORA 2RR13 3WG2A 1RVF1 2Y6KA 4Q5OA 2WDBA 2FDIA 2Z69A 1XE0A 1W0PA 3RI9A 2P3KA 4F3JA 1L3JA 4IQPA 1QXJA 2W91A 5D8AC 5FREA 3RVHA 3VBUA 4AK3A 2C1FA 1BK0A 2CWSA 2AREA 2Y33A 4K21A 1WW4A 4ET7A 1LESA 3KM5A 5CAZA 2A3XA 3ZXDA 4YSFA 2OX0A 3N9LA 4LIVA 3JCIA 3OY8B 5DMYA 5FAXA 2Q8CA 3WNXA 1MQTB 4B3NA 4HVQA 4L0PA 3AM2A 2VZ1A 4XIKA 3H7YA 1W0OA 4NRPA 5KHHA 4XETA 2PQSA 2H6BA 4PDWB 2B46X 5FIXA 2WAOA 2J1EA 2A6VA 3NSTA 3JU9A 4QPIB 2FCTA 2XB6C 2XUMA 5FLJA 2GALA 2YDEA 3B93A 4Z8BA 1LAJA 4K1YA 3WF3A 4A44A 2ERFA 4CPBD 2ZGPA 1LU1A 4Q0PA 4BU2A 3MIHA 2P34A 4YYOA 3MIFA 1I9RA 3ZX7A 5AC92 1F8VA 5DUVA 1WCKA 5DAVA 5FXWA 5IVEA 3BU7A 4BLIA 3IIAA 1O8SA 2RM23 3IWZA 4AI0A 1MS5A 3ZYIB 1ZA4A 2XL7A 3KSCA 4MZUA 4QB2A 4AYUA 5A1FA 5C3SA 2VW2A 3KF5A 5FMOL 3VKMA 4FPHA 3DXUA 4NAMA 1CAXA 4CZSA 1KXGA 3C3VA 4AHYA 1N1TA 4DUVA 2A75A 1YWKA 2HWF1 2ZS6B 4M3CF 5EFUA 3AZXA 5F2SA 4AVBA 4QGNA 2HH9A 4META 3WCRA 4A45A 3KV9A 3LCPA 1WLDA 4CXWA 5DAWA 1KDKA 1UWWA 4XJ9A 3FC0A 1UXZA 4Y24A 1F2NA 1HQLA 5FYTA 2AGSA 4DXSA 1IG3A 1CX4A 2VL4A 2YMZA 5E8AA 4L8QA 3UL2A 2BWAA 4DY3A 2YC0A 3D82A 4LULA 2WS92 5LBBA 1JZ2A 1REEA 1RUOA 2RG4A 3N7JA 2JIGA 3HNBM 4Y26A 3SCHA 4D0QA 1HRV2 3IBMA 5EQUA 5CADA 3V0BA 5C5UA 1FPN3 1N3QA 4IEVA 3WUCA 2V72A 2GC0A 2GNBA 3CJIC 1JI6A 2DVGA 3KGZA 2XJVA 2WN3A 4IGQA 2H6CA 2XJQA 5FZHA 5BNNA 1W9TA 3RZHA 1R1ZA 2V09A 4XOGA 4NHMA 3ZIWA 1UYXA 2P1BA 5JSOA 3I2DA 3C7GA 3KT1A 2AR6A 1RMU3 3B02A 1XNDA 1PM4A 2YBKA 3AP9A 4ZZ8A 5FZBA 1DYPA 3MW3A 5J7MA 3VBSC 3UKNA 2LROA 5JMOA 4O7XA 2B7YA 4MH0E 1C4RA 1QQP2 2DUPA 3ACHA 2JICA 3D0SA 3NAPB 3R4SA 4FQ4A 5FZKA 4AEDA 5C70A 3DGTA 1N1YA 1RUH3 1DYKA 1BXHA 2D40A 1F5JA 2E51A 4WM8C 1W3VA 4QPYA 1HJGA 2W0XA 5BNPB 1JZ5A 3WG1A 2XBO3 4JRLA 5GLVA 2ZGOA 5FZOA 1RUI2 1OH4A 2EXIA 3CU7A 1SFYA 4IEWA 4PIZA 1XYOA 3ME2A 4CP0A 1LJ7A 3AFKA 4NAOA 1XOYA 4NWWA 3AL6A 2QQMA 3S5QA 5C8WA 1WLCA 3D3AA 4AI2A 3POEA 5LEJA 3UESA 3M3QA 2JDPA 3VDAA 2ET7A 2ZCWA 1G9AA 2K9ZA 3ETQA 3WP5A 3P1IA 3UV9A 5ABJC 4ONUA 5I0SA 2W94A 3IM0A 4MGIE 5DABA 4E8DA 5LZ6A 1O3SA 5FDBA 1O3TA 4YZ4A 1BHGA 3KHBA 2QQPA 3MIEA 3CKHA 1QH7A 2UYBA 1BVP1 4HOOA 1C8M3 3MLJA 5CZKA 1O8PA 3OGVA 2QQLA 4IGPA 5FXZA 2VXRA 3IAQA 5FZEA 4AHWA 3RS6A 3ZSLA 4QM8A 2VMFA 2VY0A 1QJX1 4GXLA 5LK5A 1WMFA 1SBEA 2F6BA 3E6BA 4YGCA 5EV7A 3AMPA 3WDUA 4FVVA 1HKDA 3O0XA 2B8MA 2P3JA 4P5YA 4NIAA 5I8YA 2LS6A 1TNFA 4ZPIA 5FRAA 3S7IA 4ZZ5A 3ILRA 4TXWA 2WZPP 3USSA 5ANQA 1C1LA 1GOFA 4HKLA 1H8TB 1ND3B 2CWMA 5F5AA 1H2MA 4CP1A 3FZ3A 1WCDJ 4I01A 2JG8C 5CVRA 5FZ7A 2A3WA 1GYKA 4XCBA 5FZ1A 2RDRA 1D0GA 3J7MA 5B4XA 2DURA 2VNGA 3LWCA 2P3YA 4P9GA 4QPWA 4UOJA 5FP8A 1PO12 5FY0A 4QKNA 5BY5A 4LUMA 1US3A 1G6NA 4FO9A 5IK7A 1U12A 4XBQA 1AVBA 2XJPA 3PNAA 4K7JA 4TWTA 5L19A 5CA6A 3ES4A 1GUIA 5BYNA 3OY8A 2EIBA 4YFZA 3BKZA 4X6QB 4UFMA 1PK6B 5FY5A 1MQTA 4GAZA 2AZ5A 4HN0A 4N43B 1W0NA 1UU6A 5ACA3 4N7UA 3M1HA 4UW4A 4QPIA 5IAVA 1QQP3 1HJFA 5GKAC 4D6RA 4PLNA 3GZTB 3RZMA 2RV9A 1W39A 2DCKA 4XFIA 3VBRA 2ZJCA 4KBZA 4F83A 1T2XA 1RVF3 3RPQA 3WG3A 2UWBA 3M3EA 2DU0A 3FHIB 1HV0A 4WVZA 2ZGTA 4Y1ZA 1RUD2 3WDVA 1W8FA 4UW3A 2JJ6A 2WBKA 4HMZA 4W50A 1GZCA 4LBNA 4IEUA 2WNVC 1MZ5A 4D3WA 2KR2A 2BGPA 2XJTA 1GU3A 2ZHMA 1AYN1 1XNKA 2WZEA 5FMDA 4OQ9A 2ZEYA 3K4DA 5FPXA 3NV3A 2RHPA 1XJAA 3B7MA 2P6CA 3ZFEC 5DDJ2 5LBFA 4CP9B 3U75A 1VB2A 3BVCA 2ZMNA 2BZDA 2VZUA 4DPNA 2B9UA 4CDQC 1D2QA 4BIOA 1GSLA 2DVBA 3VDBA 5K0UC 5CG9A 1UU5A 2XR4A 3BOWA 2VCCA 5LA2A 2O8QA 1ULDA 1QJFA 1S2BA 2JDAA 3LF7A 1TEIA 2XJSA 2ZX3A 1AYM1 3VHRA 5KC5A 5L73A 4B29A 1AHSA 3POYA 3MI8A 3RZGA 4TYSA 2HWD1 4EN8B 2F4LA 5FBZA 2HWF3 3AP5A 3OBAA 3KWVA 1NLQA 5FOJB 2VZRA 3K2OA 4QKBA 4QT6A 5C3RA 4OULA 4E4SA 4LO8A 2WLPA 3LA3A 1LENA 4IE6A 1FOD2 1RL3A 1OURA 1YFUA 2VVFA 5E89A 1F4AA 1C3HA 2UWCA 1Q8OA 2J1TA 1FAYA 2W9XA 5BNPA 1W6OB 3B5LB 3S7EA 3R6SA 1SQ4A 1W2OA 4LBOA 1D4M1 4HPKB 3LE0A 3FLTA 4QWNA 2XQXA 4GJZA 1V6IA 2Y6LA 4D7SA 1KEXA 3I2FA 3J7NA 4NHLA 3J7HA 3DL3A 3HNYM 2Q8DA 1CX1A 2VAUA 4PI2A 1V0AA 4XFCA 4I3PA 3NNLA 5L9RA 5FPVA 3ZYHA 1K5MC 3ZXJA 2ZHNA 3OD4A 2X09A 4LE4A 3DKQA 4Y3OA 3TWIA 4Q1RA 3RMYA 1W6NB 1K42A 1J84A 4KU8A 4PIYA 4XUNA 5I8SA 5F3CA 1DQ6A 1MS4A 4RQPC 1T6BX 5LBEA 1NCQB 1QJU2 1ALYA 4GWJA 4Y1YA 4DMIA 4I0AA 3MF9A 4ZONA 3O1MA 3NNMA 4QDRA 5EHDA 4XYXA 3K77A 4PLOA 4FP3A 2JDYA 2WZ8A 3H8XA 1XNBA 2W68A 1GQGA 3QH7A 5CFDB 1WMDA 2ZGLA 1VRH1 5F8PA 3S30A 4N9HA 3SH3A 1HDKA 2FDHA 2RJLA 1NCRB 2QVSB 3KVAA 4MGSA 4IEOA 5FY9A 4E8CA 4IL7A 3H42B 1IKQA 1S0IA 3HEIA 3LSEA 4P5HA 4XZPA 5DDJ3 4B7EA 4M0NA 3ZSKA 1SMVA 3PTRB 2K46A 1H8TA 1ND3A 2WZR2 4NROA 3FHAA 5FPBA 4CDUC 3WQ0A 1BVVA 1OVPA 1UY0A 4NIDA 5A7NA 1FMD1 2IFRA 4FXKB 4LLOA 1NXD1 5JAXA 2BNOA 2PAEA 1CONA 3ACIA 4LKSA 4AFMA 4BZ4A 1EUUA 3SLIA 2W3JA 3L2HA 3LIHA 4MV2A 3ECQA 2JDMA 4M01A 1MS0A 2CNAA 1B35C 4OI2A 2ZX2A 3WINE 4QXHA 1V6JA 1QJX3 1S0CA 4S2HA 4DS0A 1G9BA 4GWNA 3VD7A 3K4AA 1LHNA 1NA1C 1PK6A 4FPJA 2WJSA 2DU1A 5EXOA 1DQ4A 2GC2A 3BGAA 3MHZA 4Q0SA 4N43A 4P02B 3SISA 2R071 4FTEA 3O1VA 5HV0A 4R52A 5SV8A 1VRBA 4XTMA 5FYCA 4XF3A 4OUSA 3CZJA 4JQRA 1VPHA 2Y6HA 5LASA 1SLLA 2RS11 4Q4Y2 2OZJA 2QDRA 1AZDA 1CVNA 1AX2A 5SV5A 4BQ5A 3SKJE 2GC3A 1HIXA 2QBXA 3HBKA 4BB3A 3NV4A 1AF9A 2Q1MA 5F32A 1UL9A 3PVEA 4IV3B 1ZA7A 3H1MA 3VZLA 1YUDA 4BM8A 1W06A 1OA3A 4LPLA 3ZYGA 4EWAA 3MZHA 2LTNA 3BI3A 4GH4C 3ZVXA 2VMGA 3LKJA 4TN7A 4Q4V1 5DUUA 1PO21 1VE0A 5FYZA 4TTGA 1Y43B 2VXJA 1KFXL 4GQ7A 2L9LA 2W5FA 3AVSA 4RHV1 4CE8A 3ST7A 1JXNA 4HK8A 4BOWA 1DGWX 3WY6A 2OUJA 4CP9A 1QJU3 5KHIA 1IPKA 2QQWA 2VG9A 2B5HA 1X7NA 3OD0A 2CAVA 5IFTA 2BBAA 3POBA 4QXKA 3IZOA 3PHMA 2JEMA 3QOPA 5GLUA 1RJ7A 3RNSA 3Q8EA 3LB9A 3WNLA 2DTYA 2IXHA 2YHJA 2NP0A 5DZEA 3H7JA 2MPFA 5AFBA 5ERLA 4R4XA 2KD7A 2WNUC 3AYEA 3FWEA 2VTXJ 5L9BA 1W8WA 4PT6A 2ZHKA 4IV1C 4QDQA 4ASLA 4INDA 4GJYA 3VGIA 1FI2A 2PMWB 2WZR3 4WBBA 5CFCC 1DQ1A 5DG2A 4GZ9A 4CU9A 1F31A 1OLRA 1T6GC 2GMMA 1PNFA 4NPLA 3GNEA 1SPPB 1NOVA 3TEXA 1WMXA 3RGBA 2GNTA 5K7PA 2ZBJA 2DFCA 3QH6A 4FPGA 1JOBA 4JGYC 4IEYA 4KU7A 1QMJA 2Y26A 5A1LA 4A41A 4QPGB 4N9IA 2ZPXA 4CCOA 1OD3A 4LBKA 1JYCA 2KM2A 3LAGA 2WINB 3AP6A 2RDNA 3CHXA 4QHZA 3ZMOA 1D7PM 4Y4YA 4YG3A 1MEC1 1OHFA 1W6OA 2XHNA 1H1MA 3FN9A 5JPMB 4CXXA 1K3IA 2Z4FA 4NVPA 3OGRA 4HPKA 5FO7B 4ASKA 4E9KA 3U0ZA 5KHJA 2VNOA 1UN1A 5IWFA 5CYYA 4AI8A 2PFWA 3BIEA 5BUVA 5LRSA 1AYM3 5HXMA 1GOHA 3AXDA 5LBCA 1ND2B 3S0MA 1IGOA 5JCTA 3W5MA 1UPIA 2VH9A 2HWD3 4HFSA 4Q27A 1QH6A 2GP3A 4WVVA 2EIDA 3FBYA 5IVCA 2LM3A 5H9SA 3WW3A 3PJYA 1LOBA 4FAHA 3UKVA 1QF3A 1EV11 5FZAA 5F3EA 2Q5TA 1SLTA 1W6NA 1W9SA 4ZXKA 4D8MA 1NYWA 2BNNA 3VZKA 4FBFA 2EXHA 5I8TA 4LXLA 3ACLA 1RUJ2 5DUXA 3BN6A 1COV1 5A7OA 1NCQA 2DF7A 3BTAA 3B94A 2BDRA 3WUDA 2ZGMA 1ZBE1 2A70A 1RUE1 4LEJA 1JBCA 5D8AB 3ITQA 1FXZA 1J59A 1BYHA 2BFUS 1D4M3 4CEWC 5CFDA 1NE4A 3FBMA 4QHOA 4V2VA 5IK5A 2HYXA 2FDFA 1OQDA 1NCRA 1NKGA 2D43A 2IUWA 3BYWA 5KBFA 1FPN1 1S0BA 4EWDA 2D7FA 1ZBA1 5FQ0B 2JDZA 4JTOA 1VR3A 2W1SA 3B3QE 4Q4V2 1V6LA 1DZTA 2WO3A 3W21A 1G9FA 4RL7A 2O14A 1UF2C 1LOFC 4LO5B 3N4MA 4WVWA 4Y22B 3WNKA 3WHTA 5JXJA 3EXUA 1LU2A 2ZMLA 1LR5A 1A78A 3LDKA 4S2DA 1QDOA 3A4UA 2HWB2 4LQRA 3GYDA 3SKVA 1O4ZA 4Q4X2 3CF6E 3WNMA 4QX5A 3TB0A 3NMBA 3WOGA 2XDVA 1W9WA 2ILMA 5CKQA 2VCAA 1JZ6A 1U0AA 4YLZA 1VRH3 2IVIB 3POGA 2J1AA 3Q8BA 1R081 1UKGA 2WO1A 4MSVA 1PZ9A 2PAKA 5C9AC 3T0BA 1IS5A 3MLLA 4LKFA 2D6NA 2R30A 4ISRA 1HW5A 4R9BA 2XLFA 4XJWA 2VMHA 1EAH2 4JAAA 3DXTA 4CCJA 4MGKE 3WQ7A 3NV1A 4S2GA 3PL0A 2VOWA 1Z0HA 2QQVA 2IXIA 1X9PA 2WNEA 3J7LA 4LO4B 4RA0A 4U2AA 5FFOC 4K20A 2J1SA 1XPWA 1OMIA 4W6YA 3PMSA 1ST8A 3TNPB 1E57A 3A22A 1G7YA 3BPZA 1AR92 3PURA 2R042 5DAQA 4A2UA 4IV3A 5AC91 2WA3A 1MS1A 2ZACA 4FOVA 2BYVE 2IXKA 4CPBA 5IW0A 1CD3G 3Q8FA 2VCMA 2ZEZA 1W8ZA 4P00B 2CTVA 4XQDA 2RJKA 5LY2A 2WWUA 5A3OA 4CCKA 4WZFA 4FTSA 2MHFA 1F5FA 2NLRA 2QUOA 3IMNA 1W03A 2R073 3OOXA 2SBAA 2FCVA 3OGGA 1YNAA 3E5UA 2ARAA 4YVSB 4AHZA 2FMDA 2D6MA 1DGRA 2G4IA 3ZFFC 3RWKX 5T55A 1A34A 2ZX4A 3ES1A 3VBSB 3POWA 2ZKNA 4QX7A 2X29A 2Z2SB 3T3YA 3ZXEA 4AF9A 1AL0G 5KR7A 5HCFA 4AVVA 5EIYB 3DN7A 4K1ZA 2XOMA 3H50A 4X8NA 5D2AA 2WS91 3A21A 4XHXA 2W92A 2BP6A 3Q8CA 2CGOA 5A7SA 1FATA 1U5XA 4NWVA 5FUIA 5J37A 1MR5A 5C71A 4AI9A 4QB6A 1HRV1 1BKZA 1UW8A 3OTFA 1CAVB 4P9LA 3NKTA 1AR71 2BVVA 1W6PB 1VMJA 3ZXKA 4RR3C 1H1IA 1VLNA 1LODA 2XPJA 3T2TA 1D2SA 2VZTA 4Q4V3 1LEDA 4XBLA 2GAUA 4XJUA 3VBOC 4O65A 3I4IA 3HT1A 3I2IA 3DPRC 3NO8A 4LE3A 3VZJA 1RUG2 3P3NA 4RHV3 4BISA 1OOPC 4XFAA 1SPPA 3M3IA 4LBMA 3O0WA 1JOJA 2BJSA 1Q8SA 2O8OA 1SACA 1QJEA 2BOJA 5FTTC 4ES9A 1QQP1 2HWB3 4BH9A 4FFFA 4XZUG 4FOWA 4Q4X3 4G4FA 2XVLA 5FXVA 1UX7A 1A6CA 5FBJA 2AEYA 2D98A 2J1VA 1S0FA 2YY1A 4JZRA 4ARXA 2W2IA 1RUI1 2VNRA 5JXGA 4ZHNA 4NIGA 2YV8A 5FUPA 4BE3A 1GP4A 3UJOA 3ZDVA 1V6MA 4DEQA 1UU4A 1VB4A 2YBSA 3R4DB 3P3PA 2VOXA 4L2NA 3PIJA 1ULGA 2RS32 2P17A 1LKNA 3WDYA 2ZXQA 2YB7A 1VBC2 1R082 1R64A 2G9ZA 2FQPA 4FQZA 3KV6A 4XDPA 3S5AA 4OUEA 3U78A 4D6SA 3ZXLA 3KGLA 3RJ2X 4JV4A 3WDXA 1H4HA 1J3QA 1QJY2 2CGNA 1O7FA 2NMNA 3POSA 4BQ2A 2JD9A 2TBVA 1JMUB 5FY1A 4EROA 4JQTA 4FCAA 3I3MA 3N35A 2Q8EA 5D8AA 2BU9A 1MEC3 2JE9A 2QFEA 3H3UA 