2BGPA

Mannan binding module from man5c in bound conformation
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
116
structure length
116
Chain Sequence
SWTYTAASASITAPAQLVGNVGELQGAGSAVIWNVDVPVTGEYRINLTWSSPYSSKVNTLVMDGTALSYAFAEATVPVTYVQTKTLSAGNHSFGVRVGSSDWGYMNVHSLKLELLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Mannan-Specific Family 35 Carbohydrate-Binding Module: Evidence for Significant Conformational Changes Upon Ligand Binding
pubmed doi rcsb
source organism Cellvibrio japonicus
molecule tags Carbohydrate binding protein
molecule keywords ENDO-B1,4-MANNANASE 5C
total genus 12
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2bgpA00
3CKHA 3OGVA 1JZ6A 3IB3A 3UNPA 1GU3A 2RV9A 4A45A 1K45A 2E32A 2VMDA 3HN3A 4LPLA 3A7QA 2VZVA 2J1UA 4LHSA 1JZ8A 4OYUA 4CU6A 2Z4FA 1H6XA 1JHJA 1CZVA 4A4AA 5LA2A 2QQMA 4LQRA 1UMHA 2XOMA 4W4ZA 2W92A 2QBXA 4QPWA 5J1XA 2VO5A 1TG7A 2WAAA 1MPXA 1GMMA 3CQOA 3GDBA 3SEPA 1BHGA 2VMFA 3NNGA 2YG0A 2DCKA 3VDAA 2E31A 3LE0A 4KWUA 3I2FA 4ZXEA 4FI9A 1PMJX 3WQBA 1US3A 1JYVA 3VDBA 1D7PM 4PF1A 1JYXA 5DN2A 2E26A 1UYZA 5JXGA 2BBAA 1F4HA 4BJ0A 4XUTA 5LA0A 3MV01 1W9SA 2VZQA 2QQIA 1UX7A 5B4NA 1GOFA 2VZRA 3THCA 4QB1A 3FN9A 2QQLA 5IJRA 1JZ4A 1UY3A 1OH4A 4ARXA 4BK5A 2V72A 3OEAA 5CYYA 2VJXA 3T0BA 2WN2A 1W9TA 2VQTA 3OGSA 1US2A 2JKXA 2ZEZA 3HNYM 2J1SA 2DCJA 4XZUG 4MGSA 1NAEA 3K75B 2LS6A 1JI6A 1TVGA 4D0QA 3JXSA 2WABA 3VD7A 1DYOA 2ZEYA 5LCWL 5DMYA 1KEXA 2WN3A 1GOGA 4ET7A 1JZ5A 1R64A 4DEVA 4ZZ5A 3UETA 4MOAA 2PQSA 4UOJA 4JKMA 1UYXA 3WF4A 4CVUA 4MGQA 3HPNA 1UXZA 2WYSA 1DLCA 4IUGA 2VTFA 1DP0A 2VOTA 4DXTA 3IAQA 4DUVA 2VC9A 4QX3A 2WQ8A 4GWIA 1SG3A 2Y6LA 5G05L 4DXRA 1L7QA 3WNLA 2BGPA 2VCAA 3HNMA 3I3EA 4QX2A 3WF1A 2KD7A 3C7OA 3T0AA 3DYPA 1UY0A 4TXWA 3MUY1 1OF4A 3E1F1 4MADA 4CUCA 4MO3M 4HG6B 3D3AA 3DECA 1F4AA 1ULPA 1W9WA 2YC4A 2BZDA 3IAPA 5I0DA 3I2IA 1O8SA 2Y6JA 1J84A 3HNBM 4DUXA 1JU4A 4QB6A 3A21A 1UZ0A 3NRUA 2VZ3A 3FL7A 1UY1A 1CZTA 3T2OA 3ABZA 3I3BA 4JX0A 4OMCA 5IFTA 4XURA 3WNMA 4OUEA 2W1UA 1T2XA 2R7EB 4ZY9A 4RYDA 2EIDA 5IHRA 2Y6KA 3HJRA 3MV11 2EIBA 3BGAA 3OB8A 4KMQA 3CZUA 3I3DA 4QDRA 2WO3A 1K12A 2BGOA 3WNNA 5JUVA 1XNAA 4OZOA 3T2PA 3LEKA 1ULOA 1W8OA 3OG2A 2VMEA 2XHNA 3SKJE 3ACGA 3HOBA 2HLEA 3GM8A 3K46A 2JE8A 4UAPA 2VZOA 5C71A 4UI9L 5HXMA 4P02B 2QQKA 2Y8KA 2QQNA 3ACHA 2W95A 4P00B 1GNYA 2WUHA 4AG4A 2W3JA 3FHAA 3W5NA 2V4VA 2OKXA 2W87A 4QDQA 3T2QA 2VCCA 4DUWA 2VZTA 4BXSV 2WO1A 3EB7A 3NJVA 5JMOA 4CU9A 3ETPA 1P8JA 2YFZA 3NJXA 3WF0A 2XONA 2EIEA 3AC0A 3CZJA 5EJZB 2VL4A 2J1TA 4JKKA 1HN1A 1UYYA 3CIHA 5FUIA 4CUBA 4CU7A 2W91A 3K4ZA 3IDAA 3SKVA 3MBWA 1SHWB 3WF2A 1JZ3A 3LEIA 2VQUA 3J7HA 4QAWA 3C7GA 1H6YA 3C7EA 2Y64A 2X09A 3EYPA 3DYMA 3T09A 4PQQA 3UESA 4PT6A 4BDVB 5JR2A 5B4XA 1JYWA 3VDCA 3K77A 2W46A 3T0DA 4M4PA 1XPWA 1UY2A 1PMHX 3U37A 5HPOA 1L7RA 4A6OA 4W50A 3VD5A 5LA1A 1JZ7A 2WZ8A 2W94A 4TTGA 1EUTA 2ORZA 4QX0A 1O8PA 2W1WA 1IQDC 2LW8A 3OEBA 1XC6A 2J1VA 5G04L 3WF3A 3C7HA 5JXIA 1W0NA 2VMCA 2QQOA 2X10A 4L0PA 1NUKA 3I2HA 2ORXA 4A41A 5JXHA 3K4AA 1K3IA 1CX1A 1K42A 1EUUA 1KGYA 3VD3A 1RYYA 1O59A 2Y6HA 2WO2A 3I2JA 5JXJA 2VCBA 4M4RA 3OGRA 3P1IA 3LPFA 2VZSA 2VZPA 4P5YA 3ECQA 4E8CA 3ZM8A 1CZSA 4DXSA 1OT5A 1JZ2A 1NX9A 3GGLA 3WNPA 2W9XA 1YQ2A 2Y6GA 3FHQA 3VD4A 2J7MA 1WKYA 2HYXA 2B4KA 3IIIA 4KI5M 2J1RA 1XNTA 1OF3A 3W5MA 1GUIA 2RVAA 4P08A 1JYNA 4A42A 2YB7A 2ZEXA 3A23A 1GOHA 3LQCA 1WCQA 1W8NA 1GQPA 4XUQA 2J1AA 4QDSA 2W1SA 1LNSA 5DPNA 4CUAA 2J22A 2WDBA 3SEEA 1UXXX 1NKGA 3A22A 1UY4A 3ACFA 4AAXA 3WNOA 2YC2A 4D8MA 2QQJA 3I2GA 4E8DA 4RN5A 3MUZ1 3THDA 4GWJA 3C8XA 3PUHA 2DDUA 3WNKA 2RJ2A 5EIYB 2YFUA 4QB2A 2ID4A 2JD9A 2E33A 1CIYA 1SDDB 2ZEWA 4ZZ8A 4A3ZA 2EICA 4Z2AA 3GXUA 3CMGA 1OD3A 3CDZB 3P6BA 1J83A 2J1EA 2B9VA 2C26A 3PUIA 4W8JA 3DYOA 3VD9A 2BERA 2CDOA 4XUNA 1W99A 4DEQA 5F7UA 3LEGA 2ZXQA 5IFPA 2VR4A 1PX4A 3F2ZA 1UMIA 3ACIA 1UWWA 3I97A 4XUPA 4QX1A 4GZ9A 2L9LA 2C9KA 5IYYA 3I2KA 5DQ0A 4XUOA 5C7GA 2V5DA 2VZUA 2XQXA 4OMDA 4XVHA 4YPJA 3WSOA 2W47A 3HEIA 3C7FA 4ARYA 5EJ1B 2W5FA 3WEZA 2CDPA 3NQHA 5CZKA 2VM9A 2X05A 4A44A 4BK4A 1JU3A 2WBKA 3OBAA 5A1AA 3MO4A 3BN6A 1PX3A 4JKLA 3T08A 4LKSA 1I5PA 2JDAA 2VZ1A 2C4XA 5C70A 2WAOA 3LPGA 4JHZA 2WZEA 4CU8A 3K4DA 2W1QA
chains in the Genus database with same CATH superfamily
1COV1 1URXA 1S0EA 1R1A2 3NKGA 1IOAA 3VV1A 5C33A 2VOKA 2XBO3 5C9AA 3WUCA 2XL7A 4Z92B 4ES8A 3VHNA 1G8WA 2AZ5A 4BU2A 5FUPA 4D6SA 4ZHNA 2E7AA 1JH5A 1AX0A 3M1HA 1K45A 1APNA 2VMDA 1LKNA 1D2QA 1CAUB 3AB0A 2WZR3 3OPTA 4XJWA 5KHGA 1SACA 4LHSA 1VMJA 1LOCA 3DL3A 1KFXL 2D5HA 2PAEA 3KV6A 3N7LA 4QXHA 4BYYA 4LT5A 4QX7A 1RUJ1 1CZVA 3OYWA 5C9AC 4PJYA 3RS6A 4A4AA 5LA2A 4FFHA 5F6LB 4XBQA 1C3HA 1W8TA 3H42B 2GH8A 2XOMA 3GBFA 3PNAA 3WT3A 3M3IA 4OHZA 1YWKA 2QBXA 4QPWA 5KHKA 4UBHA 3ES1A 3L9JT 3CQOA 1UOGA 1JTZX 3ILRA 1UU6A 1YHFA 2EALA 2HWE3 4GALA 4OCTA 4I30A 3ZXFA 5DG1A 2RDQA 4HLTA 4FBFA 2IC1A 1UZWA 4J1XA 2E53A 2AGSA 3LE0A 3MPBA 1ZBE3 4C0BA 1OLQA 2RR12 1JBCA 1ZRDA 5BNNC 4HSJA 5A3NA 3VDBA 3AM2A 1RUE1 4WVMA 2P5BA 5L7OC 1BLZA 1XNDA 3I3QA 5KR7A 1W3VA 5JXGA 3SH3A 1Y43B 3AJZA 2BBAA 1F4HA 4FPCA 3SCHA 1AZDA 2YBPA 5J09A 1LU1A 1WA4A 4LLOA 4NAMA 4PI2A 5LBEA 1GQHA 3ZYIB 3GHMA 4GMP1 4MZUA 1QQP3 3H3UA 4EE2A 1UU4A 1LR5A 5F3EA 1FX5A 4AFAA 5FZLA 4J1WA 3H8UA 2VZQA 3IKWA 2CV6A 4R9AA 3X29B 1IPSA 3WV6A 1AR91 2VUJA 3ZXAC 1GOFA 3RJRA 3THCA 3WG3A 2F4LA 1H0BA 4GJYA 4Q0UA 4CCKA 4NIGA 2WFF3 4QGLA 3FN9A 5FLIA 4F3JA 3CJXA 1VBB3 4YZ1A 4EQVA 1HIXA 1MEC2 1W6NB 4CTEA 2OIIA 5JOZA 1PVC3 1EY2A 1U12A 2V72A 3JBG3 3MYXA 4JGYA 4LBOA 4Q4Y3 5T50A 4COWA 3N4MA 2WN2A 2RDNA 5GZEA 1LGBA 4AK3A 2Z42A 4WVVA 2VQTA 4PIZA 1HV1A 1Y9QA 2ZEZA 2O8OA 3SMHA 1C8NA 3A0NA 5FZ6A 4QQOA 1BQPA 2QDRA 1N47A 2LRPA 1LB2A 3T4VA 4YARA 3VGIA 2G1MA 1B35B 1RVF1 2G9FA 4ATEA 2WABA 1VRBA 4Q4Y2 4FPOB 1SLIA 4PDWA 4AEDA 3RYPA 2OQ6A 1X33A 2FMYA 3KZ4C 5FP4A 5JCTA 1KEXA 2WFF2 3VZMA 1SPPB 4XDQA 1GOGA 4CA9A 3LA2A 2BRTA 2QZ2A 4DEVA 3O0XA 3BUCA 4QXKA 1CAXB 3OUHA 2EF6A 4JDMA 1ONAA 5A6QA 1RUD3 3PIJA 2A3XA 1UIJA 4QX8A 5LASA 3TEYA 4L97A 4UOJA 3S57A 5F5AA 4RD7A 2DBIA 1UYXA 3PUQA 3QOPA 4XACA 5FZ1A 4YM3A 4LKEA 3WF4A 2YROA 3J26N 3OY8B 3THTA 4AQSA 1DZTA 3BU0A 3AK0A 2IWGB 4CEWB 1RHI1 2AUYA 2UURA 4MGQA 1UXZA 1Q8VA 4BISA 3M3QA 3U78A 5A33A 1H1MA 2VTFA 4BXFA 3B02A 1DLLA 4WM7C 3ZMNA 3LSEA 3WG2A 3VKOA 3M3EA 1QNYA 2VC9A 2OPWA 4EWDA 4QX3A 1DYKA 2B42B 2WQ8A 4IE0A 1WLCA 1XE7A 2Q1MA 4TLFA 1Z78A 5FP3A 4CCDA 1SG3A 1BBT2 3IIAA 2Y6LA 3AYAA 5HCFA 1UD1A 5BV6A 5FPXA 3SCFA 1L7QA 4HFSA 5FZOB 1CJPA 2VCAA 3I3EA 2QTWB 2BEOA 2WC2A 3NAPB 3OPWA 2BOJA 1ULEA 3SLIA 5IVEA 2Y38A 3JB4C 3C7OA 2BNOA 3U4SA 3DYPA 5FXXA 3E1F1 1C4RA 1POQA 3TN93 3CJIB 3TWIA 4IEOA 1DGRN 1AR93 4IL7A 1ZRCA 2PMWB 2GN7A 1F4AA 1YUDA 4EROA 4YW4A 2O1QA 1WD4A 2YGLA 4RHV2 1VBB1 2BW8A 3HQUA 4CDQC 4Q0QA 4QHZA 1OQ1A 1MS4A 4CYDA 1VB2A 3D5OA 2TNFA 5I0DA 1AYM3 1JN2P 3ZDSA 5FOBB 2WLQA 2JD4A 1H1AA 2Y6JA 3KGZA 4NVPA 5FY9A 5FLHA 4IEPA 5BXXA 5ABJC 1TMF3 3V0BA 5C8CA 3CHXA 5A33B 1FYUA 3BYWA 4BLIA 5F37A 4XXPA 1RUG2 5A7WB 3T2OA 2BTVC 3ABZA 3I3BA 2ZCWA 4IGQA 1E5RA 4BE3A 3SXWA 1J3QA 1RMU2 2IVJA 2R7EB 1V6OA 4HN0A 4RYDA 2EIDA 4B29A 3OB8A 1IG0A 1F5FA 5DZFA 2CHHA 4KMQA 4UXAA 2WO3A 1X8MA 3GJAA 3JD72 4NWVA 1K12A 1TEIA 5E88A 4XF0A 2EXKA 5JUVA 2VCMA 3W58A 5M0TA 1AR62 2WNUC 1QKQA 1R1A3 3NJZA 1RUD1 4OZOA 5FMCA 2ZABA 5FYVA 4MXVA 5FQ0B 4NMIA 5BPXA 2VMEA 5L9BA 3CBNA 1CIWA 4ASKA 4BMBA 1ND2A 1HRI2 2ARCA 4YLZA 3VKLA 1FOD3 2JE9A 2R32A 4FQZA 4XZPA 4CP9B 2W68A 2PAMA 4TN7A 1PIV1 4AHYA 5BNPC 1VMHA 3LB9A 4Y1UA 2ZKNA 3AZXA 2CYFA 2QVSB 4BB3A 4CUGA 1STMA 4IV3A 1BZWA 3EHKA 2QZ3A 4L2NA 4UI9L 5C71A 5HXMA 4Y22B 5F8PA 3BVCA 5FZEA 2XH6A 2ZGQA 1AX1A 2P34A 3KCXA 2WUHA 5BNOB 3W5NA 2V4VA 1G9AA 3L2YA 1W2UA 4YG3A 1S0FA 3FFQA 5BYNA 3G7DA 2VU9A 1XQNA 3VZOA 1VPHA 1R093 1RUI3 5GLTA 4ITCA 2A6ZA 4ATFA 3VHRA 3B94A 5C9AB 1NA1A 3EB7A 2XJTA 5FYUA 3WDUA 5IT6A 4PBPA 5FYBA 4A7KA 1UCXA 5F2SA 3WF0A 2P3IA 1GNZA 4AXOA 4Q4Y1 2Q30A 3ZYFA 5EJZB 2R063 4ZKTB 1SCSA 4IXLA 1DIWA 4CUBA 1GFF2 1NCQC 3ZLIA 4YM1A 3CJIA 2PAKA 2JIJA 3FBYA 4HOOA 5FXWA 3SKVA 3VBFC 4DO0A 4Q2FA 1JOPA 1H8TB 2WNVA 3UKNA 4JRAA 4PHZA 3WF2A 1W6PB 1F5JA 1OA3A 1UQXA 3G6JB 3ZXGA 5J48A 1RUNA 3PMSA 1PK6B 2VQUA 3J7HA 3ZVXA 2RM22 4X8PA 1TE1B 2PLV3 1AR73 2DFBA 2H6CA 3K3NA 4NIHA 1O3QA 2ZKLA 1TMF2 3DYMA 2EIGA 3Q8EA 2P6HA 4PI0A 5FKCA 4NO4A 3VKNA 1RUH2 4LBMA 3BALA 4EJRA 1I1EA 1AHSA 3K77A 3DF0A 2VUCA 3VBFB 1SPPA 1VE0A 4Y1ZA 4I09A 4UFLA 4BQ3A 1PMHX 4Q1PA 3FLRA 3K51A 4OQ9A 5CEHA 1QJX1 4XQDA 3M70A 1IHMA 3DPRC 3NWKA 1OD5A 1C5IA 1XNBA 3BOPA 1FXZA 4W50A 3THPA 4QX5A 4FTBA 1WW6A 2XBO1 1S0CA 4MGZE 4Q27A 2V4AA 1UO9A 3OUJA 2JDNA 2P17A 3AFKA 5A70A 1EAH1 4JDNA 2W52A 4MGIE 5EP9A 1GZTA 5HV4A 1GZCA 1S0DA 2RR11 3OEBA 3AL6A 1RC6A 1A78A 1JHNA 3KT1A 2FMDA 2KR2A 5C8CB 3SCGA 2ARBA 2VMCA 3FC0A 1FNYA 2QQOA 2H0VA 2VTXJ 2OS2A 3S6PA 4PIYA 2NPIA 4QM9A 3HWJA 3ME2A 3UT0A 4QT6A 4NRQA 5JXHA 1K3IA 2VXRA 1U5YA 1K42A 1ZBA2 1KGYA 1MS8A 4WZFA 4Q4X1 4META 1RYYA 1UZYA 4I0BA 1ULDA 1OQDA 2Y6HA 1BEV3 3TAYA 1WMXA 5A3PA 1V0AA 3NV4A 1QJU2 4AQTA 4DS0A 2BVVA 4N53B 4AWDA 1VBE3 2DV9A 1YQ5A 3LPFA 2UYAA 1RUJ2 2YMZA 2VZSA 3JQWA 4DXZA 2PFWA 3QH7A 1J1LA 1D4VB 5A3OA 2EXHA 1QJU1 1XJAA 5FZDA 3AYCA 4KWLA 1OT5A 4QPIC 2JDYA 3GGLA 1C57A 4QMAA 3VBOC 3KLSA 4LTAA 1HRV3 5C3QA 4XJUA 3J9SA 3SH5A 2AREA 4GMP3 4YGCA 3FFZA 1FMD2 1OVPA 1ZBA3 4OZXA 5FBZA 2HYXA 1PVXA 4K40A 1W2AX 3AJYA 3NV2A 1DQ6A 1PO21 4YSFA 2VAUA 2ET1A 3UGFA 4OQ8A 3JZVA 1RL3A 1OF3A 1QH7A 3VBOA 4P08A 4ORFA 2Y60A 1NE6A 3U10A 4A42A 1C8M3 1CX4A 3Q9OA 5T5PA 3AMPA 2Z79A 3P3PA 1K5JA 1DQ2A 1X7NA 1REDA 4KGQA 5GLZA 4JQRA 4XFFA 1GANA 4CDQB 3OCPA 1WCQA 4XIKA 3T1MA 5KWRA 4LA2A 1UOBA 4IGOA 4BZ4A 1XRUA 4W6WA 2ADEA 2VQAA 5LATA 2JDMA 1O3TA 5T55A 2JWPA 5K0UC 3ETQA 3VBUB 4QPYA 1CAWA 2JE7A 1C8M1 4OLLA 3A4UA 3LDBA 4H14A 1NZCA 2KA3A 1JOBA 1DZQA 3POSA 1RUH1 5FK7A 2J22A 5D8AB 3N35A 4DPNA 2A3WA 3SEEA 1CR7A 3WUDA 1WLDA 1FNZA 2A6WA 3GBWA 1VBD3 2YC2A 1XE0A 2ZAAA 3H1YA 1MEC3 3TEWA 3P5BA 1IPKA 2Y6FA 1U5XA 3WOGA 2QQJA 1W0PA 1OC1A 4Y4RA 2SLIA 2ZX0A 1RITA 4RR3B 3KCCA 3PUHA 2R49A 5GM0A 1D2SA 3PIGA 2AYHA 2RS12 3WNKA 1NG0A 1HLCA 3VZJA 1AXYA 2ID4A 2JD9A 5AC92 5A32B 2ZX2A 2E33A 4FOWA 1CIYA 1DHKB 4LO7A 4OFGA 4P14A 5FZ0A 4YFWA 2ZEWA 2JICA 1ASJ1 4XCBA 5FAXA 3B7MA 3WP4A 5GKAC 5H9SA 1COV3 3ZFFC 4YWAA 2DUPA 2AENA 1Z0HA 2VMGA 4FAGA 5GJ6A 1QOSA 2WNUB 1WW7A 1LOFA 1OD3A 3PL0A 2QCSB 4RS5B 1J83A 4AFBA 2D97A 4ZONA 3VD9A 4YZ2A 1GZ9A 4NPLA 2B7YA 2Y0IA 2ET7A 5E6HA 4QU1A 4C0HA 3TYJA 3H3ZA 4XQ4A 2CWSA 2HH9A 3U11A 2IXJA 1E5IA 2ZXQA 1Q43A 4AFDA 4BQ2A 1VR3A 2GDFA 3DXUA 