2BGPA

Mannan binding module from man5c in bound conformation
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
116
structure length
116
Chain Sequence
SWTYTAASASITAPAQLVGNVGELQGAGSAVIWNVDVPVTGEYRINLTWSSPYSSKVNTLVMDGTALSYAFAEATVPVTYVQTKTLSAGNHSFGVRVGSSDWGYMNVHSLKLELLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-B1,4-MANNANASE 5C
publication title Structure of a Mannan-Specific Family 35 Carbohydrate-Binding Module: Evidence for Significant Conformational Changes Upon Ligand Binding
pubmed doi rcsb
source organism Cellvibrio japonicus
molecule tags Carbohydrate binding protein
total genus 12
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2bgpA00
5A1AA 2C9KA 4A45A 1DYOA 1W9TA 4QB2A 1L7RA 2E33A 2W46A 5G05L 1NX9A 2W9XA 4E8DA 1JZ3A 2B9VA 4XUOA 3J7HA 1GNYA 3JXSA 5IFTA 5EJZB 3VD9A 5IHRA 2W87A 4BXSV 1CZVA 3T0BA 3T08A 2VZVA 2VMDA 4LKSA 1W8NA 3LE0A 4JKKA 2ZEYA 4DUVA 3DYPA 3ETPA 3LEGA 3CMGA 4KI5M 2J1VA 2XQXA 5JR2A 3NQHA 5JXHA 1RYYA 1JZ2A 4CU7A 4W8JA 2CDOA 4W4ZA 2VMEA 3IAPA 3IDAA 1CIYA 2WAAA 4ARXA 1UXZA 1HN1A 2X10A 3I3DA 2WO2A 3A23A 4M4RA 3LQCA 3CKHA 2WUHA 3THDA 2BGOA 2J1SA 4DXTA 2XOMA 2X05A 3C7FA 4JKMA 2WYSA 3I2FA 1D7PM 4ZZ5A 1TG7A 3GGLA 4W50A 5C7GA 2W94A 2EICA 1K3IA 4CVUA 2WABA 5JXIA 3I2KA 2V4VA 4PT6A 2E31A 4QDQA 3UETA 1GOFA 1OF3A 3DECA 3P6BA 3I3EA 3T0AA 3C7GA 4AAXA 5DMYA 1T2XA 3THCA 2J22A 3BN6A 3NJXA 1TVGA 3SKJE 1UMIA 1JU4A 1UY1A 1WKYA 2DDUA 4XUPA 4GZ9A 4MGQA 4ZXEA 2W1QA 3K4AA 4AG4A 5LA1A 2JD9A 4BK4A 3IB3A 2J1UA 1GMMA 4QX1A 5IFPA 2VZQA 3FHQA 2QQMA 4OMDA 4DEVA 3WF2A 2HYXA 1EUTA 3HN3A 3ECQA 3DYOA 1NAEA 3F2ZA 1JYVA 1UY0A 1K45A 3WNPA 4D8MA 1KEXA 3C7OA 1US3A 1ULOA 3LEKA 1JYWA 3I3BA 4MOAA 4UI9L 2YFUA 2DCJA 1SG3A 3A21A 1J84A 3I2JA 3MV11 4KMQA 2RV9A 3U37A 4QPWA 2W95A 2V5DA 3CQOA 3VDCA 3WQBA 5JXGA 4GWJA 2VZ1A 2WBKA 1US2A 1JYXA 2VM9A 4DXRA 1GUIA 2VZRA 1GQPA 4A3ZA 4M4PA 2ORZA 2VCAA 2PQSA 1JZ8A 3SEEA 2W1SA 1CZSA 1I5PA 1BHGA 3W5MA 3AC0A 1PX3A 2WO3A 4BJ0A 5CZKA 5HPOA 4A41A 2XHNA 3WF3A 3ZM8A 1JYNA 5F7UA 4RYDA 1JI6A 3IAQA 1PMHX 4LQRA 4CU9A 2YC2A 2QQJA 5C70A 3MBWA 4TXWA 3WNNA 2HLEA 