4FT8A 4AWDA 1CESA 4GB31 1YHFA 3BPSA 4HN1A 1X33A 2VGDA 2XWJB 3ZXAC 4Y20B 5FQ0A 3N9MA 1EPWA 3OEBA 5K8SA 5JXIA 2YC4A 1Q3EA 2A73B 4JDMA 1EV13 3GBFA 1X82A 2JDUA 1GMMA 5FLIA 3CDZB 3SEEA 4OYUA 2JDKA 1UZVA 4Y22A 2XGXA 3WW2A 1COV3 1OKQA 1UCXA 1JHNA 1PO11 1JU4A 3E6CC 1ZBE3 3RYPA 5FZ0A 3LFIA 1RUE3 1I5ZA 4HKOA 1UYZA 1Z7S2 2C26A 1QKQA 1A8DA 3POJA 4IUGA 2BOIA 4NIIA 4IEQA 4NN0A 4YVWC 4F8AA 2EIEA 3VDCA 3WLUA 3HQRA 1S4CA 3VBFC 2BRTA 2WNOA 2WNVB 3A0KA 4QKDA 3KQ4B 1WA6X 3AMMA 4V1PA 3T2PA 3AZWA 1I3HA 2WYFA 3VL9A 1Y9GA 1AR72 4RGGA 1ZBA3 5J96B 1O5UA 3VBHC 2C9AA 2EF6A 3VZOA 3ZFEB 4YARA 2YU2A 1V9U2 2WKKA 3WD5A 1UNBA 4FPKA 4HVRA 1QHDA 4YGEA 1NG0A 1ZZ9A 3LEKA 4NOTA 4FSJA 2KA3A 2FHRA 2QKDA 3AMHA 4CDQB 1SBFA 3AMQA 2GNDA 5FUNA 1ZRFA 1DZQA 3I2JA 1PZ8A 4NRQA 4I3GA 2ZX1A 4COUA 4QB1A 5FPZA 5LK7B 4XACA 2CDPA 4HSJA 3KF3A 5FCCA 4C0BA 2VQAA 1Q8PA 1RUD1 4PF5A 4XXPA 5GZDA 2DYCA 3WW4A 4Q2FA 4MHRA 4AEKA 3JB8A 4CA9A 2PELA 3I3BA 1XSRA 4ZU4A 2ZHLA 1K45A 3T09A 2GNMA 2RS33 3OYWB 1XB9A 1GWMA 4MO3M 4NMIA 5A33B 5IAXA 1VBC3 3RYRA 2BPA2 1R083 4JDNA 4Q8LA 5KXCA 5FYMA 5IHRA 3MPPG 4YVSA 5DDJ1 2AACA 1MS8A 2PAMA 1XU2A 3K3NA 3R4UA 2UU8A 3NNJA 3VBSA 4YWAA 5D21A 4FPYA 5GLZA 3A0NA 1QWRA 2JG9A 3ABZA 1K5JA 3SH5A 2WWJA 3ELNA 4FPCA 3WVJA 3GJBA 1GZWA 5FK8A 3WCSA 1GOGA 4B7KA 3CL1A 5CKNA 3FUQA 1DBNA 3PLQA 1WBLA 2OUHA 4K8FA 4YZ2A 1WD4A 5AC93 1VAMA 1BBT2 2ZA9A 2WYSA 1C28A 5T50A 3VKNA 1CAVA 3RFRA 1UY2A 3ZYPA 1W6PA 3N7LA 4TLGA 2Q0AA 1OUXA 5DAXA 2JKXA 1UIKA 4XW3A 1H8VA 3USUB 1KD7A 3QACA 4GB32 5E88A 5FK7A 5A3PA 5IVJA 3THCA 1FT9A 3NJXA 2WSUA 2CU5A 3ZXGA 4HETA 1PVXA 1O6UA 5EZWA 3IIIA 4P9WA 1OFNA 2NQYA 3AP4A 1FOD1 4YW2A 3HJRA 5DPNA 3SMHA 2ZEWA 4M3CA 1W99A 1RUF2 5IJRA 5FYBA 4EN9B 1YYNA 3MDPA 5F3IA 3VKFC 3ZYRA 2ZGSA 4DQAA 3MF6A 1S0EA 2WS93 3RJRA 2WT1A 5EPAA 2C5DA 3IAPA 2D3SA 1OA4A 3KCCA 4ATFA 1OPMA 1HRV3 2ETEA 2JIJA 2TEPA 3VKOA 4A6SA 2W52A 3PUHA 1AL22 1AR73 2XVKA 3HBZA 4PBPA 4Q0QA 1QY4A 3H9AA 5DUWA 1H0BA 3T2OA 3LQCA 4BLJA 3KS7A 1L7RA 2QQIA 1YIPA 1C5IA 4Q0VA 2D6LX 3RSJA 5C6CA 5C4WC 3FJSA 2IXLA 1ASJ2 1QDCA 2GSYA 4YZ3A 4LHSA 5CB7A 2JKBA 3ZR5A 4EYUA 1MQTC 4HBNA 4QD2A 2Z42A 2UY9A 4HZFA 3UYJA 2J42A 3NL1A 4Q29A 1C1FA 3EQEA 2WFF2 1G8WA 2VECA 4QM9A 4PDWA 4CDUB 4EN0A 3RG0A 3WNOA 3O1TA 2PHDA 4YW4A 3M2MA 4MXWB 3U10A 2EAKA 4EQVA 5F37A 1QJU1 1WMEA 2OZ6A 2JWPA 2XHKA 4L97A 1O59A 1VMHA 5FJHA 4AQSA 5LY1A 1JW6A 3VBRC 1YXWA 3ORJA 1IOAA 1LGNA 1U5YA 3A23A 1YEWA 2G1MA 4QQOA 2DCJA 1KQRA 4BIFA 1B35B 1RUI3 3AVRA 4AVAA 1LNSA 3SCFA 2PHWA 1VAVA 3GBGA 3FFZA 3H8UA 4XILA 4Y20A 1W9FA 1OBNA 3HD8B 4ZXEA 3URFA 4IGOA 1UOGA 2GMEA 2XWBB 4UXAA 4B4QA 1EUTA 1CWPA 5IUQA 3WP6A 4A3ZA 1V70A 4I0WB 4JKLA 1DLLA 2WZR1 3I54A 4O9EA 1JYWA 2YFUA 1YO8A 3QCWA 4XEZA 1Y4WA 1MZ6A 2WT0A 4G9SB 3UGHA 4D7YA 5JI7A 3AJYA 1ZRCA 2GH8A 4LBLA 5ISLA 4AFAA 4L99A 4QX3A 1J3RA 1BJQA 1YIFA 2W95A 2VZQA 3ETPA 5CIRA 2OPWA 4GB33 1IQDC 3DUIA 4GH4B 2SLIA 4I30A 4CCCA 4CDXC 4KI5M 4KWKA 4HT1T 2WNVA 4IEXA 1H2NA 2LW8A 1GLHA 2HWE2 3ZXFA 4TSVA 3S57A 4JKKA 4D94A 2PLV2 2ARBA 3ATGA 2CDOA 3O14A 5K9YA 3KMHA 4R9AA 1KS4A 2QZ2A 2VMCA 1AXKA 4X6RB 4ASMB 3WDTA 4MGZE 2XKPA 3ZFEA 1DU3D 3M7AA 5FZGA 2XJUA 2QJVA 4Q26A 4Q4Y1 4H3WA 1AR82 3SHRA 3ZSEA 2YBPA 2PHXA 5A6YA 4CDQA 1Y9MA 4EZ4A 1NY72 1R092 2QQNA 4HG6B 1PO13 3RQ0A 3NAPA 4D6QA 4ES8A 3IN9A 1ACCA 1LCLA 4YNIA 1YQ8A 4KG0A 1VIWB 3OYWA 3P5BA 3MUZ1 1ASJ3 1UY1A 2WNUB 4H55A 4IERA 5A33A 4L11A 2CL2A 4IV1B 3RZLA 1RUNA 2OQ7A 3SXWA 1DF0A 5HCHA 1S0GA 4EJRA 5CFCB 2WWSA 5DG1A 1LULA 4CCEA 1DQ0A 3JQXA 1NE6A 5GM0A 5DN2A 3ZN4A 1JUHA 1SLIA 1LB2A 1PGL2 3JB4C 3LGRA 3OBRA 4YM3A 4BHPA 5FY4A 2RVAA 1OKOA 2NN8A 4JGYB 1TME2 4LHKA 2VUCA 5JSRA 1AX0A 5JVVA 3HWJA 3TN92 4DY5A 2ATFA 2FZ1A 4E2QA 1GZTA 3HIFA 3I2HA 3VLBB 3NNFA 2CY6A 1D0HA 2RMU2 4XF0A 1O4TA 1RUD3 3BALA 5IK8A 2BBVA 2ZX0A 5LA0A 3USUA 3TEZA 1OI6A 4QMAA 1RHI2 3Q9OA 4FOQA 3UJQA 3AXEA 3RWNA 4CEYC 5CG8A 5A7QA 2XLAA 1JODA 3HQXA 4AVSA 2Y8KA 2WN2A 1QNYA 1FV2A 4AQ6A 4ZU5A 5F1RA 3HT2A 4RS5B 4AG4A 4OI1A 2RS52 2W08A 2P4EA 4BJ0A 1KFUL 5FZLA 3W58A 3WR0A 1QEXA 3EMRA 1QOTA 2A6XA 4MHUA 5EJ3A 2X5IB 4YM1A 3AKRA 2VZ3A 2EXJA 2OQ6A 1UOFA 5EJZB 1WLWA 4JKMA 1SDWA 4L9BA 2YZ4A 4O9GA 5EYYA 4LIUA 4CCNA 1R1A2 3GALA 2H0VA 1UQXA 1H6XA 3DCQA 2R1DA 4LMFA 1CZVA 1VBE1 3O0VA 3T30A 2PHRA 3B9IA 4COYA 1I6XA 2TNFA 3SEPA 4LOTA 4AHXA 1A3KA 2YG0A 3E1F1 4HLTA 1HX6A 1L7LA 5CKMA 3ZN5A 5KHKA 1N1SA 1YRZA 4CU6A 3OBZA 1VBA2 4A42A 3QLQA 1AR83 3N9NA 5FYHA 2IZWA 4LK7A 1JOPA 1ZRRA 2JDHA 1LRHA 3GF6A 4CDUA 2IFWA 2HKXA 3ZSMA 2CAUA 1FOD3 1GBGA 1RUJ1 3MW2A 5T52A 2EIGA 4MXWA 3WP4A 1ZM1A 5CBLA 3K4ZA 4LITA 1IHMA 1ZRIA 5B2GB 1ZVFA 3UNPA 1GP6A 4BWOA 1LHUA 4BMBA 4BQYA 3DYMA 1US2A 3JD72 4MOAA 3HOBA 2V4AA 3P6BA 2R062 2ARCA 4N7IA 5GZGA 4KWLA 2R6QA 3AFGA 1B35A 1ZRDA 1YLLA 5FYVA 3ZLIA 3VUOA 3NRUA 3U11A 1PGW2 4JGZC 3VDDC 2WO2A 2ZZJA 5AFEA 5C9AB 4FFIA 5LA9A 3N7KA 3FX3A 1DGRN 2B45X 4MYEA 4X8PA 2BGCA 1QOSA 1IS3A 3OPTA 1OC1A 2IXJA 2QQKA 1REDA 4JC1A 4AI1A 5JWPA 1J3PA 1UKRA 3AYCA 4DO0A 3WV6A 3TN93 4COWA 1RB8G 2VVDA 2XLGA 1ZZ6A 4CU7A 4DB5A 3B9CA 4LHNA 5C8CB 2Z5WA 3NVCA 4I02A 3SH4A 3GCXA 2VZVA 4URAA 2HWB1 4DEVA 3B00A 4Q4X1 3G7DA 1PHMA 5IYYA 1RHI3 1JZ7A 1MVEA 3LEIA 4Z2WA 2RDSA 4Q4W2 5IFPA 4XVHA 2QZ3A 3ZYFA 1QU0A 1F9KA 4M00A 3E5XA 5DAPA 3HMYA 2R16A 1PNGA 4UBHA 4XIOA 2ZOEB 2A6YA 3OUJA 4NHKA 2DUQA 4NUBA 4XUPA 4AQ2A 5B4NA 1EAH1 1JZ4A 3NWKA 5DQ0A 1LHOA 1O3RA 3ZFFB 4KQ7A 3HN3A 4WM7C 1PX4A 4P08A 1ZX5A 2OVUA 1MS9A 1WW6A 4UT5A 3MFAA 1BEV2 3V65A 1RXFA 1AR91 2W1WA 2R041 2AENA 4W6WA 4YM2A 3C7FA 3NJZA 1SCSA 1Q56A 3FE5A 4QGMA 2C0ZA 2GU9A 3TYJA 5H9RA 1MPXA 4GWIA 1POQA 5F2WA 5JZGC 3GHMA 4K9SA 2DFBA 2WNUA 1YFXA 1VBE2 3DKWA 4IV1A 2WSVA 4CCMA 5HCAA 3GZUC 4DINB 2DCYA 3ZSJA 5BNOB 4I0BA 3OBTA 5FYUA 2DDUA 1DP0A 4XF9A 4RFRB 3VBOB 1LOCA 3DPRB 4KL1A 4ZS3A 3VV1A 1OF3A 3NNGA 4AL9A 1OOPB 4CCDA 3C2UA 2H0BA 3RZJA 2UY8A 2EA7A 3DYPA 1WLTA 1RXGA 2B39A 4JGYA 4Q4Y3 1HN0A 4OLLA 3ROUA 3JD73 5DZFA 2VO5A 1UAIA 4NPRA 1W04A 2J1RA 4A7YA 1HRI2 2RJ2A 1UZ0A 2LALA 4BPZA 1TE1B 4UFKA 2G19A 1NCQC 3J4UH 2E63A 1W2TA 4RFT0 5I0RA 2ZGUA 5J36A 1VBB2 4HK9A 3KB5A 1DQ5A 1GANA 1REFA 2I74A 2VBBA 2DTWA 1W2UA 4ZKTB 1CZSA 5CFDC 1SLBA 1X50A 3ALQA 4CTEA 3FUOA 3FLRA 3MW4A 1UXXX 1NCRC 4MXVA 4UI9L 1V6NA 3I3QA 1JYVA 1RUG1 1PVC2 1RUC2 4RS5A 3I59B 5A3WA 2BERA 1CIYA 1ENRA 2W46A 2JB8A 2BV4A 2D3PA 1W8NA 2YYOA 2X5IA 4IXLA 4XFGA 3S6PA 1AJOA 4UFIA 5IVFA 5A7WB 1RTVA 4DXRA 4WV8A 4BA6A 2O1QA 1LHWA 4OI0A 3SC7X 3WF1A 2VCBA 1W8TA 4AFBA 2JXAA 2XONA 1ZZ8A 4Z82A 5T5OA 1IG0A 2X10A 1W8HA 1ONAA 3BCWA 1ENXA 1BQPA 2MEV2 5G04L 3ZFGC 1AR62 1GWKA 1XYPA 2VMEA 3I8TA 1XXNA 3ZOIA 4K40A 3WF2A 2RS31 4S2FA 1VBC1 2WA4A 5FYSA 2FDKA 4QX2A 4P14A 5BV6A 4XAAA 5FZFA 3AZZA 4OHZA 1O91A 2O0OA 1S2EA 1S2KA 1BEV3 2OXBA 2HEYF 1LOFA 5E1RA 1QJY1 3MIGA 4N53C 2C4XA 1JU3A 1W6QB 1K12A 1X9TA 3HVDA 4AGRA 3NV2A 3TRSB 2HEWF 3CJXA 2WRAA 3K3OA 5FP3A 3ZYBA 1DGLA 5T5JA 3BTYA 1XNAA 2PA7A 2BFUL 3AKTA 4XAEA 3GM8A 1VBE3 2FZ2A 2RR12 5JR2A 4YVWB 4IV3C 1OLMA 5C7GA 3VB9A 1KDMA 4JDOA 4CDWC 5C3QA 4GA9A 3VBFB 3ILNA 5AVAA 3MGUA 2YROA 1E5RA 2QCSB 1IKPA 3E5QA 4LBQD 4Q1PA 1UZYA 4YFWA 3V0BB 2GC1A 4FTBA 4FFHA 2EXKA 3N9QA 1NZCA 3CJIB 4B1LA 2YU1A 3D5OA 2GH2A 4CUGA 3VBHB 1XU1A 4LKDA 3KT7A 2IWGB 1JHJA 1FX5A 3N36A 1KITA 1YJLA 4N8MA 5A6ZA 1RUJ3 2D97A 3EYPA 3I97A 3WNPA 5C8CA 2AEZA 2RDQA 3ACFA 4NE9A 2D93A 2ORZA 1XQNA 5G05L 4KNCA 3WXPA 4DFSA 4KGGA 4BXFA 1L7QA 1VBB3 4ATEA 2OYZA 5A3LA 1DIWA 3WHUA 1Z7S1 4CXYA 2A6ZA 4FOYA 2VM9A 4NR1A 5FZIA 4WM8B 4XE9A 2Y6JA 2ZGRA 1SBDA 3AB0A 2E33A 3V0AB 4Y1VA 3O1UA 4FPEA 3ON7A 2VNVA 2RM22 3NW4A 3ZPYA 5FPLA 4XUTA 4LA3A 3SNMA 4OCTA 1S0JA 2Q1ZB 2OS2A 4AFDA 1V9U1 2WFPA 3UKTA 4Z1VA 4H7MA 2BVBA 3ZFFA 3AYAA 3ACGA 5BNQA 1GP5A 4E4HA 2OW4A 2VVEA 4M4RA 1O3QA 2FD8A 3AC0A 4C8DA 3W5NA 5FLHA 3J8F2 4M4PA 5ABJB 4YG0A 4QPGA 2I2SA 1EY2A 1OT5A 3ZKUA 3VHPA 3BU0A 1W90A 2RE9A 2GZWA 4H14A 4IE5A 4V2WA 5GALA 2JE8A 4MADA 4MUVA 3T1LA 5C33A 5A3NA 1APNA 1CGPA 4D7TA 3FMGA 3RYKA 4UFHA 5LATA 2VE1A 2Y64A 4XXAA 1RJ8A 1LTEA 3M3OA 4LT5A 4GALA 2YC2A 4LR4A 3KVBA 5BNOA 1UO9A 3VBUC 3VBOA 5JXHA 2VUAA 1ND2A 1YI9A 1C5HA 3DPRA 3N3HA 3TEWA 3R0RA 2B42B 1EAH3 3LA2A 2WLQA 5FMOS 3F95A 1CR7A 4QAWA 1TMF2 2D44A 2WT2A 3K46A 2CYFA 2Q4SA 4YPJA 4JX0A 3AKSA 1FNYA 2HYKA 3LPGA 3UGFA 2Y0OA 1UZWA 4YW6A 1H6YA 2FMYA 3JXSA 4LUKA 1RMU2 3MUY1 3W20A 1AR93 3R05A 2R043 1DYOA 2JG8B 4IE0A 1BBT1 1W3XA 4J1WA 4NIHA 3WSOA 3UETA 3VHOA 5I91A 2YGMA 4AVTA 1W8UA 3PUSA 5FYIA 2K0GA 3U4SA 2DV9A 4RSUA 1RUH2 3O7OA 1ULPA 2WL1A 2VJXA 5J48A 1M06G 2EICA 2VD7A 4R8HA 1WW5A 4W6XA 1CPMA 3KV5A 4QKFA 2XBO2 5F6KA 5C4WB 2C24A 4ISQA 1HV1A 1H2LA 3I59A 4I09A 5J98B 4I2OA 3MIDA 3MV01 5K4LA 1ZNPA 1U5ZA 4NHYA 1PGSA 1VMFA 1HB3A 3Q8AA 1V6OA 3JQWA 4P9XA 1RUF1 1WUVA 2DVFA 5A7WA 4OMCA 3M4FA 3KLSA 2HWC2 1H2KA 1W05A 2KXLA 4AW7A 4DUXA 4Y1UA 3O1PA 3VBRB 2Z79A 1LGBA 1PMHX 3GZEA 3IDEA 2R0HA 1CAUB 5HPOA 1W6MB 3ZR6A 4Y1XA 2JB4A 2VZOA 4YRDA 5FZ3A 1J1LA 1BMV2 5L9VA 4FPOB 1AL21 3OJBA 4XTPA 2VBDA 4RGAA 1C8M2 1ENSA 3IMMA 3T0DA 1QGLA 2UWAA 4XCAA 5JMCA 1ASJ1 1DG6A 2BEOA 3MBWA 4LLFA 2PHFA 1SEFA 3CQOA 1N1VA 3CMGA 2DUOA 3MIBA 3QBQA 4KGQA 1RUG3 3TAYA 4DOUA 4OZXA 4EZHA 1SHWB 5E6HA 5A70A 2WFF1 4ZU7A 1GNYA 2MNGA 3UGGA 1W2AX 5BNNC 4XMAA 3H3LA 3J8F3 3AZVA 1MZFA 2IVJA