5L9VA 3DV8A 5GALA 1AR61 1YQ8A 1PX4A 3F2ZA 1CN1A 3S30A 4GZ9A 3JD71 3VLBB 1UKRA 1KS4A 5IUQA 3KV4A 1ENRA 5ISLA 2QQWA 4K8RB 2IZWA 5J96B 1BVVA 5DQ0A 3AKPA 5C7GA 1UPSA 4GH4B 1EYBA 1N1YA 4WV8A 3R4DB 3WSOA 1WCDJ 5CFDC 3C7FA 5ABJA 3PVOA 3J4UH 5EJ1B 4D69A 4QKNA 4ZXKA 5C8CC 2G19A 2PLV1 3NQHA 2VM9A 4RR3C 3T4HB 2A73B 5IAXA 5JPMB 1JU3A 1MZ5A 3OBAA 5DG2A 3MO4A 4CRQA 1CAVB 2XLFA 3BN6A 2WSUA 1IPJA 4O7XA 4LNVA 2Z5WA 3T08A 1DGWX 1LTEA 5LB6A 1GSLA 2CU5A 4IEXA 5KXEA 4CCMA 3IT8A 4HK8A 3NMBA 1AXKA 4EZ4A 1NE4A 1XE8A 1HXS1 1W8ZA 2RJKA 3GZUC 5FOJB 4K1ZA 1CGPA 1CD3G 2HEVF 1YQ6A 3DGTA 3OGVA 1JZ6A 4BOWA 2G9ZA 4FFIA 4FPHA 4IV1C 1HB4A 4LUKA 4AHXA 2WFPA 1WLWA 3W9AA 2RV9A 4N7UA 3OF1A 2W0XA 1BEV1 2WA4A 4FO9A 5ANNA 1ENSA 4YVWB 2Q1FA 4A45A 3WLUA 5I91A 3WDTA 4B4QA 1F35A 2D6MA 1R091 1RUI1 2J1UA 4CU6A 2P2KA 1JHJA 4IV1A 2PHWA 3PUSA 3BU7A 1D4M1 2A1XA 3RJ2X 1MVEA 1WGPA 1I6XA 1YCIA 4KG0A 1ZZ6A 1NQDA 1O4TA 1UMHA 4EN7B 2OZ6A 1MACA 1T6BX 2R0HA 5D8AC 4Y26A 1HQWA 4XJ8A 3O1TA 4FCAA 1UU5A 4P5HA 5C8WA 1O5LA 2VO5A 1TG7A 2PA7A 1OLRA 4YVSC 5DDJ1 1B35C 1PMIA 3PVBB 4NPRA 3SEPA 4D6RA 1N1TA 2VMFA 3V0BB 3NNGA 4NAOA 5F5IA 5FR3A 2A71A 2DCKA 5ACA3 3GNEA 1LGCA 5KXBA 1BK0A 1JXNA 2IFRA 2JJ6A 1LOGA 1SLAA 1VBC3 4K1YA 1AR71 4BK5A 2WFF1 2BJSA 4YGDA 5EV7A 2Y26A 4IE5A 5LA9A 4YNIA 5FMDA 4NIAA 1B35A 4CE8A 1Q8OA 3ELNA 1HQLA 4LHNA 4N9HA 4OUSA 1AR83 5EPAA 3MLKA 3WQBA 1US3A 5IK4A 4QPGB 1JYVA 1D7PM 2YXSA 4CXYA 2OX0A 2O0OA 4IESA 5BNOA 2PELA 5DN2A 1UYZA 4IE7A 3TN91 4COZA 4V2WA 1AL22 2WA3A 4IEWA 3ZR6A 4BJ0A 1E5HA 1QJX2 4JCKA 4QGNA 3BPZA 5JOWA 3HT2A 5FXVA 3P3NA 3MGUA 1LOAA 3MV01 1W9SA 2QQIA 4LBNA 2Q4SA 2VG9A 4I0WB 4S2GA 4AGVA 3PTRB 2HWD2 4UW5A 3ZKYA 3ZPOA 5B4NA 5FV3A 5IVBA 1O3SA 5JI9A 4CDXB 1AL23 1GWMA 5IJRA 3MZHA 1OH4A 4ARXA 2GN3A 5FYZA 1AR92 1VP6A 2P1BA 2RM21 3KT4A 4M3CE 5CYYA 3DPRB 3KB5A 3BOWA 3AZZA 4OI4A 2IFWA 4AEDC 3HNYM 4FFGA 4INDA 1HRV2 2VVFA 3VBSC 1UMZA 3VB9A 4EN6B 3K75B 4GQ7A 5JIUA 2LS6A 1JI6A 4D0QA 3V0AA 2HWC3 2HWE2 1W9FA 1QMJA 2HWB2 5CB7A 1OI6A 2RDRA 3HVDA 5C4WA 2DTWA 1RUJ3 2ZHLA 2P4EA 3QACA 5FY4A 1GP6A 2EAAA 1GV9A 3ZFGC 4ET7A 4ES9A 1NLRA 3O1OA 4E4DX 4E9KA 1OKQA 1KDKA 2RDSA 4CDUC 1YFUA 1B09A 1MS3A 4ZU7A 4WZCA 3LFMA 2NN8A 4UFHA 3PU3A 2O14A 1K5MB 1C1LA 1MQTB 4JKMA 2DU1A 4LR4A 4QPIA 1DG6A 2HWD3 4LO6B 4CVUA 5K9YA 4COVA 3RSJA 4B4PA 5C5TA 4FPLA 4CZSA 5LBBA 3S0MA 1H9PA 2WYSA 2ZOEB 3LCPA 1H8VA 4RL7A 4I2OA 2BUKA 3ZSMA 4SBVA 2VULA 3ZYRA 2DBNA 4K6BA 1LEDA 3E5XA 2H0BA 3INAA 3NNLA 5JI7A 1W06A 3H50A 3PUAA 4Q26A 1NCQB 1LRHA 1CPNA 2VECA 2BGCA 1XU2A 3M7AA 4IE4A 5G05L 3N9NA 4DXRA 2VQ0A 4M0NA 2BGPA 4DRVA 1XYNA 1HJGA 1EPZA 1JUHA 1IKPA 3HAGA 2I2SA 4NHKA 3TOJA 5C5UA 5CG8A 2PYTA 4MGTA 4TXWA 2R042 4KWKA 2E6VA 4CUCA 2VBBA 3VZNA 3ZDVA 4HG6B 3D3AA 3O1MA 4MV2A 1ULPA 5J37A 1W6PA 4OHYA 3JBG1 3EJKA 2CL2A 2UWAA 1W9WA 4LBLA 2DUOA 4DY3A 4R52A 2OA2A 5IK8A 3Q8AA 4Y20B 2BFUL 4JTOA 1BK1A 2DCTA 1DGWA 4Y33A 1H2LA 1PZ9A 4RHV1 2K46A 1NY71 3GJBA 3VBSB 5E8AA 4DUXA 1JU4A 2RS51 2AACA 4I02A 3UV9A 1MS9A 4CCCA 3NRUA 2FDKA 4DNYA 2PLV2 1O4ZA 4RFRB 3WP3A 1LULA 1NT0A 3KT7A 4OVEA 4JX0A 4HMZA 4JVAA 2ILMA 2YY1A 2WYFA 2WNUA 4Y24A 1T2XA 3WQ1A 1U0AA 1S0GA 4XMIA 5DAVA 3E6CC 3WHUA 2Y6KA 2ZPXA 4H7LA 4AFCA 4QKFA 2Q8CA 4CEYC 2EIBA 4E4ZA 5D1IA 4LK6A 4N9IA 1T6GC 4CCNA 2WZPP 4QDRA 1KDMA 1SLTA 3D0SA 3MIGA 5FYTA 3WP6A 3V65A 5LK7B 2QDNA 4BQYA 1QQP2 2BGOA 4P9XA 1LCLA 3WNNA 4KBBA 3ZIWA 4A2UA 4ZS2A 1RGSA 3QLQA 5CNAA 2A6VA 4LULA 3ZFFA 1CAVA 3GHNA 2CAVA 5A3WA 3SKJE 1FT9A 3K48A 2HLEA 5JZGB 4CEYB 5LBFA 1JS9A 3M8LA 3H9AA 4HPKA 4QPGC 4UAPA 2VZOA 3ITQA 3WW1A 4AFMA 4P02B 1NA1C 4ZU4A 2AEYA 2QQKA 1QGLA 2ZTNA 3ACHA 4YVWA 1NLSA 3I2DA 3PHMA 5FZMA 2W3JA 3FHAA 4LEJA 3W59A 2D93A 4FPKA 3IPVB 1ZX5A 2W87A 3PJYA 5JPNB 1TME1 3T2QA 1VRH1 4D3WA 4DUWA 3SNMA 2WQZC 4BQXA 3V0AB 4ZU5A 3GZTB 5FYSA 3CJIC 1QDOA 2BU9A 4Q4W2 2GNTA 3ZXLA 2VY0A 4CCJA 4D94A 1P8JA 2XONA 2JIGA 2EIEA 3AC0A 4LBJA 4WVWA 1F15A 1V70A 3AKQA 1RVF2 4XW3A 2PHRA 1BCXA 1AR63 4CU7A 1UYPA 5KC6A 4H7MA 2FHRA 4KG8A 3D8CA 2JECA 2OZJA 4Y1YA 5FO7B 2YYOA 4F83A 1N1VA 2ZX3A 1FAYA 4ASMB 1X36A 1HB2A 4HETA 1SHWB 4YM2A 4M3CF 4HONA 4NHYA 4DZGA 2ZGKA 4FAHA 1AUYA 3PVNA 5BY5A 1PGSA 1RINA 3LEIA 1JZ3A 4QAWA 3U4XA 2P6CA 3LEMA 3C7EA 3FX3A 3OOXA 1RXFA 2VNOA 1QXPA 4AW7A 2VVDA 4LLFA 3WNXA 2OUJA 4PQQA 4L11A 5CG9A 4PT6A 1WW4A 4FP2A 3AVSA 5F5QA 4BDVB 1Z7S2 1ZZ7A 1IS3A 2D5FA 2JG9B 3AKTA 4LE3A 5FPZA 5B4XA 1C8M2 2Y33A 3O5SA 5FREA 3VDCA 4P9GA 3RZZA 1FPN1 2NMOA 3DCQA 3U37A 1QJFA 3VHPA 1L7RA 1WMFA 3EMRA 3PTYA 3V56A 4E4HA 3ASIA 4AI3A 1RUE3 4AVAA 1GKBA 4XYXA 5LA1A 1JZ7A 1DDLA 4TTGA 1RUF2 3Q8FA 4MSVA 4QX0A 1UW8A 3ALQA 5LWBA 3BODA 2RS13 4QPIB 1QQP1 3DXTA 5E1RA 2Q8OA 3UK9A 4IE6A 5HV0A 1QOTA 2PHTA 2J1VA 4HBNA 4YW6A 3M3CA 1PZ8A 1W0NA 2WT1A 5IATA 1DFQA 2Q5TA 3JB8A 4L0PA 3W21A 4CDWB 1V6MA 3ZSKA 4A41A 4CP9A 4LXLA 1YFYA 3UL2A 5KHIA 3K4AA 3OBZA 2NM1A 4YG0A 3WVJA 4XDOA 4XQWA 1YO8A 4ISRA 3AXDA 5FPAA 5FRAA 1RTVA 1O59A 2A5ZA 3BKZA 4AEDB 4M4RA 1AYN3 3OGRA 3P1IA 4CCLA 1GZWB 3HMYA 4D7YA 4GULA 4EN8B 2VZPA 1LU2A 4XDPA 2OPKA 4P5YA 3R4SA 2BBVA 4KNCA 4XTPA 5EYXA 1S2EA 2WINB 4QQ2A 4RS5A 4FVVA 5EWSA 3ZX7A 3MF9A 5FP9A 1NX9A 1QY4A 5JLVA 3ROUA 4XBLA 2V09A 5E89A 1XU1A 4OUMA 1YIPA 2BFUS 2GU9A 3DKWA 4LHKA 4N7IA 5L7OA 5JSOA 3VD4A 4YRDA 5F9TA 2B4KA 1VBA2 1COV2 3RG0A 4C1WA 1L3JA 3NJYA 3IIIA 4KI5M 4Y5TA 3ZFFB 4DY5A 2J1RA 1XNTA 3MW4A 1AR81 3W5MA 3QD6A 1C1FA 1EAH2 5H9PA 3WDVA 2YB7A 1QXJA 5JR7B 3S7EA 2ZEXA 2FBEA 3I4IA 3J8F2 2GC1A 4OI0A 3S5QA 3RFRA 2WS91 1W28A 4UYBA 1QU0A 1YJKA 4GH4A 2GC0A 2P3KA 2GMMA 1IS6A 3MIDA 4RA0A 4PLOA 1NXMA 2WKKA 1JYCA 2RM23 2JKBA 2VW1A 3KSCA 4AYUA 1LENA 1RUC2 2CNAA 3GCXA 3LIGA 4UW3A 4D7TA 3LFIA 4QDSA 1UIKA 2ZGOA 1FMD3 4GKYA 3N7MA 4BQWA 1JOJA 2CGOA 3ZMOA 4CUAA 5FQ0A 2D44A 4C8DA 4XAAA 1ZNPA 4J25A 5DDJ3 1U5IA 2WDBA 4IEZA 4K20A 1RB8G 3ZN4A 3A22A 3ACFA 4D8MA 2VMHA 3EBRA 3IN9A 4CEWA 4EV0A 3BIEA 3VKFC 1CJDA 1V6NA 4RN5A 2GP3A 4LKFA 4Q8KA 4GWJA 1NXD1 2JB8A 1ZZBA 3R6SA 2HEYF 4AGGA 2BWAA 2YFUA 2YHJA 1OQEA 4QB2A 2JG8A 4E2SA 1TNRA 1KS5A 1HRV1 2WJSA 1LOFC 1ASJ3 1ENQA 3B93A 4OHVA 4QHOA 4LHLA 4HKOA 3POWA 5F6KA 2YPJA 4Y4YA 5FY1A 5ACA1 1LAJA 4AQ2A 1CVNA 1D4M3 1DGLA 2KM2A 1W6QB 1YNAA 2EICA 5HBAA 2RS31 1SBEA 2HWC2 4I0AA 2VE1A 3GXUA 3KV9A 5C3PA 2OYZA 2Q1ZB 1AYN1 3CMGA 1NA1B 2VBPA 1H4HA 3CDZB 4Q29A 2B9VA 4MG2A 1PGL1 4RGKA 3IDBB 5DAPA 5KHHA 1VBD1 3E5UA 2CDOA 2XG3A 2X53S 1W99A 4C90A 4QKDA 4R9CA 5H9QA 5F7UA 4GA9A 2WS92 1SEFA 1U5ZA 2B45X 1Y7BA 4UF0B 4LORA 3LEGA 4MHUA 3J8F1 5FWJA 4WVZA 5IFPA 1ND2B 1QXRA 4RFT0 2FZ2A 3KV5A 3MW3A 4KGGA 5CFDA 1AJKA 2HKXA 1UWWA 1LECA 1Q8PA 2FCTA 3ACIA 4XTMA 2BPA2 2ZZQA 5FTTC 1AR72 1VLNA 2PHDA 2ERFA 1I5ZA 4GXLA 5IYYA 4XF1A 1VBA1 2VTXA 4CDQA 2HJIA 4P9IA 1KITA 4U2AA 4XUOA 4AAPA 3RZKA 2XQXA 4OMDA 1HXS3 4LOTA 4MUVA 4QXCA 4O9EA 5KXCA 5GZFA 1Q3EA 4NOTA 2GAUA 5IVCA 1RUG1 5CZKA 2R1BA 2X05A 2UU8A 2R062 2Q8EA 3FHIB 1VBC2 4WM8B 4XABA 2AH2A 4XFGA 1KJLA 3OBRA 2VW0A 3BTXA 3EO6A 1LGNA 4AZZA 4JAAA 2X29A 3UYJA 3W20A 2TEPA 5FFOC 4GKXA 4GWMA 4S2FA 3DUIA 3RZJA 2LM3A 1YFWA 1ACCA 2PHXA 4MLOA 3VZLA 1NZIA 1F2NA 1PO23 2VPVA 2WNOA 2WZEA 3IDEA 2ZAHA 3AZVA 4P9JA 3O1PA 4A6SA 3NAPC 3POFA 1BKZA 2IXCA 4Q4X3 1PK6A 1CQ9A 3IB3A 3IZOA 2WLPA 4Y5SA 3RYRA 3UNPA 1IKQA 1GU3A 5DUVA 3PVEA 3KHCA 4AVVA 5FY7A 1J3PA 3PJQA 1PM7A 1SQ4A 3T3YA 1VB4A 4BH9A 2GNDA 3KGLA 3H7YA 4D6QA 5C3SA 5D8AA 1O3RA 3HN3A 3AP6A 1A8MA 3A7QA 5FIXA 4BIOA 1HQNA 1BYHA 1O91A 1SLBA 3O7OA 3POYA 5FBJA 4NUBA 4AI8A 1PO13 1W05A 1XSRA 4FPJA 1XSQA 2Z4FA 1H6XA 1QJY3 3UJOA 5A3MA 1H2MA 5LBCA 4NIIA 2B46X 4YGBA 4LQRA 4XETA 2DFCA 4B1LA 5JSRA 1A8DA 4TYSA 1MS1A 5A6XA 1EAH3 2BP6A 2XJSA 3LWCA 2VD7A 3RWNA 3KWVA 4S2DA 4JV4A 5J98B 4QQHA 4CP2A 1IQAA 5J1XA 1ZREA 5LY2A 3ACLA 2WAAA 3D4KA 1OLMA 4JGYB 1MPXA 1EV13 3GDBA 3WCSA 4AR2A 1BHGA 1N3PA 3ZPYA 4YZ5A 2Y34A 5FKBA 5JOXA 1GICA 2YG0A 4JHTA 5FZ8A 3S7IA 3VN4A 3HBZA 2D6KA 5BNQA 4K9SA 4XIOA 5K4LA 3NNFA 4R9DA 5FYHA 2ZGTA 4MHRA 3KVAA 4LK7A 1POV1 4FPFA 4FI9A 1X82A 4N43A 1WD3A 4Z07A 1BVP1 3IM0A 4CXXA 1YI9A 2WS93 5FP7A 4PF1A 4AE2A 1OURA 2RS53 4PDWB 2YU2A 3O1UA 2E26A 3AXEA 1ENXA 4YG6A 3E6DA 4Y5Z0 1VBE2 1WMDA 4XUTA 1RUG3 1DZRA 1X8EA 1YXWA 2R043 3RI9A 3I3MA 1VBD2 1HJFA 4MGKE 4QXBA 1H30A 5LA0A 1XBFA 3RWKX 3H7JA 4BHPA 2HWF1 3MIFA 4N8MA 3U75A 3POBA 1TME2 1WUVA 3FMGA 3R4UA 4Q5OA 2QQLA 4HPKB 4HVQA 5AVPA 1PGW1 3ORJA 1G9CA 3RZMA 4KH9A 5FXZA 1C5HA 3WQ7A 1YQCA 1NOVA 2EXJA 4AVBA 1YRZA 3KQ4B 4YVSB 4E4SA 4AI1A 1ZVFA 5JZGA 2JKXA 5JMCA 2PTMA 3E6BA 4XZUG 1H9WA 4MGSA 2DU0A 2W2IA 2XR4A 1NAEA 4AVCA 1KXGA 4QHBA 1TVGA 1VMFA 3WXPA 4FQ4A 4LITA 1RUE2 1N3OA 5JOYA 3UKTA 4K7JA 4LIVA 5C3RA 2ZEYA 3N9QA 2VNGA 3GF6A 1CAUA 5LCWL 5DMYA 3T30A 5FK8A 2WN3A 1GR3A 1VRH3 2JXAA 5KC5A 1JZ5A 1GZWA 1R64A 3M3OA 4I3PA 3UETA 4BMEA 2ETEA 5CKNA 4D7SA 3KVBA 3OJBA 2FDJA 3MICA 1JYTA 1NLQA 1SFNA 2PQSA 1LHOA 1AYM1 3AKRA 4AHZA 4DMIA 4M3CB 1W39A 2Z69A 1NQJA 5A7NA 4Y20A 1UZZA 2DURA 4Q0PA 4XFHA 2W39A 2E7QA 2QQPA 2ZGNA 1DLCA 5F3IA 5T3NA 4BQ4A 1Z7S3 1TQ5A 4DXTA 2AEZA 2C1FA 3WZ1A 2B39A 1ZA7A 4YW5A 4DQAA 5I8TA 1H4GA 1WW5A 4P9YA 1QJY2 2ZMKA 2ENRA 1S0IA 2V5YA 1C28A 1AR82 2D43A 3DN7A 2RG4A 4BQ1A 4LKDA 4GB33 5A7QA 4LMFA 3HNMA 4HKWA 3RMYA 2QQVA 1W6OB 2ZACA 3TEZA 1L7LA 3U0ZA 4TZDA 1QJZA 2B9UA 1R1A1 2ES3A 3AKSA 2XKPA 1UY0A 3T0AA 3PU8A 2CY6A 2OQ7A 1OF4A 1J59A 4FTSA 5IVYA 5FPBA 3AP4A 2TUNA 2BOIA 1E5SA 1LHWA 3HT1A 4JZRA 4MO3M 4XFIA 3DECA 3PDQA 2IXIA 5K0UA 5SV5A 3V64A 5CBLA 3LD8A 4PQ9A 1F9KA 3FZ3A 2CGPA 1V6KA 4Q4W3 5IVJA 2YC4A 1IGOA 2BZDA 3IAPA 4E27A 3L2HA 2HWF3 3OSDA 2YZ4A 2X5IA 2VOWA 5FLJA 4JGZA 2LTNA 3ZYPA 1J84A 3HNBM 4XCAA 4LOSA 2OUHA 2PN5A 3A21A 4KU7A 4QB6A 4JDOA 2CTVA 2UY8A 2VZ3A 1WCUA 1CONA 3FL7A 3VBOB 3WHTA 3TBDA 3FLTA 3KHBA 4C91A 2ZA9A 3FJSA 4CDWC 5IFTA 1X9TA 3WNMA 4OUEA 5FUNA 3H1MA 3NO8A 3N3HA 4Z2WA 2ZJCA 4M0HA 4LBKA 5FYCA 5IHRA 4COYA 3BGAA 2JG8C 3J7MA 5AC93 4U36A 2I07B 5HCBA 1OA2A 1QJU3 3I3DA 1R1ZA 2FQPA 5CKQA 4KU8A 3AP5A 5FPVA 5K7PA 3SQOA 3R0RA 4MX3A 2XDVA 3RI8A 1XNAA 3UGHA 4LA3A 3T2PA 4B3NA 2HWE1 1ULOA 2VOVA 3N7JA 3OG2A 2XHNA 5TSWA 1M06G 2A6YA 1LHUA 3ACGA 3HOBA 2VVEA 3NV1A 3K46A 4LJHA 4Q0VA 2JE8A 1KJRA 3I54A 5CADA 1FOD2 1QHDA 2FDHA 2OXBA 4E2QA 1PO11 4AI2A 4PLMA 4HKLA 3DKQA 2Y8KA 2W95A 2XUEA 4P00B 1W3XA 1GNYA 1PGW2 1Z7S1 5FCCA 3WCRA 5A6ZA 3SITA 2MHFA 4AVTA 1BMV1 1AX2A 3URFA 4FPYA 2VUDA 2OKXA 4QDQA 2VCCA 2LUWA 5A3LA 1VAKA 2QNKA 2HWD1 4Y1XA 4BXSV 4BLJA 4NHLA 3I59A 1IZ3A 3NJVA 5JMOA 3NV3A 4KWJA 4S2HA 1REEA 2YFZA 1HRI3 2ZMNA 2MEV2 2VNRA 2D3RA 1S0JA 4PIXA 1MQTA 1O7FA 3E5QA 3CZJA 5DUXA 2WWUA 1H8TC 2J1TA 3TN92 1UYYA 2HYKA 1KFUL 1W90A 1V6JA 3QH6A 