3NRUA 4OUEA 2Y6GA 2Y8KA 4UOJA 3WF1A 4QX0A 1O59A 3GXUA 2J1AA 5DPNA 2WZEA 2JE8A 3A7QA 2QQKA 4DUXA 3GDBA 3K4ZA 5B4XA 1OT5A 2LW8A 4L0PA 2ID4A 3HOBA 1UYZA 1UY3A 2YG0A 2EIEA 2VQUA 2Y6KA 4A4AA 5J1XA 2W5FA 4ARYA 4MO3M 4XURA 1XC6A 4OYUA 2QBXA 3P1IA 2VMCA 1OH4A 1UY4A 2VR4A 3ACFA 4ET7A 3I2IA 1PX4A 3CIHA 3UNPA 2BZDA 1H6XA 1UYXA 3W5NA 1ULPA 3VD3A 2W47A 1GOHA 3OG2A 4RN5A 3VDAA 1CX1A 2E26A 4TTGA 2W91A 3WNLA 1WCQA 1DP0A 4PF1A 1KGYA 2KD7A 4BK5A 4DUWA 4CUBA 2WDBA 4CU6A 5FUIA 2VZPA 4D0QA 2ZEZA 5IYYA 3UESA 3HNMA 3I97A 4P02B 5JXJA 5EJ1B 4YPJA 4P5YA 3T09A 2VZTA 2WN2A 4PQQA 1XPWA 2C4XA 2RVAA 2BERA 2QQLA 2VC9A 2YB7A 4A42A 4CUCA 2DCKA 4CUAA 3VDBA 3K75B 1JZ7A 4HG6B 4QB1A 2QQNA 1XNAA 2Y6LA 1PMJX 2ORXA 2WO1A 3WNOA 2LS6A 5LA0A 4MADA 4LHSA 1F4HA 3FN9A 3K46A 2E32A 3FL7A 2VZSA 3D3AA 2ZEWA 2J1TA 2R7EB 1JZ6A 5IJRA 5HXMA 3T2PA 3IIIA 3OGRA 2VJXA 1EUUA 1R64A 1O8SA 3HNBM 1L7QA 3NJVA 2W1WA 3FHAA 4DEQA 3I2HA 1UWWA 3WF0A 1K12A 1MPXA 2J1EA 4JHZA 1NUKA 5I0DA 2VTFA 1J83A 3HEIA 4P08A 3T2OA 4DXSA 1CZTA 1W8OA 2RJ2A 2W1UA 3ACIA 4MGSA 2EIBA 2VMFA 4LPLA 2Z4FA 2VZUA 3WF4A 3WNKA 3CZJA 2Y64A 3MUY1 1W9SA 4XUTA 3WSOA 3ABZA 2EIDA 3HNYM 1W99A 3OB8A 4KWUA 5JMOA 2W3JA 3GM8A 2X09A 3PUHA 3T2QA 2J7MA 1F4AA 4ZY9A 2C26A 3HJRA 3SEPA 4A44A 2Y6HA 5LA2A 3I2GA 4JX0A 4E8CA 3C7HA 1O8PA 3VD4A 1XNTA 2BGPA 3LPGA 2CDPA 4FI9A 2B4KA 1SHWB 3HPNA 3EYPA 3EB7A 4JKLA 3MV01 2VOTA 3ACHA 3OBAA 2JKXA 3C8XA 2QQIA 2WQ8A 1NKGA 3K77A 1W9WA 4BDVB 4QX3A 2ZXQA 2XONA 4GWIA 2WN3A 3K4DA 4A6OA 2VO5A 3E1F1 2VCCA 3OGVA 3LPFA 4OZOA 4IUGA 2Y6JA 1UY2A 1UX7A 1OF4A 4QDSA 4QX2A 3MO4A 3DYMA 4Z2AA 3OEAA 5G04L 2JDAA 3SKVA 3ACGA 1GOGA 3VD7A 1DLCA 5C71A 2L9LA 3PUIA 5EIYB 1LNSA 4XUNA 1GU3A 1UZ0A 3CZUA 2J1RA 2W92A 5DQ0A 1JZ5A 1JZ4A 2BBAA 1H6YA 4XZUG 5CYYA 5JUVA 3WNMA 1IQDC 1SDDB 4QDRA 2QQOA 2VZ3A 3A22A 3NNGA 2YC4A 3MUZ1 3OEBA 4XUQA 4XVHA 2YFZA 4UAPA 2VQTA 1P8JA 2VCBA 1UYYA 1UMHA 4QAWA 1OD3A 1JHJA 3T0DA 2WZ8A 4OMCA 3CDZB 5B4NA 3VD5A 2OKXA 1K42A 1YQ2A 5LCWL 4P00B 2VL4A 1UXXX 4QB6A 3OGSA 5DN2A 2VZOA 4CU8A 1JU3A 2ZEXA 2V72A 4ZZ8A 3LEIA 1W0NA 3C7EA 2WAOA 3WEZA 3BGAA