chains in the Genus database with same CATH topology
2W95A 2VZQA 3ETPA 3FHQA 1UMHA 2YFZA 1IQDC 1XNTA 2WUHA 4KI5M 3T2QA 4TTGA 3HPNA 2LW8A 2L9LA 2X05A 2W5FA 1UY3A 4JKKA 2CDOA 3I2KA 2VMCA 2HLEA 1NX9A 3VD4A 3IB3A 5IFTA 2BBAA 1P8JA 3CIHA 3WNLA 2J1UA 3GGLA 3T08A 2QQNA 4HG6B 4XUQA 2KD7A 4PT6A 4QDQA 1JYXA 4OZOA 3MUZ1 1UY1A 4GZ9A 4AAXA 4CU9A 1SG3A 3VD9A 2VMDA 5DN2A 4A41A 3HNMA 4KWUA 1OD3A 2RVAA 4CVUA 1WCQA 1D7PM 2XHNA 3FN9A 1K3IA 2Z4FA 3OGRA 5CYYA 3I2HA 1GQPA 3FL7A 5HXMA 1GOHA 3W5MA 4UAPA 4CUAA 5LA0A 3MO4A 5LA1A 4W4ZA 2EIDA 2QQOA 5EJ1B 4PF1A 3MV11 1W9SA 2Y8KA 2W47A 2WN2A 4D8MA 2Y6KA 2WDBA 4AG4A 3BN6A 4BJ0A 2W91A 3OGSA 2VZ3A 4ET7A 5EJZB 4JKMA 4PQQA 1W8OA 4DXTA 5DMYA 1H6XA 1CZVA 4L0PA 2HYXA 2VZ1A 1NKGA 2WAAA 2PQSA 2WAOA 2J1EA 3SEPA 2W1SA 2YG0A 3E1F1 4FI9A 4CU6A 2WO3A 4A42A 3WF3A 4A44A 4BK5A 3WNKA 2J22A 5JXJA 1O8SA 3K4ZA 4QB2A 4LQRA 3UNPA 3SKVA 3WNMA 3DYMA 1US2A 4MOAA 3HOBA 1JZ6A 4DUVA 1W9WA 4RYDA 4ARYA 2VCAA 3P6BA 2J1AA 2WO1A 4A45A 1UWWA 3T0BA 3NRUA 4JHZA 1UXZA 2WO2A 4QX0A 4DXSA 2VL4A 4BXSV 2QQKA 2J1SA 1XPWA 1JZ2A 4A4AA 3A22A 4CU7A 3HNBM 4D0QA 2VTFA 2V72A 1JI6A 2VZVA 2WN3A 2ZEZA 4P00B 1UMIA 2ORXA 1W9TA 4DEVA 5IYYA 1JZ7A 1UYXA 3LEIA 3C7GA 5IFPA 4XVHA 4DUWA 4ZZ8A 2Y6GA 5JMOA 5B4NA 4XUPA 1JZ4A 3ACHA 5C70A 5DQ0A 4A6OA 3HN3A 1JZ5A 1PX4A 5EIYB 4P08A 2XOMA 1OH4A 3A21A 2W92A 5FUIA 2W1WA 5C71A 4QB6A 2QQMA 3C7FA 1JYNA 3LPFA 2VR4A 3D3AA 1MPXA 1J83A 4GWIA 3C7HA 2VZTA 3UESA 4BK4A 1SDDB 3VDAA 1PX3A 3I2IA 3P1IA 2W94A 2DDUA 1DP0A 4E8DA 3WF0A 2OKXA 1BHGA 1OF3A 3NNGA 1YQ2A 3CKHA 3WEZA 2E26A 3DYPA 5CZKA 1O8PA 2W1QA 3OGVA 2QQLA 4XZUG 3IAQA 2VO5A 2VMFA 2VZSA 1UX7A 2J1RA 3VD5A 2J1VA 2RJ2A 1OF4A 1UZ0A 4ZY9A 4ARXA 4MGQA 5JXGA 1CZTA 3CZUA 4P5YA 2W1UA 2LS6A 5I0DA 4DEQA 4ZZ5A 4TXWA 3OEAA 1GOFA 1CZSA 2ZXQA 2YB7A 1R64A 4OMDA 3NJVA 1UXXX 4UI9L 4OUEA 1JYVA 3GXUA 5B4XA 2BERA 1CIYA 4QPWA 2W46A 4UOJA 5J1XA 1W8NA 2JD9A 1HN1A 1US3A 2J7MA 3F2ZA 4DXRA 1GUIA 3WF1A 2EIBA 2VCBA 2XONA 2X10A 1RYYA 1W0NA 5G04L 1NUKA 2VMEA 1JZ8A 3OEBA 5JXIA 2YC4A 3A7QA 2RV9A 3WF2A 2DCKA 4QX2A 1GMMA 1T2XA 3CDZB 3SEEA 4OYUA 3NQHA 1UY4A 2C4XA 1JU4A 1JU3A 2BGOA 3GDBA 4W50A 2WBKA 1K12A 1UYZA 2C26A 4IUGA 1PMJX 2BGPA 2EIEA 1XNAA 4CUCA 3VDCA 1GU3A 2WZEA 1F4HA 3GM8A 3EB7A 4KMQA 2ZEYA 5JR2A 3K4DA 5C7GA 3K75B 3T2PA 3I3DA 4QX1A 2BZDA 2VZUA 3LEKA 3VDBA 2VCCA 1JHJA 2ID4A 5LA2A 3ZM8A 2V4VA 3I2JA 2JDAA 3EYPA 3I97A 3WNPA 3ACFA 4QB1A 2ORZA 5G05L 2VOTA 1TG7A 2CDPA 2VQTA 1L7QA 2R7EB 3I3BA 2WQ8A 1K45A 3OBAA 3T09A 4MO3M 2VM9A 2VZRA 2VC9A 2Y6JA 2E33A 5IHRA 3THDA 1JZ3A 1NAEA 4XUTA 3IDAA 1KGYA 1F4AA 4W8JA 1DLCA 2J1TA 3PUIA 3ABZA 2W9XA 3ACGA 1GOGA 3I2GA 3LE0A 3DYOA 4M4RA 2XQXA 3WQBA 4BDVB 3AC0A 3W5NA 2Y6LA 1KEXA 3I2FA 4M4PA 2WYSA 3J7HA 2WABA 3HNYM 4Z2AA 1OT5A 3LEGA 1UY2A 1CX1A 5JUVA 2JKXA 4XUOA 2JE8A 4MADA 2C9KA 2ZEXA 3THCA 3NJXA 2X09A 2Y64A 3U37A 4QDSA 1K42A 1J84A 2QQJA 2YC2A 4XUNA 3IIIA 4XURA 5JXHA 2V5DA 3VD3A 3HJRA 5DPNA 4GWJA 3C7OA 2ZEWA 1W99A 5IJRA 4QDRA 3C8XA 4QAWA 3K77A 4YPJA 3K46A 4JX0A 2WZ8A 3LPGA 1H6YA 3JXSA 3IAPA 3MUY1 1DYOA 4MGSA 3WSOA 3UETA 4E8CA 3PUHA 3HEIA 2B4KA 3T2OA 4CUBA 3LQCA 3I3EA 3OG2A 1L7RA 5LCWL 2QQIA 4CU8A 1ULPA 2VJXA 4LHSA 2EICA 2B9VA 3FHAA 1UY0A 3ACIA 4LKSA 3WNOA 3MV01 1EUUA 2W3JA 4RN5A 2E31A 3WF4A 1O59A 3ECQA 1I5PA 4OMCA 3DECA 2E32A 3A23A 5A1AA 4DUXA 3VD7A 1XC6A 2DCJA 3K4AA 1PMHX 1LNSA 3BGAA 5HPOA 4P02B 3T0AA 2VZOA 1WKYA 4ZXEA 3WNNA 2VZPA 3CZJA 2VQUA 1UYYA 2Y6HA 2W87A 1EUTA 3T0DA 4A3ZA 4JKLA 1TVGA 3MBWA 5F7UA 3SKJE 2YFUA 3OB8A 3CMGA 3CQOA 1JYWA 2QBXA 3C7EA 1SHWB 1ULOA 1GNYA 4QX3A 4LPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W95 A;  2VZQ A;  3ETP A;  3FHQ A;  1UMH A;  2YFZ A;  1IQD C;  1XNT A;  2WUH A;  4KI5 M;  3T2Q A;  4TTG A;  3HPN A;  2LW8 A;  2L9L A;  2X05 A;  2W5F A;  1UY3 A;  4JKK A;  2CDO A;  3I2K A;  2VMC A;  2HLE A;  1NX9 A;  3VD4 A;  3IB3 A;  5IFT A;  2BBA A;  1P8J A;  3CIH A;  3WNL A;  2J1U A;  3GGL A;  3T08 A;  2QQN A;  4HG6 B;  4XUQ A;  2KD7 A;  4PT6 A;  4QDQ A;  1JYX A;  4OZO A;  3MUZ 1;  1UY1 A;  4GZ9 A;  4AAX A;  4CU9 A;  1SG3 A;  3VD9 A;  2VMD A;  5DN2 A;  4A41 A;  3HNM A;  4KWU A;  1OD3 A;  2RVA A;  4CVU A;  1WCQ A;  1D7P M;  2XHN A;  3FN9 A;  1K3I A;  2Z4F A;  3OGR A;  5CYY A;  3I2H A;  1GQP A;  3FL7 A;  5HXM A;  1GOH A;  3W5M A;  4UAP A;  4CUA A;  5LA0 A;  3MO4 A;  5LA1 A;  4W4Z A;  2EID A;  2QQO A;  5EJ1 B;  4PF1 A;  3MV1 1;  1W9S A;  2Y8K A;  2W47 A;  2WN2 A;  4D8M A;  2Y6K A;  2WDB A;  4AG4 A;  3BN6 A;  4BJ0 A;  2W91 A;  3OGS A;  2VZ3 A;  4ET7 A;  5EJZ B;  4JKM A;  4PQQ A;  1W8O A;  4DXT A;  5DMY A;  1H6X A;  1CZV A;  4L0P A;  2HYX A;  2VZ1 A;  1NKG A;  2WAA A;  2PQS A;  2WAO A;  2J1E A;  3SEP A;  2W1S A;  2YG0 A;  3E1F 1;  4FI9 A;  4CU6 A;  2WO3 A;  4A42 A;  3WF3 A;  4A44 A;  4BK5 A;  3WNK A;  2J22 A;  5JXJ A;  1O8S A;  3K4Z A;  4QB2 A;  4LQR A;  3UNP A;  3SKV A;  3WNM A;  3DYM A;  1US2 A;  4MOA A;  3HOB A;  1JZ6 A;  4DUV A;  1W9W A;  4RYD A;  4ARY A;  2VCA A;  3P6B A;  2J1A A;  2WO1 A;  4A45 A;  1UWW A;  3T0B A;  3NRU A;  4JHZ A;  1UXZ A;  2WO2 A;  4QX0 A;  4DXS A;  2VL4 A;  4BXS V;  2QQK A;  2J1S A;  1XPW A;  1JZ2 A;  4A4A A;  3A22 A;  4CU7 A;  3HNB M;  4D0Q A;  2VTF A;  2V72 A;  1JI6 A;  2VZV A;  2WN3 A;  2ZEZ A;  4P00 B;  1UMI A;  2ORX A;  1W9T A;  4DEV A;  5IYY A;  1JZ7 A;  1UYX A;  3LEI A;  3C7G A;  5IFP A;  4XVH A;  4DUW A;  4ZZ8 A;  2Y6G A;  5JMO A;  5B4N A;  4XUP A;  1JZ4 A;  3ACH A;  5C70 A;  5DQ0 A;  4A6O A;  3HN3 A;  1JZ5 A;  1PX4 A;  5EIY B;  4P08 A;  2XOM A;  1OH4 A;  3A21 A;  2W92 A;  5FUI A;  2W1W A;  5C71 A;  4QB6 A;  2QQM A;  3C7F A;  1JYN A;  3LPF A;  2VR4 A;  3D3A A;  1MPX A;  1J83 A;  4GWI A;  3C7H A;  2VZT A;  3UES A;  4BK4 A;  1SDD B;  3VDA A;  1PX3 A;  3I2I A;  3P1I A;  2W94 A;  2DDU A;  1DP0 A;  4E8D A;  3WF0 A;  2OKX A;  1BHG A;  1OF3 A;  3NNG A;  1YQ2 A;  3CKH A;  3WEZ A;  2E26 A;  3DYP A;  5CZK A;  1O8P A;  2W1Q A;  3OGV A;  2QQL A;  4XZU G;  3IAQ A;  2VO5 A;  2VMF A;  2VZS A;  1UX7 A;  2J1R A;  3VD5 A;  2J1V A;  2RJ2 A;  1OF4 A;  1UZ0 A;  4ZY9 A;  4ARX A;  4MGQ A;  5JXG A;  1CZT A;  3CZU A;  4P5Y A;  2W1U A;  2LS6 A;  5I0D A;  4DEQ A;  4ZZ5 A;  4TXW A;  3OEA A;  1GOF A;  1CZS A;  2ZXQ A;  2YB7 A;  1R64 A;  4OMD A;  3NJV A;  1UXX X;  4UI9 L;  4OUE A;  1JYV A;  3GXU A;  5B4X A;  2BER A;  1CIY A;  4QPW A;  2W46 A;  4UOJ A;  5J1X A;  1W8N A;  2JD9 A;  1HN1 A;  1US3 A;  2J7M A;  3F2Z A;  4DXR A;  1GUI A;  3WF1 A;  2EIB A;  2VCB A;  2XON A;  2X10 A;  1RYY A;  1W0N A;  5G04 L;  1NUK A;  2VME A;  1JZ8 A;  3OEB A;  5JXI A;  2YC4 A;  3A7Q A;  2RV9 A;  3WF2 A;  2DCK A;  4QX2 A;  1GMM A;  1T2X A;  3CDZ B;  3SEE A;  4OYU A;  3NQH A;  1UY4 A;  2C4X A;  1JU4 A;  1JU3 A;  2BGO A;  3GDB A;  4W50 A;  2WBK A;  1K12 A;  1UYZ A;  2C26 A;  4IUG A;  1PMJ X;  2BGP A;  2EIE A;  1XNA A;  4CUC A;  3VDC A;  1GU3 A;  2WZE A;  1F4H A;  3GM8 A;  3EB7 A;  4KMQ A;  2ZEY A;  5JR2 A;  3K4D A;  5C7G A;  3K75 B;  3T2P A;  3I3D A;  4QX1 A;  2BZD A;  2VZU A;  3LEK A;  3VDB A;  2VCC A;  1JHJ A;  2ID4 A;  5LA2 A;  3ZM8 A;  2V4V A;  3I2J A;  2JDA A;  3EYP A;  3I97 A;  3WNP A;  3ACF A;  4QB1 A;  2ORZ A;  5G05 L;  2VOT A;  1TG7 A;  2CDP A;  2VQT A;  1L7Q A;  2R7E B;  3I3B A;  2WQ8 A;  1K45 A;  3OBA A;  3T09 A;  4MO3 M;  2VM9 A;  2VZR A;  2VC9 A;  2Y6J A;  2E33 A;  5IHR A;  3THD A;  1JZ3 A;  1NAE A;  4XUT A;  3IDA A;  1KGY A;  1F4A A;  4W8J A;  1DLC A;  2J1T A;  3PUI A;  3ABZ A;  2W9X A;  3ACG A;  1GOG A;  3I2G A;  3LE0 A;  3DYO A;  4M4R A;  2XQX A;  3WQB A;  4BDV B;  3AC0 A;  3W5N A;  2Y6L A;  1KEX A;  3I2F A;  4M4P A;  2WYS A;  3J7H A;  2WAB A;  3HNY M;  4Z2A A;  1OT5 A;  3LEG A;  1UY2 A;  1CX1 A;  5JUV A;  2JKX A;  4XUO A;  2JE8 A;  4MAD A;  2C9K A;  2ZEX A;  3THC A;  3NJX A;  2X09 A;  2Y64 A;  3U37 A;  4QDS A;  1K42 A;  1J84 A;  2QQJ A;  2YC2 A;  4XUN A;  3III A;  4XUR A;  5JXH A;  2V5D A;  3VD3 A;  3HJR A;  5DPN A;  4GWJ A;  3C7O A;  2ZEW A;  1W99 A;  5IJR A;  4QDR A;  3C8X A;  4QAW A;  3K77 A;  4YPJ A;  3K46 A;  4JX0 A;  2WZ8 A;  3LPG A;  1H6Y A;  3JXS A;  3IAP A;  3MUY 1;  1DYO A;  4MGS A;  3WSO A;  3UET A;  4E8C A;  3PUH A;  3HEI A;  2B4K A;  3T2O A;  4CUB A;  3LQC A;  3I3E A;  3OG2 A;  1L7R A;  5LCW L;  2QQI A;  4CU8 A;  1ULP A;  2VJX A;  4LHS A;  2EIC A;  2B9V A;  3FHA A;  1UY0 A;  3ACI A;  4LKS A;  3WNO A;  3MV0 1;  1EUU A;  2W3J A;  4RN5 A;  2E31 A;  3WF4 A;  1O59 A;  3ECQ A;  1I5P A;  4OMC A;  3DEC A;  2E32 A;  3A23 A;  5A1A A;  4DUX A;  3VD7 A;  1XC6 A;  2DCJ A;  3K4A A;  1PMH X;  1LNS A;  3BGA A;  5HPO A;  4P02 B;  3T0A A;  2VZO A;  1WKY A;  4ZXE A;  3WNN A;  2VZP A;  3CZJ A;  2VQU A;  1UYY A;  2Y6H A;  2W87 A;  1EUT A;  3T0D A;  4A3Z A;  4JKL A;  1TVG A;  3MBW A;  5F7U A;  3SKJ E;  2YFU A;  3OB8 A;  3CMG A;  3CQO A;  1JYW A;  2QBX A;  3C7E A;  1SHW B;  1ULO A;  1GNY A;  4QX3 A;  4LPL A; 