2DVAA 4UFMA 2JDKA 1O4YA 2ZX4A 4Q4V3 4BPZA 5KHJA 4AL9A 3MBWA 1LEMA 3USUA 3SISA 4AI0A 5FDBA 3OUIA 2ATFA 3HQXA 5APAA 1QF3A 1H6YA 1BBT3 1WCKA 2Y64A 1REFA 1O6UA 3EYPA 4AF9A 3LAGA 3ZSLA 3AYDA 1G9BA 3CL1A 3NVCA 2HWF2 4N90A 2B5HA 5HI0A 5JR2A 2HBUA 4YYOA 2JDPA 4R4ZA 4DRRA 4GWNA 3T0DA 2C24A 4M4PA 1XPWA 1UY2A 1UKGA 1ULFA 3AZYA 4IV1B 4LE4A 2YGMA 4YW3A 3ZSJA 4K3UA 1X50A 1FV2A 4A3XA 3WINE 1W6MB 4NPMA 5FZCA 2FDFA 5CA6A 3HQRA 2W94A 4PF5A 1EUTA 5FMBA 2D7FA 2ORZA 4M3CA 2XPJA 2RS33 1IQDC 4H2AA 2LW8A 2WT0A 5G04L 3NNJA 5A7OA 2WQ4A 4YW1A 5LEKA 1NUKA 2ORXA 3ENRA 3LSDA 1SBDA 1RMU1 3CF6E 5A7WA 4LBQB 3AMMA 3N9MA 1CX1A 1O5UA 3VBRB 5J36A 4PDWC 1EUUA 1MZFA 1ZBE1 2XVLA 1POV0 4L99A 3BPSA 3FUQA 3VD3A 4ZS3A 1R081 4RS5C 4UWDA 4Y22A 5I8SA 3VL8A 3O1VA 2JX9A 2WO2A 3I2JA 5D21A 4YZ4A 5JXJA 4YVSA 5LRSA 2GALA 1W9YA 1GYKA 2PXJA 3N9OA 1PVC1 3MHZA 2EXIA 1HDKA 1VBB2 3ECQA 3VDDC 4FSJA 3ST7A 4JQTA 5D2AA 4E8CA 1VBA3 3ZM8A 4LIUA 5DAQA 4HN1A 1W2TA 1SLLA 3KQRA 3BTZA 4N43C 4QD2A 4CCEA 2Z2SB 1MZEA 2XHKA 4HT1T 1YQ2A 2Y6GA 2R041 4NWWA 4O65A 2JG9C 2C0ZA 4X6QB 1W04A 5JWPA 1HB3A 1WKYA 2XL9A 3POEA 5E16A 5FP8A 4AVSA 2OT7A 2ZS6B 3ZN6A 2V73A 4UFIA 3BCWA 5FZIA 5J7MA 3WG4A 2RVAA 1JYNA 1BBT1 1ODMA 1OH3A 4TSVA 2E51A 3WW4A 3WW3A 2R073 3A23A 5C6CA 4L92A 1GOHA 2GNMA 2A70A 3MFCA 4OULA 4GJZA 4AOCA 1PNGA 4PCRA 1GWKA 1GQPA 4LO8A 1D0HA 2D6NA 4WM7B 3ZYJB 4XUQA 2J1AA 4UT5A 1VBC1 1RJ7A 2R061 1F31A 2GSYA 2RJLA 4XILA 2CWMA 2D40A 4L9BA 3ZYBA 4LO4B 4CEWC 2BNNA 3WP5A 1V6IA 2H6BA 1NCRC 4IQPA 3PURA 3RYKA 2P3YA 5FY5A 5K0UB 1AYN2 3BIWE 3ZFEA 4RGGA 1ULGA 1LJ7A 3IMMA 2RS32 4ONUA 5A1LA 1NKGA 2XJQA 4QM8A 3KMHA 2DVDA 5IW0A 4AAXA 4YZ3A 1DU3D 2WT2A 4XFAA 5LRRA 2XWJB 4GD4A 4WM8C 4E8DA 2D6OX 3THDA 4XAEA 5F39A 1RUOA 2FCUA 4Q0SA 4XEZA 3C8XA 2HBTA 5T52A 4Q4V2 4XXAA 1OPOA 2RS11 3IWZA 4OHXA 4MGYE 4IDZA 4CDUA 2VOXA 5J3UA 1ZM1A 3Q8CA 1SDDB 2GC2A 2ZZJA 3ZFGB 3PMEA 2MEV3 2FD8A 2ARAA 4K21A 5FZ3A 1I3HA 2WNEA 4TLGA 1ND2C 4FT8A 4CXWA 3T1LA 4KQ7A 4AI9A 5GLUA 3BTAA 3RNSA 2D98A 4UW4A 4FOVA 4IEUA 1E57A 1W6MA 3P6BA 2J1EA 2NQYA 1WMEA 1YFXA 2C26A 2VGDA 3H8RA 5C4WB 3DYOA 4B4RA 1OA4A 4HVOA 1PO12 2E7TA 1GWLA 2BERA 4WBBA 1OOPB 4IW3A 1EPWA 1VALA 4QQLA 1TZOA 3U07A 4DEQA 3O12A 4V1PA 4B8EA 3TB0A 2WZR1 4Q4V1 5DZGA 5EQUA 2VR4A 5FZAA 1HB1A 1XB9A 4MH0E 3UGGA 3ZN5A 1UOJA 4N53A 1X9PA 4FOYA 5GZCA 5FZ4A 4QX1A 2Q0AA 4QGMA 4XF3A 2YBSA 1PHMA 1PO22 2WRAA 3ILNA 3OTFA 4XE9A 4YW2A 3VBHC 2R16A 3QCWA 4NHXA 1OOPC 1OBNA 2VZUA 3TEXA 1AJOA 4EWAA 1FMD1 3IBMA 4H55A 2W47A 3HEIA 4E2GA 2WNVC 4JGZC 4BQ5A 4XOGA 5ERLA 4ARYA 1W0OA 2W5FA 3WEZA 2CDPA 3OYWB 4A44A 3MEPA 4H3WA 3GYDA 1FV3A 1RUC1 1UF2C 4UW6A 2ZGPA 3C3VA 2WBKA 3VBHA 2XKOA 1PX3A 3ILFA 5JVVA 1AF9A 3NAPA 4CP1A 1K5MA 1PK6C 4JRLA 4CP0A 1DCSA 3LOBA 2XQRA 1PIV3 2CGNA 3POGA 2ZBJA 1R092 1RUI2 2MPFA 2VZ1A 3KF3A 1JYIA 4GMP0 2DCYA 2WAOA 3LPGA 2A6XA 1LOEA 2WSVA 4JHZA 4XF9A 3K4DA 1XOYA 3ES4A 2W1QA 1OUXA 3LIHA 2XMLA 1UN1A 3CKHA 3LDRA 1K5MC 1PZ7A 1HV0A 1DQ5A 4PBOA 2XJRA 5DAXA 4RSUA 5LEJA 3I2OA 1H2KA 1VIWB 1VAVA 2UWCA 2GNBA 4NRPA 4FOQA 4EYUA 2E32A 1HXS2 2JEMA 2DUQA 4BM8A 4GB32 2VNVA 3CEWA 3MF6A 4LPLA 2VZVA 2AC1A 1FPN3 1QJY1 1RMU3 1CWPA 1RUF1 4YVWC 4OYUA 2XBO2 1JZ8A 1YLLA 4BA6A 4J6GA 1CAXA 5HCHA 1HW5A 1W8UA 1ZZCA 1A6CA 4G4FA 2QQMA 1OKOA 2ZX1A 4HANA 2CSGA 4YM0A 2ZGSA 1QEXA 3B69A 2G4IA 1V6LA 4CDXA 4W4ZA 2W92A 3MPPG 4NROA 5CAZA 1R082 5A32A 2C5DA 1VAMA 3QBQA 5A6YA 1AYM2 1J3RA 3Q8BA 5KXDA 1GMMA 1KRIA 3MIEA 5A1FA 3AYEA 3H3LA 1MQTC 1TMF1 2NZ9A 2NLRA 1H8TA 2WNVB 3LDKA 4UF0A 3VDAA 4AEJA 2E31A 3LZZA 5EXOA 4XHXA 4CDXC 4IEYA 4KWUA 3HD8B 3I2FA 4ZXEA 5CKMA 5FPUA 1MVQA 4LO5B 1PMJX 2RMU2 4JC1A 4AHWA 1W8WA 2JDUA 1JYXA 1Y9MA 2OW4A 3KCYA 1XYOA 3B00A 1GP5A 1HX6A 4W6YA 4Q1RA 1TME3 1UX6A 2ZHMA 2XB6C 5IVFA 4I01A 3RZLA 5L9RA 5BNNA 4Q4W1 1WLTA 5CFCA 1OFSA 1ZA4A 1UX7A 4QWNA 3VUOA 3USSA 5IWFA 3ZFEB 2IXLA 5JZGC 2VZRA 3GZEA 3M2MA 1VRH2 4QB1A 2JG8B 1JZ4A 2XXZA 1UY3A 1ZRFA 4MXWB 2TBVA 3VDDB 1M4WA 1BJQA 3SH4A 1PNFA 2HWB3 3OEAA 4XC9A 4XJAA 2QJVA 2VJXA 3T0BA 1MS0A 2XGXA 1ASJ2 3J8F3 3LGRA 2I45A 3TRSB 1W9TA 2ZGUA 5DUWA 3N9LA 3H1WA 3O0WA 1US2A 3MLJA 3AP7A 3OGSA 3ZXKA 4W6XA 2J1SA 2DCJA 5FMOL 1VBE1 2O8QA 3IDCB 5CU1A 2D3SA 1OPMA 3DEMA 3JXSA 3ZR5A 4HK9A 4JGYC 2F17A 2WO7A 4IEVA 2XLAA 3HN1A 3VD7A 5JSPA 1DYOA 4OHWA 4RQPA 4Z1VA 4UFKA 4O9GA 5FYYA 4UBGA 2EVXA 3FBMA 4ZZ5A 4O61A 1XNCA 5B2GB 3BB6A 5L36A 1Y4WA 1W2NA 4FPGA 4MOAA 5T5LA 1TNFA 1YEWA 1ND3A 1CESA 1QIQA 2D6LX 5DUUA 3TNQA 1BMV2 1GLHA 1QOOA 2VBDA 4RQPC 4A7YA 5DXDA 5I93A 2GMPA 3SHRA 1IS4A 1A34A 2RS52 1NCRB 3MIBA 3ZO0B 1FOD1 3FUOA 4CPBD 2FDIA 3HPNA 2R30A 2PHUA 4IUGA 4NE9A 3R05A 2JG9A 1DP0A 1S2KA 2VOTA 1MR5A 1WBFA 3H0OA 3IAQA 1V9U1 3LA7A 3MLLA 4TWTA 5F5CA 1FATA 4DUVA 1YJLA 4LBQA 3RVHA 5EZWA 3JBG2 1NYWA 1WWYA 3VBRA 1G6NA 3OD4A 4GWIA 3UKVA 4GB31 2KXLA 2D6PA 3ZKUA 5DAWA 1ZZ8A 3BI3A 3N36A 3ON7A 4Y3OA 1JUIA 1D0GA 3WNLA 4WVMB 4QX2A 3WF1A 1ZYBA 2DTYA 2YC0A 4RQPB 2NYYA 4WM7A 4MVTA 5JDBA 2KD7A 2ZHNA 3A0KA 1V9U3 4XPVA 2GP5A 3MUY1 4GH4C 5H9RA 1CAWB 3RMXA 4MADA 2X8KA 3AP9A 3B01A 2X5IC 3WDWA 4BCUA 1GP4A 2YBKA 2K0GA 5CFCB 2W08A 3NW4A 4QQPA 1NY72 5A3TA 4JTNA 1KQRA 3KS7A 5T5JA 4HZFA 1FI2A 2A75A 3ZFEC 2YU1A 1W2OA 2YPDA 3GBGA 1O8SA 3I2IA 4XHBA 1IS5A 4HL0A 1RHI2 4F7ZA 2WR9A 1SLCA 3B3QE 4RR3A 2LROA 5FZGA 1UZ0A 2OVUA 3MFAA 1WBLA 4QKBA 1WZXA 2WWJA 1UY1A 1CZTA 3N9PA 4Q4X2 3ZOIA 1ZBA1 3M4FA 4OMCA 5FJHA 4XURA 1POV3 2A3YA 2W1UA 2DYCA 1S4CA 3U14A 4EN0A 5F32A 4NIDA 1RIRA 4ZY9A 3HJRA 3MV11 5FYMA 1IG3A 3J7NA 3O0VA 3CZUA 3POJA 4MYEA 3GALA 2ADDA 5AFBA 2JB4A 3NSTA 3OD0A 3OGJA 1OSGA 1OHFA 2ZGRA 5ABJB 1JODA 3VBUA 3ZYHA 1H1IA 5GLVA 3CNAA 3C2UA 1VJ2A 2EAKA 3APBA 3LEKA 5L19A 1W8OA 2BDRA 1EV12 1JMUB 2WZR2 3AVRA 2IXHA 3RZHA 1ND3B 1Q56A 1HN0A 3B9IA 1SMVA 3WDYA 3GM8A 3IMNA 1OXCA 1R083 2ZGLA 4IEQA 4M00A 4Z82A 5FZ7A 4URAA 5HCAA 2GZWA 4HSLA 3O1RA 1AVBA 2EA7A 2N7GA 4CPBA 1W6NA 1CPMA 2QUOA 5I0SA 1UZVA 2R6QA 1Y3TA 2IXKA 2QQNA 2B8MA 3FWEA 5FZKA 3O14A 1BXHA 2CAUA 4AG4A 4DFSA 1OVSA 1PM4A 5I0TA 2F4PA 4OI1A 3AMHA 4Q8LA 4QU2A 3RDIA 3GCWA 3WY6A 5AFEA 1RHI3 2HEWF 4P9LA 2HWC1 5BNPA 3T2TA 5IK5A 5CIRA 2VZTA 1W03A 4HVRA 5I8YA 4RGAA 2WO1A 5FJKA 1ULCA 1HKDA 3CU7A 4RHV3 4XMAA 4CU9A 1XXNA 1N3QA 3ETPA 3OPZA 3NJXA 4R9BA 2JENA 2PHFA 2BV4A 1ALYA 2HWB1 3MIHA 1AL21 4M01A 5A3UA 3JQXA 2VL4A 3MDPA 1OOPA 3KM5A 4JKKA 1HN1A 2F6BA 3CIHA 5FUIA 2W91A 3F95A 4F8AA 1DQ1A 3KD4A 2JDHA 3K4ZA 3ATGA 2C6SA 3IDAA 4IETA 3HBKA 1MZ6A 2P37A 5FZFA 3FE5A 2BNMA 5IVVA 2QKDA 4XFBA 4NHMA 3ZXJA 3RZGA 3ZXEA 1RUC3 3ZSEA 3C7GA 4CSWA 5EYYA 3VHOA 2SBAA 5BNOC 4V2VA 5IK7A 1QWRA 2X09A 3T09A 1NCQA 2GC3A 3AMQA 1UAIA 1DGRA 1XYPA 3UESA 1Q5OA 5DDJ2 1W6OA 3B5LB 1SFPA 1JYWA 3D82A 3NNMA 3WW2A 2W46A 1W8HA 1UNBA 1WA6X 4A7ZA 4CDUB 3N7KA 2YDEA 2UWBA 4YFZA 4XJ9A 1OMIA 4ASLA 5HPOA 4A6OA 5JAXA 1PIV2 2D3PA 3I59B 2E63A 4NRMA 3VBHB 3WQ0A 2DVFA 4C1XA 1HRI1 3VD5A 1AXZA 2GMEA 1J58A 1EV11 3MI8A 5SV8A 2WZ8A 1A3KA 1RUD2 2AR6A 5F3CA 2ZHKA 1O8PA 3JD73 2W1WA 3TNPB 5FZHA 2FCVA 5FPLA 3WG1A 1XC6A 2DVGA 3S5AA 1DYPA 3WF3A 3DPRA 2QE3A 3C7HA 3VBSA 3GZAA 4Z8BA 4ISQA 5JXIA 4UFJA 4Y1VA 3I8TA 2IUWA 2X10A 3I2HA 3JUUA 3LKJA 1XNKA 5EFUA 5GZGA 1EP0A 3LF7A 1YC61 5C4WC 2R0FA 1SBFA 3AX4A 1YIFA 4IV3B 4X6RB 5FZ9A 3PLQA 3VDDA 4EWEA 2RHPA 1SFYA 5EHDA 3ZFGA 4G9SB 2DCZA 1UOFA 2NMNA 3VL9A 2PQQA 2VMIA 2VCBA 4IERA 2QQUA 1I9RA 1JW6A 5F1RA 3MW2A 2C9AA 3AZWA 4IGPA 4B7EA 2A7AA 1D4M2 3NL1A 4FTEA 1PVC2 4DIQA 4AGRA 5JIAA 3OGGA 5BNNB 1CZSA 2DVBA 1KD7A 4DXSA 1DQ0A 4KBZA 3WD5A 3OBTA 5T5OA 1JZ2A 3WNPA 2R072 1ZBE2 2PHLA 3BTYA 1ST8A 1BEV2 2W9XA 1ZRIA 4XJZA 2GH2A 3FHQA 5FYIA 4MXWA 3AFGA 4YW7A 5C3OA 4GIQA 2J7MA 5I0RA 1Y9GA 4FFFA 5CISA 3KF5A 5LK5A 4B7KA 1AL0G 1LHVA 1DBNA 1ZZ9A 4GAZA 3I49A 1Q8SA 3RRDA 1MS5A 3EXUA 5FY8A 1QNWA 1GUIA 3K3OA 4X8NA 4ZPIA 5CFCC 5GZDA 2ZMLA 4CCOA 3VZKA 1ZRRA 1NCRA 5ANQA 1V9U2 3LQCA 2Y0OA 5KBFA 5LW9A 2Q8DA 2R1DA 1W8NA 3NKTA 1ODNA 5A7SA 1W6QA 2VH9A 1LODA 4OI2A 1FPN2 5FZBA 2UY9A 5HXVA 3JU9A 3RPQA 2P3JA 2W1SA 1LNSA 2DWRA 4BIFA 5T54A 1G9FA 5DPNA 3H8XA 4WM8A 2MNGA 5L73A 3WR0A 2WIIB 4URTA 3J7LA 1LOBA 1WCSA 3RGBA 2NP0A 3K2OA 4NJ4A 3JCIA 5IAVA 4AQ6A 5FO8B 1UXXX 3VKMA 1UY4A 2WWSA 4FXKB 3WNOA 2FDGA 5A80A 1RUF3 1J1TA 5CVRA 2WL1A 3U1XA 3WX5A 2E9QA 5FWEA 1G9DA 3I2GA 3AL5A 2FZ1A 5F2WA 2VUAA 3MUZ1 1OFNA 3RQ0A 4COUA 5AC91 2K2SA 2BQPA 2YV8A 5CFDB 1QH6A 2DDUA 2RJ2A 5BNPB 4CEYA 5EIYB 3LOIA 3O1SA 4FP3A 3HIFA 1G86A 4N43B 1ND3C 3LA3A 5FY0A 3OY8A 3FLPA 2MEV1 4HXCA 1RUH3 4W65A 3UJQA 4AEKA 2XUMA 4K8FA 4I3GA 4JGZB 5LZ6A 4NN0A 1YYNA 4ZZ8A 1RJ8A 1H2NA 3D0JA 1PGL2 1GBGA 2XWBB 1QJEA 2XVGA 1N1SA 4A3ZA 3IPVA 4EN9B 1S0BA 1UPIA 2K9ZA 2XJPA 1MEC1 4L8QA 4XFCA 5FMOS 2J42A 3WDXA 4AEMA 4Z2AA 3I7DA 1GQGA 2QFEA 5DABA 5LY1A 2XLGA 4DOUA 4LUMA 4FPEA 1LHNA 1QDCA 4QPGA 3USUB 4IV3C 5DZEA 1GNHA 5FZOA 3PUIA 4W8JA 4N53C 1QJX3 3VBRC 5ACA2 1RVF3 2VXJA 5GLWA 5F3GA 3AMNA 4PLNA 4XUNA 1OLME 1SCRA 3ZXDA 1V00A 5L7OB 2G9GA 1RXGA 1W8FA 2DF7A 1YI7A 1F8VA 4NR1A 5A7PA 5FO9B 5AVAA 4SLIA 4R8HA 1OUSA 2RR13 2RMU1 1UMIA 2IVIB 3I97A 4XUPA 4G3YC 2BWCA 4B1MA 4DINB 2L9LA 1DF0A 2C9KA 2RE9A 2YUEA 4EZHA 3H8OA 5I0UA 2ZGMA 3I2KA 4LBQD 1Q8QA 2BVBA 1S2BA 3HR9A 2V5DA 1DQ4A 4R4XA 4XVHA 4YPJA 4FXGB 5K8SA 3VBFA 3CO2A 2XJVA 2JDZA 2RMU3 2R071 3ZYGA 4P9WA 4XF4A 4BK4A 4DB5A 3E97A 4XBNA 3ZN6B 3EQEA 5A1AA 1S1AA 3B9CA 2LALA 4CDWA 2XJUA 1SZBA 4JKLA 2VW2A 3SC7X 2UYBA 4LKSA 3D6EA 2XVKA 1I5PA 1LESA 2JDAA 2ARXA 3ZIXA 1UL9A 1S55A 3CLPA 4KL1A 5EJ3A 2C4XA 2X5IB 5BUVA 1G7YA 5C70A 2BYVE 2I74A 4CU8A 3POIA 3VBUC 4YGEA 4BWOA 1SDWA
chains in the Genus database with same CATH topology