chains in the Genus database with same CATH superfamily
1DQ5A 2O1QA 2C9KA 4YZ2A 4C0BA 3ILFA 5K0UC 2CSGA 1TEIA 1SLTA 2PLV3 1ZZBA 2EXKA 2R0HA 4PIXA 2E33A 4Q4V2 3WDYA 4MG2A 2GC3A 2JJ6A 1HKDA 1HRV1 1PNFA 3SMHA 2P17A 3PIGA 2BVVA 2Q1ZB 4XUOA 4RD7A 5E1RA 4SBVA 5T5PA 1YXWA 2HWD3 4NPLA 1IS4A 3JXSA 4B4RA 1CN1A 4CEYC 4LKEA 1AX1A 4XF0A 4CP0A 1S0FA 2VW2A 4M3CB 4NOTA 5EJZB 3VD9A 2W39A 2UURA 4HK9A 4MXWA 2PYTA 4FT8A 1IPSA 1EV11 1AR91 5L9RA 5IHRA 4IL7A 2VVEA 1GFF2 1V6OA 3MW2A 3ZFEA 4CUGA 1K5MA 2VMDA 4WVVA 4CEWB 3KSCA 3OUHA 1W8NA 4IW3A 4JKKA 4EE2A 1D4M3 1S2KA 2AEYA 1MQTA 3LEGA 1O3RA 2K46A 2XJSA 3ZSLA 2PXJA 1RYYA 2WQ4A 1W6MB 2CDOA 4W4ZA 2BNMA 1FT9A 4AI0A 3IAPA 2CHHA 1CIYA 2YC0A 2ZGNA 5FXVA 2ZMLA 2X10A 4MV2A 5IVCA 3VBOB 3I3DA 1OXCA 3LQCA 3PIJA 3T1MA 1HW5A 3PL0A 3THDA 1CAVA 1DYPA 4Y22A 4CE8A 1ZRCA 2XOMA 2I45A 1W0PA 1FMD1 3LA3A 4PI0A 3U11A 5BV6A 1IOAA 1D7PM 3WDTA 3GGLA 4YW2A 1X8MA 5CADA 1BEV2 2A6VA 2W94A 1D0GA 3IPVA 5CA6A 1ZREA 3OD4A 3KF5A 1HQWA 2XKPA 2BOIA 5F37A 2D6PA 2WABA 1HQNA 1AR82 2I74A 1QF3A 4D6SA 4META 1V0AA 4CCMA 4IV1A 4S2FA 1HXS1 2E51A 4JVAA 4E2GA 2E31A 3PNAA 2B45X 4W65A 1PVC1 1GOFA 4YM1A 1OLME 3P6BA 1OUXA 2A7AA 4IEXA 3ZIXA 3T0AA 3MICA 1RUH3 1ZRRA 3VBRC 2Y0OA 3SH3A 1Z78A 5GALA 4Q29A 2PTMA 5DMYA 4LLOA 4TYSA 2IZWA 5CEHA 4WVMA 3B01A 3RYKA 4K1ZA 2F4PA 1FOD1 4YGEA 1NXD1 2YXSA 4B4PA 4E4HA 4AZZA 5CFDA 4UFHA 1UY1A 1OOPA 4MGQA 4XFBA 4ZXEA 4COVA 4Q0UA 1RUI3 4FXKB 1ZM1A 1E5HA 4XTPA 5EXOA 4ES8A 2ZX0A 3H9AA 4UFKA 4YVWB 2R061 1DGWA 5BNOB 5CAZA 3ZYRA 2PLV2 4B7KA 1C57A 5LA1A 3B7MA 2JD9A 3POWA 1UMZA 3O14A 1RUC1 5F3CA 4XFIA 3N36A 4QX1A 2HWB2 2CL2A 1OFNA 4PHZA 1OPOA 2EIGA 4DEVA 2HWD2 1ND2A 2HYXA 3VKFC 1AX2A 3DYOA 1NAEA 4A7ZA 1GSLA 2SBAA 1UY0A 3WCRA 3CJIB 4OHXA 1W6NB 4BYYA 2RMU3 3LFIA 2DWRA 1JODA 1F5FA 3U78A 3RS6A 1VAVA 1BMV2 1QOTA 2MHFA 5C8CA 4WZFA 1ASJ3 1XYNA 2VW1A 1DG6A 5BNNC 1D4M2 3MIGA 4UI9L 3WY6A 4WM8B 1UPIA 3BB6A 4XF4A 5F39A 3M70A 4HONA 1Q8VA 4OI2A 2FDJA 4COWA 2RV9A 3T4HB 5EHDA 1ENQA 3U37A 1BYHA 1KDKA 2F17A 3ZO0B 4CCJA 2D97A 3UGFA 1ULGA 3CQOA 2CWMA 1H2MA 3PTYA 3VDCA 1H4GA 3I3MA 2HWE1 3MIDA 4IXLA 5L19A 3R4UA 5T54A 1R1ZA 