#chains in the Genus database with same CATH topology
 1W6Q A;  1WW7 A;  4FP2 A;  4NHX A;  5A3M A;  1ODN A;  1RIR A;  2D6P A;  5C5T A;  3OGJ A;  1WD3 A;  2GMP A;  4GUL A;  1H9W A;  4OUM A;  3KT4 A;  5ANN A;  1GZ9 A;  5H9Q A;  4YVW A;  4YM0 A;  3VL8 A;  5K0U B;  1HB1 A;  1UY3 A;  2D5H A;  3POF A;  3MEP A;  2WQ4 A;  4AED C;  3PU3 A;  2XG3 A;  3LD8 A;  3VBF A;  4CDX B;  4TZD A;  2P2K A;  2HLE A;  3T1M A;  2GP5 A;  3GCW A;  1NX9 A;  4E2S A;  3CJI A;  3IPV B;  3VD4 A;  1TMF 3;  5FO8 B;  4AE2 A;  5FZC A;  3VBH A;  3MLK A;  1G9C A;  2XUE A;  2A6W A;  1B09 A;  1OD5 A;  1VAK A;  3CIH A;  3IT8 A;  2J1U A;  3BTX A;  4DZG A;  2Q8O A;  2AYH A;  3GGL A;  1VJ2 A;  1YFW A;  4AFC A;  4XFH A;  4YVS C;  5HXV A;  4AI3 A;  1PIV 1;  4XJ8 A;  2VBP A;  4F7Z A;  1JTZ X;  1QJY 3;  5ACA 2;  5GZC A;  4YW3 A;  3JBG 2;  2ZKL A;  2ADE A;  3MPB A;  2JG9 C;  5GZF A;  5GZE A;  5CEH A;  4Y5Z 0;  1RIN A;  2E7Q A;  3O1S A;  5D1I A;  4OZO A;  2ZGK A;  2E6V A;  3G6J B;  1OLQ A;  1I1E A;  4WM8 A;  4AAX A;  3E6D A;  2OT7 A;  1RVF 2;  1SG3 A;  1AJK A;  4JRA A;  5F3G A;  3VD9 A;  3AZY A;  4AGG A;  2HWE 1;  5GJ6 A;  3V0A A;  2IXC A;  1DHK B;  5LEK A;  1V6K A;  2PLV 1;  2WR9 A;  3LDR A;  2VOK A;  3LZZ A;  3U1X A;  1LGC A;  4CVU A;  1YC6 1;  1HQN A;  1E5H A;  2E9Q A;  1AR8 1;  4BQX A;  4AR2 A;  1K5M B;  2HWC 3;  4WVM B;  5CU1 A;  4BCU A;  5CIS A;  2FDJ A;  1YJK A;  3PME A;  2R0F A;  2YPD A;  2XVG A;  1NY7 1;  5LRR A;  3FL7 A;  4A7K A;  5ABJ A;  1R09 1;  4EE2 A;  4UAP A;  4UW5 A;  4RQP B;  1MS3 A;  3M70 A;  4CYD A;  2VU9 A;  4W4Z A;  1IPS A;  1Z7S 3;  2QQO A;  5EJ1 B;  4AXO A;  5IT6 A;  3GJA A;  3V64 A;  2BWC A;  1UX6 A;  4YGB A;  3WP3 A;  1WZX A;  1QXP A;  4PF1 A;  4BME A;  5TSW A;  2W47 A;  2Y0I A;  4CEY B;  5FZ4 A;  1S0D A;  4ITC A;  3AJZ A;  1J58 A;  2XL9 A;  5A3T A;  2N7G A;  3VKL A;  1SLC A;  1PGL 1;  3OGS A;  3ZKY A;  1UYP A;  2AH2 A;  4HSL A;  1V9U 3;  1H1A A;  5JOY A;  1TME 1;  5L36 A;  2V5Y A;  2HWF 2;  4E4Z A;  4PQQ A;  3L2Y A;  2ES3 A;  1W8O A;  4DXT A;  3KCY A;  5IK4 A;  3TN9 1;  4PDW C;  2F17 A;  2WQZ C;  1U5I A;  5BXX A;  1AUY A;  4QPI C;  2JG8 A;  2WAA A;  2VQ0 A;  1F15 A;  5EYX A;  3J26 N;  2W39 A;  1DDL A;  4M3C E;  2BNM A;  4MGY E;  2RMU 1;  1OXC A;  1Q43 A;  1NXM A;  3OPZ A;  4EN7 B;  3VHN A;  3DV8 A;  4QU1 A;  1NQD A;  1RHI 1;  2GDF A;  4FI9 A;  3ZN6 B;  4DRV A;  5CNA A;  3O1R A;  1ZZB A;  3JZV A;  4Y5T A;  5C4W A;  4BK5 A;  3SCG A;  5C3P A;  3ILF A;  1NA1 B;  2J22 A;  4KBB A;  4AGV A;  4COV A;  4XF4 A;  4IEP A;  1M4W A;  2RS5 1;  3EHK A;  1NQJ A;  1XYN A;  3LDB A;  3LSD A;  2ZTN A;  4QQH A;  1XBF A;  3JBG 3;  4AEM A;  4BQ3 A;  1YCI A;  3H8R A;  2JD4 A;  4RYD A;  4ARY A;  3AYD A;  1CJP A;  1R1A 1;  4GMP 1;  3VZM A;  4UYB A;  2P3I A;  1PIV 2;  2JEN A;  4PCR A;  4DIQ A;  2Y60 A;  1CAU A;  5GLT A;  2VTX A;  1W6M A;  2WO7 A;  5J09 A;  1C57 A;  1BBT 3;  1D4V B;  1JYT A;  4JHZ A;  4UBG A;  4Q8K A;  4QX0 A;  1HB2 A;  3D8C A;  4JGZ B;  2A5Z A;  1LOE A;  3OCP A;  3VDD B;  3KCX A;  5JIU A;  4BXS V;  4O61 A;  4IEZ A;  2A3Y A;  1VBA 1;  4C1W A;  2AUY A;  4AOC A;  1CQ9 A;  2ZGN A;  4LBJ A;  4A4A A;  3H8O A;  2A1X A;  3AMN A;  4ZS2 A;  2VTF A;  2DWR A;  1EP0 A;  2A7A A;  5FYY A;  1SFN A;  4YW1 A;  3ZIX A;  1RUF 3;  2D6O X;  1UMI A;  2ORX A;  5EWS A;  2QTW B;  3HQU A;  5FPA A;  5FZM A;  3PVN A;  2NM1 A;  3APB A;  3JD7 1;  4AZZ A;  1OA2 A;  5FKB A;  2ENR A;  1S1A A;  5A6X A;  2R06 1;  1F35 A;  2AC1 A;  4XPV A;  5K0U A;  1CJD A;  1HXS 1;  1GQH A;  2QQU A;  3NAP C;  1VBD 1;  4CDX A;  5FWJ A;  4DUW A;  1PGW 1;  1GWL A;  1BLZ A;  1STM A;  2Y6G A;  1AL2 3;  5A3U A;  1WGP A;  1HB4 A;  5BNP C;  1JUI A;  2I07 B;  5T3N A;  5T54 A;  1DFQ A;  3IPV A;  4BQ1 A;  4C90 A;  4YG6 A;  1VP6 A;  4A6O A;  5KXD A;  1JYI A;  4LHL A;  1QJX 2;  2V73 A;  2ZMK A;  4LBQ B;  4LO6 B;  4AEJ A;  2F4P A;  3W9A A;  4WM7 B;  2WFF 3;  3ZYJ B;  3AK0 A;  4IES A;  1YI7 A;  4LO7 A;  4QGL A;  5T5L A;  1JN2 P;  5FR3 A;  5L7O B;  1JYN A;  1VAL A;  3LPF A;  2VR4 A;  1MZE A;  1AXZ A;  1J83 A;  1O5L A;  1ULC A;  3C7H A;  4NJ4 A;  4OVE A;  4LNV A;  4GMP 0;  4JVA A;  4BK4 A;  1SDD B;  2PN5 A;  4IET A;  4XBN A;  4EV0 A;  5IVB A;  3ZDS A;  2XML A;  3ASI A;  1KJR A;  1PX3 A;  3K51 A;  1QIQ A;  2ARX A;  4CP2 A;  5JZG B;  1N3P A;  2EAL A;  4Q4W 1;  4KG8 A;  1X8M A;  5JDB A;  5T5P A;  1OQE A;  3WF0 A;  5C3O A;  2YGL A;  1TNR A;  1E5S A;  3D6E A;  3RRD A;  2OKX A;  4J6G A;  5E16 A;  4TLF A;  3WEZ A;  4Z92 B;  1YQ2 A;  2E26 A;  4XFB A;  1SFP A;  1GNH A;  1BK1 A;  2W1Q A;  3OUI A;  4JHT A;  4PIX A;  4CSW A;  3KHC A;  3PTY A;  4J1X A;  2HEV F;  1EYB A;  3O5S A;  4UF0 B;  4B4P A;  2VZS A;  1ULE A;  4OHV A;  1O4Y A;  3FLP A;  1G9D A;  1K5M A;  4WVM A;  1OF4 A;  3VD5 A;  1QOO A;  4ZY9 A;  1PIV 3;  2HBT A;  2Q1F A;  4MGQ A;  1CZT A;  1UOB A;  2VMI A;  3CZU A;  3WDW A;  1BEV 1;  2LRP A;  2W1U A;  4IW3 A;  5FMB A;  4XQ4 A;  1H8T C;  1ND3 C;  5I0D A;  4R4Z A;  4RQP A;  3IDC B;  3OEA A;  4OHY A;  2HBU A;  3POI A;  1JS9 A;  3B69 A;  3LFM A;  2CSG A;  4G3Y C;  5FOB B;  5I93 A;  2QDN A;  3BUC A;  2DCT A;  4OMD A;  4QQ2 A;  1KJL A;  3PUQ A;  4HVO A;  5EP9 A;  5IVY A;  4B8E A;  3NJV A;  5JIA A;  4CEY A;  1AXY A;  1HLC A;  2HWE 3;  4CEW B;  1MAC A;  3GXU A;  4XF1 A;  3N9O A;  4K8R B;  2D6K A;  2PLV 3;  5JOX A;  3O12 A;  4DRR A;  2G9F A;  5FZ9 A;  4XMI A;  3JUU A;  5J1X A;  3GZA A;  4U36 A;  2PXJ A;  4YW7 A;  5JOZ A;  1HN1 A;  5KXB A;  2J7M A;  1Y7B A;  2BW8 A;  3CEW A;  4H2A A;  3F2Z A;  5FZD A;  1PK6 C;  1QJZ A;  3GBW A;  2E53 A;  1IS6 A;  4N43 C;  4C91 A;  4WZC A;  4YZ5 A;  1AYN 2;  3HN1 A;  2WC2 A;  3W59 A;  1HRI 1;  1XNC A;  4NRM A;  1XRU A;  2K2S A;  2P5B A;  2NPI A;  1SZB A;  4OHX A;  2YUE A;  2BTV C;  4LTA A;  1R09 3;  1RYY A;  4XJZ A;  3V56 A;  4E4D X;  1WCS A;  1NUK A;  2DCZ A;  5IVV A;  1VBB 1;  4NPM A;  1JZ8 A;  1PM7 A;  4EWE A;  3VN4 A;  4JTN A;  3A7Q A;  3ZFG B;  3ZN6 A;  5FMC A;  3TOJ A;  2C6S A;  2PHT A;  3WQ1 A;  3EBR A;  3I2O A;  1HXS 2;  1URX A;  1CAW B;  3I7D A;  1VBD 2;  4P9J A;  5KHG A;  3NQH A;  4JCK A;  3K48 A;  2HJI A;  1NA1 A;  3L9J T;  1PVC 1;  1RUC 1;  1UY4 A;  4MG2 A;  4DNY A;  1A8M A;  1AYM 2;  3T4V A;  3WZ1 A;  5HI0 A;  5JOW A;  2PQQ A;  1UOJ A;  3KD4 A;  1W9Y A;  2HWD 2;  2BGO A;  3GDB A;  2BUK A;  1TME 3;  1WCU A;  4N53 B;  4IE7 A;  1PMJ X;  4LJH A;  3FFQ A;  4K6B A;  4CUC A;  3H1W A;  1RIT A;  1IS4 A;  5KWR A;  1F4H A;  4R9C A;  3EB7 A;  4KMQ A;  5I0T A;  4LKE A;  5KXE A;  2XQR A;  2ZZQ A;  3K75 B;  5H9P A;  1GR3 A;  3I3D A;  5LB6 A;  2RMU 3;  2MEV 1;  4QX1 A;  1SLA A;  4CDW B;  1AR6 1;  5DZG A;  5FWE A;  4JGZ A;  3VDD A;  3U14 A;  2D3R A;  5KC6 A;  3LEM A;  4PQ9 A;  4GH4 A;  1AX1 A;  1WA4 A;  1D4M 2;  4HAN A;  1S55 A;  2I45 A;  1JH5 A;  2NYY A;  4QHB A;  1BCX A;  4R9D A;  1GIC A;  2P37 A;  2ID4 A;  5A80 A;  2CHH A;  2V4V A;  5DXD A;  3ZM8 A;  3AKQ A;  3AP7 A;  4PJY A;  2RS5 3;  3RMX A;  3CO2 A;  2IC1 A;  2FBE A;  3TNQ A;  1BZW A;  2CV6 A;  2VOT A;  1TG7 A;  2VQT A;  5JR7 B;  3ZMN A;  5FO9 B;  1POV 1;  4QQL A;  2R7E B;  3SQO A;  4MGT A;  5F9T A;  2OA2 A;  3GHN A;  2WQ8 A;  3H1Y A;  5BPX A;  4A3X A;  1YQ6 A;  3BOP A;  4DXZ A;  1R1A 3;  3J9S A;  4GMP 3;  3ZO0 B;  1ZZ7 A;  3KQR A;  2VC9 A;  2PYT A;  3THT A;  2ZAB A;  1RC6 A;  4NO4 A;  4KH9 A;  4EN6 B;  2RR1 1;  4GKX A;  3E97 A;  5F5C A;  4XQW A;  3MFC A;  4BQ4 A;  3THD A;  3CBN A;  1RGS A;  3LIG A;  5JSP A;  1Y3T A;  2XKO A;  1C8N A;  4Y33 A;  1Q5O A;  1NAE A;  1JZ3 A;  3IDA A;  1KGY A;  2EAA A;  2E7A A;  4W8J A;  5F6L B;  1DLC A;  3PUI A;  3WT3 A;  3UK9 A;  3RDI A;  4HXC A;  1GNZ A;  4N90 A;  3PDQ A;  4RR3 B;  1ZRE A;  1KRI A;  1VBA 3;  4XHB A;  4LBQ A;  1VRH 2;  3I2G A;  1AYN 3;  4IDZ A;  5CFC A;  3DYO A;  4PBO A;  1GFF 2;  1XE7 A;  3N7M A;  1YQC A;  3NJY A;  1PMI A;  4WM7 A;  3RI8 A;  3WQB A;  4BDV B;  4HL0 A;  3O1O A;  2E7T A;  5FZ6 A;  3LA7 A;  2WAB A;  2ZAA A;  3AKP A;  1G86 A;  3M3C A;  5GLW A;  5I0U A;  3LEG A;  4Z2A A;  5A32 B;  3T4H B;  5JUV A;  5L7O A;  1H30 A;  4A7Z A;  3RZZ A;  3SIT A;  3PVB B;  4XUO A;  2JDN A;  3U07 A;  1V00 A;  2C9K A;  2P6H A;  3BOD A;  4FAG A;  1ULF A;  1Q8V A;  2JEC A;  2ZEX A;  4LK6 A;  5AVP A;  2R06 3;  2DVD A;  3U37 A;  4QDS A;  2R1B A;  3IKW A;  2GN3 A;  3D4K A;  5JZG A;  1FMD 2;  1PZ7 A;  1HXS 3;  2BQP A;  2QQJ A;  4LOS A;  4YGD A;  4XFF A;  4QXB A;  1VBD 3;  1YQ5 A;  2YXS A;  2ZAH A;  3CNA A;  4RGK A;  4XUR A;  2V5D A;  3D0J A;  4QXC A;  3VD3 A;  1ZZC A;  2RM2 1;  3VBU B;  2QE3 A;  2VOV A;  3C7O A;  3NKG A;  2XH6 A;  3C8X A;  1LOG A;  2JE7 A;  2R32 A;  4ORF A;  5F5I A;  5FY8 A;  2NMO A;  1UD1 A;  2A71 A;  1FV3 A;  2VPV A;  4GIQ A;  1J1T A;  4J25 A;  4UF0 A;  5L7O C;  4RS5 C;  4AQT A;  2VUJ A;  1LHV A;  3BB6 