3CKHA 3OGVA 1JZ6A 3IB3A 3UNPA 1GU3A 2RV9A 4A45A 1K45A 2E32A 2VMDA 3HN3A 4LPLA 3A7QA 2VZVA 2J1UA 4LHSA 1JZ8A 4OYUA 4CU6A 2Z4FA 1H6XA 1JHJA 1CZVA 4A4AA 5LA2A 2QQMA 4LQRA 1UMHA 2XOMA 4W4ZA 2W92A 2QBXA 4QPWA 5J1XA 2VO5A 1TG7A 2WAAA 1MPXA 1GMMA 3CQOA 3GDBA 3SEPA 1BHGA 2VMFA 3NNGA 2YG0A 2DCKA 3VDAA 2E31A 3LE0A 4KWUA 3I2FA 4ZXEA 4FI9A 1PMJX 3WQBA 1US3A 1JYVA 3VDBA 1D7PM 4PF1A 1JYXA 5DN2A 2E26A 1UYZA 5JXGA 2BBAA 1F4HA 4BJ0A 4XUTA 5LA0A 3MV01 1W9SA 2VZQA 2QQIA 1UX7A 5B4NA 1GOFA 2VZRA 3THCA 4QB1A 3FN9A 2QQLA 5IJRA 1JZ4A 1UY3A 1OH4A 4ARXA 4BK5A 2V72A 3OEAA 5CYYA 2VJXA 3T0BA 2WN2A 1W9TA 2VQTA 3OGSA 1US2A 2JKXA 2ZEZA 3HNYM 2J1SA 2DCJA 4XZUG 4MGSA 1NAEA 3K75B 2LS6A 1JI6A 1TVGA 4D0QA 3JXSA 2WABA 3VD7A 1DYOA 2ZEYA 5LCWL 5DMYA 1KEXA 2WN3A 1GOGA 4ET7A 1JZ5A 1R64A 4DEVA 4ZZ5A 3UETA 4MOAA 2PQSA 4UOJA 4JKMA 1UYXA 3WF4A 4CVUA 4MGQA 3HPNA 1UXZA 2WYSA 1DLCA 4IUGA 2VTFA 1DP0A 2VOTA 4DXTA 3IAQA 4DUVA 2VC9A 4QX3A 2WQ8A 4GWIA 1SG3A 2Y6LA 5G05L 4DXRA 1L7QA 3WNLA 2BGPA 2VCAA 3HNMA 3I3EA 4QX2A 3WF1A 2KD7A 3C7OA 3T0AA 3DYPA 1UY0A 4TXWA 3MUY1 1OF4A 3E1F1 4MADA 4CUCA 4MO3M 4HG6B 3D3AA 3DECA 1F4AA 1ULPA 1W9WA 2YC4A 2BZDA 3IAPA 5I0DA 3I2IA 1O8SA 2Y6JA 1J84A 3HNBM 4DUXA 1JU4A 4QB6A 3A21A 1UZ0A 3NRUA 2VZ3A 3FL7A 1UY1A 1CZTA 3T2OA 3ABZA 3I3BA 4JX0A 4OMCA 5IFTA 4XURA 3WNMA 4OUEA 2W1UA 1T2XA 2R7EB 4ZY9A 4RYDA 2EIDA 5IHRA 2Y6KA 3HJRA 3MV11 2EIBA 3BGAA 3OB8A 4KMQA 3CZUA 3I3DA 4QDRA 2WO3A 1K12A 2BGOA 3WNNA 5JUVA 1XNAA 4OZOA 3T2PA 3LEKA 1ULOA 1W8OA 3OG2A 2VMEA 2XHNA 3SKJE 3ACGA 3HOBA 2HLEA 3GM8A 3K46A 2JE8A 4UAPA 2VZOA 5C71A 4UI9L 5HXMA 4P02B 2QQKA 2Y8KA 2QQNA 3ACHA 2W95A 4P00B 1GNYA 2WUHA 4AG4A 2W3JA 3FHAA 3W5NA 2V4VA 2OKXA 2W87A 4QDQA 3T2QA 2VCCA 4DUWA 2VZTA 4BXSV 2WO1A 3EB7A 3NJVA 5JMOA 4CU9A 3ETPA 1P8JA 2YFZA 3NJXA 3WF0A 2XONA 2EIEA 3AC0A 3CZJA 5EJZB 2VL4A 2J1TA 4JKKA 1HN1A 1UYYA 3CIHA 5FUIA 4CUBA 4CU7A 2W91A 3K4ZA 3IDAA 3SKVA 3MBWA 1SHWB 3WF2A 1JZ3A 3LEIA 2VQUA 3J7HA 4QAWA 3C7GA 1H6YA 3C7EA 2Y64A 2X09A 3EYPA 3DYMA 3T09A 4PQQA 3UESA 4PT6A 4BDVB 5JR2A 5B4XA 1JYWA 3VDCA 3K77A 2W46A 3T0DA 4M4PA 1XPWA 1UY2A 1PMHX 3U37A 5HPOA 1L7RA 4A6OA 4W50A 3VD5A 5LA1A 1JZ7A 2WZ8A 2W94A 4TTGA 1EUTA 2ORZA 4QX0A 1O8PA 2W1WA 1IQDC 2LW8A 3OEBA 1XC6A 2J1VA 5G04L 3WF3A 3C7HA 5JXIA 1W0NA 2VMCA 2QQOA 2X10A 4L0PA 1NUKA 3I2HA 2ORXA 4A41A 5JXHA 3K4AA 1K3IA 1CX1A 1K42A 1EUUA 1KGYA 3VD3A 1RYYA 1O59A 2Y6HA 2WO2A 3I2JA 5JXJA 2VCBA 4M4RA 3OGRA 3P1IA 3LPFA 2VZSA 2VZPA 4P5YA 3ECQA 4E8CA 3ZM8A 1CZSA 4DXSA 1OT5A 1JZ2A 1NX9A 3GGLA 3WNPA 2W9XA 1YQ2A 2Y6GA 3FHQA 3VD4A 2J7MA 1WKYA 2HYXA 2B4KA 3IIIA 4KI5M 2J1RA 1XNTA 1OF3A 3W5MA 1GUIA 2RVAA 4P08A 1JYNA 4A42A 2YB7A 2ZEXA 3A23A 1GOHA 3LQCA 1WCQA 1W8NA 1GQPA 4XUQA 2J1AA 4QDSA 2W1SA 1LNSA 5DPNA 4CUAA 2J22A 2WDBA 3SEEA 1UXXX 1NKGA 3A22A 1UY4A 3ACFA 4AAXA 3WNOA 2YC2A 4D8MA 2QQJA 3I2GA 4E8DA 4RN5A 3MUZ1 3THDA 4GWJA 3C8XA 3PUHA 2DDUA 3WNKA 2RJ2A 5EIYB 2YFUA 4QB2A 2ID4A 2JD9A 2E33A 1CIYA 1SDDB 2ZEWA 4ZZ8A 4A3ZA 2EICA 4Z2AA 3GXUA 3CMGA 1OD3A 3CDZB 3P6BA 1J83A 2J1EA 2B9VA 2C26A 3PUIA 4W8JA 3DYOA 3VD9A 2BERA 2CDOA 4XUNA 1W99A 4DEQA 5F7UA 3LEGA 2ZXQA 5IFPA 2VR4A 1PX4A 3F2ZA 1UMIA 3ACIA 1UWWA 3I97A 4XUPA 4QX1A 4GZ9A 2L9LA 2C9KA 5IYYA 3I2KA 5DQ0A 4XUOA 5C7GA 2V5DA 2VZUA 2XQXA 4OMDA 4XVHA 4YPJA 3WSOA 2W47A 3HEIA 3C7FA 4ARYA 5EJ1B 2W5FA 3WEZA 2CDPA 3NQHA 5CZKA 2VM9A 2X05A 4A44A 4BK4A 1JU3A 2WBKA 3OBAA 5A1AA 3MO4A 3BN6A 1PX3A 4JKLA 3T08A 4LKSA 1I5PA 2JDAA 2VZ1A 2C4XA 5C70A 2WAOA 3LPGA 4JHZA 2WZEA 4CU8A 3K4DA 2W1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CKH A;  3OGV A;  1JZ6 A;  3IB3 A;  3UNP A;  1GU3 A;  2RV9 A;  4A45 A;  1K45 A;  2E32 A;  2VMD A;  3HN3 A;  4LPL A;  3A7Q A;  2VZV A;  2J1U A;  4LHS A;  1JZ8 A;  4OYU A;  4CU6 A;  2Z4F A;  1H6X A;  1JHJ A;  1CZV A;  4A4A A;  5LA2 A;  2QQM A;  4LQR A;  1UMH A;  2XOM A;  4W4Z A;  2W92 A;  2QBX A;  4QPW A;  5J1X A;  2VO5 A;  1TG7 A;  2WAA A;  1MPX A;  1GMM A;  3CQO A;  3GDB A;  3SEP A;  1BHG A;  2VMF A;  3NNG A;  2YG0 A;  2DCK A;  3VDA A;  2E31 A;  3LE0 A;  4KWU A;  3I2F A;  4ZXE A;  4FI9 A;  1PMJ X;  3WQB A;  1US3 A;  1JYV A;  3VDB A;  1D7P M;  4PF1 A;  1JYX A;  5DN2 A;  2E26 A;  1UYZ A;  5JXG A;  2BBA A;  1F4H A;  4BJ0 A;  4XUT A;  5LA0 A;  3MV0 1;  1W9S A;  2VZQ A;  2QQI A;  1UX7 A;  5B4N A;  1GOF A;  2VZR A;  3THC A;  4QB1 A;  3FN9 A;  2QQL A;  5IJR A;  1JZ4 A;  1UY3 A;  1OH4 A;  4ARX A;  4BK5 A;  2V72 A;  3OEA A;  5CYY A;  2VJX A;  3T0B A;  2WN2 A;  1W9T A;  2VQT A;  3OGS A;  1US2 A;  2JKX A;  2ZEZ A;  3HNY M;  2J1S A;  2DCJ A;  4XZU G;  4MGS A;  1NAE A;  3K75 B;  2LS6 A;  1JI6 A;  1TVG A;  4D0Q A;  3JXS A;  2WAB A;  3VD7 A;  1DYO A;  2ZEY A;  5LCW L;  5DMY A;  1KEX A;  2WN3 A;  1GOG A;  4ET7 A;  1JZ5 A;  1R64 A;  4DEV A;  4ZZ5 A;  3UET A;  4MOA A;  2PQS A;  4UOJ A;  4JKM A;  1UYX A;  3WF4 A;  4CVU A;  4MGQ A;  3HPN A;  1UXZ A;  2WYS A;  1DLC A;  4IUG A;  2VTF A;  1DP0 A;  2VOT A;  4DXT A;  3IAQ A;  4DUV A;  2VC9 A;  4QX3 A;  2WQ8 A;  4GWI A;  1SG3 A;  2Y6L A;  5G05 L;  4DXR A;  1L7Q A;  3WNL A;  2BGP A;  2VCA A;  3HNM A;  3I3E A;  4QX2 A;  3WF1 A;  2KD7 A;  3C7O A;  3T0A A;  3DYP A;  1UY0 A;  4TXW A;  3MUY 1;  1OF4 A;  3E1F 1;  4MAD A;  4CUC A;  4MO3 M;  4HG6 B;  3D3A A;  3DEC A;  1F4A A;  1ULP A;  1W9W A;  2YC4 A;  2BZD A;  3IAP A;  5I0D A;  3I2I A;  1O8S A;  2Y6J A;  1J84 A;  3HNB M;  4DUX A;  1JU4 A;  4QB6 A;  3A21 A;  1UZ0 A;  3NRU A;  2VZ3 A;  3FL7 A;  1UY1 A;  1CZT A;  3T2O A;  3ABZ A;  3I3B A;  4JX0 A;  4OMC A;  5IFT A;  4XUR A;  3WNM A;  4OUE A;  2W1U A;  1T2X A;  2R7E B;  4ZY9 A;  4RYD A;  2EID A;  5IHR A;  2Y6K A;  3HJR A;  3MV1 1;  2EIB A;  3BGA A;  3OB8 A;  4KMQ A;  3CZU A;  3I3D A;  4QDR A;  2WO3 A;  1K12 A;  2BGO A;  3WNN A;  5JUV A;  1XNA A;  4OZO A;  3T2P A;  3LEK A;  1ULO A;  1W8O A;  3OG2 A;  2VME A;  2XHN A;  3SKJ E;  3ACG A;  3HOB A;  2HLE A;  3GM8 A;  3K46 A;  2JE8 A;  4UAP A;  2VZO A;  5C71 A;  4UI9 L;  5HXM A;  4P02 B;  2QQK A;  2Y8K A;  2QQN A;  3ACH A;  2W95 A;  4P00 B;  1GNY A;  2WUH A;  4AG4 A;  2W3J A;  3FHA A;  3W5N A;  2V4V A;  2OKX A;  2W87 A;  4QDQ A;  3T2Q A;  2VCC A;  4DUW A;  2VZT A;  4BXS V;  2WO1 A;  3EB7 A;  3NJV A;  5JMO A;  4CU9 A;  3ETP A;  1P8J A;  2YFZ A;  3NJX A;  3WF0 A;  2XON A;  2EIE A;  3AC0 A;  3CZJ A;  5EJZ B;  2VL4 A;  2J1T A;  4JKK A;  1HN1 A;  1UYY A;  3CIH A;  5FUI A;  4CUB A;  4CU7 A;  2W91 A;  3K4Z A;  3IDA A;  3SKV A;  3MBW A;  1SHW B;  3WF2 A;  1JZ3 A;  3LEI A;  2VQU A;  3J7H A;  4QAW A;  3C7G A;  1H6Y A;  3C7E A;  2Y64 A;  2X09 A;  3EYP A;  3DYM A;  3T09 A;  4PQQ A;  3UES A;  4PT6 A;  4BDV B;  5JR2 A;  5B4X A;  1JYW A;  3VDC A;  3K77 A;  2W46 A;  3T0D A;  4M4P A;  1XPW A;  1UY2 A;  1PMH X;  3U37 A;  5HPO A;  1L7R A;  4A6O A;  4W50 A;  3VD5 A;  5LA1 A;  1JZ7 A;  2WZ8 A;  2W94 A;  4TTG A;  1EUT A;  2ORZ A;  4QX0 A;  1O8P A;  2W1W A;  1IQD C;  2LW8 A;  3OEB A;  1XC6 A;  2J1V A;  5G04 L;  3WF3 A;  3C7H A;  5JXI A;  1W0N A;  2VMC A;  2QQO A;  2X10 A;  4L0P A;  1NUK A;  3I2H A;  2ORX A;  4A41 A;  5JXH A;  3K4A A;  1K3I A;  1CX1 A;  1K42 A;  1EUU A;  1KGY A;  3VD3 A;  1RYY A;  1O59 A;  2Y6H A;  2WO2 A;  3I2J A;  5JXJ A;  2VCB A;  4M4R A;  3OGR A;  3P1I A;  3LPF A;  2VZS A;  2VZP A;  4P5Y A;  3ECQ A;  4E8C A;  3ZM8 A;  1CZS A;  4DXS A;  1OT5 A;  1JZ2 A;  1NX9 A;  3GGL A;  3WNP A;  2W9X A;  1YQ2 A;  2Y6G A;  3FHQ A;  3VD4 A;  2J7M A;  1WKY A;  2HYX A;  2B4K A;  3III A;  4KI5 M;  2J1R A;  1XNT A;  1OF3 A;  3W5M A;  1GUI A;  2RVA A;  4P08 A;  1JYN A;  4A42 A;  2YB7 A;  2ZEX A;  3A23 A;  1GOH A;  3LQC A;  1WCQ A;  1W8N A;  1GQP A;  4XUQ A;  2J1A A;  4QDS A;  2W1S A;  1LNS A;  5DPN A;  4CUA A;  2J22 A;  2WDB A;  3SEE A;  1UXX X;  1NKG A;  3A22 A;  1UY4 A;  3ACF A;  4AAX A;  3WNO A;  2YC2 A;  4D8M A;  2QQJ A;  3I2G A;  4E8D A;  4RN5 A;  3MUZ 1;  3THD A;  4GWJ A;  3C8X A;  3PUH A;  2DDU A;  3WNK A;  2RJ2 A;  5EIY B;  2YFU A;  4QB2 A;  2ID4 A;  2JD9 A;  2E33 A;  1CIY A;  1SDD B;  2ZEW A;  4ZZ8 A;  4A3Z A;  2EIC A;  4Z2A A;  3GXU A;  3CMG A;  1OD3 A;  3CDZ B;  3P6B A;  1J83 A;  2J1E A;  2B9V A;  2C26 A;  3PUI A;  4W8J A;  3DYO A;  3VD9 A;  2BER A;  2CDO A;  4XUN A;  1W99 A;  4DEQ A;  5F7U A;  3LEG A;  2ZXQ A;  5IFP A;  2VR4 A;  1PX4 A;  3F2Z A;  1UMI A;  3ACI A;  1UWW A;  3I97 A;  4XUP A;  4QX1 A;  4GZ9 A;  2L9L A;  2C9K A;  5IYY A;  3I2K A;  5DQ0 A;  4XUO A;  5C7G A;  2V5D A;  2VZU A;  2XQX A;  4OMD A;  4XVH A;  4YPJ A;  3WSO A;  2W47 A;  3HEI A;  3C7F A;  4ARY A;  5EJ1 B;  2W5F A;  3WEZ A;  2CDP A;  3NQH A;  5CZK A;  2VM9 A;  2X05 A;  4A44 A;  4BK4 A;  1JU3 A;  2WBK A;  3OBA A;  5A1A A;  3MO4 A;  3BN6 A;  1PX3 A;  4JKL A;  3T08 A;  4LKS A;  1I5P A;  2JDA A;  2VZ1 A;  2C4X A;  5C70 A;  2WAO A;  3LPG A;  4JHZ A;  2WZE A;  4CU8 A;  3K4D A;  2W1Q A; 
#chains in the Genus database with same CATH topology
 1COV 1;  1URX A;  1S0E A;  1R1A 2;  3NKG A;  1IOA A;  3VV1 A;  5C33 A;  2VOK A;  2XBO 3;  5C9A A;  3WUC A;  2XL7 A;  4Z92 B;  4ES8 A;  3VHN A;  1G8W A;  2AZ5 A;  4BU2 A;  5FUP A;  4D6S A;  4ZHN A;  2E7A A;  1JH5 A;  1AX0 A;  3M1H A;  1K45 A;  1APN A;  2VMD A;  1LKN A;  1D2Q A;  1CAU B;  3AB0 A;  2WZR 3;  3OPT A;  4XJW A;  5KHG A;  1SAC A;  4LHS A;  1VMJ A;  1LOC A;  3DL3 A;  1KFX L;  2D5H A;  2PAE A;  3KV6 A;  3N7L A;  4QXH A;  4BYY A;  4LT5 A;  4QX7 A;  1RUJ 1;  1CZV A;  3OYW A;  5C9A C;  4PJY A;  3RS6 A;  4A4A A;  5LA2 A;  4FFH A;  5F6L B;  4XBQ A;  1C3H A;  1W8T A;  3H42 B;  2GH8 A;  2XOM A;  3GBF A;  3PNA A;  3WT3 A;  3M3I A;  4OHZ A;  1YWK A;  2QBX A;  4QPW A;  5KHK A;  4UBH A;  3ES1 A;  3L9J T;  3CQO A;  1UOG A;  1JTZ X;  3ILR A;  1UU6 A;  1YHF A;  2EAL A;  2HWE 3;  4GAL A;  4OCT A;  4I30 A;  3ZXF A;  5DG1 A;  2RDQ A;  4HLT A;  4FBF A;  2IC1 A;  1UZW A;  4J1X A;  2E53 A;  2AGS A;  3LE0 A;  3MPB A;  1ZBE 3;  4C0B A;  1OLQ A;  2RR1 2;  1JBC A;  1ZRD A;  5BNN C;  4HSJ A;  5A3N A;  3VDB A;  3AM2 A;  1RUE 1;  4WVM A;  2P5B A;  5L7O C;  1BLZ A;  1XND A;  3I3Q A;  5KR7 A;  1W3V A;  5JXG A;  3SH3 A;  1Y43 B;  3AJZ A;  2BBA A;  1F4H A;  4FPC A;  3SCH A;  1AZD A;  2YBP A;  5J09 A;  1LU1 A;  1WA4 A;  4LLO A;  4NAM A;  4PI2 A;  5LBE A;  1GQH A;  3ZYI B;  3GHM A;  4GMP 1;  4MZU A;  1QQP 3;  3H3U A;  4EE2 A;  1UU4 A;  1LR5 A;  5F3E A;  1FX5 A;  4AFA A;  5FZL A;  4J1W A;  3H8U A;  2VZQ A;  3IKW A;  2CV6 A;  4R9A A;  3X29 B;  1IPS A;  3WV6 A;  1AR9 1;  2VUJ A;  3ZXA C;  1GOF A;  3RJR A;  3THC A;  3WG3 A;  2F4L A;  1H0B A;  4GJY A;  4Q0U A;  4CCK A;  4NIG A;  2WFF 3;  4QGL A;  3FN9 A;  5FLI A;  4F3J A;  3CJX A;  1VBB 3;  4YZ1 A;  4EQV A;  1HIX A;  1MEC 2;  1W6N B;  4CTE A;  2OII A;  5JOZ A;  1PVC 3;  1EY2 A;  1U12 A;  2V72 A;  3JBG 3;  3MYX A;  4JGY A;  4LBO A;  4Q4Y 3;  5T50 A;  4COW A;  3N4M A;  2WN2 A;  2RDN A;  5GZE A;  1LGB A;  4AK3 A;  2Z42 A;  4WVV A;  2VQT A;  4PIZ A;  1HV1 A;  1Y9Q A;  2ZEZ A;  2O8O A;  3SMH A;  1C8N A;  3A0N A;  5FZ6 A;  4QQO A;  1BQP A;  2QDR A;  1N47 A;  2LRP A;  1LB2 A;  3T4V A;  4YAR A;  3VGI A;  2G1M A;  1B35 B;  1RVF 1;  2G9F A;  4ATE A;  2WAB A;  1VRB A;  4Q4Y 2;  4FPO B;  1SLI A;  4PDW A;  4AED A;  3RYP A;  2OQ6 A;  1X33 A;  2FMY A;  3KZ4 C;  5FP4 A;  5JCT A;  1KEX A;  2WFF 2;  3VZM A;  1SPP B;  4XDQ A;  1GOG A;  4CA9 A;  3LA2 A;  2BRT A;  2QZ2 A;  4DEV A;  3O0X A;  3BUC A;  4QXK A;  1CAX B;  3OUH A;  2EF6 A;  4JDM A;  1ONA A;  5A6Q A;  1RUD 3;  3PIJ A;  2A3X A;  1UIJ A;  4QX8 A;  5LAS A;  3TEY A;  4L97 A;  4UOJ A;  3S57 A;  