3VHRA 2RG4A 5CKNA 2XKOA 1UNBA 1US2A 2DVBA 3AFGA 4N9IA 1XSQA 4XE9A 4DY5A 3NSTA 4DXRA 1RL3A 1JYXA 1V00A 2VZRA 1V6JA 2X53S 4M4PA 5B2GB 1E5SA 1X82A 2ORZA 2PHWA 3BALA 2VCAA 2PQSA 4ORFA 1NYWA 1YI9A 5DZGA 4W6WA 2MNGA 3RJ2X 1CZSA 3U10A 4AK3A 3AC0A 3NW4A 1PX3A 3KQRA 1LODA 3H7YA 4EWAA 1W0OA 3USSA 3IT8A 3K51A 3VV1A 2XHNA 1MS0A 5CG8A 1PO23 2VQ0A 4MVTA 3ZM8A 3O0VA 3FC0A 4OHVA 1JYNA 3NJYA 1REEA 4HK8A 1JI6A 2Y60A 3PVNA 4NIGA 1YCIA 5DG2A 1DGLA 2PHUA 5I93A 4LIUA 3WINE 1LR5A 1QJZA 4CDUA 4D6QA 2RS12 5JZGB 5FRAA 1CIWA 5C70A 1AZDA 2C6SA 3NNJA 1RUH2 4L9BA 4BLJA 2VBPA 2UWAA 2PHDA 3VHNA 4R9AA 2Y8KA 4R9BA 4F8AA 3FMGA 5FPXA 2GH8A 4QX0A 4Z92B 2JG9A 1I9RA 1W03A 1WLCA 5KC5A 3F95A 4NIHA 3R05A 3ITQA 3A7QA 3RGBA 3TEXA 2QQKA 3USUB 3GZAA 5LY2A 1XQNA 3GDBA 1RUI2 1OT5A 1LHOA 4I0BA 4OZXA 4L0PA 4RR3A 3VBUC 1CAWB 4IGQA 4LK6A 3KT1A 3GALA 3BUCA 3BOWA 4JTOA 4ZHNA 1VBE1 5FPUA 4CP1A 2EIEA 1R081 1J59A 2Y6KA 5FK7A 1AJOA 2QTWB 4A4AA 5BNOC 1FXZA 1XNCA 2QE3A 3IDBB 4YVWC 2EXHA 4L99A 3L9JT 1ZBE1 4XURA 5A1FA 1XC6A 2ARAA 3AYEA 3GHNA 1AR63 4OYUA 1LOCA 1VB4A 2XGXA 3N7KA 4NPRA 3TAYA 3WW1A 2RMU2 2YBPA 3S7EA 1UY4A 4B29A 4F7ZA 4DZGA 5FZOB 2D6OX 3VUOA 2BZDA 1H6XA 2XH6A 2B46X 1ULPA 2RM23 1ASJ2 2GC2A 3VD3A 1GOHA 2W47A 2F4LA 3JD73 3SCGA 4B7EA 1NCQA 3ST7A 4XFFA 3CJIC 3TRSB 2WWJA 4XDPA 1MEC2 3Q8CA 1EP0A 2ARBA 1SPPA 1DP0A 4OLLA 5C3PA 1RXGA 1CX4A 2FDFA 4CUBA 2PHRA 3I3QA 3OTFA 3WDUA 4NWWA 2DTWA 5IAVA 4WM8C 4RGAA 4D0QA 1XXNA 5IYYA 1FNZA 1ZZCA 2VU9A 4LBMA 5BPXA 1CWPA 4HMZA 1SQ4A 1ZNPA 4K20A 3U1XA 3PMEA 1GANA 2XXZA 1UCXA 2VNRA 1BK0A 3VZNA 3ZN5A 1TMF1 4HSLA 4K40A 4WM7A 4LBQD 4Q0VA 3T09A 4FTSA 1V9U3 3SC7X 2PHFA 4R8HA 4YNIA 1XPWA 1I3HA 3JQWA 3S30A 4XJZA 3WR0A 1QJY3 4ISQA 1AYN3 5C9AC 4QKDA 2YGLA 4DO0A 2IFWA 1VRH3 5FYSA 3UGGA 2QCSB 3EBRA 4A42A 2FCUA 4GH4A 3VBSA 3VKMA 4CUCA 1EYBA 2ES3A 1W8TA 3K75B 2C5DA 1QH6A 1W8UA 1ULFA 1XNAA 2JECA 1PMJX 1PO22 3WNOA 1PO11 4J1WA 5SV8A 2LS6A 4OUMA 2XMLA 5LA0A 2VE1A 4MZUA 4LHSA 5F5CA 3HQRA 3K46A 1N3PA 1ZX5A 5FZ1A 4KQ7A 1O4TA 4OI0A 2JE9A 5DAXA 3UT0A 1RUG1 5FYCA 3H42B 4XPVA 3SCHA 4ZU4A 3D3AA 2ZEWA 2W08A 4FOQA 3CBNA 