A;  3DEM A;  1MVQ A;  1XE8 A;  2R07 2;  4OFG A;  2EVX A;  4UWD A;  2X5I C;  1POV 0;  2UUR A;  3J8F 1;  4GWM A;  1UIJ A;  3TBD A;  1CIW A;  2B4K A;  4PHZ A;  3PVO A;  4CUB A;  1OVS A;  3EJK A;  3I3E A;  2RS1 2;  3OG2 A;  4OQ8 A;  1UMZ A;  5LCW L;  4CU8 A;  3I49 A;  1DCS A;  4FFG A;  5FV3 A;  2B9V A;  1NLS A;  3RZK A;  4BYY A;  4Q4W 3;  2R49 A;  2X53 S;  3H0O A;  1ZYB A;  4CEW A;  1OSG A;  3PU8 A;  2GN7 A;  3WG4 A;  1CPN A;  2ZGQ A;  1TZO A;  5HCB A;  1N47 A;  3LOI A;  1ODM A;  1OH3 A;  5FPU A;  3KZ4 C;  3THP A;  4RN5 A;  2E31 A;  3WF4 A;  3UT0 A;  1I5P A;  3TEY A;  1NT0 A;  4H7L A;  4MVT A;  1CAX B;  3IDB B;  4URT A;  4YW5 A;  4W65 A;  1TMF 1;  3DEC A;  3KV4 A;  1UPS A;  1DZR A;  2E32 A;  2FCU A;  1LEC A;  5A1A A;  4MLO A;  1LEM A;  1IZ3 A;  1PO2 2;  3AL5 A;  3PIG A;  4GD4 A;  4M0H A;  3WX5 A;  1XC6 A;  3MIC A;  3OSD A;  4E27 A;  4RHV 2;  3T0A A;  1RMU 1;  3BIW E;  2TUN A;  2WII B;  1HQW A;  4PI0 A;  1WKY A;  4CCL A;  1Z78 A;  4COZ A;  5JPN B;  5LWB A;  2VUL A;  2DVA A;  4LA2 A;  1NLR A;  3WNN A;  2VZP A;  5FJK A;  2VQU A;  1TQ5 A;  1UYY A;  2LUW A;  1DQ2 A;  3ENR A;  2W87 A;  2D5F A;  3B01 A;  4SBV A;  5F39 A;  5FP7 A;  3N9P A;  3ZFG A;  5HV4 A;  5JI9 A;  5LW9 A;  1GKB A;  1RUH 1;  1TVG A;  2ET1 A;  1OQ1 A;  5F7U A;  1IQA A;  3OB8 A;  1CAW A;  1LOA A;  2Q30 A;  2XBO 1;  4C0H A;  3C7E A;  3PUA A;  1ULO A;  1FNZ A;  4K3U A;  5C9A A;  1YFY A;  3DF0 A;  4SLI A;  4UW6 A;  4IE4 A;  3LOB A;  2PHU A;  2Y6F A;  5BNN B;  5A6Q A;  5FP4 A;  1XSQ A;  4N53 A;  3FHQ A;  4Y4R A;  1UMH A;  2YFZ A;  1GV9 A;  4AAP A;  4P9Y A;  1CN1 A;  1XNT A;  3QD6 A;  2HWC 1;  2WUH A;  1HRI 3;  3T2Q A;  4B4R A;  3HPN A;  1W28 A;  1W2N A;  1N3O A;  5C8C C;  2X05 A;  1FMD 3;  3CLP A;  1X8E A;  4HKW A;  4Q0U A;  4B1M A;  2X8K A;  3I2K A;  5A7P A;  4Y5S A;  1IPJ A;  5APA A;  1BMV 1;  4CDW A;  4AED B;  5FP9 A;  4XDQ A;  1C8M 1;  4C1X A;  1MEC 2;  3IB3 A;  4AVC A;  4YZ1 A;  3ZPO A;  4E2G A;  1P8J A;  1H4G A;  1SCR A;  2Y34 A;  1OLM E;  3HAG A;  1KS5 A;  5FZO B;  3INA A;  3U4X A;  3T08 A;  4OHW A;  5M0T A;  1PVC 3;  3H3Z A;  1RUC 3;  4GKY A;  3OPW A;  4BQW A;  3VZN A;  4L92 A;  2QNK A;  4XC9 A;  5HBA A;  4MX3 A;  1QNW A;  3OF1 A;  4RD7 A;  2VW1 A;  2PHL A;  4XUQ A;  2G9G A;  4XJA A;  2VUD A;  2RS1 3;  2UYA A;  3BTZ A;  1JYX A;  4XDO A;  4OI4 A;  4D69 A;  1EV1 2;  2JX9 A;  2JG9 B;  1UZZ A;  1WWY A;  2PTM A;  2NZ9 A;  4PLM A;  4QU2 A;  1GZW B;  4Z07 A;  3WW1 A;  5JLV A;  2VMD A;  5FY7 A;  4QPG C;  4FPL A;  2ADD A;  3M8L A;  1COV 2;  2MEV 3;  1OPO A;  3PJQ A;  1H9P A;  1AR6 3;  1NZI A;  1X36 A;  2XJR A;  2XXZ A;  1ZBE 2;  2OPK A;  2YPJ A;  3HNM A;  1RUE 2;  4KWU A;  5F5Q A;  1DGW A;  1WCQ A;  5FZ8 A;  4RR3 A;  3X29 B;  1FYU A;  4QQP A;  5FKC A;  3AX4 A;  5BNO C;  1OUS A;  1PO2 3;  2DBI A;  2DBN A;  1ND2 C;  4FPF A;  4UFL A;  1Q8Q A;  1WBF A;  3EO6 A;  4KWJ A;  4UFJ A;  2CGP A;  1FPN 2;  1GQP A;  5FXX A;  1OOP A;  1ZBA 2;  5ACA 1;  2FDG A;  1OFS A;  1POV 3;  4CUA A;  3JBG 1;  5A32 A;  1ENQ A;  3MO4 A;  5LA1 A;  3MYX A;  1EPZ A;  4M3C B;  3OUH A;  4CRQ A;  2VW0 A;  2OII A;  1Y9Q A;  4P9I A;  4XAB A;  4HON A;  5IAT A;  5J3U A;  1E5I A;  3HR9 A;  1QXR A;  2Y38 A;  4QX8 A;  3MV1 1;  4FXG B;  4LOR A;  2RR1 3;  3WG2 A;  1RVF 1;  2Y6K A;  4Q5O A;  2WDB A;  2FDI A;  2Z69 A;  1XE0 A;  1W0P A;  3RI9 A;  2P3K A;  4F3J A;  1L3J A;  4IQP A;  1QXJ A;  2W91 A;  5D8A C;  5FRE A;  3RVH A;  3VBU A;  4AK3 A;  2C1F A;  1BK0 A;  2CWS A;  2ARE A;  2Y33 A;  4K21 A;  1WW4 A;  4ET7 A;  1LES A;  3KM5 A;  5CAZ A;  2A3X A;  3ZXD A;  4YSF A;  2OX0 A;  3N9L A;  4LIV A;  3JCI A;  3OY8 B;  5DMY A;  5FAX A;  2Q8C A;  3WNX A;  1MQT B;  4B3N A;  4HVQ A;  4L0P A;  3AM2 A;  2VZ1 A;  4XIK A;  3H7Y A;  1W0O A;  4NRP A;  5KHH A;  4XET A;  2PQS A;  2H6B A;  4PDW B;  2B46 X;  5FIX A;  2WAO A;  2J1E A;  2A6V A;  3NST A;  3JU9 A;  4QPI B;  2FCT A;  2XB6 C;  2XUM A;  5FLJ A;  2GAL A;  2YDE A;  3B93 A;  4Z8B A;  1LAJ A;  4K1Y A;  3WF3 A;  4A44 A;  2ERF A;  4CPB D;  2ZGP A;  1LU1 A;  4Q0P A;  4BU2 A;  3MIH A;  2P34 A;  4YYO A;  3MIF A;  1I9R A;  3ZX7 A;  5AC9 2;  1F8V A;  5DUV A;  1WCK A;  5DAV A;  5FXW A;  5IVE A;  3BU7 A;  4BLI A;  3IIA A;  1O8S A;  2RM2 3;  3IWZ A;  4AI0 A;  1MS5 A;  3ZYI B;  1ZA4 A;  2XL7 A;  3KSC A;  4MZU A;  4QB2 A;  4AYU A;  5A1F A;  5C3S A;  2VW2 A;  3KF5 A;  5FMO L;  3VKM A;  4FPH A;  3DXU A;  4NAM A;  1CAX A;  4CZS A;  1KXG A;  3C3V A;  4AHY A;  1N1T A;  4DUV A;  2A75 A;  1YWK A;  2HWF 1;  2ZS6 B;  4M3C F;  5EFU A;  3AZX A;  5F2S A;  4AVB A;  4QGN A;  2HH9 A;  4MET A;  3WCR A;  4A45 A;  3KV9 A;  3LCP A;  1WLD A;  4CXW A;  5DAW A;  1KDK A;  1UWW A;  4XJ9 A;  3FC0 A;  1UXZ A;  4Y24 A;  1F2N A;  1HQL A;  5FYT A;  2AGS A;  4DXS A;  1IG3 A;  1CX4 A;  2VL4 A;  2YMZ A;  5E8A A;  4L8Q A;  3UL2 A;  2BWA A;  4DY3 A;  2YC0 A;  3D82 A;  4LUL A;  2WS9 2;  5LBB A;  1JZ2 A;  1REE A;  1RUO A;  2RG4 A;  3N7J A;  2JIG A;  3HNB M;  4Y26 A;  3SCH A;  4D0Q A;  1HRV 2;  3IBM A;  5EQU A;  5CAD A;  3V0B A;  5C5U A;  1FPN 3;  1N3Q A;  4IEV A;  3WUC A;  2V72 A;  2GC0 A;  2GNB A;  3CJI C;  1JI6 A;  2DVG A;  3KGZ A;  2XJV A;  2WN3 A;  4IGQ A;  2H6C A;  2XJQ A;  5FZH A;  5BNN A;  1W9T A;  3RZH A;  1R1Z A;  2V09 A;  4XOG A;  4NHM A;  3ZIW A;  1UYX A;  2P1B A;  5JSO A;  3I2D A;  3C7G A;  3KT1 A;  2AR6 A;  1RMU 3;  3B02 A;  1XND A;  1PM4 A;  2YBK A;  3AP9 A;  4ZZ8 A;  5FZB A;  1DYP A;  3MW3 A;  5J7M A;  3VBS C;  3UKN A;  2LRO A;  5JMO A;  4O7X A;  2B7Y A;  4MH0 E;  1C4R A;  1QQP 2;  2DUP A;  3ACH A;  2JIC A;  3D0S A;  3NAP B;  3R4S A;  4FQ4 A;  5FZK A;  4AED A;  5C70 A;  3DGT A;  1N1Y A;  1RUH 3;  1DYK A;  1BXH A;  2D40 A;  1F5J A;  2E51 A;  4WM8 C;  1W3V A;  4QPY A;  1HJG A;  2W0X A;  5BNP B;  1JZ5 A;  3WG1 A;  2XBO 3;  4JRL A;  5GLV A;  2ZGO A;  5FZO A;  1RUI 2;  1OH4 A;  2EXI A;  3CU7 A;  1SFY A;  4IEW A;  4PIZ A;  1XYO A;  3ME2 A;  4CP0 A;  1LJ7 A;  3AFK A;  4NAO A;  1XOY A;  4NWW A;  3AL6 A;  2QQM A;  3S5Q A;  5C8W A;  1WLC A;  3D3A A;  4AI2 A;  3POE A;  5LEJ A;  3UES A;  3M3Q A;  2JDP A;  3VDA A;  2ET7 A;  2ZCW A;  1G9A A;  2K9Z A;  3ETQ A;  3WP5 A;  3P1I A;  3UV9 A;  5ABJ C;  4ONU A;  5I0S A;  2W94 A;  3IM0 A;  4MGI E;  5DAB A;  4E8D A;  5LZ6 A;  1O3S A;  5FDB A;  1O3T A;  4YZ4 A;  1BHG A;  3KHB A;  2QQP A;  3MIE A;  3CKH A;  1QH7 A;  2UYB A;  1BVP 1;  4HOO A;  1C8M 3;  3MLJ A;  5CZK A;  1O8P A;  3OGV A;  2QQL A;  4IGP A;  5FXZ A;  2VXR A;  3IAQ A;  5FZE A;  4AHW A;  3RS6 A;  3ZSL A;  4QM8 A;  2VMF A;  2VY0 A;  1QJX 1;  4GXL A;  5LK5 A;  1WMF A;  1SBE A;  2F6B A;  3E6B A;  4YGC A;  5EV7 A;  3AMP A;  3WDU A;  4FVV A;  1HKD A;  3O0X A;  2B8M A;  2P3J A;  4P5Y A;  4NIA A;  5I8Y A;  2LS6 A;  1TNF A;  4ZPI A;  5FRA A;  3S7I A;  4ZZ5 A;  3ILR A;  4TXW A;  2WZP P;  3USS A;  5ANQ A;  1C1L A;  1GOF A;  4HKL A;  1H8T B;  1ND3 B;  2CWM A;  5F5A A;  1H2M A;  4CP1 A;  3FZ3 A;  1WCD J;  4I01 A;  2JG8 C;  5CVR A;  5FZ7 A;  2A3W A;  1GYK A;  4XCB A;  5FZ1 A;  2RDR A;  1D0G A;  3J7M A;  5B4X A;  2DUR A;  2VNG A;  3LWC A;  2P3Y A;  4P9G A;  4QPW A;  4UOJ A;  5FP8 A;  1PO1 2;  5FY0 A;  4QKN A;  5BY5 A;  4LUM A;  1US3 A;  1G6N A;  4FO9 A;  5IK7 A;  1U12 A;  4XBQ A;  1AVB A;  2XJP A;  3PNA A;  4K7J A;  4TWT A;  5L19 A;  5CA6 A;  3ES4 A;  1GUI A;  5BYN A;  3OY8 A;  2EIB A;  4YFZ A;  3BKZ A;  4X6Q B;  4UFM A;  1PK6 B;  5FY5 A;  1MQT A;  4GAZ A;  2AZ5 A;  4HN0 A;  4N43 B;  1W0N A;  1UU6 A;  5ACA 3;  4N7U A;  3M1H A;  4UW4 A;  4QPI A;  5IAV A;  1QQP 3;  1HJF A;  5GKA C;  4D6R A;  4PLN A;  3GZT B;  3RZM A;  2RV9 A;  1W39 A;  2DCK A;  4XFI A;  3VBR A;  2ZJC A;  4KBZ A;  4F83 A;  1T2X A;  1RVF 3;  3RPQ A;  3WG3 A;  2UWB A;  3M3E A;  2DU0 A;  3FHI B;  1HV0 A;  4WVZ A;  2ZGT A;  4Y1Z A;  1RUD 2;  3WDV A;  1W8F A;  4UW3 A;  2JJ6 A;  2WBK A;  4HMZ A;  4W50 A;  1GZC A;  4LBN A;  4IEU A;  2WNV C;  1MZ5 A;  4D3W A;  2KR2 A;  2BGP A;  2XJT A;  1GU3 A;  2ZHM A;  1AYN 1;  1XNK A;  2WZE A;  5FMD A;  4OQ9 A;  2ZEY A;  3K4D A;  5FPX A;  3NV3 A;  2RHP A;  1XJA A;  3B7M A;  2P6C A;  3ZFE C;  5DDJ 2;  5LBF A;  4CP9 B;  3U75 A;  1VB2 A;  3BVC A;  2ZMN A;  2BZD A;  2VZU A;  4DPN A;  2B9U A;  4CDQ C;  1D2Q A;  4BIO A;  1GSL A;  2DVB A;  3VDB A;  5K0U C;  5CG9 A;  1UU5 A;  2XR4 A;  3BOW A;  2VCC A;  5LA2 A;  2O8Q A;  1ULD A;  1QJF A;  1S2B A;  2JDA A;  3LF7 A;  1TEI A;  2XJS A;  2ZX3 A;  1AYM 1;  3VHR A;  5KC5 A;  5L73 A;  4B29 A;  1AHS A;  3POY A;  3MI8 A;  3RZG A;  4TYS A;  2HWD 1;  4EN8 B;  2F4L A;  5FBZ A;  2HWF 3;  3AP5 A;  3OBA A;  3KWV A;  1NLQ A;  5FOJ B;  2VZR A;  3K2O A;  4QKB A;  4QT6 A;  5C3R A;  4OUL A;  4E4S A;  4LO8 A;  2WLP A;  3LA3 A;  1LEN A;  4IE6 A;  1FOD 2;  1RL3 A;  1OUR A;  1YFU A;  2VVF A;  5E89 A;  1F4A A;  1C3H A;  2UWC A;  1Q8O A;  2J1T A;  1FAY A;  2W9X A;  5BNP A;  1W6O B;  3B5L B;  3S7E A;  3R6S A;  1SQ4 A;  1W2O A;  4LBO A;  1D4M 1;  4HPK