5F5A A;  4RD7 A;  2DBI A;  1UYX A;  3PUQ A;  3QOP A;  4XAC A;  5FZ1 A;  4YM3 A;  4LKE A;  3WF4 A;  2YRO A;  3J26 N;  3OY8 B;  3THT A;  4AQS A;  1DZT A;  3BU0 A;  3AK0 A;  2IWG B;  4CEW B;  1RHI 1;  2AUY A;  2UUR A;  4MGQ A;  1UXZ A;  1Q8V A;  4BIS A;  3M3Q A;  3U78 A;  5A33 A;  1H1M A;  2VTF A;  4BXF A;  3B02 A;  1DLL A;  4WM7 C;  3ZMN A;  3LSE A;  3WG2 A;  3VKO A;  3M3E A;  1QNY A;  2VC9 A;  2OPW A;  4EWD A;  4QX3 A;  1DYK A;  2B42 B;  2WQ8 A;  4IE0 A;  1WLC A;  1XE7 A;  2Q1M A;  4TLF A;  1Z78 A;  5FP3 A;  4CCD A;  1SG3 A;  1BBT 2;  3IIA A;  2Y6L A;  3AYA A;  5HCF A;  1UD1 A;  5BV6 A;  5FPX A;  3SCF A;  1L7Q A;  4HFS A;  5FZO B;  1CJP A;  2VCA A;  3I3E A;  2QTW B;  2BEO A;  2WC2 A;  3NAP B;  3OPW A;  2BOJ A;  1ULE A;  3SLI A;  5IVE A;  2Y38 A;  3JB4 C;  3C7O A;  2BNO A;  3U4S A;  3DYP A;  5FXX A;  3E1F 1;  1C4R A;  1POQ A;  3TN9 3;  3CJI B;  3TWI A;  4IEO A;  1DGR N;  1AR9 3;  4IL7 A;  1ZRC A;  2PMW B;  2GN7 A;  1F4A A;  1YUD A;  4ERO A;  4YW4 A;  2O1Q A;  1WD4 A;  2YGL A;  4RHV 2;  1VBB 1;  2BW8 A;  3HQU A;  4CDQ C;  4Q0Q A;  4QHZ A;  1OQ1 A;  1MS4 A;  4CYD A;  1VB2 A;  3D5O A;  2TNF A;  5I0D A;  1AYM 3;  1JN2 P;  3ZDS A;  5FOB B;  2WLQ A;  2JD4 A;  1H1A A;  2Y6J A;  3KGZ A;  4NVP A;  5FY9 A;  5FLH A;  4IEP A;  5BXX A;  5ABJ C;  1TMF 3;  3V0B A;  5C8C A;  3CHX A;  5A33 B;  1FYU A;  3BYW A;  4BLI A;  5F37 A;  4XXP A;  1RUG 2;  5A7W B;  3T2O A;  2BTV C;  3ABZ A;  3I3B A;  2ZCW A;  4IGQ A;  1E5R A;  4BE3 A;  3SXW A;  1J3Q A;  1RMU 2;  2IVJ A;  2R7E B;  1V6O A;  4HN0 A;  4RYD A;  2EID A;  4B29 A;  3OB8 A;  1IG0 A;  1F5F A;  5DZF A;  2CHH A;  4KMQ A;  4UXA A;  2WO3 A;  1X8M A;  3GJA A;  3JD7 2;  4NWV A;  1K12 A;  1TEI A;  5E88 A;  4XF0 A;  2EXK A;  5JUV A;  2VCM A;  3W58 A;  5M0T A;  1AR6 2;  2WNU C;  1QKQ A;  1R1A 3;  3NJZ A;  1RUD 1;  4OZO A;  5FMC A;  2ZAB A;  5FYV A;  4MXV A;  5FQ0 B;  4NMI A;  5BPX A;  2VME A;  5L9B A;  3CBN A;  1CIW A;  4ASK A;  4BMB A;  1ND2 A;  1HRI 2;  2ARC A;  4YLZ A;  3VKL A;  1FOD 3;  2JE9 A;  2R32 A;  4FQZ A;  4XZP A;  4CP9 B;  2W68 A;  2PAM A;  4TN7 A;  1PIV 1;  4AHY A;  5BNP C;  1VMH A;  3LB9 A;  4Y1U A;  2ZKN A;  3AZX A;  2CYF A;  2QVS B;  4BB3 A;  4CUG A;  1STM A;  4IV3 A;  1BZW A;  3EHK A;  2QZ3 A;  4L2N A;  4UI9 L;  5C71 A;  5HXM A;  4Y22 B;  5F8P A;  3BVC A;  5FZE A;  2XH6 A;  2ZGQ A;  1AX1 A;  2P34 A;  3KCX A;  2WUH A;  5BNO B;  3W5N A;  2V4V A;  1G9A A;  3L2Y A;  1W2U A;  4YG3 A;  1S0F A;  3FFQ A;  5BYN A;  3G7D A;  2VU9 A;  1XQN A;  3VZO A;  1VPH A;  1R09 3;  1RUI 3;  5GLT A;  4ITC A;  2A6Z A;  4ATF A;  3VHR A;  3B94 A;  5C9A B;  1NA1 A;  3EB7 A;  2XJT A;  5FYU A;  3WDU A;  5IT6 A;  4PBP A;  5FYB A;  4A7K A;  1UCX A;  5F2S A;  3WF0 A;  2P3I A;  1GNZ A;  4AXO A;  4Q4Y 1;  2Q30 A;  3ZYF A;  5EJZ B;  2R06 3;  4ZKT B;  1SCS A;  4IXL A;  1DIW A;  4CUB A;  1GFF 2;  1NCQ C;  3ZLI A;  4YM1 A;  3CJI A;  2PAK A;  2JIJ A;  3FBY A;  4HOO A;  5FXW A;  3SKV A;  3VBF C;  4DO0 A;  4Q2F A;  1JOP A;  1H8T B;  2WNV A;  3UKN A;  4JRA A;  4PHZ A;  3WF2 A;  1W6P B;  1F5J A;  1OA3 A;  1UQX A;  3G6J B;  3ZXG A;  5J48 A;  1RUN A;  3PMS A;  1PK6 B;  2VQU A;  3J7H A;  3ZVX A;  2RM2 2;  4X8P A;  1TE1 B;  2PLV 3;  1AR7 3;  2DFB A;  2H6C A;  3K3N A;  4NIH A;  1O3Q A;  2ZKL A;  1TMF 2;  3DYM A;  2EIG A;  3Q8E A;  2P6H A;  4PI0 A;  5FKC A;  4NO4 A;  3VKN A;  1RUH 2;  4LBM A;  3BAL A;  4EJR A;  1I1E A;  1AHS A;  3K77 A;  3DF0 A;  2VUC A;  3VBF B;  1SPP A;  1VE0 A;  4Y1Z A;  4I09 A;  4UFL A;  4BQ3 A;  1PMH X;  4Q1P A;  3FLR A;  3K51 A;  4OQ9 A;  5CEH A;  1QJX 1;  4XQD A;  3M70 A;  1IHM A;  3DPR C;  3NWK A;  1OD5 A;  1C5I A;  1XNB A;  3BOP A;  1FXZ A;  4W50 A;  3THP A;  4QX5 A;  4FTB A;  1WW6 A;  2XBO 1;  1S0C A;  4MGZ E;  4Q27 A;  2V4A A;  1UO9 A;  3OUJ A;  2JDN A;  2P17 A;  3AFK A;  5A70 A;  1EAH 1;  4JDN A;  2W52 A;  4MGI E;  5EP9 A;  1GZT A;  5HV4 A;  1GZC A;  1S0D A;  2RR1 1;  3OEB A;  3AL6 A;  1RC6 A;  1A78 A;  1JHN A;  3KT1 A;  2FMD A;  2KR2 A;  5C8C B;  3SCG A;  2ARB A;  2VMC A;  3FC0 A;  1FNY A;  2QQO A;  2H0V A;  2VTX J;  2OS2 A;  3S6P A;  4PIY A;  2NPI A;  4QM9 A;  3HWJ A;  3ME2 A;  3UT0 A;  4QT6 A;  4NRQ A;  5JXH A;  1K3I A;  2VXR A;  1U5Y A;  1K42 A;  1ZBA 2;  1KGY A;  1MS8 A;  4WZF A;  4Q4X 1;  4MET A;  1RYY A;  1UZY A;  4I0B A;  1ULD A;  1OQD A;  2Y6H A;  1BEV 3;  3TAY A;  1WMX A;  5A3P A;  1V0A A;  3NV4 A;  1QJU 2;  4AQT A;  4DS0 A;  2BVV A;  4N53 B;  4AWD A;  1VBE 3;  2DV9 A;  1YQ5 A;  3LPF A;  2UYA A;  1RUJ 2;  2YMZ A;  2VZS A;  3JQW A;  4DXZ A;  2PFW A;  3QH7 A;  1J1L A;  1D4V B;  5A3O A;  2EXH A;  1QJU 1;  1XJA A;  5FZD A;  3AYC A;  4KWL A;  1OT5 A;  4QPI C;  2JDY A;  3GGL A;  1C57 A;  4QMA A;  3VBO C;  3KLS A;  4LTA A;  1HRV 3;  5C3Q A;  4XJU A;  3J9S A;  3SH5 A;  2ARE A;  4GMP 3;  4YGC A;  3FFZ A;  1FMD 2;  1OVP A;  1ZBA 3;  4OZX A;  5FBZ A;  2HYX A;  1PVX A;  4K40 A;  1W2A X;  3AJY A;  3NV2 A;  1DQ6 A;  1PO2 1;  4YSF A;  2VAU A;  2ET1 A;  3UGF A;  4OQ8 A;  3JZV A;  1RL3 A;  1OF3 A;  1QH7 A;  3VBO A;  4P08 A;  4ORF A;  2Y60 A;  1NE6 A;  3U10 A;  4A42 A;  1C8M 3;  1CX4 A;  3Q9O A;  5T5P A;  3AMP A;  2Z79 A;  3P3P A;  1K5J A;  1DQ2 A;  1X7N A;  1RED A;  4KGQ A;  5GLZ A;  4JQR A;  4XFF A;  1GAN A;  4CDQ B;  3OCP A;  1WCQ A;  4XIK A;  3T1M A;  5KWR A;  4LA2 A;  1UOB A;  4IGO A;  4BZ4 A;  1XRU A;  4W6W A;  2ADE A;  2VQA A;  5LAT A;  2JDM A;  1O3T A;  5T55 A;  2JWP A;  5K0U C;  3ETQ A;  3VBU B;  4QPY A;  1CAW A;  2JE7 A;  1C8M 1;  4OLL A;  3A4U A;  3LDB A;  4H14 A;  1NZC A;  2KA3 A;  1JOB A;  1DZQ A;  3POS A;  1RUH 1;  5FK7 A;  2J22 A;  5D8A B;  3N35 A;  4DPN A;  2A3W A;  3SEE A;  1CR7 A;  3WUD A;  1WLD A;  1FNZ A;  2A6W A;  3GBW A;  1VBD 3;  2YC2 A;  1XE0 A;  2ZAA A;  3H1Y A;  1MEC 3;  3TEW A;  3P5B A;  1IPK A;  2Y6F A;  1U5X A;  3WOG A;  2QQJ A;  1W0P A;  1OC1 A;  4Y4R A;  2SLI A;  2ZX0 A;  1RIT A;  4RR3 B;  3KCC A;  3PUH A;  2R49 A;  5GM0 A;  1D2S A;  3PIG A;  2AYH A;  2RS1 2;  3WNK A;  1NG0 A;  1HLC A;  3VZJ A;  1AXY A;  2ID4 A;  2JD9 A;  5AC9 2;  5A32 B;  2ZX2 A;  2E33 A;  4FOW A;  1CIY A;  1DHK B;  4LO7 A;  4OFG A;  4P14 A;  5FZ0 A;  4YFW A;  2ZEW A;  2JIC A;  1ASJ 1;  4XCB A;  5FAX A;  3B7M A;  3WP4 A;  5GKA C;  5H9S A;  1COV 3;  3ZFF C;  4YWA A;  2DUP A;  2AEN A;  1Z0H A;  2VMG A;  4FAG A;  5GJ6 A;  1QOS A;  2WNU B;  1WW7 A;  1LOF A;  1OD3 A;  3PL0 A;  2QCS B;  4RS5 B;  1J83 A;  4AFB A;  2D97 A;  4ZON A;  3VD9 A;  4YZ2 A;  1GZ9 A;  4NPL A;  2B7Y A;  2Y0I A;  2ET7 A;  5E6H A;  4QU1 A;  4C0H A;  3TYJ A;  3H3Z A;  4XQ4 A;  2CWS A;  2HH9 A;  3U11 A;  2IXJ A;  1E5I A;  2ZXQ A;  1Q43 A;  4AFD A;  4BQ2 A;  1VR3 A;  2GDF A;  3DXU A;  5L9V A;  3DV8 A;  5GAL A;  1AR6 1;  1YQ8 A;  1PX4 A;  3F2Z A;  1CN1 A;  3S30 A;  4GZ9 A;  3JD7 1;  3VLB B;  1UKR A;  1KS4 A;  5IUQ A;  3KV4 A;  1ENR A;  5ISL A;  2QQW A;  4K8R B;  2IZW A;  5J96 B;  1BVV A;  5DQ0 A;  3AKP A;  5C7G A;  1UPS A;  4GH4 B;  1EYB A;  1N1Y A;  4WV8 A;  3R4D B;  3WSO A;  1WCD J;  5CFD C;  3C7F A;  5ABJ A;  3PVO A;  3J4U H;  5EJ1 B;  4D69 A;  4QKN A;  4ZXK A;  5C8C C;  2G19 A;  2PLV 1;  3NQH A;  2VM9 A;  4RR3 C;  3T4H B;  2A73 B;  5IAX A;  5JPM B;  1JU3 A;  1MZ5 A;  3OBA A;  5DG2 A;  3MO4 A;  4CRQ A;  1CAV B;  2XLF A;  3BN6 A;  2WSU A;  1IPJ A;  4O7X A;  4LNV A;  2Z5W A;  3T08 A;  1DGW X;  1LTE A;  5LB6 A;  1GSL A;  2CU5 A;  4IEX A;  5KXE A;  4CCM A;  3IT8 A;  4HK8 A;  3NMB A;  1AXK A;  4EZ4 A;  1NE4 A;  1XE8 A;  1HXS 1;  1W8Z A;  2RJK A;  3GZU C;  5FOJ B;  4K1Z A;  1CGP A;  1CD3 G;  2HEV F;  1YQ6 A;  3DGT A;  3OGV A;  1JZ6 A;  4BOW A;  2G9Z A;  4FFI A;  4FPH A;  4IV1 C;  1HB4 A;  4LUK A;  4AHX A;  2WFP A;  1WLW A;  3W9A A;  2RV9 A;  4N7U A;  3OF1 A;  2W0X A;  1BEV 1;  2WA4 A;  4FO9 A;  5ANN A;  1ENS A;  4YVW B;  2Q1F A;  4A45 A;  3WLU A;  5I91 A;  3WDT A;  4B4Q A;  1F35 A;  2D6M A;  1R09 1;  1RUI 1;  2J1U A;  4CU6 A;  2P2K A;  1JHJ A;  4IV1 A;  2PHW A;  3PUS A;  3BU7 A;  1D4M 1;  2A1X A;  3RJ2 X;  1MVE A;  1WGP A;  1I6X A;  1YCI A;  4KG0 A;  1ZZ6 A;  1NQD A;  1O4T A;  1UMH A;  4EN7 B;  2OZ6 A;  1MAC A;  1T6B X;  2R0H A;  5D8A C;  4Y26 A;  1HQW A;  4XJ8 A;  3O1T A;  4FCA A;  1UU5 A;  4P5H A;  5C8W A;  1O5L A;  2VO5 A;  1TG7 A;  2PA7 A;  1OLR A;  4YVS C;  5DDJ 1;  1B35 C;  1PMI A;  3PVB B;  4NPR A;  3SEP A;  4D6R A;  1N1T A;  2VMF A;  3V0B B;  3NNG A;  4NAO A;  5F5I A;  5FR3 A;  2A71 A;  2DCK A;  5ACA 3;  3GNE A;  1LGC A;  5KXB A;  1BK0 A;  1JXN A;  2IFR A;  2JJ6 A;  1LOG A;  1SLA A;  1VBC 3;  4K1Y A;  1AR7 1;  4BK5 A;  2WFF 1;  2BJS A;  4YGD A;  5EV7 A;  2Y26 A;  4IE5 A;  5LA9 A;  4YNI A;  5FMD A;  4NIA A;  1B35 A;  4CE8 A;  1Q8O A;  3ELN A;  1HQL A;  4LHN A;  4N9H A;  4OUS A;  1AR8 3;  5EPA A;  3MLK A;  3WQB A;  1US3 A;  5IK4 A;  4QPG B;  1JYV A;  1D7P M;  2YXS A;  4CXY A;  2OX0 A;  2O0O A;  4IES A;  5BNO A;  2PEL A;  5DN2 A;  1UYZ A;  4IE7 A;  3TN9 1;  4COZ A;  4V2W A;  1AL2 2;  2WA3 A;  4IEW A;  3ZR6 A;  4BJ0 A;  1E5H A;  1QJX 2;  4JCK A;  4QGN A;  3BPZ A;  5JOW A;  3HT2 A;  5FXV A;  3P3N A;  3MGU A;  1LOA A;  3MV0 1;  1W9S A;  2QQI A;  4LBN A;  2Q4S A;  2VG9 A;  4I0W B;  4S2G A;  4AGV A;  3PTR B;  2HWD 2;  4UW5 A;  3ZKY A;  3ZPO A;  5B4N A;  5FV3 A;  5IVB A;  1O3S A;  5JI9 A;  4CDX B;  1AL2 3;  1GWM A;  5IJR A;  3MZH A;  1OH4 A;  4ARX A;  2GN3 A;  5FYZ A;  1AR9 2;  1VP6 A;  2P1B A;  2RM2 1;  3KT4 A;  4M3C E;  5CYY A;  3DPR B;  3KB5 A;  3BOW A;  3AZZ A;  4OI4 A;  2IFW A;  4AED C;  3HNY M;  4FFG A;  4IND A;  1HRV 2;  2VVF A;  3VBS C;  1UMZ A;  3VB9 A;  4EN6 B;  3K75 B;  4GQ7 A;  5JIU A;  2LS6 A;  1JI6 A;  4D0Q A;  3V0A A;  2HWC 3;  2HWE 2;  1W9F A;  1QMJ A;  2HWB 2;  5CB7 A;  1OI6 A;  2RDR A;  3HVD A;  5C4W A;  2DTW A;  1RUJ 3;  2ZHL A;  2P4E A;  3QAC A;  5FY4 A;  1GP6 A;  2EAA A;  1GV9 A;  3ZFG C;  4ET7 A;  4ES9 A;  1NLR A;  3O1O A;  4E4D X;  4E9K A;  1OKQ A;  1KDK A;  2RDS A;  4CDU C;  1YFU A;  1B09 A;  1MS3 A;  4ZU7 A;  4WZC A;  3LFM A;  2NN8 A;  4UFH A;  3PU3 A;  2O14 A;  1K5M B;  1C1L A;  1MQT B;  4JKM A;  2DU1 A;  4LR4 A;  4QPI A;  1DG6 A;  2HWD 3;  4LO6 B;  4CVU A;  5K9Y A;  4COV A;  3RSJ A;  4B4P A;  5C5T A;  4FPL A;  4CZS A;  5LBB A;  3S0M A;  1H9P A;  2WYS A;  2ZOE B;  3LCP A;  1H8V A;  4RL7 A;  4I2O A;  2BUK A;  3ZSM A;  4SBV A;  2VUL A;  3ZYR A;  2DBN A;  4K6B A;  1LED A;  3E5X A;  2H0B A;  3INA A;  3NNL A;  5JI7 A;  1W06 A;  3H50 A;  3PUA A;  4Q26 A;  1NCQ B;  1LRH A;  1CPN A;  