1JZ6A 3JUUA 1PGW2 1YNAA 2PA7A 4BZ4A 3AZVA 1A8MA 2KR2A 3PJYA 1UOGA 3IIIA 4BLIA 3RZMA 4R9DA 3RG0A 3VL8A 2X29A 4GMP0 3N4MA 3MLKA 5FYTA 1WMXA 3WNXA 4H7MA 3WF0A 4RHV2 1M4WA 5H9QA 4IE6A 1NUKA 4MUVA 2JE7A 4I2OA 1IPJA 1HIXA 2NN8A 3PUSA 3THPA 4A6SA 3LSEA 1KQRA 4DXSA 2VOWA 1BCXA 4MGSA 3I49A 1OC1A 2Z4FA 2R16A 3WG2A 3ZXDA 1BKZA 4XJ9A 1AR62 3CU7A 3V0BB 3WNKA 4DRVA 1JYIA 5L7OA 4NUBA 3V56A 4JQRA 4XUTA 5A1LA 3ETQA 2Q1FA 5FYMA 3WHUA 3O0XA 2ZGUA 2UWCA 4P14A 1DZQA 2RM22 3HNYM 3JD72 3QH7A 2CYFA 4Q1PA 2RDQA 5DAVA 2O14A 3T2QA 1OBNA 1DQ6A 2VUDA 1SFPA 1W39A 2ZGKA 5DDJ3 4CDQB 1K5JA 3H8OA 3HJRA 3O5SA 4K3UA 5KHKA 2AEZA 3IMNA 1OUSA 3LSDA 3I4IA 3AKTA 1QJX1 2JIGA 4Y1ZA 5C5UA 2WNVB 3Q8AA 5FY1A 5LA2A 3FWEA 4NJ4A 3VD4A 2QZ2A 2XWBB 1XNTA 4QPGB 3ZXGA 1YQ6A 4BPZA 2OPKA 1YRZA 3AVRA 2VECA 2XJTA 4GJYA 2VY0A 2B4KA 1KFUL 2RDNA 2P37A 1V9U2 3BPZA 3HIFA 2EAKA 5AVPA 1RVF2 5FKCA 5JOXA 1R1A3 1CGPA 3ACHA 1QJY2 3OBAA 1AYN2 2VCMA 3K77A 4HL0A 2PAEA 1VRH2 1W9WA 3ZR6A 1AVBA 1FNYA 1ZA4A 2RS53 2XL9A 5K4LA 4Y1UA 4NAOA 3ZN4A 5C3OA 3M1HA 5FYVA 1BBT3 2H0BA 2WS91 1PIV3 1UU5A 2DYCA 3WQ1A 4Y26A 1PNGA 1OA3A 1VAMA 2VCCA 1ZA7A 4K8RB 2EXJA 4LO5B 4PLOA 1OF4A 1OKQA 4L8QA 2P3KA 3MO4A 2SLIA 5FZ6A 3WP3A 3LGRA 1EAH3 5L9VA 5FCCA 2OVUA 1B35B 4N53B 2WL1A 3WP4A 1MVQA 4YG3A 1GQGA 1R093 2VOXA 4GA9A 3ZFFB 5FPAA 3NAPB 5IVBA 3H3ZA 4BQ3A 1G9DA 5FBZA 3ZSJA 1VR3A 5EV7A 4YYOA 4E4DX 2RS31 3JBG1 4QQLA 5JIAA 1LRHA 3BTAA 4EQVA 3VBHA 5HV0A 2Q8CA 1ST8A 4IEWA 5F3EA 3M8LA 4NHXA 1LENA 3B93A 3DN7A 2JD4A 2CTVA 1BVP1 1GU3A 1UZ0A 1W6QA 2RHPA 3PU3A 4J6GA 5DQ0A 3WUDA 1ZZ8A 3ZKYA 5GZGA 3PMSA 3AKQA 2PHXA 4LUKA 5CYYA 4BH9A 1PK6A 3BOPA 2AYHA 3WNMA 1IQDC 4J1XA 1CAUA 4PJYA 5FWJA 1U0AA 2XVGA 1ENRA 2XJUA 1MS4A 4FPYA 4CCOA 4Q4W3 2VGDA 3I59A 5JR7B 4XVHA 1S2BA 3POSA 1VB2A 4JZRA 4YW6A 1DIWA 1G86A 2D98A 3RZKA 2P5BA 3C2UA 4KBZA 2YV8A 4AHZA 4CPBD 4UAPA 4NN0A 4LE4A 1LOAA 5DAPA 5FLJA 5JIUA 2VCBA 5KHGA 2VXRA 1H1MA 4CDXA 1QNYA 4P9WA 5DABA 1UYYA 1UMHA 3MI8A 4FPEA 4MGYE 5DDJ2 3ZXEA 4LNVA 1ODMA 1VIWB 3OYWA 3LWCA 1JHJA 3AJYA 4Q1RA 5J96B 4R9CA 2I2SA 2X5IC 1BQPA 1CPMA 2DUQA 4JRLA 1YHFA 2JDUA 1E57A 2VL4A 2ZX1A 3E6DA 2R043 2WNVC 2Y0IA 5DN2A 5JOZA 5BXXA 3S5AA 4KBBA 1YUDA 2BRTA 1N1VA 5FPVA 3CJXA 4KWJA 3UK9A 3ZFEB 3GYDA 2ZABA 1R1A2 3PU8A 3QCWA 4AVVA 1MQTB 3WEZA 3BGAA 4IV3C 4QKFA 1S55A 3IN9A 3RZJA 1YJLA 4UT5A 3AP6A 3LA2A 2NQYA 1STMA 3KD4A 4FPCA 4H14A 2PMWB 4K8FA 3V64A 2RS52 1AF9A 1RUF2 3VBFA 1QQP2 1W9TA 1BBT2 4QB2A 4RFT0 3LF7A 5CFCA 3TEYA 1PIV2 2DFCA 2R49A 1TNRA 5G05L 4BMEA 4E8DA 3HT2A 3K48A 1N47A 4XTMA 5KXCA 3BODA 3J7HA 1PMIA 4AE2A 1FPN3 1U5IA 3BU7A 3Q8EA 3CEWA 1AYM1 5HCHA 3N9LA 3FFZA 5EP9A 2R6QA 3LA7A 4Y22B 1AXZA 1EAH2 2FQPA 1LTEA 4GJZA 4LO8A 4WBBA 4AWDA 1GYKA 3M4FA 1F9KA 4WVWA 4L92A 3WHTA 3ZXKA 4CDWA 4HVQA 4AVAA 2W87A 3D82A 1H0BA 4GQ7A 1R092 3TN93 4AI9A 5K7PA 2CNAA 2BPA2 4MGZE 3T08A 1BLZA 3IPVB 4LKSA 5FTTC 1AL23 4FPKA 5FZEA 2ZEYA 3MIEA 5FXWA 4DUVA 2RR13 3B02A 3ETPA 1IKQA 2W52A 4R4ZA 5ACA3 1GLHA 5JR2A 2VG9A 4N7UA 3ZFFC 2UU8A 3KLSA 4NIIA 4AQTA 5IVEA 1JZ2A 3MF6A 4IV1B 2D5HA 4CU7A 3T1LA 1MZ6A 1POV3 1TNFA 2VMEA 3MIFA 1ASJ1 2J42A 3N35A 3OSDA 5FZKA 1NLSA 3VDDA 1X50A 1SACA 2JDPA 4LK7A 1HN1A 2OW4A 4OHZA 5FQ0A 1JYTA 1XE0A 3VB9A 3A23A 4Q4W2 3OPTA 5GLVA 1EPWA 2BGOA 4WVMB 5FY8A 2CGNA 2ADDA 5C4WB 1Y4WA 1UL9A 3NJZA 1RUE1 4Q4Y3 3WDXA 2WYSA 3FE5A 3I2FA 4ES9A 1OOPB 4I0AA 4IERA 3B9IA 1HRI3 3GJAA 4QXBA 1ZZ9A 3Q8FA 4W50A 3I2OA 2PAMA 5GZCA 1QWRA 3RI9A 3IIAA 1O91A 2Q8EA 4B1LA 2Z5WA 1QU0A 1QEXA 5JLVA 2E7QA 3L2HA 4KU7A 3KF3A 4OHWA 2QDRA 2WFF3 4RQPA 1OVSA 1AXKA 5A70A 2CU5A 1IZ3A 1ND2B 1YFXA 4LBKA 2WO7A 1VAKA 5FLHA 3URFA 4RS5C 4UFMA 4FAHA 2R042 4AAXA 2XHKA 1SBEA 4IEVA 4QQHA 5LY1A 2B39A 2VULA 4EN7B 5C8CB 3THCA 2O8QA 1GBGA 2XUMA 3NJXA 4AHYA 5FPBA 1TVGA 2GMPA 5FZLA 2VTXJ 5LBFA 2WA3A 4AVCA 1HB2A 1JU4A 4JGYA 1WKYA 4X6RB 4XUPA 4GZ9A 3GBFA 2W1QA 1VBD1 3ZFEC 4AVSA 3JQXA 4AG4A 2JIJA 1PGW1 4LO7A 4GWMA 1O4YA 1MQTC 2ZBJA 3W21A 1SMVA 3LEMA 4IE5A 1C1LA 1GMMA 2J1UA 3WCSA 3NWKA 1YIFA 4AI8A 4HLTA 1D2QA 4I01A 5F1RA 3FHQA 3TBDA 4OMDA 5F5AA 3VL9A 2TBVA 3HN3A 4Q8LA 1JYVA 5FBJA 1DGRA 1OHFA 4XOGA 4JDOA 4ZS2A 1RJ8A 4QD2A 1KEXA 1J3QA 1ACCA 3H7JA 5KXEA 5LEKA 1US3A 4CYDA 3TN92 3TYJA 4ZU5A 1J1LA 3ZYPA 1V6LA 2Y6FA 3OBTA 