B;  3LE0 A;  3FLT A;  4QWN A;  2XQX A;  4GJZ A;  1V6I A;  2Y6L A;  4D7S A;  1KEX A;  3I2F A;  3J7N A;  4NHL A;  3J7H A;  3DL3 A;  3HNY M;  2Q8D A;  1CX1 A;  2VAU A;  4PI2 A;  1V0A A;  4XFC A;  4I3P A;  3NNL A;  5L9R A;  5FPV A;  3ZYH A;  1K5M C;  3ZXJ A;  2ZHN A;  3OD4 A;  2X09 A;  4LE4 A;  3DKQ A;  4Y3O A;  3TWI A;  4Q1R A;  3RMY A;  1W6N B;  1K42 A;  1J84 A;  4KU8 A;  4PIY A;  4XUN A;  5I8S A;  5F3C A;  1DQ6 A;  1MS4 A;  4RQP C;  1T6B X;  5LBE A;  1NCQ B;  1QJU 2;  1ALY A;  4GWJ A;  4Y1Y A;  4DMI A;  4I0A A;  3MF9 A;  4ZON A;  3O1M A;  3NNM A;  4QDR A;  5EHD A;  4XYX A;  3K77 A;  4PLO A;  4FP3 A;  2JDY A;  2WZ8 A;  3H8X A;  1XNB A;  2W68 A;  1GQG A;  3QH7 A;  5CFD B;  1WMD A;  2ZGL A;  1VRH 1;  5F8P A;  3S30 A;  4N9H A;  3SH3 A;  1HDK A;  2FDH A;  2RJL A;  1NCR B;  2QVS B;  3KVA A;  4MGS A;  4IEO A;  5FY9 A;  4E8C A;  4IL7 A;  3H42 B;  1IKQ A;  1S0I A;  3HEI A;  3LSE A;  4P5H A;  4XZP A;  5DDJ 3;  4B7E A;  4M0N A;  3ZSK A;  1SMV A;  3PTR B;  2K46 A;  1H8T A;  1ND3 A;  2WZR 2;  4NRO A;  3FHA A;  5FPB A;  4CDU C;  3WQ0 A;  1BVV A;  1OVP A;  1UY0 A;  4NID A;  5A7N A;  1FMD 1;  2IFR A;  4FXK B;  4LLO A;  1NXD 1;  5JAX A;  2BNO A;  2PAE A;  1CON A;  3ACI A;  4LKS A;  4AFM A;  4BZ4 A;  1EUU A;  3SLI A;  2W3J A;  3L2H A;  3LIH A;  4MV2 A;  3ECQ A;  2JDM A;  4M01 A;  1MS0 A;  2CNA A;  1B35 C;  4OI2 A;  2ZX2 A;  3WIN E;  4QXH A;  1V6J A;  1QJX 3;  1S0C A;  4S2H A;  4DS0 A;  1G9B A;  4GWN A;  3VD7 A;  3K4A A;  1LHN A;  1NA1 C;  1PK6 A;  4FPJ A;  2WJS A;  2DU1 A;  5EXO A;  1DQ4 A;  2GC2 A;  3BGA A;  3MHZ A;  4Q0S A;  4N43 A;  4P02 B;  3SIS A;  2R07 1;  4FTE A;  3O1V A;  5HV0 A;  4R52 A;  5SV8 A;  1VRB A;  4XTM A;  5FYC A;  4XF3 A;  4OUS A;  3CZJ A;  4JQR A;  1VPH A;  2Y6H A;  5LAS A;  1SLL A;  2RS1 1;  4Q4Y 2;  2OZJ A;  2QDR A;  1AZD A;  1CVN A;  1AX2 A;  5SV5 A;  4BQ5 A;  3SKJ E;  2GC3 A;  1HIX A;  2QBX A;  3HBK A;  4BB3 A;  3NV4 A;  1AF9 A;  2Q1M A;  5F32 A;  1UL9 A;  3PVE A;  4IV3 B;  1ZA7 A;  3H1M A;  3VZL A;  1YUD A;  4BM8 A;  1W06 A;  1OA3 A;  4LPL A;  3ZYG A;  4EWA A;  3MZH A;  2LTN A;  3BI3 A;  4GH4 C;  3ZVX A;  2VMG A;  3LKJ A;  4TN7 A;  4Q4V 1;  5DUU A;  1PO2 1;  1VE0 A;  5FYZ A;  4TTG A;  1Y43 B;  2VXJ A;  1KFX L;  4GQ7 A;  2L9L A;  2W5F A;  3AVS A;  4RHV 1;  4CE8 A;  3ST7 A;  1JXN A;  4HK8 A;  4BOW A;  1DGW X;  3WY6 A;  2OUJ A;  4CP9 A;  1QJU 3;  5KHI A;  1IPK A;  2QQW A;  2VG9 A;  2B5H A;  1X7N A;  3OD0 A;  2CAV A;  5IFT A;  2BBA A;  3POB A;  4QXK A;  3IZO A;  3PHM A;  2JEM A;  3QOP A;  5GLU A;  1RJ7 A;  3RNS A;  3Q8E A;  3LB9 A;  3WNL A;  2DTY A;  2IXH A;  2YHJ A;  2NP0 A;  5DZE A;  3H7J A;  2MPF A;  5AFB A;  5ERL A;  4R4X A;  2KD7 A;  2WNU C;  3AYE A;  3FWE A;  2VTX J;  5L9B A;  1W8W A;  4PT6 A;  2ZHK A;  4IV1 C;  4QDQ A;  4ASL A;  4IND A;  4GJY A;  3VGI A;  1FI2 A;  2PMW B;  2WZR 3;  4WBB A;  5CFC C;  1DQ1 A;  5DG2 A;  4GZ9 A;  4CU9 A;  1F31 A;  1OLR A;  1T6G C;  2GMM A;  1PNF A;  4NPL A;  3GNE A;  1SPP B;  1NOV A;  3TEX A;  1WMX A;  3RGB A;  2GNT A;  5K7P A;  2ZBJ A;  2DFC A;  3QH6 A;  4FPG A;  1JOB A;  4JGY C;  4IEY A;  4KU7 A;  1QMJ A;  2Y26 A;  5A1L A;  4A41 A;  4QPG B;  4N9I A;  2ZPX A;  4CCO A;  1OD3 A;  4LBK A;  1JYC A;  2KM2 A;  3LAG A;  2WIN B;  3AP6 A;  2RDN A;  3CHX A;  4QHZ A;  3ZMO A;  1D7P M;  4Y4Y A;  4YG3 A;  1MEC 1;  1OHF A;  1W6O A;  2XHN A;  1H1M A;  3FN9 A;  5JPM B;  4CXX A;  1K3I A;  2Z4F A;  4NVP A;  3OGR A;  4HPK A;  5FO7 B;  4ASK A;  4E9K A;  3U0Z A;  5KHJ A;  2VNO A;  1UN1 A;  5IWF A;  5CYY A;  4AI8 A;  2PFW A;  3BIE A;  5BUV A;  5LRS A;  1AYM 3;  5HXM A;  1GOH A;  3AXD A;  5LBC A;  1ND2 B;  3S0M A;  1IGO A;  5JCT A;  3W5M A;  1UPI A;  2VH9 A;  2HWD 3;  4HFS A;  4Q27 A;  1QH6 A;  2GP3 A;  4WVV A;  2EID A;  3FBY A;  5IVC A;  2LM3 A;  5H9S A;  3WW3 A;  3PJY A;  1LOB A;  4FAH A;  3UKV A;  1QF3 A;  1EV1 1;  5FZA A;  5F3E A;  2Q5T A;  1SLT A;  1W6N A;  1W9S A;  4ZXK A;  4D8M A;  1NYW A;  2BNN A;  3VZK A;  4FBF A;  2EXH A;  5I8T A;  4LXL A;  3ACL A;  1RUJ 2;  5DUX A;  3BN6 A;  1COV 1;  5A7O A;  1NCQ A;  2DF7 A;  3BTA A;  3B94 A;  2BDR A;  3WUD A;  2ZGM A;  1ZBE 1;  2A70 A;  1RUE 1;  4LEJ A;  1JBC A;  5D8A B;  3ITQ A;  1FXZ A;  1J59 A;  1BYH A;  2BFU S;  1D4M 3;  4CEW C;  5CFD A;  1NE4 A;  3FBM A;  4QHO A;  4V2V A;  5IK5 A;  2HYX A;  2FDF A;  1OQD A;  1NCR A;  1NKG A;  2D43 A;  2IUW A;  3BYW A;  5KBF A;  1FPN 1;  1S0B A;  4EWD A;  2D7F A;  1ZBA 1;  5FQ0 B;  2JDZ A;  4JTO A;  1VR3 A;  2W1S A;  3B3Q E;  4Q4V 2;  1V6L A;  1DZT A;  2WO3 A;  3W21 A;  1G9F A;  4RL7 A;  2O14 A;  1UF2 C;  1LOF C;  4LO5 B;  3N4M A;  4WVW A;  4Y22 B;  3WNK A;  3WHT A;  5JXJ A;  3EXU A;  1LU2 A;  2ZML A;  1LR5 A;  1A78 A;  3LDK A;  4S2D A;  1QDO A;  3A4U A;  2HWB 2;  4LQR A;  3GYD A;  3SKV A;  1O4Z A;  4Q4X 2;  3CF6 E;  3WNM A;  4QX5 A;  3TB0 A;  3NMB A;  3WOG A;  2XDV A;  1W9W A;  2ILM A;  5CKQ A;  2VCA A;  1JZ6 A;  1U0A A;  4YLZ A;  1VRH 3;  2IVI B;  3POG A;  2J1A A;  3Q8B A;  1R08 1;  1UKG A;  2WO1 A;  4MSV A;  1PZ9 A;  2PAK A;  5C9A C;  3T0B A;  1IS5 A;  3MLL A;  4LKF A;  2D6N A;  2R30 A;  4ISR A;  1HW5 A;  4R9B A;  2XLF A;  4XJW A;  2VMH A;  1EAH 2;  4JAA A;  3DXT A;  4CCJ A;  4MGK E;  3WQ7 A;  3NV1 A;  4S2G A;  3PL0 A;  2VOW A;  1Z0H A;  2QQV A;  2IXI A;  1X9P A;  2WNE A;  3J7L A;  4LO4 B;  4RA0 A;  4U2A A;  5FFO C;  4K20 A;  2J1S A;  1XPW A;  1OMI A;  4W6Y A;  3PMS A;  1ST8 A;  3TNP B;  1E57 A;  3A22 A;  1G7Y A;  3BPZ A;  1AR9 2;  3PUR A;  2R04 2;  5DAQ A;  4A2U A;  4IV3 A;  5AC9 1;  2WA3 A;  1MS1 A;  2ZAC A;  4FOV A;  2BYV E;  2IXK A;  4CPB A;  5IW0 A;  1CD3 G;  3Q8F A;  2VCM A;  2ZEZ A;  1W8Z A;  4P00 B;  2CTV A;  4XQD A;  2RJK A;  5LY2 A;  2WWU A;  5A3O A;  4CCK A;  4WZF A;  4FTS A;  2MHF A;  1F5F A;  2NLR A;  2QUO A;  3IMN A;  1W03 A;  2R07 3;  3OOX A;  2SBA A;  2FCV A;  3OGG A;  1YNA A;  3E5U A;  2ARA A;  4YVS B;  4AHZ A;  2FMD A;  2D6M A;  1DGR A;  2G4I A;  3ZFF C;  3RWK X;  5T55 A;  1A34 A;  2ZX4 A;  3ES1 A;  3VBS B;  3POW A;  2ZKN A;  4QX7 A;  2X29 A;  2Z2S B;  3T3Y A;  3ZXE A;  4AF9 A;  1AL0 G;  5KR7 A;  5HCF A;  4AVV A;  5EIY B;  3DN7 A;  4K1Z A;  2XOM A;  3H50 A;  4X8N A;  5D2A A;  2WS9 1;  3A21 A;  4XHX A;  2W92 A;  2BP6 A;  3Q8C A;  2CGO A;  5A7S A;  1FAT A;  1U5X A;  4NWV A;  5FUI A;  5J37 A;  1MR5 A;  5C71 A;  4AI9 A;  4QB6 A;  1HRV 1;  1BKZ A;  1UW8 A;  3OTF A;  1CAV B;  4P9L A;  3NKT A;  1AR7 1;  2BVV A;  1W6P B;  1VMJ A;  3ZXK A;  4RR3 C;  1H1I A;  1VLN A;  1LOD A;  2XPJ A;  3T2T A;  1D2S A;  2VZT A;  4Q4V 3;  1LED A;  4XBL A;  2GAU A;  4XJU A;  3VBO C;  4O65 A;  3I4I A;  3HT1 A;  3I2I A;  3DPR C;  3NO8 A;  4LE3 A;  3VZJ A;  1RUG 2;  3P3N A;  4RHV 3;  4BIS A;  1OOP C;  4XFA A;  1SPP A;  3M3I A;  4LBM A;  3O0W A;  1JOJ A;  2BJS A;  1Q8S A;  2O8O A;  1SAC A;  1QJE A;  2BOJ A;  5FTT C;  4ES9 A;  1QQP 1;  2HWB 3;  4BH9 A;  4FFF A;  4XZU G;  4FOW A;  4Q4X 3;  4G4F A;  2XVL A;  5FXV A;  1UX7 A;  1A6C A;  5FBJ A;  2AEY A;  2D98 A;  2J1V A;  1S0F A;  2YY1 A;  4JZR A;  4ARX A;  2W2I A;  1RUI 1;  2VNR A;  5JXG A;  4ZHN A;  4NIG A;  2YV8 A;  5FUP A;  4BE3 A;  1GP4 A;  3UJO A;  3ZDV A;  1V6M A;  4DEQ A;  1UU4 A;  1VB4 A;  2YBS A;  3R4D B;  3P3P A;  2VOX A;  4L2N A;  3PIJ A;  1ULG A;  2RS3 2;  2P17 A;  1LKN A;  3WDY A;  2ZXQ A;  2YB7 A;  1VBC 2;  1R08 2;  1R64 A;  2G9Z A;  2FQP A;  4FQZ A;  3KV6 A;  4XDP A;  3S5A A;  4OUE A;  3U78 A;  4D6S A;  3ZXL A;  3KGL A;  3RJ2 X;  4JV4 A;  3WDX A;  1H4H A;  1J3Q A;  1QJY 2;  2CGN A;  1O7F A;  2NMN A;  3POS A;  4BQ2 A;  2JD9 A;  2TBV A;  1JMU B;  5FY1 A;  4ERO A;  4JQT A;  4FCA A;  3I3M A;  3N35 A;  2Q8E A;  5D8A A;  2BU9 A;  1MEC 3;  2JE9 A;  2QFE A;  3H3U A;  4FT8 A;  4AWD A;  1CES A;  4GB3 1;  1YHF A;  3BPS A;  4HN1 A;  1X33 A;  2VGD A;  2XWJ B;  3ZXA C;  4Y20 B;  5FQ0 A;  3N9M A;  1EPW A;  3OEB A;  5K8S A;  5JXI A;  2YC4 A;  1Q3E A;  2A73 B;  4JDM A;  1EV1 3;  3GBF A;  1X82 A;  2JDU A;  1GMM A;  5FLI A;  3CDZ B;  3SEE A;  4OYU A;  2JDK A;  1UZV A;  4Y22 A;  2XGX A;  3WW2 A;  1COV 3;  1OKQ A;  1UCX A;  1JHN A;  1PO1 1;  1JU4 A;  3E6C C;  1ZBE 3;  3RYP A;  5FZ0 A;  3LFI A;  1RUE 3;  1I5Z A;  4HKO A;  1UYZ A;  1Z7S 2;  2C26 A;  1QKQ A;  1A8D A;  3POJ A;  4IUG A;  2BOI A;  4NII A;  4IEQ A;  4NN0 A;  4YVW C;  4F8A A;  2EIE A;  3VDC A;  3WLU A;  3HQR A;  1S4C A;  3VBF C;  2BRT A;  2WNO A;  2WNV B;  3A0K A;  4QKD A;  3KQ4 B;  1WA6 X;  3AMM A;  4V1P A;  3T2P A;  3AZW A;  1I3H A;  2WYF A;  3VL9 A;  1Y9G A;  1AR7 2;  4RGG A;  1ZBA 3;  5J96 B;  1O5U A;  3VBH C;  2C9A A;  2EF6 A;  3VZO A;  3ZFE B;  4YAR A;  2YU2 A;  1V9U 2;  2WKK A;  3WD5 A;  1UNB A;  4FPK A;  4HVR A;  1QHD A;  4YGE A;  1NG0 A;  1ZZ9 A;  3LEK A;  4NOT A;  4FSJ A;  2KA3 A;  2FHR A;  2QKD A;  3AMH A;  4CDQ B;  1SBF A;  3AMQ A;  2GND A;  5FUN A;  1ZRF A;  1DZQ A;  3I2J A;  1PZ8 A;  4NRQ A;  4I3G A;  2ZX1 A;  4COU A;  4QB1 A;  5FPZ A;  5LK7 B;  4XAC A;  2CDP A;  4HSJ A;  3KF3 A;  5FCC A;  4C0B A;  2VQA A;  1Q8P A;  1RUD 1;  4PF5 A;  4XXP A;  5GZD A;  2DYC A;  3WW4 A;  4Q2F A;  4MHR A;  4AEK A;  3JB8 A;  4CA9 A;  2PEL A;  3I3B A;  1XSR A;  4ZU4 A;  2ZHL A;  1K45 A;  3T09 A;  2GNM A;  2RS3 3;  3OYW B;  1XB9 A;  1GWM A;  4MO3 M;  4NMI A;  5A33 B;  5IAX A;  1VBC 3;  3RYR A;  2BPA 2;  1R08 3;  4JDN A;  4Q8L A;  5KXC A;  5FYM A;  5IHR A;  3MPP G;  4YVS A;  5DDJ 1;  2AAC A;  1MS8 A;  2PAM A;  1XU2 A;  3K3N A;  3R4U A;  2UU8 A;  3NNJ A;  3VBS A;  4YWA A;  5D21 A;  4FPY A;  5GLZ A;  3A0N A;  1QWR A;  2JG9 A;  3ABZ A;  1K5J A;  3SH5 A;  2WWJ A;  3ELN A;  4FPC A;  3WVJ A;  3GJB A;  1GZW A;  5FK8 A;  3WCS A;  1GOG A;  4B7K A;  3CL1 A;  5CKN A;  3FUQ A;  1DBN A;  3PLQ A;  1WBL A;  2OUH A;  4K8F A;  4YZ2 A;  1WD4 A;  5AC9 3;  1VAM A;  1BBT 2;  2ZA9 A;  2WYS A;  1C28 A;  5T50 A;  3VKN A;  1CAV A;  3RFR A;  1UY2 A;  3ZYP A;  1W6P A;  3N7L A;  4TLG A;  2Q0A A;  1OUX A;  5DAX A;  2JKX A;  1UIK A;  4XW3 A;  1H8V A;  3USU B;  1KD7 A;  3QAC A;  4GB3 2;  5E88 A;  5FK7 A;  5A3P A;  5IVJ A;  3THC A;  1FT9 A;  3NJX A;  2WSU A;  2CU5 A;  3ZXG A;  4HET A;  1PVX A;  1O6U A;  5EZW A;  3III A;  4P9W A;  1OFN A;  2NQY A;  3AP4 A;  1FOD 1;  4YW2 A;  3HJR A;  5DPN A;  3SMH A;  2ZEW A;  4M3C A;  1W99 A;  1RUF 2;  5IJR A;  5FYB A;  4EN9 B;  1YYN A;  3MDP A;  5F3I A;  3VKF C;  3ZYR A;  2ZGS A;  4DQA A;  3MF6 A;  1S0E A;  2WS9 3;  3RJR A;  2WT1 A;  5EPA A;  2C5D A;  3IAP A;  2D3S A;  1OA4 A;  3KCC A;  4ATF A;  1OPM A;  1HRV 3;  2ETE A;  2JIJ A;  2TEP A;  3VKO A;  4A6S A;  2W52 A;  3PUH A;  1AL2 2;  1AR7 3;  2XVK A;  3HBZ A;  4PBP A;  4Q0Q A;  1QY4 A;  3H9A A;  5DUW A;  1H0B A;  3T2O A;  3LQC A;  4BLJ A;  3KS7 A;  1L7R A;  2QQI A;  1YIP A;  1C5I A;  4Q0V A;  2D6L X;  3RSJ A;  5C6C A;  5C4W C;  3FJS A;  2IXL A;  1ASJ 2;  1QDC A;  2GSY A;  4YZ3 A;  4LHS A;  5CB7 A;  2JKB A;  3ZR5 A;  4EYU A;  1MQT C;  4HBN A;  4QD2 A;  2Z42 A;  2UY9 A;  4HZF A;  3UYJ A;  2J42 A;  3NL1 A;  4Q29 A;  1C1F A;  3EQE A;  2WFF 2;  1G8W A;  2VEC A;  4QM9 A;  4PDW A;  4CDU B;  4EN0 A;  3RG0 A;  3WNO A;  3O1T A;  2PHD A;  4YW4 A;  3M2M A;  4MXW B;  3U10 A;  2EAK A;  4EQV A;  5F37 A;  1QJU 1;  1WME A;  2OZ6 A;  2JWP A;  2XHK A;  4L97 A;  1O59 A;  1VMH A;  5FJH A;  4AQS A;  5LY1 A;  1JW6 A;  3VBR C;  1YXW A;  3ORJ A;  1IOA A;  1LGN A;  1U5Y A;  3A23 A;  1YEW A;  2G1M A;  4QQO A;  2DCJ A;  1KQR A;  4BIF A;  1B35 B;  1RUI 3;  3AVR A;  4AVA A;  1LNS A;  3SCF A;  2PHW A;  1VAV A;  3GBG A;  3FFZ A;  3H8U A;  4XIL A;  4Y20 A;  1W9F A;  1OBN A;  3HD8 B;  4ZXE A;  3URF A;  4IGO A;  1UOG A;  2GME A;  2XWB B;  4UXA A;  4B4Q A;  1EUT A;  1CWP A;  5IUQ A;  3WP6 A;  4A3Z A;  1V70 A;  4I0W B;  4JKL A;  1DLL A;  2WZR 1;  3I54 A;  4O9E A;  1JYW A;  2YFU A;  1YO8 A;  3QCW A;  4XEZ A;  1Y4W A;  1MZ6 A;  2WT0 A;  4G9S B;  3UGH A;  4D7Y A;  5JI7 A;  3AJY A;  1ZRC A;  2GH8 A;  4LBL A;  5ISL A;  4AFA A;  4L99 A;  4QX3 A;  1J3R A;  1BJQ A;  1YIF A;  2W95 A;  2VZQ A;  3ETP A;  5CIR A;  2OPW A;  4GB3 3;  1IQD C;  3DUI A;  4GH4 B;  2SLI A;  4I30 A;  4CCC A;  4CDX C;  4KI5 M;  4KWK A;  4HT1 T;  2WNV A;  4IEX A;  1H2N A;  2LW8 A;  1GLH A;  2HWE 2;  3ZXF A;  4TSV A;  3S57 A;  4JKK A;  4D94 A;  2PLV 2;  2ARB A;  3ATG A;  2CDO A;  3O14 A;  5K9Y A;  3KMH A;  4R9A A;  1KS4 A;  2QZ2 A;  2VMC A;  1AXK A;  4X6R B;  4ASM B;  3WDT A;  4MGZ E;  2XKP A;  3ZFE A;  1DU3 D;  3M7A A;  5FZG A;  2XJU A;  2QJV A;  4Q26 A;  4Q4Y 1;  4H3W A;  1AR8 2;  3SHR A;  3ZSE A;  2YBP A;  2PHX A;  5A6Y A;  4CDQ A;  1Y9M A;  4EZ4 A;  1NY7 2;  1R09 2;  2QQN A;  4HG6 B;  1PO1 3;  3RQ0 A;  3NAP A;  4D6Q A;  4ES8 A;  3IN9 A;  1ACC A;  1LCL A;  4YNI A;  1YQ8 A;  4KG0 A;  1VIW B;  3OYW A;  3P5B A;  3MUZ 1;  1ASJ 3;  1UY1 A;  2WNU B;  4H55 A;  4IER A;  5A33 A;  4L11 A;  2CL2 A;  4IV1 B;  3RZL A;  1RUN A;  2OQ7 A;  3SXW A;  1DF0 A;  5HCH A;  1S0G A;  4EJR A;  5CFC B;  2WWS A;  5DG1 A;  1LUL A;  4CCE A;  1DQ0 A;  3JQX A;  1NE6 A;  5GM0 A;  5DN2 A;  3ZN4 A;  1JUH A;  1SLI A;  1LB2 A;  1PGL 2;  3JB4 C;  3LGR A;  3OBR A;  4YM3 A;  4BHP A;  5FY4 A;  2RVA A;  1OKO A;  2NN8 A;  4JGY B;  1TME 2;  4LHK A;  2VUC A;  5JSR A;  1AX0 A;  5JVV A;  3HWJ A;  3TN9 2;  4DY5 A;  2ATF A;  2FZ1 A;  4E2Q A;  1GZT A;  3HIF A;  3I2H A;  3VLB B;  3NNF A;  2CY6 A;  1D0H A;  2RMU 2;  4XF0 A;  1O4T A;  1RUD 3;  3BAL A;  5IK8 A;  2BBV A;  2ZX0 A;  5LA0 A;  3USU A;  3TEZ A;  1OI6 A;  4QMA A;  1RHI 2;  3Q9O A;  4FOQ A;  3UJQ A;  3AXE A;  3RWN A;  4CEY C;  5CG8 A;  5A7Q A;  2XLA A;  1JOD A;  3HQX A;  4AVS A;  2Y8K A;  2WN2 A;  1QNY A;  1FV2 A;  4AQ6 A;  4ZU5 A;  5F1R A;  3HT2 A;  4RS5 B;  4AG4 A;  4OI1 A;  2RS5 2;  2W08 A;  2P4E A;  4BJ0 A;  1KFU L;  5FZL A;  3W58 A;  3WR0 A;  1QEX A;  3EMR A;  1QOT A;  2A6X A;  4MHU A;  5EJ3 A;  2X5I B;  4YM1 A;  3AKR A;  2VZ3 A;  2EXJ A;  2OQ6 A;  1UOF A;  5EJZ B;  1WLW A;  4JKM A;  1SDW A;  4L9B A;  2YZ4 A;  4O9G A;  5EYY A;  4LIU A;  4CCN A;  1R1A 2;  3GAL A;  2H0V A;  1UQX A;  1H6X A;  3DCQ A;  2R1D A;  4LMF A;  1CZV A;  1VBE 1;  3O0V A;  3T30 A;  2PHR A;  3B9I A;  4COY A;  1I6X A;  2TNF A;  3SEP A;  4LOT A;  4AHX A;  1A3K A;  2YG0 A;  3E1F 1;  4HLT A;  1HX6 A;  1L7L A;  5CKM A;  3ZN5 A;  5KHK A;  1N1S A;  1YRZ A;  4CU6 A;  3OBZ A;  1VBA 2;  4A42 A;  3QLQ A;  1AR8 3;  3N9N A;  5FYH A;  2IZW A;  4LK7 A;  1JOP A;  1ZRR A;  2JDH A;  1LRH A;  3GF6 A;  4CDU A;  2IFW A;  2HKX A;  3ZSM A;  2CAU A;  1FOD 3;  1GBG A;  1RUJ 1;  3MW2 A;  5T52 A;  2EIG A;  4MXW A;  3WP4 A;  1ZM1 A;  5CBL A;  3K4Z A;  4LIT A;  1IHM A;  1ZRI A;  5B2G B;  1ZVF A;  3UNP A;  1GP6 A;  4BWO A;  1LHU A;  4BMB A;  4BQY A;  3DYM A;  1US2 A;  3JD7 2;  4MOA A;  3HOB A;  2V4A A;  3P6B A;  2R06 2;  2ARC A;  4N7I A;  5GZG A;  4KWL A;  2R6Q A;  3AFG A;  1B35 A;  1ZRD A;  1YLL A;  5FYV A;  3ZLI A;  3VUO A;  3NRU A;  3U11 A;  1PGW 2;  4JGZ C;  3VDD C;  2WO2 A;  2ZZJ A;  5AFE A;  5C9A B;  4FFI A;  5LA9 A;  3N7K A;  3FX3 A;  1DGR N;  2B45 X;  4MYE A;  4X8P A;  2BGC A;  1QOS A;  1IS3 A;  3OPT A;  1OC1 A;  2IXJ A;  2QQK A;  1RED A;  4JC1 A;  4AI1 A;  5JWP A;  1J3P A;  1UKR A;  3AYC A;  4DO0 A;  3WV6 A;  3TN9 3;  4COW A;  1RB8 G;  2VVD A;  2XLG A;  1ZZ6 A;  4CU7 A;  4DB5 A;  3B9C A;  4LHN A;  5C8C B;  2Z5W A;  3NVC A;  4I02 A;  3SH4 A;  3GCX A;  2VZV A;  4URA A;  2HWB 1;  4DEV A;  3B00 A;  4Q4X 1;  3G7D A;  1PHM A;  5IYY A;  1RHI 3;  1JZ7 A;  1MVE A;  3LEI A;  4Z2W A;  2RDS A;  4Q4W 2;  5IFP A;  4XVH A;  2QZ3 A;  3ZYF A;  1QU0 A;  1F9K A;  4M00 A;  3E5X A;  5DAP A;  3HMY A;  2R16 A;  1PNG A;  4UBH A;  4XIO A;  2ZOE B;  2A6Y A;  3OUJ A;  4NHK A;  2DUQ A;  4NUB A;  4XUP A;  4AQ2 A;  5B4N A;  1EAH 1;  1JZ4 A;  3NWK A;  5DQ0 A;  1LHO A;  1O3R A;  3ZFF B;  4KQ7 A;  3HN3 A;  4WM7 C;  1PX4 A;  4P08 A;  1ZX5 A;  2OVU A;  1MS9 A;  1WW6 A;  4UT5 A;  3MFA A;  1BEV 2;  3V65 A;  1RXF A;  1AR9 1;  2W1W A;  2R04 1;  2AEN A;  4W6W A;  4YM2 A;  3C7F A;  3NJZ A;  1SCS A;  1Q56 A;  3FE5 A;  4QGM A;  2C0Z A;  2GU9 A;  3TYJ A;  5H9R A;  1MPX A;  4GWI A;  1POQ A;  5F2W A;  5JZG C;  3GHM A;  4K9S A;  2DFB A;  2WNU A;  1YFX A;  1VBE 2;  3DKW A;  4IV1 A;  2WSV A;  4CCM A;  5HCA A;  3GZU C;  4DIN B;  2DCY A;  3ZSJ A;  5BNO B;  4I0B A;  3OBT A;  5FYU A;  2DDU A;  1DP0 A;  4XF9 A;  4RFR B;  3VBO B;  1LOC A;  3DPR B;  4KL1 A;  4ZS3 A;  3VV1 A;  1OF3 A;  3NNG A;  4AL9 A;  1OOP B;  4CCD A;  3C2U A;  2H0B A;  3RZJ A;  2UY8 A;  2EA7 A;  3DYP A;  1WLT A;  1RXG A;  2B39 A;  4JGY A;  4Q4Y 3;  1HN0 A;  4OLL A;  3ROU A;  3JD7 3;  5DZF A;  2VO5 A;  1UAI A;  4NPR A;  1W04 A;  2J1R A;  4A7Y A;  1HRI 2;  2RJ2 A;  1UZ0 A;  2LAL A;  4BPZ A;  1TE1 B;  4UFK A;  2G19 A;  1NCQ C;  3J4U H;  2E63 A;  1W2T A;  4RFT 0;  5I0R A;  2ZGU A;  5J36 A;  1VBB 2;  4HK9 A;  3KB5 A;  1DQ5 A;  1GAN A;  1REF A;  2I74 A;  2VBB A;  2DTW A;  1W2U A;  4ZKT B;  1CZS A;  5CFD C;  1SLB A;  1X50 A;  3ALQ A;  4CTE A;  3FUO A;  3FLR A;  3MW4 A;  1UXX X;  1NCR C;  4MXV A;  4UI9 L;  1V6N A;  3I3Q A;  1JYV A;  1RUG 1;  1PVC 2;  1RUC 2;  4RS5 A;  3I59 B;  5A3W A;  2BER A;  1CIY A;  1ENR A;  2W46 A;  2JB8 A;  2BV4 A;  2D3P A;  1W8N A;  2YYO A;  2X5I A;  4IXL A;  4XFG A;  3S6P A;  1AJO A;  4UFI A;  5IVF A;  5A7W B;  1RTV A;  4DXR A;  4WV8 A;  4BA6 A;  2O1Q A;  1LHW A;  4OI0 A;  3SC7 X;  3WF1 A;  2VCB A;  1W8T A;  4AFB A;  2JXA A;  2XON A;  1ZZ8 A;  4Z82 A;  5T5O A;  1IG0 A;  2X10 A;  1W8H A;  1ONA A;  3BCW A;  1ENX A;  1BQP A;  2MEV 2;  5G04 L;  3ZFG C;  1AR6 2;  1GWK A;  1XYP A;  2VME A;  3I8T A;  1XXN A;  3ZOI A;  4K40 A;  3WF2 A;  2RS3 1;  4S2F A;  1VBC 1;  2WA4 A;  5FYS A;  2FDK A;  4QX2 A;  4P14 A;  5BV6 A;  4XAA A;  5FZF A;  3AZZ A;  4OHZ A;  1O91 A;  2O0O A;  1S2E A;  1S2K A;  1BEV 3;  2OXB A;  2HEY F;  1LOF A;  5E1R A;  1QJY 1;  3MIG A;  4N53 C;  2C4X A;  1JU3 A;  1W6Q B;  1K12 A;  1X9T A;  3HVD A;  4AGR A;  3NV2 