2VEC A;  2BGC A;  1XU2 A;  3M7A A;  4IE4 A;  5G05 L;  3N9N A;  4DXR A;  2VQ0 A;  4M0N A;  2BGP A;  4DRV A;  1XYN A;  1HJG A;  1EPZ A;  1JUH A;  1IKP A;  3HAG A;  2I2S A;  4NHK A;  3TOJ A;  5C5U A;  5CG8 A;  2PYT A;  4MGT A;  4TXW A;  2R04 2;  4KWK A;  2E6V A;  4CUC A;  2VBB A;  3VZN A;  3ZDV A;  4HG6 B;  3D3A A;  3O1M A;  4MV2 A;  1ULP A;  5J37 A;  1W6P A;  4OHY A;  3JBG 1;  3EJK A;  2CL2 A;  2UWA A;  1W9W A;  4LBL A;  2DUO A;  4DY3 A;  4R52 A;  2OA2 A;  5IK8 A;  3Q8A A;  4Y20 B;  2BFU L;  4JTO A;  1BK1 A;  2DCT A;  1DGW A;  4Y33 A;  1H2L A;  1PZ9 A;  4RHV 1;  2K46 A;  1NY7 1;  3GJB A;  3VBS B;  5E8A A;  4DUX A;  1JU4 A;  2RS5 1;  2AAC A;  4I02 A;  3UV9 A;  1MS9 A;  4CCC A;  3NRU A;  2FDK A;  4DNY A;  2PLV 2;  1O4Z A;  4RFR B;  3WP3 A;  1LUL A;  1NT0 A;  3KT7 A;  4OVE A;  4JX0 A;  4HMZ A;  4JVA A;  2ILM A;  2YY1 A;  2WYF A;  2WNU A;  4Y24 A;  1T2X A;  3WQ1 A;  1U0A A;  1S0G A;  4XMI A;  5DAV A;  3E6C C;  3WHU A;  2Y6K A;  2ZPX A;  4H7L A;  4AFC A;  4QKF A;  2Q8C A;  4CEY C;  2EIB A;  4E4Z A;  5D1I A;  4LK6 A;  4N9I A;  1T6G C;  4CCN A;  2WZP P;  4QDR A;  1KDM A;  1SLT A;  3D0S A;  3MIG A;  5FYT A;  3WP6 A;  3V65 A;  5LK7 B;  2QDN A;  4BQY A;  1QQP 2;  2BGO A;  4P9X A;  1LCL A;  3WNN A;  4KBB A;  3ZIW A;  4A2U A;  4ZS2 A;  1RGS A;  3QLQ A;  5CNA A;  2A6V A;  4LUL A;  3ZFF A;  1CAV A;  3GHN A;  2CAV A;  5A3W A;  3SKJ E;  1FT9 A;  3K48 A;  2HLE A;  5JZG B;  4CEY B;  5LBF A;  1JS9 A;  3M8L A;  3H9A A;  4HPK A;  4QPG C;  4UAP A;  2VZO A;  3ITQ A;  3WW1 A;  4AFM A;  4P02 B;  1NA1 C;  4ZU4 A;  2AEY A;  2QQK A;  1QGL A;  2ZTN A;  3ACH A;  4YVW A;  1NLS A;  3I2D A;  3PHM A;  5FZM A;  2W3J A;  3FHA A;  4LEJ A;  3W59 A;  2D93 A;  4FPK A;  3IPV B;  1ZX5 A;  2W87 A;  3PJY A;  5JPN B;  1TME 1;  3T2Q A;  1VRH 1;  4D3W A;  4DUW A;  3SNM A;  2WQZ C;  4BQX A;  3V0A B;  4ZU5 A;  3GZT B;  5FYS A;  3CJI C;  1QDO A;  2BU9 A;  4Q4W 2;  2GNT A;  3ZXL A;  2VY0 A;  4CCJ A;  4D94 A;  1P8J A;  2XON A;  2JIG A;  2EIE A;  3AC0 A;  4LBJ A;  4WVW A;  1F15 A;  1V70 A;  3AKQ A;  1RVF 2;  4XW3 A;  2PHR A;  1BCX A;  1AR6 3;  4CU7 A;  1UYP A;  5KC6 A;  4H7M A;  2FHR A;  4KG8 A;  3D8C A;  2JEC A;  2OZJ A;  4Y1Y A;  5FO7 B;  2YYO A;  4F83 A;  1N1V A;  2ZX3 A;  1FAY A;  4ASM B;  1X36 A;  1HB2 A;  4HET A;  1SHW B;  4YM2 A;  4M3C F;  4HON A;  4NHY A;  4DZG A;  2ZGK A;  4FAH A;  1AUY A;  3PVN A;  5BY5 A;  1PGS A;  1RIN A;  3LEI A;  1JZ3 A;  4QAW A;  3U4X A;  2P6C A;  3LEM A;  3C7E A;  3FX3 A;  3OOX A;  1RXF A;  2VNO A;  1QXP A;  4AW7 A;  2VVD A;  4LLF A;  3WNX A;  2OUJ A;  4PQQ A;  4L11 A;  5CG9 A;  4PT6 A;  1WW4 A;  4FP2 A;  3AVS A;  5F5Q A;  4BDV B;  1Z7S 2;  1ZZ7 A;  1IS3 A;  2D5F A;  2JG9 B;  3AKT A;  4LE3 A;  5FPZ A;  5B4X A;  1C8M 2;  2Y33 A;  3O5S A;  5FRE A;  3VDC A;  4P9G A;  3RZZ A;  1FPN 1;  2NMO A;  3DCQ A;  3U37 A;  1QJF A;  3VHP A;  1L7R A;  1WMF A;  3EMR A;  3PTY A;  3V56 A;  4E4H A;  3ASI A;  4AI3 A;  1RUE 3;  4AVA A;  1GKB A;  4XYX A;  5LA1 A;  1JZ7 A;  1DDL A;  4TTG A;  1RUF 2;  3Q8F A;  4MSV A;  4QX0 A;  1UW8 A;  3ALQ A;  5LWB A;  3BOD A;  2RS1 3;  4QPI B;  1QQP 1;  3DXT A;  5E1R A;  2Q8O A;  3UK9 A;  4IE6 A;  5HV0 A;  1QOT A;  2PHT A;  2J1V A;  4HBN A;  4YW6 A;  3M3C A;  1PZ8 A;  1W0N A;  2WT1 A;  5IAT A;  1DFQ A;  2Q5T A;  3JB8 A;  4L0P A;  3W21 A;  4CDW B;  1V6M A;  3ZSK A;  4A41 A;  4CP9 A;  4LXL A;  1YFY A;  3UL2 A;  5KHI A;  3K4A A;  3OBZ A;  2NM1 A;  4YG0 A;  3WVJ A;  4XDO A;  4XQW A;  1YO8 A;  4ISR A;  3AXD A;  5FPA A;  5FRA A;  1RTV A;  1O59 A;  2A5Z A;  3BKZ A;  4AED B;  4M4R A;  1AYN 3;  3OGR A;  3P1I A;  4CCL A;  1GZW B;  3HMY A;  4D7Y A;  4GUL A;  4EN8 B;  2VZP A;  1LU2 A;  4XDP A;  2OPK A;  4P5Y A;  3R4S A;  2BBV A;  4KNC A;  4XTP A;  5EYX A;  1S2E A;  2WIN B;  4QQ2 A;  4RS5 A;  4FVV A;  5EWS A;  3ZX7 A;  3MF9 A;  5FP9 A;  1NX9 A;  1QY4 A;  5JLV A;  3ROU A;  4XBL A;  2V09 A;  5E89 A;  1XU1 A;  4OUM A;  1YIP A;  2BFU S;  2GU9 A;  3DKW A;  4LHK A;  4N7I A;  5L7O A;  5JSO A;  3VD4 A;  4YRD A;  5F9T A;  2B4K A;  1VBA 2;  1COV 2;  3RG0 A;  4C1W A;  1L3J A;  3NJY A;  3III A;  4KI5 M;  4Y5T A;  3ZFF B;  4DY5 A;  2J1R A;  1XNT A;  3MW4 A;  1AR8 1;  3W5M A;  3QD6 A;  1C1F A;  1EAH 2;  5H9P A;  3WDV A;  2YB7 A;  1QXJ A;  5JR7 B;  3S7E A;  2ZEX A;  2FBE A;  3I4I A;  3J8F 2;  2GC1 A;  4OI0 A;  3S5Q A;  3RFR A;  2WS9 1;  1W28 A;  4UYB A;  1QU0 A;  1YJK A;  4GH4 A;  2GC0 A;  2P3K A;  2GMM A;  1IS6 A;  3MID A;  4RA0 A;  4PLO A;  1NXM A;  2WKK A;  1JYC A;  2RM2 3;  2JKB A;  2VW1 A;  3KSC A;  4AYU A;  1LEN A;  1RUC 2;  2CNA A;  3GCX A;  3LIG A;  4UW3 A;  4D7T A;  3LFI A;  4QDS A;  1UIK A;  2ZGO A;  1FMD 3;  4GKY A;  3N7M A;  4BQW A;  1JOJ A;  2CGO A;  3ZMO A;  4CUA A;  5FQ0 A;  2D44 A;  4C8D A;  4XAA A;  1ZNP A;  4J25 A;  5DDJ 3;  1U5I A;  2WDB A;  4IEZ A;  4K20 A;  1RB8 G;  3ZN4 A;  3A22 A;  3ACF A;  4D8M A;  2VMH A;  3EBR A;  3IN9 A;  4CEW A;  4EV0 A;  3BIE A;  3VKF C;  1CJD A;  1V6N A;  4RN5 A;  2GP3 A;  4LKF A;  4Q8K A;  4GWJ A;  1NXD 1;  2JB8 A;  1ZZB A;  3R6S A;  2HEY F;  4AGG A;  2BWA A;  2YFU A;  2YHJ A;  1OQE A;  4QB2 A;  2JG8 A;  4E2S A;  1TNR A;  1KS5 A;  1HRV 1;  2WJS A;  1LOF C;  1ASJ 3;  1ENQ A;  3B93 A;  4OHV A;  4QHO A;  4LHL A;  4HKO A;  3POW A;  5F6K A;  2YPJ A;  4Y4Y A;  5FY1 A;  5ACA 1;  1LAJ A;  4AQ2 A;  1CVN A;  1D4M 3;  1DGL A;  2KM2 A;  1W6Q B;  1YNA A;  2EIC A;  5HBA A;  2RS3 1;  1SBE A;  2HWC 2;  4I0A A;  2VE1 A;  3GXU A;  3KV9 A;  5C3P A;  2OYZ A;  2Q1Z B;  1AYN 1;  3CMG A;  1NA1 B;  2VBP A;  1H4H A;  3CDZ B;  4Q29 A;  2B9V A;  4MG2 A;  1PGL 1;  4RGK A;  3IDB B;  5DAP A;  5KHH A;  1VBD 1;  3E5U A;  2CDO A;  2XG3 A;  2X53 S;  1W99 A;  4C90 A;  4QKD A;  4R9C A;  5H9Q A;  5F7U A;  4GA9 A;  2WS9 2;  1SEF A;  1U5Z A;  2B45 X;  1Y7B A;  4UF0 B;  4LOR A;  3LEG A;  4MHU A;  3J8F 1;  5FWJ A;  4WVZ A;  5IFP A;  1ND2 B;  1QXR A;  4RFT 0;  2FZ2 A;  3KV5 A;  3MW3 A;  4KGG A;  5CFD A;  1AJK A;  2HKX A;  1UWW A;  1LEC A;  1Q8P A;  2FCT A;  3ACI A;  4XTM A;  2BPA 2;  2ZZQ A;  5FTT C;  1AR7 2;  1VLN A;  2PHD A;  2ERF A;  1I5Z A;  4GXL A;  5IYY A;  4XF1 A;  1VBA 1;  2VTX A;  4CDQ A;  2HJI A;  4P9I A;  1KIT A;  4U2A A;  4XUO A;  4AAP A;  3RZK A;  2XQX A;  4OMD A;  1HXS 3;  4LOT A;  4MUV A;  4QXC A;  4O9E A;  5KXC A;  5GZF A;  1Q3E A;  4NOT A;  2GAU A;  5IVC A;  1RUG 1;  5CZK A;  2R1B A;  2X05 A;  2UU8 A;  2R06 2;  2Q8E A;  3FHI B;  1VBC 2;  4WM8 B;  4XAB A;  2AH2 A;  4XFG A;  1KJL A;  3OBR A;  2VW0 A;  3BTX A;  3EO6 A;  1LGN A;  4AZZ A;  4JAA A;  2X29 A;  3UYJ A;  3W20 A;  2TEP A;  5FFO C;  4GKX A;  4GWM A;  4S2F A;  3DUI A;  3RZJ A;  2LM3 A;  1YFW A;  1ACC A;  2PHX A;  4MLO A;  3VZL A;  1NZI A;  1F2N A;  1PO2 3;  2VPV A;  2WNO A;  2WZE A;  3IDE A;  2ZAH A;  3AZV A;  4P9J A;  3O1P A;  4A6S A;  3NAP C;  3POF A;  1BKZ A;  2IXC A;  4Q4X 3;  1PK6 A;  1CQ9 A;  3IB3 A;  3IZO A;  2WLP A;  4Y5S A;  3RYR A;  3UNP A;  1IKQ A;  1GU3 A;  5DUV A;  3PVE A;  3KHC A;  4AVV A;  5FY7 A;  1J3P A;  3PJQ A;  1PM7 A;  1SQ4 A;  3T3Y A;  1VB4 A;  4BH9 A;  2GND A;  3KGL A;  3H7Y A;  4D6Q A;  5C3S A;  5D8A A;  1O3R A;  3HN3 A;  3AP6 A;  1A8M A;  3A7Q A;  5FIX A;  4BIO A;  1HQN A;  1BYH A;  1O91 A;  1SLB A;  3O7O A;  3POY A;  5FBJ A;  4NUB A;  4AI8 A;  1PO1 3;  1W05 A;  1XSR A;  4FPJ A;  1XSQ A;  2Z4F A;  1H6X A;  1QJY 3;  3UJO A;  5A3M A;  1H2M A;  5LBC A;  4NII A;  2B46 X;  4YGB A;  4LQR A;  4XET A;  2DFC A;  4B1L A;  5JSR A;  1A8D A;  4TYS A;  1MS1 A;  5A6X A;  1EAH 3;  2BP6 A;  2XJS A;  3LWC A;  2VD7 A;  3RWN A;  3KWV A;  4S2D A;  4JV4 A;  5J98 B;  4QQH A;  4CP2 A;  1IQA A;  5J1X A;  1ZRE A;  5LY2 A;  3ACL A;  2WAA A;  3D4K A;  1OLM A;  4JGY B;  1MPX A;  1EV1 3;  3GDB A;  3WCS A;  4AR2 A;  1BHG A;  1N3P A;  3ZPY A;  4YZ5 A;  2Y34 A;  5FKB A;  5JOX A;  1GIC A;  2YG0 A;  4JHT A;  5FZ8 A;  3S7I A;  3VN4 A;  3HBZ A;  2D6K A;  5BNQ A;  4K9S A;  4XIO A;  5K4L A;  3NNF A;  4R9D A;  5FYH A;  2ZGT A;  4MHR A;  3KVA A;  4LK7 A;  1POV 1;  4FPF A;  4FI9 A;  1X82 A;  4N43 A;  1WD3 A;  4Z07 A;  1BVP 1;  3IM0 A;  4CXX A;  1YI9 A;  2WS9 3;  5FP7 A;  4PF1 A;  4AE2 A;  1OUR A;  2RS5 3;  4PDW B;  2YU2 A;  3O1U A;  2E26 A;  3AXE A;  1ENX A;  4YG6 A;  3E6D A;  4Y5Z 0;  1VBE 2;  1WMD A;  4XUT A;  1RUG 3;  1DZR A;  1X8E A;  1YXW A;  2R04 3;  3RI9 A;  3I3M A;  1VBD 2;  1HJF A;  4MGK E;  4QXB A;  1H30 A;  5LA0 A;  1XBF A;  3RWK X;  3H7J A;  4BHP A;  2HWF 1;  3MIF A;  4N8M A;  3U75 A;  3POB A;  1TME 2;  1WUV A;  3FMG A;  3R4U A;  4Q5O A;  2QQL A;  4HPK B;  4HVQ A;  5AVP A;  1PGW 1;  3ORJ A;  1G9C A;  3RZM A;  4KH9 A;  5FXZ A;  1C5H A;  3WQ7 A;  1YQC A;  1NOV A;  2EXJ A;  4AVB A;  1YRZ A;  3KQ4 B;  4YVS B;  4E4S A;  4AI1 A;  1ZVF A;  5JZG A;  2JKX A;  5JMC A;  2PTM A;  3E6B A;  4XZU G;  1H9W A;  4MGS A;  2DU0 A;  2W2I A;  2XR4 A;  1NAE A;  4AVC A;  1KXG A;  4QHB A;  1TVG A;  1VMF A;  3WXP A;  4FQ4 A;  4LIT A;  1RUE 2;  1N3O A;  5JOY A;  3UKT A;  4K7J A;  4LIV A;  5C3R A;  2ZEY A;  3N9Q A;  2VNG A;  3GF6 A;  1CAU A;  5LCW L;  5DMY A;  3T30 A;  5FK8 A;  2WN3 A;  1GR3 A;  1VRH 3;  2JXA A;  5KC5 A;  1JZ5 A;  1GZW A;  1R64 A;  3M3O A;  4I3P A;  3UET A;  4BME A;  2ETE A;  5CKN A;  4D7S A;  3KVB A;  3OJB A;  2FDJ A;  3MIC A;  1JYT A;  1NLQ A;  1SFN A;  2PQS A;  1LHO A;  1AYM 1;  3AKR A;  4AHZ A;  4DMI A;  4M3C B;  1W39 A;  2Z69 A;  1NQJ A;  5A7N A;  4Y20 A;  1UZZ A;  2DUR A;  4Q0P A;  4XFH A;  2W39 A;  2E7Q A;  2QQP A;  2ZGN A;  1DLC A;  5F3I A;  5T3N A;  4BQ4 A;  1Z7S 3;  1TQ5 A;  4DXT A;  2AEZ A;  2C1F A;  3WZ1 A;  2B39 A;  1ZA7 A;  4YW5 A;  4DQA A;  5I8T A;  1H4G A;  1WW5 A;  4P9Y A;  1QJY 2;  2ZMK A;  2ENR A;  1S0I A;  2V5Y A;  1C28 A;  1AR8 2;  2D43 A;  3DN7 A;  2RG4 A;  4BQ1 A;  4LKD A;  4GB3 3;  5A7Q A;  4LMF A;  3HNM A;  4HKW A;  3RMY A;  2QQV A;  1W6O B;  2ZAC A;  3TEZ A;  1L7L A;  3U0Z A;  4TZD A;  1QJZ A;  2B9U A;  1R1A 1;  2ES3 A;  3AKS A;  2XKP A;  1UY0 A;  3T0A A;  3PU8 A;  2CY6 A;  2OQ7 A;  1OF4 A;  1J59 A;  4FTS A;  5IVY A;  5FPB A;  3AP4 A;  2TUN A;  2BOI A;  1E5S A;  1LHW A;  3HT1 A;  4JZR A;  4MO3 M;  4XFI A;  3DEC A;  3PDQ A;  2IXI A;  5K0U A;  5SV5 A;  3V64 A;  5CBL A;  3LD8 A;  4PQ9 A;  1F9K A;  3FZ3 A;  2CGP A;  1V6K A;  4Q4W 3;  5IVJ A;  2YC4 A;  1IGO A;  2BZD A;  3IAP A;  4E27 A;  3L2H A;  2HWF 3;  3OSD A;  2YZ4 A;  2X5I A;  2VOW A;  5FLJ A;  4JGZ A;  2LTN A;  3ZYP A;  1J84 A;  3HNB M;  4XCA A;  4LOS A;  2OUH A;  