4N43C 4WV8A 3I3BA 4AR2A 5FXZA 2F6BA 3CNAA 2RR12 1IKPA 2NMNA 2DCZA 4GMP1 4NHKA 3SH5A 4AEDB 2WT2A 4TN7A 5A7WA 4EWDA 2ZPXA 1UOJA 2Q5TA 3I2JA 3U4XA 3RYPA 4KMQA 4EN9B 2GU9A 2VXJA 1KFXL 2WT0A 2WIIB 1AR73 1QOOA 4QQPA 3RMYA 2JG8A 4LKFA 1QJU1 2V5DA 2YZ4A 1OH3A 1IS6A 2BWCA 2A6WA 4NRMA 5FZBA 1I6XA 4U36A 4CDUB 3TEZA 3WQBA 2DUOA 3A4UA 2E7AA 4GULA 5E16A 2VUAA 1C8M1 2O8OA 4LBOA 3WP5A 1CONA 2K9ZA 1WWYA 2VM9A 5FZ4A 1GUIA 4KGQA 4A3ZA 3NV3A 1UOFA 1TME3 1RUD3 2JG9B 3AMHA 2HWB3 2CAUA 4Q4Y2 1ZRDA 4GIQA 3PUQA 4HFSA 2H6CA 2DUPA 4IEZA 2GP3A 4O65A 1BHGA 4YZ1A 1HRI2 4ISRA 3B69A 2WO3A 5C4WC 2ZGTA 5CZKA 4AGVA 1VMJA 5HPOA 1LHNA 1IQAA 4X8PA 1OOPC 1IS5A 1OA4A 1WUVA 2GZWA 3EMRA 3WF3A 3ZX7A 3ALQA 4RYDA 3ZIWA 3D6EA 2ADEA 1VRBA 1VRH1 2WFF2 3I2DA 1QOSA 1H8TB 4NRQA 2D40A 3LKJA 3H8XA 1WMEA 5CVRA 2A1XA 4H55A 2NMOA 2B9UA 2YC2A 4OVEA 4PBPA 1S0BA 1NQDA 1NLRA 4QX7A 3DPRC 4Q4X3 3IM0A 1OQEA 4UFLA 4ZS3A 1VBA1 3RZZA 4EN6B 4OUEA 3O1OA 2WNUC 2VVFA 2WZR1 1LULA 1GZCA 4GB31 4UOJA 3WF1A 1NCQB 2OT7A 2XQRA 1G9AA 2P3YA 2JE8A 1SPPB 1ND3C 4AAPA 2KA3A 2HWC1 4PF5A 1E5IA 4DUXA 5I91A 1ZRIA 5C3QA 5C8CC 2BNOA 2LW8A 5J48A 1RUJ3 4P9XA 1ZZ6A 5ANNA 4C1WA 5JI9A 5F8PA 2UYBA 4FTBA 5E88A 4OQ8A 1WBLA 2BOJA 3U4SA 1UY3A 2GP5A 2YG0A 1WMDA 2BFUS 1W6PA 3HT1A 4UW3A 1KJRA 4IEYA 4QQOA 4HZFA 5J1XA 4WM7B 4PIYA 4QM8A 2D43A 1Q56A 3OCPA 1F15A 2OZJA 3MEPA 3P1IA 3RWNA 1NZIA 1BXHA 1IPKA 2VMCA 5LA9A 1W2TA 2VR4A 3KV5A 4ET7A 4YRDA 1W6OA 5FOJB 3UNPA 1RHI3 3W5NA 3PVBB 1WCUA 1OMIA 4FOWA 4GH4B 5L9BA 3VBSB 1WD4A 3H3LA 2RS13 2Y38A 3J8F1 4Y20A 1JXNA 2IXHA 2E26A 1Q8SA 4XJAA 2W91A 1WCKA 3UV9A 4YFZA 1KGYA 1SLBA 1UZWA 4XFGA 3N7MA 4BK5A 4DUWA 1AR72 3AL6A 3LAGA 3POEA 2G9GA 5E89A 5FUIA 2VZPA 3CLPA 2HWF3 1YIPA 4IDZA 4AEDC 3KVAA 3UESA 3HBKA 1RXFA 1A34A 5EJ1B 1J1TA 2OA2A 5GKAC 5CKQA 4YPJA 3O7OA 4KG0A 4MYEA 2HBTA 4CP9A 5I8YA 2EAAA 3LB9A 2VZTA 1FV2A 2WN2A 2WZPP 1AJKA 1UOBA 4CDUC 1TME2 1RUD2 1WA6X 2IUWA 2FD8A 3ON7A 4TWTA 1XNKA 3A0NA 1XJAA 4GWNA 2TEPA 2VC9A 4CEYA 2YMZA 4PQ9A 4AXOA 5D21A 2QKDA 3WLUA 4AFAA 3KHCA 2DCKA 3OBZA 4HG6B 1WW5A 5DXDA 2QQNA 1MS8A 2WWSA 2Y6LA 1SDWA 1HLCA 5FZDA 2ORXA 