A;  3TRS B;  2HEW F;  3CJX A;  2WRA A;  3K3O A;  5FP3 A;  3ZYB A;  1DGL A;  5T5J A;  3BTY A;  1XNA A;  2PA7 A;  2BFU L;  3AKT A;  4XAE A;  3GM8 A;  1VBE 3;  2FZ2 A;  2RR1 2;  5JR2 A;  4YVW B;  4IV3 C;  1OLM A;  5C7G A;  3VB9 A;  1KDM A;  4JDO A;  4CDW C;  5C3Q A;  4GA9 A;  3VBF B;  3ILN A;  5AVA A;  3MGU A;  2YRO A;  1E5R A;  2QCS B;  1IKP A;  3E5Q A;  4LBQ D;  4Q1P A;  1UZY A;  4YFW A;  3V0B B;  2GC1 A;  4FTB A;  4FFH A;  2EXK A;  3N9Q A;  1NZC A;  3CJI B;  4B1L A;  2YU1 A;  3D5O A;  2GH2 A;  4CUG A;  3VBH B;  1XU1 A;  4LKD A;  3KT7 A;  2IWG B;  1JHJ A;  1FX5 A;  3N36 A;  1KIT A;  1YJL A;  4N8M A;  5A6Z A;  1RUJ 3;  2D97 A;  3EYP A;  3I97 A;  3WNP A;  5C8C A;  2AEZ A;  2RDQ A;  3ACF A;  4NE9 A;  2D93 A;  2ORZ A;  1XQN A;  5G05 L;  4KNC A;  3WXP A;  4DFS A;  4KGG A;  4BXF A;  1L7Q A;  1VBB 3;  4ATE A;  2OYZ A;  5A3L A;  1DIW A;  3WHU A;  1Z7S 1;  4CXY A;  2A6Z A;  4FOY A;  2VM9 A;  4NR1 A;  5FZI A;  4WM8 B;  4XE9 A;  2Y6J A;  2ZGR A;  1SBD A;  3AB0 A;  2E33 A;  3V0A B;  4Y1V A;  3O1U A;  4FPE A;  3ON7 A;  2VNV A;  2RM2 2;  3NW4 A;  3ZPY A;  5FPL A;  4XUT A;  4LA3 A;  3SNM A;  4OCT A;  1S0J A;  2Q1Z B;  2OS2 A;  4AFD A;  1V9U 1;  2WFP A;  3UKT A;  4Z1V A;  4H7M A;  2BVB A;  3ZFF A;  3AYA A;  3ACG A;  5BNQ A;  1GP5 A;  4E4H A;  2OW4 A;  2VVE A;  4M4R A;  1O3Q A;  2FD8 A;  3AC0 A;  4C8D A;  3W5N A;  5FLH A;  3J8F 2;  4M4P A;  5ABJ B;  4YG0 A;  4QPG A;  2I2S A;  1EY2 A;  1OT5 A;  3ZKU A;  3VHP A;  3BU0 A;  1W90 A;  2RE9 A;  2GZW A;  4H14 A;  4IE5 A;  4V2W A;  5GAL A;  2JE8 A;  4MAD A;  4MUV A;  3T1L A;  5C33 A;  5A3N A;  1APN A;  1CGP A;  4D7T A;  3FMG A;  3RYK A;  4UFH A;  5LAT A;  2VE1 A;  2Y64 A;  4XXA A;  1RJ8 A;  1LTE A;  3M3O A;  4LT5 A;  4GAL A;  2YC2 A;  4LR4 A;  3KVB A;  5BNO A;  1UO9 A;  3VBU C;  3VBO A;  5JXH A;  2VUA A;  1ND2 A;  1YI9 A;  1C5H A;  3DPR A;  3N3H A;  3TEW A;  3R0R A;  2B42 B;  1EAH 3;  3LA2 A;  2WLQ A;  5FMO S;  3F95 A;  1CR7 A;  4QAW A;  1TMF 2;  2D44 A;  2WT2 A;  3K46 A;  2CYF A;  2Q4S A;  4YPJ A;  4JX0 A;  3AKS A;  1FNY A;  2HYK A;  3LPG A;  3UGF A;  2Y0O A;  1UZW A;  4YW6 A;  1H6Y A;  2FMY A;  3JXS A;  4LUK A;  1RMU 2;  3MUY 1;  3W20 A;  1AR9 3;  3R05 A;  2R04 3;  1DYO A;  2JG8 B;  4IE0 A;  1BBT 1;  1W3X A;  4J1W A;  4NIH A;  3WSO A;  3UET A;  3VHO A;  5I91 A;  2YGM A;  4AVT A;  1W8U A;  3PUS A;  5FYI A;  2K0G A;  3U4S A;  2DV9 A;  4RSU A;  1RUH 2;  3O7O A;  1ULP A;  2WL1 A;  2VJX A;  5J48 A;  1M06 G;  2EIC A;  2VD7 A;  4R8H A;  1WW5 A;  4W6X A;  1CPM A;  3KV5 A;  4QKF A;  2XBO 2;  5F6K A;  5C4W B;  2C24 A;  4ISQ A;  1HV1 A;  1H2L A;  3I59 A;  4I09 A;  5J98 B;  4I2O A;  3MID A;  3MV0 1;  5K4L A;  1ZNP A;  1U5Z A;  4NHY A;  1PGS A;  1VMF A;  1HB3 A;  3Q8A A;  1V6O A;  3JQW A;  4P9X A;  1RUF 1;  1WUV A;  2DVF A;  5A7W A;  4OMC A;  3M4F A;  3KLS A;  2HWC 2;  1H2K A;  1W05 A;  2KXL A;  4AW7 A;  4DUX A;  4Y1U A;  3O1P A;  3VBR B;  2Z79 A;  1LGB A;  1PMH X;  3GZE A;  3IDE A;  2R0H A;  1CAU B;  5HPO A;  1W6M B;  3ZR6 A;  4Y1X A;  2JB4 A;  2VZO A;  4YRD A;  5FZ3 A;  1J1L A;  1BMV 2;  5L9V A;  4FPO B;  1AL2 1;  3OJB A;  4XTP A;  2VBD A;  4RGA A;  1C8M 2;  1ENS A;  3IMM A;  3T0D A;  1QGL A;  2UWA A;  4XCA A;  5JMC A;  1ASJ 1;  1DG6 A;  2BEO A;  3MBW A;  4LLF A;  2PHF A;  1SEF A;  3CQO A;  1N1V A;  3CMG A;  2DUO A;  3MIB A;  3QBQ A;  4KGQ A;  1RUG 3;  3TAY A;  4DOU A;  4OZX A;  4EZH A;  1SHW B;  5E6H A;  5A70 A;  2WFF 1;  4ZU7 A;  1GNY A;  2MNG A;  3UGG A;  1W2A X;  5BNN C;  4XMA A;  3H3L A;  3J8F 3;  3AZV A;  1MZF A;  2IVJ A; 
#chains in the Genus database with same CATH homology
 2W95 A;  2VZQ A;  3ETP A;  3FHQ A;  1UMH A;  2YFZ A;  1IQD C;  1XNT A;  2WUH A;  4KI5 M;  3T2Q A;  4TTG A;  3HPN A;  2LW8 A;  2L9L A;  2X05 A;  2W5F A;  1UY3 A;  4JKK A;  2CDO A;  3I2K A;  2VMC A;  2HLE A;  1NX9 A;  3VD4 A;  3IB3 A;  5IFT A;  2BBA A;  1P8J A;  3CIH A;  3WNL A;  2J1U A;  3GGL A;  3T08 A;  2QQN A;  4HG6 B;  4XUQ A;  2KD7 A;  4PT6 A;  4QDQ A;  1JYX A;  4OZO A;  3MUZ 1;  1UY1 A;  4GZ9 A;  4AAX A;  4CU9 A;  1SG3 A;  3VD9 A;  2VMD A;  5DN2 A;  4A41 A;  3HNM A;  4KWU A;  1OD3 A;  2RVA A;  4CVU A;  1WCQ A;  1D7P M;  2XHN A;  3FN9 A;  1K3I A;  2Z4F A;  3OGR A;  5CYY A;  3I2H A;  1GQP A;  3FL7 A;  5HXM A;  1GOH A;  3W5M A;  4UAP A;  4CUA A;  5LA0 A;  3MO4 A;  5LA1 A;  4W4Z A;  2EID A;  2QQO A;  5EJ1 B;  4PF1 A;  3MV1 1;  1W9S A;  2Y8K A;  2W47 A;  2WN2 A;  4D8M A;  2Y6K A;  2WDB A;  4AG4 A;  3BN6 A;  4BJ0 A;  2W91 A;  3OGS A;  2VZ3 A;  4ET7 A;  5EJZ B;  4JKM A;  4PQQ A;  1W8O A;  4DXT A;  5DMY A;  1H6X A;  1CZV A;  4L0P A;  2HYX A;  2VZ1 A;  1NKG A;  2WAA A;  2PQS A;  2WAO A;  2J1E A;  3SEP A;  2W1S A;  2YG0 A;  3E1F 1;  4FI9 A;  4CU6 A;  2WO3 A;  4A42 A;  3WF3 A;  4A44 A;  4BK5 A;  3WNK A;  2J22 A;  5JXJ A;  1O8S A;  3K4Z A;  4QB2 A;  4LQR A;  3UNP A;  3SKV A;  3WNM A;  3DYM A;  1US2 A;  4MOA A;  3HOB A;  1JZ6 A;  4DUV A;  1W9W A;  4RYD A;  4ARY A;  2VCA A;  3P6B A;  2J1A A;  2WO1 A;  4A45 A;  1UWW A;  3T0B A;  3NRU A;  4JHZ A;  1UXZ A;  2WO2 A;  4QX0 A;  4DXS A;  2VL4 A;  4BXS V;  2QQK A;  2J1S A;  1XPW A;  1JZ2 A;  4A4A A;  3A22 A;  4CU7 A;  3HNB M;  4D0Q A;  2VTF A;  2V72 A;  1JI6 A;  2VZV A;  2WN3 A;  2ZEZ A;  4P00 B;  1UMI A;  2ORX A;  1W9T A;  4DEV A;  5IYY A;  1JZ7 A;  1UYX A;  3LEI A;  3C7G A;  5IFP A;  4XVH A;  4DUW A;  4ZZ8 A;  2Y6G A;  5JMO A;  5B4N A;  4XUP A;  1JZ4 A;  3ACH A;  5C70 A;  5DQ0 A;  4A6O A;  3HN3 A;  1JZ5 A;  1PX4 A;  5EIY B;  4P08 A;  2XOM A;  1OH4 A;  3A21 A;  2W92 A;  5FUI A;  2W1W A;  5C71 A;  4QB6 A;  2QQM A;  3C7F A;  1JYN A;  3LPF A;  2VR4 A;  3D3A A;  1MPX A;  1J83 A;  4GWI A;  3C7H A;  2VZT A;  3UES A;  4BK4 A;  1SDD B;  3VDA A;  1PX3 A;  3I2I A;  3P1I A;  2W94 A;  2DDU A;  1DP0 A;  4E8D A;  3WF0 A;  2OKX A;  1BHG A;  1OF3 A;  3NNG A;  1YQ2 A;  3CKH A;  3WEZ A;  2E26 A;  3DYP A;  5CZK A;  1O8P A;  2W1Q A;  3OGV A;  2QQL A;  4XZU G;  3IAQ A;  2VO5 A;  2VMF A;  2VZS A;  1UX7 A;  2J1R A;  3VD5 A;  2J1V A;  2RJ2 A;  1OF4 A;  1UZ0 A;  4ZY9 A;  4ARX A;  4MGQ A;  5JXG A;  1CZT A;  3CZU A;  4P5Y A;  2W1U A;  2LS6 A;  5I0D A;  4DEQ A;  4ZZ5 A;  4TXW A;  3OEA A;  1GOF A;  1CZS A;  2ZXQ A;  2YB7 A;  1R64 A;  4OMD A;  3NJV A;  1UXX X;  4UI9 L;  4OUE A;  1JYV A;  3GXU A;  5B4X A;  2BER A;  1CIY A;  4QPW A;  2W46 A;  4UOJ A;  5J1X A;  1W8N A;  2JD9 A;  1HN1 A;  1US3 A;  2J7M A;  3F2Z A;  4DXR A;  1GUI A;  3WF1 A;  2EIB A;  2VCB A;  2XON A;  2X10 A;  1RYY A;  1W0N A;  5G04 L;  1NUK A;  2VME A;  1JZ8 A;  3OEB A;  5JXI A;  2YC4 A;  3A7Q A;  2RV9 A;  3WF2 A;  2DCK A;  4QX2 A;  1GMM A;  1T2X A;  3CDZ B;  3SEE A;  4OYU A;  3NQH A;  1UY4 A;  2C4X A;  1JU4 A;  1JU3 A;  2BGO A;  3GDB A;  4W50 A;  2WBK A;  1K12 A;  1UYZ A;  2C26 A;  4IUG A;  1PMJ X;  2BGP A;  2EIE A;  1XNA A;  4CUC A;  3VDC A;  1GU3 A;  2WZE A;  1F4H A;  3GM8 A;  3EB7 A;  4KMQ A;  2ZEY A;  5JR2 A;  3K4D A;  5C7G A;  3K75 B;  3T2P A;  3I3D A;  4QX1 A;  2BZD A;  2VZU A;  3LEK A;  3VDB A;  2VCC A;  1JHJ A;  2ID4 A;  5LA2 A;  3ZM8 A;  2V4V A;  3I2J A;  2JDA A;  3EYP A;  3I97 A;  3WNP A;  3ACF A;  4QB1 A;  2ORZ A;  5G05 L;  2VOT A;  1TG7 A;  2CDP A;  2VQT A;  1L7Q A;  2R7E B;  3I3B A;  2WQ8 A;  1K45 A;  3OBA A;  3T09 A;  4MO3 M;  2VM9 A;  2VZR A;  2VC9 A;  2Y6J A;  2E33 A;  5IHR A;  3THD A;  1JZ3 A;  1NAE A;  4XUT A;  3IDA A;  1KGY A;  1F4A A;  4W8J A;  1DLC A;  2J1T A;  3PUI A;  3ABZ A;  2W9X A;  3ACG A;  1GOG A;  3I2G A;  3LE0 A;  3DYO A;  4M4R A;  2XQX A;  3WQB A;  4BDV B;  3AC0 A;  3W5N A;  2Y6L A;  1KEX A;  3I2F A;  4M4P A;  2WYS A;  3J7H A;  2WAB A;  3HNY M;  4Z2A A;  1OT5 A;  3LEG A;  1UY2 A;  1CX1 A;  5JUV A;  2JKX A;  4XUO A;  2JE8 A;  4MAD A;  2C9K A;  2ZEX A;  3THC A;  3NJX A;  2X09 A;  2Y64 A;  3U37 A;  4QDS A;  1K42 A;  1J84 A;  2QQJ A;  2YC2 A;  4XUN A;  3III A;  4XUR A;  5JXH A;  2V5D A;  3VD3 A;  3HJR A;  5DPN A;  4GWJ A;  3C7O A;  2ZEW A;  1W99 A;  5IJR A;  4QDR A;  3C8X A;  4QAW A;  3K77 A;  4YPJ A;  3K46 A;  4JX0 A;  2WZ8 A;  3LPG A;  1H6Y A;  3JXS A;  3IAP A;  3MUY 1;  1DYO A;  4MGS A;  3WSO A;  3UET A;  4E8C A;  3PUH A;  3HEI A;  2B4K A;  3T2O A;  4CUB A;  3LQC A;  3I3E A;  3OG2 A;  1L7R A;  5LCW L;  2QQI A;  4CU8 A;  1ULP A;  2VJX A;  4LHS A;  2EIC A;  2B9V A;  3FHA A;  1UY0 A;  3ACI A;  4LKS A;  3WNO A;  3MV0 1;  1EUU A;  2W3J A;  4RN5 A;  2E31 A;  3WF4 A;  1O59 A;  3ECQ A;  1I5P A;  4OMC A;  3DEC A;  2E32 A;  3A23 A;  5A1A A;  4DUX A;  3VD7 A;  1XC6 A;  2DCJ A;  3K4A A;  1PMH X;  1LNS A;  3BGA A;  5HPO A;  4P02 B;  3T0A A;  2VZO A;  1WKY A;  4ZXE A;  3WNN A;  2VZP A;  3CZJ A;  2VQU A;  1UYY A;  2Y6H A;  2W87 A;  1EUT A;  3T0D A;  4A3Z A;  4JKL A;  1TVG A;  3MBW A;  5F7U A;  3SKJ E;  2YFU A;  3OB8 A;  3CMG A;  3CQO A;  1JYW A;  2QBX A;  3C7E A;  1SHW B;  1ULO A;  1GNY A;  4QX3 A;  4LPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...