2PN5 A;  3A21 A;  4KU7 A;  4QB6 A;  4JDO A;  2CTV A;  2UY8 A;  2VZ3 A;  1WCU A;  1CON A;  3FL7 A;  3VBO B;  3WHT A;  3TBD A;  3FLT A;  3KHB A;  4C91 A;  2ZA9 A;  3FJS A;  4CDW C;  5IFT A;  1X9T A;  3WNM A;  4OUE A;  5FUN A;  3H1M A;  3NO8 A;  3N3H A;  4Z2W A;  2ZJC A;  4M0H A;  4LBK A;  5FYC A;  5IHR A;  4COY A;  3BGA A;  2JG8 C;  3J7M A;  5AC9 3;  4U36 A;  2I07 B;  5HCB A;  1OA2 A;  1QJU 3;  3I3D A;  1R1Z A;  2FQP A;  5CKQ A;  4KU8 A;  3AP5 A;  5FPV A;  5K7P A;  3SQO A;  3R0R A;  4MX3 A;  2XDV A;  3RI8 A;  1XNA A;  3UGH A;  4LA3 A;  3T2P A;  4B3N A;  2HWE 1;  1ULO A;  2VOV A;  3N7J A;  3OG2 A;  2XHN A;  5TSW A;  1M06 G;  2A6Y A;  1LHU A;  3ACG A;  3HOB A;  2VVE A;  3NV1 A;  3K46 A;  4LJH A;  4Q0V A;  2JE8 A;  1KJR A;  3I54 A;  5CAD A;  1FOD 2;  1QHD A;  2FDH A;  2OXB A;  4E2Q A;  1PO1 1;  4AI2 A;  4PLM A;  4HKL A;  3DKQ A;  2Y8K A;  2W95 A;  2XUE A;  4P00 B;  1W3X A;  1GNY A;  1PGW 2;  1Z7S 1;  5FCC A;  3WCR A;  5A6Z A;  3SIT A;  2MHF A;  4AVT A;  1BMV 1;  1AX2 A;  3URF A;  4FPY A;  2VUD A;  2OKX A;  4QDQ A;  2VCC A;  2LUW A;  5A3L A;  1VAK A;  2QNK A;  2HWD 1;  4Y1X A;  4BXS V;  4BLJ A;  4NHL A;  3I59 A;  1IZ3 A;  3NJV A;  5JMO A;  3NV3 A;  4KWJ A;  4S2H A;  1REE A;  2YFZ A;  1HRI 3;  2ZMN A;  2MEV 2;  2VNR A;  2D3R A;  1S0J A;  4PIX A;  1MQT A;  1O7F A;  3E5Q A;  3CZJ A;  5DUX A;  2WWU A;  1H8T C;  2J1T A;  3TN9 2;  1UYY A;  2HYK A;  1KFU L;  1W90 A;  1V6J A;  3QH6 A;  2DVA A;  4UFM A;  2JDK A;  1O4Y A;  2ZX4 A;  4Q4V 3;  4BPZ A;  5KHJ A;  4AL9 A;  3MBW A;  1LEM A;  3USU A;  3SIS A;  4AI0 A;  5FDB A;  3OUI A;  2ATF A;  3HQX A;  5APA A;  1QF3 A;  1H6Y A;  1BBT 3;  1WCK A;  2Y64 A;  1REF A;  1O6U A;  3EYP A;  4AF9 A;  3LAG A;  3ZSL A;  3AYD A;  1G9B A;  3CL1 A;  3NVC A;  2HWF 2;  4N90 A;  2B5H A;  5HI0 A;  5JR2 A;  2HBU A;  4YYO A;  2JDP A;  4R4Z A;  4DRR A;  4GWN A;  3T0D A;  2C24 A;  4M4P A;  1XPW A;  1UY2 A;  1UKG A;  1ULF A;  3AZY A;  4IV1 B;  4LE4 A;  2YGM A;  4YW3 A;  3ZSJ A;  4K3U A;  1X50 A;  1FV2 A;  4A3X A;  3WIN E;  1W6M B;  4NPM A;  5FZC A;  2FDF A;  5CA6 A;  3HQR A;  2W94 A;  4PF5 A;  1EUT A;  5FMB A;  2D7F A;  2ORZ A;  4M3C A;  2XPJ A;  2RS3 3;  1IQD C;  4H2A A;  2LW8 A;  2WT0 A;  5G04 L;  3NNJ A;  5A7O A;  2WQ4 A;  4YW1 A;  5LEK A;  1NUK A;  2ORX A;  3ENR A;  3LSD A;  1SBD A;  1RMU 1;  3CF6 E;  5A7W A;  4LBQ B;  3AMM A;  3N9M A;  1CX1 A;  1O5U A;  3VBR B;  5J36 A;  4PDW C;  1EUU A;  1MZF A;  1ZBE 1;  2XVL A;  1POV 0;  4L99 A;  3BPS A;  3FUQ A;  3VD3 A;  4ZS3 A;  1R08 1;  4RS5 C;  4UWD A;  4Y22 A;  5I8S A;  3VL8 A;  3O1V A;  2JX9 A;  2WO2 A;  3I2J A;  5D21 A;  4YZ4 A;  5JXJ A;  4YVS A;  5LRS A;  2GAL A;  1W9Y A;  1GYK A;  2PXJ A;  3N9O A;  1PVC 1;  3MHZ A;  2EXI A;  1HDK A;  1VBB 2;  3ECQ A;  3VDD C;  4FSJ A;  3ST7 A;  4JQT A;  5D2A A;  4E8C A;  1VBA 3;  3ZM8 A;  4LIU A;  5DAQ A;  4HN1 A;  1W2T A;  1SLL A;  3KQR A;  3BTZ A;  4N43 C;  4QD2 A;  4CCE A;  2Z2S B;  1MZE A;  2XHK A;  4HT1 T;  1YQ2 A;  2Y6G A;  2R04 1;  4NWW A;  4O65 A;  2JG9 C;  2C0Z A;  4X6Q B;  1W04 A;  5JWP A;  1HB3 A;  1WKY A;  2XL9 A;  3POE A;  5E16 A;  5FP8 A;  4AVS A;  2OT7 A;  2ZS6 B;  3ZN6 A;  2V73 A;  4UFI A;  3BCW A;  5FZI A;  5J7M A;  3WG4 A;  2RVA A;  1JYN A;  1BBT 1;  1ODM A;  1OH3 A;  4TSV A;  2E51 A;  3WW4 A;  3WW3 A;  2R07 3;  3A23 A;  5C6C A;  4L92 A;  1GOH A;  2GNM A;  2A70 A;  3MFC A;  4OUL A;  4GJZ A;  4AOC A;  1PNG A;  4PCR A;  1GWK A;  1GQP A;  4LO8 A;  1D0H A;  2D6N A;  4WM7 B;  3ZYJ B;  4XUQ A;  2J1A A;  4UT5 A;  1VBC 1;  1RJ7 A;  2R06 1;  1F31 A;  2GSY A;  2RJL A;  4XIL A;  2CWM A;  2D40 A;  4L9B A;  3ZYB A;  4LO4 B;  4CEW C;  2BNN A;  3WP5 A;  1V6I A;  2H6B A;  1NCR C;  4IQP A;  3PUR A;  3RYK A;  2P3Y A;  5FY5 A;  5K0U B;  1AYN 2;  3BIW E;  3ZFE A;  4RGG A;  1ULG A;  1LJ7 A;  3IMM A;  2RS3 2;  4ONU A;  5A1L A;  1NKG A;  2XJQ A;  4QM8 A;  3KMH A;  2DVD A;  5IW0 A;  4AAX A;  4YZ3 A;  1DU3 D;  2WT2 A;  4XFA A;  5LRR A;  2XWJ B;  4GD4 A;  4WM8 C;  4E8D A;  2D6O X;  3THD A;  4XAE A;  5F39 A;  1RUO A;  2FCU A;  4Q0S A;  4XEZ A;  3C8X A;  2HBT A;  5T52 A;  4Q4V 2;  4XXA A;  1OPO A;  2RS1 1;  3IWZ A;  4OHX A;  4MGY E;  4IDZ A;  4CDU A;  2VOX A;  5J3U A;  1ZM1 A;  3Q8C A;  1SDD B;  2GC2 A;  2ZZJ A;  3ZFG B;  3PME A;  2MEV 3;  2FD8 A;  2ARA A;  4K21 A;  5FZ3 A;  1I3H A;  2WNE A;  4TLG A;  1ND2 C;  4FT8 A;  4CXW A;  3T1L A;  4KQ7 A;  4AI9 A;  5GLU A;  3BTA A;  3RNS A;  2D98 A;  4UW4 A;  4FOV A;  4IEU A;  1E57 A;  1W6M A;  3P6B A;  2J1E A;  2NQY A;  1WME A;  1YFX A;  2C26 A;  2VGD A;  3H8R A;  5C4W B;  3DYO A;  4B4R A;  1OA4 A;  4HVO A;  1PO1 2;  2E7T A;  1GWL A;  2BER A;  4WBB A;  1OOP B;  4IW3 A;  1EPW A;  1VAL A;  4QQL A;  1TZO A;  3U07 A;  4DEQ A;  3O12 A;  4V1P A;  4B8E A;  3TB0 A;  2WZR 1;  4Q4V 1;  5DZG A;  5EQU A;  2VR4 A;  5FZA A;  1HB1 A;  1XB9 A;  4MH0 E;  3UGG A;  3ZN5 A;  1UOJ A;  4N53 A;  1X9P A;  4FOY A;  5GZC A;  5FZ4 A;  4QX1 A;  2Q0A A;  4QGM A;  4XF3 A;  2YBS A;  1PHM A;  1PO2 2;  2WRA A;  3ILN A;  3OTF A;  4XE9 A;  4YW2 A;  3VBH C;  2R16 A;  3QCW A;  4NHX A;  1OOP C;  1OBN A;  2VZU A;  3TEX A;  1AJO A;  4EWA A;  1FMD 1;  3IBM A;  4H55 A;  2W47 A;  3HEI A;  4E2G A;  2WNV C;  4JGZ C;  4BQ5 A;  4XOG A;  5ERL A;  4ARY A;  1W0O A;  2W5F A;  3WEZ A;  2CDP A;  3OYW B;  4A44 A;  3MEP A;  4H3W A;  3GYD A;  1FV3 A;  1RUC 1;  1UF2 C;  4UW6 A;  2ZGP A;  3C3V A;  2WBK A;  3VBH A;  2XKO A;  1PX3 A;  3ILF A;  5JVV A;  1AF9 A;  3NAP A;  4CP1 A;  1K5M A;  1PK6 C;  4JRL A;  4CP0 A;  1DCS A;  3LOB A;  2XQR A;  1PIV 3;  2CGN A;  3POG A;  2ZBJ A;  1R09 2;  1RUI 2;  2MPF A;  2VZ1 A;  3KF3 A;  1JYI A;  4GMP 0;  2DCY A;  2WAO A;  3LPG A;  2A6X A;  1LOE A;  2WSV A;  4JHZ A;  4XF9 A;  3K4D A;  1XOY A;  3ES4 A;  2W1Q A;  1OUX A;  3LIH A;  2XML A;  1UN1 A;  3CKH A;  3LDR A;  1K5M C;  1PZ7 A;  1HV0 A;  1DQ5 A;  4PBO A;  2XJR A;  5DAX A;  4RSU A;  5LEJ A;  3I2O A;  1H2K A;  1VIW B;  1VAV A;  2UWC A;  2GNB A;  4NRP A;  4FOQ A;  4EYU A;  2E32 A;  1HXS 2;  2JEM A;  2DUQ A;  4BM8 A;  4GB3 2;  2VNV A;  3CEW A;  3MF6 A;  4LPL A;  2VZV A;  2AC1 A;  1FPN 3;  1QJY 1;  1RMU 3;  1CWP A;  1RUF 1;  4YVW C;  4OYU A;  2XBO 2;  1JZ8 A;  1YLL A;  4BA6 A;  4J6G A;  1CAX A;  5HCH A;  1HW5 A;  1W8U A;  1ZZC A;  1A6C A;  4G4F A;  2QQM A;  1OKO A;  2ZX1 A;  4HAN A;  2CSG A;  4YM0 A;  2ZGS A;  1QEX A;  3B69 A;  2G4I A;  1V6L A;  4CDX A;  4W4Z A;  2W92 A;  3MPP G;  4NRO A;  5CAZ A;  1R08 2;  5A32 A;  2C5D A;  1VAM A;  3QBQ A;  5A6Y A;  1AYM 2;  1J3R A;  3Q8B A;  5KXD A;  1GMM A;  1KRI A;  3MIE A;  5A1F A;  3AYE A;  3H3L A;  1MQT C;  1TMF 1;  2NZ9 A;  2NLR A;  1H8T A;  2WNV B;  3LDK A;  4UF0 A;  3VDA A;  4AEJ A;  2E31 A;  3LZZ A;  5EXO A;  4XHX A;  4CDX C;  4IEY A;  4KWU A;  3HD8 B;  3I2F A;  4ZXE A;  5CKM A;  5FPU A;  1MVQ A;  4LO5 B;  1PMJ X;  2RMU 2;  4JC1 A;  4AHW A;  1W8W A;  2JDU A;  1JYX A;  1Y9M A;  2OW4 A;  3KCY A;  1XYO A;  3B00 A;  1GP5 A;  1HX6 A;  4W6Y A;  4Q1R A;  1TME 3;  1UX6 A;  2ZHM A;  2XB6 C;  5IVF A;  4I01 A;  3RZL A;  5L9R A;  5BNN A;  4Q4W 1;  1WLT A;  5CFC A;  1OFS A;  1ZA4 A;  1UX7 A;  4QWN A;  3VUO A;  3USS A;  5IWF A;  3ZFE B;  2IXL A;  5JZG C;  2VZR A;  3GZE A;  3M2M A;  1VRH 2;  4QB1 A;  2JG8 B;  1JZ4 A;  2XXZ A;  1UY3 A;  1ZRF A;  4MXW B;  2TBV A;  3VDD B;  1M4W A;  1BJQ A;  3SH4 A;  1PNF A;  2HWB 3;  3OEA A;  4XC9 A;  4XJA A;  2QJV A;  2VJX A;  3T0B A;  1MS0 A;  2XGX A;  1ASJ 2;  3J8F 3;  3LGR A;  2I45 A;  3TRS B;  1W9T A;  2ZGU A;  5DUW A;  3N9L A;  3H1W A;  3O0W A;  1US2 A;  3MLJ A;  3AP7 A;  3OGS A;  3ZXK A;  4W6X A;  2J1S A;  2DCJ A;  5FMO L;  1VBE 1;  2O8Q A;  3IDC B;  5CU1 A;  2D3S A;  1OPM A;  3DEM A;  3JXS A;  3ZR5 A;  4HK9 A;  4JGY C;  2F17 A;  2WO7 A;  4IEV A;  2XLA A;  3HN1 A;  3VD7 A;  5JSP A;  1DYO A;  4OHW A;  4RQP A;  4Z1V A;  4UFK A;  4O9G A;  5FYY A;  4UBG A;  2EVX A;  3FBM A;  4ZZ5 A;  4O61 A;  1XNC A;  5B2G B;  3BB6 A;  5L36 A;  1Y4W A;  1W2N A;  4FPG A;  4MOA A;  5T5L A;  1TNF A;  1YEW A;  1ND3 A;  1CES A;  1QIQ A;  2D6L X;  5DUU A;  3TNQ A;  1BMV 2;  1GLH A;  1QOO A;  2VBD A;  4RQP C;  4A7Y A;  5DXD A;  5I93 A;  2GMP A;  3SHR A;  1IS4 A;  1A34 A;  2RS5 2;  1NCR B;  3MIB A;  3ZO0 B;  1FOD 1;  3FUO A;  4CPB D;  2FDI A;  3HPN A;  2R30 A;  2PHU A;  4IUG A;  4NE9 A;  3R05 A;  2JG9 A;  1DP0 A;  1S2K A;  2VOT A;  1MR5 A;  1WBF A;  3H0O A;  3IAQ A;  1V9U 1;  3LA7 A;  3MLL A;  4TWT A;  5F5C A;  1FAT A;  4DUV A;  1YJL A;  4LBQ A;  3RVH A;  5EZW A;  3JBG 2;  1NYW A;  1WWY A;  3VBR A;  1G6N A;  3OD4 A;  4GWI A;  3UKV A;  4GB3 1;  2KXL A;  2D6P A;  3ZKU A;  5DAW A;  1ZZ8 A;  3BI3 A;  3N36 A;  3ON7 A;  4Y3O A;  1JUI A;  1D0G A;  3WNL A;  4WVM B;  4QX2 A;  3WF1 A;  1ZYB A;  2DTY A;  2YC0 A;  4RQP B;  2NYY A;  4WM7 A;  4MVT A;  5JDB A;  2KD7 A;  2ZHN A;  3A0K A;  1V9U 3;  4XPV A;  2GP5 A;  3MUY 1;  4GH4 C;  5H9R A;  1CAW B;  3RMX A;  4MAD A;  2X8K A;  3AP9 A;  3B01 A;  2X5I C;  3WDW A;  4BCU A;  1GP4 A;  2YBK A;  2K0G A;  5CFC B;  2W08 A;  3NW4 A;  4QQP A;  1NY7 2;  5A3T A;  4JTN A;  1KQR A;  3KS7 A;  5T5J A;  4HZF A;  1FI2 A;  2A75 A;  3ZFE C;  2YU1 A;  1W2O A;  2YPD A;  3GBG A;  1O8S A;  3I2I A;  4XHB A;  1IS5 A;  4HL0 A;  1RHI 2;  4F7Z A;  2WR9 A;  1SLC A;  3B3Q E;  4RR3 A;  2LRO A;  5FZG A;  1UZ0 A;  2OVU A;  3MFA A;  1WBL A;  4QKB A;  1WZX A;  2WWJ A;  1UY1 A;  1CZT A;  3N9P A;  4Q4X 2;  3ZOI A;  1ZBA 1;  3M4F A;  4OMC A;  5FJH A;  4XUR A;  1POV 3;  2A3Y A;  2W1U A;  2DYC A;  1S4C A;  3U14 A;  4EN0 A;  5F32 A;  4NID A;  1RIR A;  4ZY9 A;  3HJR A;  3MV1 1;  5FYM A;  1IG3 A;  3J7N A;  3O0V A;  3CZU A;  3POJ A;  4MYE A;  3GAL A;  2ADD A;  5AFB A;  2JB4 A;  3NST A;  3OD0 A;  3OGJ A;  1OSG A;  1OHF A;  2ZGR A;  5ABJ B;  1JOD A;  3VBU A;  3ZYH A;  1H1I A;  5GLV A;  3CNA A;  3C2U A;  1VJ2 A;  2EAK A;  3APB A;  3LEK A;  5L19 A;  1W8O A;  2BDR A;  1EV1 2;  1JMU B;  2WZR 2;  3AVR A;  2IXH A;  3RZH A;  1ND3 B;  1Q56 A;  1HN0 A;  3B9I A;  1SMV A;  3WDY A;  3GM8 A;  3IMN A;  1OXC A;  1R08 3;  2ZGL A;  4IEQ A;  4M00 A;  4Z82 A;  5FZ7 A;  4URA A;  5HCA A;  2GZW A;  4HSL A;  3O1R A;  1AVB A;  2EA7 A;  2N7G A;  4CPB A;  1W6N A;  1CPM A;  2QUO A;  5I0S A;  1UZV A;  2R6Q A;  1Y3T A;  2IXK A;  2QQN A;  2B8M A;  3FWE A;  5FZK A;  3O14 A;  1BXH A;  2CAU A;  4AG4 A;  4DFS A;  1OVS A;  1PM4 A;  5I0T A;  2F4P A;  4OI1 A;  3AMH A;  4Q8L A;  4QU2 A;  3RDI A;  3GCW A;  3WY6 A;  5AFE A;  1RHI 3;  2HEW F;  4P9L A;  2HWC 1;  5BNP A;  3T2T A;  5IK5 A;  5CIR A;  2VZT A;  1W03 A;  4HVR A;  5I8Y A;  4RGA A;  2WO1 A;  5FJK A;  1ULC A;  1HKD A;  3CU7 A;  4RHV 3;  4XMA A;  4CU9 A;  1XXN A;  1N3Q A;  3ETP A;  3OPZ A;  3NJX A;  4R9B A;  2JEN A;  2PHF A;  2BV4 A;  1ALY A;  2HWB 1;  3MIH A;  1AL2 1;  4M01 A;  5A3U A;  3JQX A;  2VL4 A;  3MDP A;  1OOP A;  3KM5 A;  4JKK A;  1HN1 A;  2F6B A;  3CIH A;  5FUI A;  2W91 A;  3F95 A;  4F8A A;  1DQ1 A;  3KD4 A;  2JDH A;  3K4Z A;  3ATG A;  2C6S A;  3IDA A;  4IET A;  3HBK A;  1MZ6 A;  2P37 A;  5FZF A;  3FE5 A;  2BNM A;  5IVV A;  2QKD A;  4XFB A;  4NHM A;  3ZXJ A;  3RZG A;  3ZXE A;  1RUC 3;  3ZSE A;  3C7G A;  4CSW A;  5EYY A;  3VHO A;  2SBA A;  5BNO C;  4V2V A;  5IK7 A;  1QWR A;  2X09 A;  3T09 A;  1NCQ A;  2GC3 A;  3AMQ A;  1UAI A;  1DGR A;  1XYP A;  3UES A;  1Q5O A;  5DDJ 2;  1W6O A;  3B5L B;  1SFP A;  1JYW A;  3D82 A;  3NNM A;  3WW2 A;  2W46 A;  1W8H A;  1UNB A;  1WA6 X;  4A7Z A;  4CDU B;  3N7K A;  2YDE A;  2UWB A;  4YFZ A;  4XJ9 A;  1OMI A;  4ASL A;  5HPO A;  4A6O A;  5JAX A;  1PIV 2;  2D3P A;  3I59 B;  2E63 A;  4NRM A;  3VBH B;  3WQ0 A;  2DVF A;  4C1X A;  1HRI 1;  3VD5 A;  1AXZ A;  2GME A;  1J58 A;  1EV1 1;  3MI8 A;  5SV8 A;  2WZ8 A;  1A3K A;  1RUD 2;  2AR6 A;  5F3C A;  2ZHK A;  1O8P A;  3JD7 3;  2W1W A;  3TNP B;  5FZH A;  2FCV A;  5FPL A;  3WG1 A;  1XC6 A;  2DVG A;  3S5A A;  1DYP A;  3WF3 A;  3DPR A;  2QE3 A;  3C7H A;  3VBS A;  3GZA A;  4Z8B A;  4ISQ A;  5JXI A;  4UFJ A;  4Y1V A;  3I8T A;  2IUW A;  2X10 A;  3I2H A;  3JUU A;  3LKJ A;  1XNK A;  5EFU A;  5GZG A;  1EP0 A;  3LF7 A;  1YC6 1;  5C4W C;  2R0F A;  1SBF A;  3AX4 A;  1YIF A;  4IV3 B;  4X6R B;  5FZ9 A;  3PLQ A;  3VDD A;  4EWE A;  2RHP A;  1SFY A;  5EHD A;  3ZFG A;  4G9S B;  2DCZ A;  1UOF A;  2NMN A;  3VL9 A;  2PQQ A;  2VMI A;  2VCB A;  4IER A;  2QQU A;  1I9R A;  1JW6 A;  5F1R A;  3MW2 A;  2C9A A;  3AZW A;  4IGP A;  4B7E A;  2A7A A;  1D4M 2;  3NL1 A;  4FTE A;  1PVC 2;  4DIQ A;  4AGR A;  5JIA A;  3OGG A;  5BNN B;  1CZS A;  2DVB A;  1KD7 A;  4DXS A;  1DQ0 A;  4KBZ A;  3WD5 A;  3OBT A;  5T5O A;  1JZ2 A;  3WNP A;  2R07 2;  1ZBE 2;  2PHL A;  3BTY A;  1ST8 A;  1BEV 2;  2W9X A;  1ZRI A;  4XJZ A;  2GH2 A;  3FHQ A;  5FYI A;  4MXW A;  3AFG A;  4YW7 A;  5C3O A;  4GIQ A;  2J7M A;  5I0R A;  1Y9G A;  4FFF A;  5CIS A;  3KF5 A;  5LK5 A;  4B7K A;  1AL0 G;  1LHV A;  1DBN A;  1ZZ9 A;  4GAZ A;  3I49 A;  1Q8S A;  3RRD A;  1MS5 A;  3EXU A;  5FY8 A;  1QNW A;  1GUI A;  3K3O A;  4X8N A;  4ZPI A;  5CFC C;  5GZD A;  2ZML A;  4CCO A;  3VZK A;  1ZRR A;  1NCR A;  5ANQ A;  1V9U 2;  3LQC A;  2Y0O A;  5KBF A;  5LW9 A;  2Q8D A;  2R1D A;  1W8N A;  3NKT A;  1ODN A;  5A7S A;  1W6Q A;  2VH9 A;  1LOD A;  4OI2 A;  1FPN 2;  5FZB A;  2UY9 A;  5HXV A;  3JU9 A;  3RPQ A;  2P3J A;  2W1S A;  1LNS A;  2DWR A;  4BIF A;  5T54 A;  1G9F A;  5DPN A;  3H8X A;  4WM8 A;  2MNG A;  5L73 A;  3WR0 A;  2WII B;  4URT A;  3J7L A;  1LOB A;  1WCS A;  3RGB A;  2NP0 A;  3K2O A;  4NJ4 A;  3JCI A;  5IAV A;  4AQ6 A;  5FO8 B;  1UXX X;  3VKM A;  1UY4 A;  2WWS A;  4FXK B;  3WNO A;  2FDG A;  5A80 A;  1RUF 3;  1J1T A;  5CVR A;  2WL1 A;  3U1X A;  3WX5 A;  2E9Q A;  5FWE A;  1G9D A;  3I2G A;  3AL5 A;  2FZ1 A;  5F2W A;  2VUA A;  3MUZ 1;  1OFN A;  3RQ0 A;  4COU A;  5AC9 1;  2K2S A;  2BQP A;  2YV8 A;  5CFD B;  1QH6 A;  2DDU A;  2RJ2 A;  5BNP B;  4CEY A;  5EIY B;  3LOI A;  3O1S A;  4FP3 A;  3HIF A;  1G86 A;  4N43 B;  1ND3 C;  3LA3 A;  5FY0 A;  3OY8 A;  3FLP A;  2MEV 1;  4HXC A;  1RUH 3;  4W65 A;  3UJQ A;  4AEK A;  2XUM A;  4K8F A;  4I3G A;  4JGZ B;  5LZ6 A;  4NN0 A;  1YYN A;  4ZZ8 A;  1RJ8 A;  1H2N A;  3D0J A;  1PGL 2;  1GBG A;  2XWB B;  1QJE A;  2XVG A;  1N1S A;  4A3Z A;  3IPV A;  4EN9 B;  1S0B A;  1UPI A;  2K9Z A;  2XJP A;  1MEC 1;  4L8Q A;  4XFC A;  5FMO S;  2J42 A;  3WDX A;  4AEM A;  4Z2A A;  3I7D A;  1GQG A;  2QFE A;  5DAB A;  5LY1 A;  2XLG A;  4DOU A;  4LUM A;  4FPE A;  1LHN A;  1QDC A;  4QPG A;  3USU B;  4IV3 C;  5DZE A;  1GNH A;  5FZO A;  3PUI A;  4W8J A;  4N53 C;  1QJX 3;  3VBR C;  5ACA 2;  1RVF 3;  2VXJ A;  5GLW A;  5F3G A;  3AMN A;  4PLN A;  4XUN A;  1OLM E;  1SCR A;  3ZXD A;  1V00 A;  5L7O B;  2G9G A;  1RXG A;  1W8F A;  2DF7 A;  1YI7 A;  1F8V A;  4NR1 A;  5A7P A;  5FO9 B;  5AVA A;  4SLI A;  4R8H A;  1OUS A;  2RR1 3;  2RMU 1;  1UMI A;  2IVI B;  3I97 A;  4XUP A;  4G3Y C;  2BWC A;  4B1M A;  4DIN B;  2L9L A;  1DF0 A;  2C9K A;  2RE9 A;  2YUE A;  4EZH A;  3H8O A;  5I0U A;  2ZGM A;  3I2K A;  4LBQ D;  1Q8Q A;  2BVB A;  1S2B A;  3HR9 A;  2V5D A;  1DQ4 A;  4R4X A;  4XVH A;  4YPJ A;  4FXG B;  5K8S A;  3VBF A;  3CO2 A;  2XJV A;  2JDZ A;  2RMU 3;  2R07 1;  3ZYG A;  4P9W A;  4XF4 A;  4BK4 A;  4DB5 A;  3E97 A;  4XBN A;  3ZN6 B;  3EQE A;  5A1A A;  1S1A A;  3B9C A;  2LAL A;  4CDW A;  2XJU A;  1SZB A;  4JKL A;  2VW2 A;  3SC7 X;  2UYB A;  4LKS A;  3D6E A;  2XVK A;  1I5P A;  1LES A;  2JDA A;  2ARX A;  3ZIX A;  1UL9 A;  1S55 A;  3CLP A;  4KL1 A;  5EJ3 A;  2C4X A;  2X5I B;  5BUV A;  1G7Y A;  5C70 A;  2BYV E;  2I74 A;  4CU8 A;  3POI A;  3VBU C;  4YGE A;  4BWO A;  1SDW A; 
#chains in the Genus database with same CATH homology
 3CKH A;  3OGV A;  1JZ6 A;  3IB3 A;  3UNP A;  1GU3 A;  2RV9 A;  4A45 A;  1K45 A;  2E32 A;  2VMD A;  3HN3 A;  4LPL A;  3A7Q A;  2VZV A;  2J1U A;  4LHS A;  1JZ8 A;  4OYU A;  4CU6 A;  2Z4F A;  1H6X A;  1JHJ A;  1CZV A;  4A4A A;  5LA2 A;  2QQM A;  4LQR A;  1UMH A;  2XOM A;  4W4Z A;  2W92 A;  2QBX A;  4QPW A;  5J1X A;  2VO5 A;  1TG7 A;  2WAA A;  1MPX A;  1GMM A;  3CQO A;  3GDB A;  3SEP A;  1BHG A;  2VMF A;  3NNG A;  2YG0 A;  2DCK A;  3VDA A;  2E31 A;  3LE0 A;  4KWU A;  3I2F A;  4ZXE A;  4FI9 A;  1PMJ X;  3WQB A;  1US3 A;  1JYV A;  3VDB A;  1D7P M;  4PF1 A;  1JYX A;  5DN2 A;  2E26 A;  1UYZ A;  5JXG A;  2BBA A;  1F4H A;  4BJ0 A;  4XUT A;  5LA0 A;  3MV0 1;  1W9S A;  2VZQ A;  2QQI A;  1UX7 A;  5B4N A;  1GOF A;  2VZR A;  3THC A;  4QB1 A;  3FN9 A;  2QQL A;  5IJR A;  1JZ4 A;  1UY3 A;  1OH4 A;  4ARX A;  4BK5 A;  2V72 A;  3OEA A;  5CYY A;  2VJX A;  3T0B A;  2WN2 A;  1W9T A;  2VQT A;  3OGS A;  1US2 A;  2JKX A;  2ZEZ A;  3HNY M;  2J1S A;  2DCJ A;  4XZU G;  4MGS A;  1NAE A;  3K75 B;  2LS6 A;  1JI6 A;  1TVG A;  4D0Q A;  3JXS A;  2WAB A;  3VD7 A;  1DYO A;  2ZEY A;  5LCW L;  5DMY A;  1KEX A;  2WN3 A;  1GOG A;  4ET7 A;  1JZ5 A;  1R64 A;  4DEV A;  4ZZ5 A;  3UET A;  4MOA A;  2PQS A;  4UOJ A;  4JKM A;  1UYX A;  3WF4 A;  4CVU A;  4MGQ A;  3HPN A;  1UXZ A;  2WYS A;  1DLC A;  4IUG A;  2VTF A;  1DP0 A;  2VOT A;  4DXT A;  3IAQ A;  4DUV A;  2VC9 A;  4QX3 A;  2WQ8 A;  4GWI A;  1SG3 A;  2Y6L A;  5G05 L;  4DXR A;  1L7Q A;  3WNL A;  2BGP A;  2VCA A;  3HNM A;  3I3E A;  4QX2 A;  3WF1 A;  2KD7 A;  3C7O A;  3T0A A;  3DYP A;  1UY0 A;  4TXW A;  3MUY 1;  1OF4 A;  3E1F 1;  4MAD A;  4CUC A;  4MO3 M;  4HG6 B;  3D3A A;  3DEC A;  1F4A A;  1ULP A;  1W9W A;  2YC4 A;  2BZD A;  3IAP A;  5I0D A;  3I2I A;  1O8S A;  2Y6J A;  1J84 A;  3HNB M;  4DUX A;  1JU4 A;  4QB6 A;  3A21 A;  1UZ0 A;  3NRU A;  2VZ3 A;  3FL7 A;  1UY1 A;  1CZT A;  3T2O A;  3ABZ A;  3I3B A;  4JX0 A;  4OMC A;  5IFT A;  4XUR A;  3WNM A;  4OUE A;  2W1U A;  1T2X A;  2R7E B;  4ZY9 A;  4RYD A;  2EID A;  5IHR A;  2Y6K A;  3HJR A;  3MV1 1;  2EIB A;  3BGA A;  3OB8 A;  4KMQ A;  3CZU A;  3I3D A;  4QDR A;  2WO3 A;  1K12 A;  2BGO A;  3WNN A;  5JUV A;  1XNA A;  4OZO A;  3T2P A;  3LEK A;  1ULO A;  1W8O A;  3OG2 A;  2VME A;  2XHN A;  3SKJ E;  3ACG A;  3HOB A;  2HLE A;  3GM8 A;  3K46 A;  2JE8 A;  4UAP A;  2VZO A;  5C71 A;  4UI9 L;  5HXM A;  4P02 B;  2QQK A;  2Y8K A;  2QQN A;  3ACH A;  2W95 A;  4P00 B;  1GNY A;  2WUH A;  4AG4 A;  2W3J A;  3FHA A;  3W5N A;  2V4V A;  2OKX A;  2W87 A;  4QDQ A;  3T2Q A;  2VCC A;  4DUW A;  2VZT A;  4BXS V;  2WO1 A;  3EB7 A;  3NJV A;  5JMO A;  4CU9 A;  3ETP A;  1P8J A;  2YFZ A;  3NJX A;  3WF0 A;  2XON A;  2EIE A;  3AC0 A;  3CZJ A;  5EJZ B;  2VL4 A;  2J1T A;  4JKK A;  1HN1 A;  1UYY A;  3CIH A;  5FUI A;  4CUB A;  4CU7 A;  2W91 A;  3K4Z A;  3IDA A;  3SKV A;  3MBW A;  1SHW B;  3WF2 A;  1JZ3 A;  3LEI A;  2VQU A;  3J7H A;  4QAW A;  3C7G A;  1H6Y A;  3C7E A;  2Y64 A;  2X09 A;  3EYP A;  3DYM A;  3T09 A;  4PQQ A;  3UES A;  4PT6 A;  4BDV B;  5JR2 A;  5B4X A;  1JYW A;  3VDC A;  3K77 A;  2W46 A;  3T0D A;  4M4P A;  1XPW A;  1UY2 A;  1PMH X;  3U37 A;  5HPO A;  1L7R A;  4A6O A;  4W50 A;  3VD5 A;  5LA1 A;  1JZ7 A;  2WZ8 A;  2W94 A;  4TTG A;  1EUT A;  2ORZ A;  4QX0 A;  1O8P A;  2W1W A;  1IQD C;  2LW8 A;  3OEB A;  1XC6 A;  2J1V A;  5G04 L;  3WF3 A;  3C7H A;  5JXI A;  1W0N A;  2VMC A;  2QQO A;  2X10 A;  4L0P A;  1NUK A;  3I2H A;  2ORX A;  4A41 A;  5JXH A;  3K4A A;  1K3I A;  1CX1 A;  1K42 A;  1EUU A;  1KGY A;  3VD3 A;  1RYY A;  1O59 A;  2Y6H A;  2WO2 A;  3I2J A;  5JXJ A;  2VCB A;  4M4R A;  3OGR A;  3P1I A;  3LPF A;  2VZS A;  2VZP A;  4P5Y A;  3ECQ A;  4E8C A;  3ZM8 A;  1CZS A;  4DXS A;  1OT5 A;  1JZ2 A;  1NX9 A;  3GGL A;  3WNP A;  2W9X A;  1YQ2 A;  2Y6G A;  3FHQ A;  3VD4 A;  2J7M A;  1WKY A;  2HYX A;  2B4K A;  3III A;  4KI5 M;  2J1R A;  1XNT A;  1OF3 A;  3W5M A;  1GUI A;  2RVA A;  4P08 A;  1JYN A;  4A42 A;  2YB7 A;  2ZEX A;  3A23 A;  1GOH A;  3LQC A;  1WCQ A;  1W8N A;  1GQP A;  4XUQ A;  2J1A A;  4QDS A;  2W1S A;  1LNS A;  5DPN A;  4CUA A;  2J22 A;  2WDB A;  3SEE A;  1UXX X;  1NKG A;  3A22 A;  1UY4 A;  3ACF A;  4AAX A;  3WNO A;  2YC2 A;  4D8M A;  2QQJ A;  3I2G A;  4E8D A;  4RN5 A;  3MUZ 1;  3THD A;  4GWJ A;  3C8X A;  3PUH A;  2DDU A;  3WNK A;  2RJ2 A;  5EIY B;  2YFU A;  4QB2 A;  2ID4 A;  2JD9 A;  2E33 A;  1CIY A;  1SDD B;  2ZEW A;  4ZZ8 A;  4A3Z A;  2EIC A;  4Z2A A;  3GXU A;  3CMG A;  1OD3 A;  3CDZ B;  3P6B A;  1J83 A;  2J1E A;  2B9V A;  2C26 A;  3PUI A;  4W8J A;  3DYO A;  3VD9 A;  2BER A;  2CDO A;  4XUN A;  1W99 A;  4DEQ A;  5F7U A;  3LEG A;  2ZXQ A;  5IFP A;  2VR4 A;  1PX4 A;  3F2Z A;  1UMI A;  3ACI A;  1UWW A;  3I97 A;  4XUP A;  4QX1 A;  4GZ9 A;  2L9L A;  2C9K A;  5IYY A;  3I2K A;  5DQ0 A;  4XUO A;  5C7G A;  2V5D A;  2VZU A;  2XQX A;  4OMD A;  4XVH A;  4YPJ A;  3WSO A;  2W47 A;  3HEI A;  3C7F A;  4ARY A;  5EJ1 B;  2W5F A;  3WEZ A;  2CDP A;  3NQH A;  5CZK A;  2VM9 A;  2X05 A;  4A44 A;  4BK4 A;  1JU3 A;  2WBK A;  3OBA A;  5A1A A;  3MO4 A;  3BN6 A;  1PX3 A;  4JKL A;  3T08 A;  4LKS A;  1I5P A;  2JDA A;  2VZ1 A;  2C4X A;  5C70 A;  2WAO A;  3LPG A;  4JHZ A;  2WZE A;  4CU8 A;  3K4D A;  2W1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...