3ZYFA 5FYUA 5FP3A 5FY5A 4B1MA 5FMOS 4PDWB 3HQUA 2XJQA 4XMIA 4MADA 3FN9A 1MEC3 1RINA 1AX0A 5JDBA 4XXPA 4K6BA 3N9PA 4NRPA 5DUWA 1GWLA 1NG0A 2VZSA 2VPVA 3IZOA 5L7OB 1O6UA 2AENA 4CEWC 4Q4X2 1QGLA 1H8TC 2OIIA 3WVJA 2R7EB 5KWRA 4FPLA 4Z2WA 3WDWA 4BQWA 2XG3A 1DQ0A 5FPLA 2PELA 3BYWA 4CXXA 2NZ9A 1EUUA 3BTXA 4DRRA 3B94A 2ZKNA 1L7QA 2W1WA 5FZMA 2WLPA 4DEQA 1NA1A 1Z7S2 1RUJ2 4HKOA 1F2NA 1V6IA 3CF6E 4XDOA 4IESA 3VBOC 3POJA 2JB8A 5M0TA 1KJLA 3B00A 2VOVA 2P6CA 2WNOA 4XCBA 2C0ZA 3EHKA 4XILA 4YVSB 1GP4A 4L2NA 4LBQA 2WYFA 3SQOA 2XBO3 3KGZA 5A3LA 1RMU1 2VMFA 4LPLA 5A3UA 5E8AA 2VZUA 3HWJA 3WF4A 5IK7A 3H8RA 3AMQA 1DQ4A 3DV8A 1W9SA 3BTYA 3PVEA 5IAXA 1RHI2 2ARXA 3ABZA 2JX9A 4KGGA 4UWDA 2Q8OA 2NM1A 2Y34A 5JMCA 1UN1A 2EIDA 2R073 2QJVA 3PURA 3ZXLA 3GNEA 4YWAA 3VBRA 1W8FA 1WBFA 2J7MA 3VZKA 4AEMA 2A5ZA 1C4RA 4ZY9A 2C26A 4QPIA 5BNQA 1S4CA 1MS3A 2OQ6A 4IGPA 2MEV3 3MGUA 4AYUA 3FBYA 4GD4A 1GZWA 3MFCA 1O7FA 4QWNA 4O7XA 4BMBA 1GICA 2ZACA 3I2GA 4JX0A 4E8CA 2D6MA 2HWF2 3C7HA 2XWJB 4FI9A 4XW3A 2GSYA 1XE7A 5J7MA 3OD0A 1IHMA 4RHV3 2FBEA 1H8VA 2D3RA 4XHXA 2ETEA 2QQWA 2IXIA 3EYPA 3DGTA 1N1YA 5JWPA 4XC9A 5F6KA 2VOTA 3RMXA 2OS2A 5FDBA 2DVFA 2JKXA 3C8XA 5A3MA 2WQ8A 3N3HA 1NKGA 2GDFA 5A3TA 5DAQA 5BUVA 3NO8A 4IQPA 4QXCA 4QX3A 5L36A 3VHPA 2XONA 4GWIA 1BZWA 4QGLA 4YW1A 1LHWA 3KCYA 3K4DA 1O3QA 1LB2A 3DKWA 4AHWA 4BIOA 2GC1A 3KQ4B 3VHOA 1JHNA 1PK6B 3I7DA 4DS0A 5BNNA 4HOOA 1CAUB 2PN5A 3ENRA 5A6YA 3OGVA 2CWSA 4RSUA 4IUGA 2Y6JA 1X8EA 5DAWA 4QX2A 1COV1 1UD1A 3I59B 3ILRA 3S7IA 3DYMA 1ODNA 3ZVXA 4YZ3A 1S0CA 2OXBA 4NWVA 1NQJA 2FHRA 4HBNA 4PDWC 5GLTA 1LGNA 4OI4A 3PDQA 5T55A 2KXLA 1WGPA 2JXAA 3QBQA 1FPN1 2VVDA 3SKVA 1GOGA 3KCXA 4IEQA 4TSVA 5A7SA 3ZN6A 4NR1A 1OFSA 4FPJA 3OPZA 3WP6A 3OYWB 2BUKA 4LO4B 5EIYB 1RVF3 3AMMA 4Z07A 3CZUA 4LBLA 5KHIA 2W92A 4P5HA 4HKLA 1W8ZA 1L3JA 1JZ5A 1JZ4A 2BBAA 1AL21 3ES1A 5JUVA 1UX6A 3MZHA 3NVCA 1W3VA 5C5TA 1FI2A 2BTVC 2ET7A 3GHMA 1SDDB 4M00A 5ACA1 1CAXA 5JSOA 3AXDA 1OQDA 1SCSA 3KHBA 2QQOA 3A22A 1V6MA 5FZHA 1YFWA 2XBO2 2JEMA 3W59A 3OEBA 4K21A 4XUQA 3TNPB 1N1SA 4NHLA 1HB1A 5CIRA 4YVSC 1UQXA 4AEJA 2WLQA 4CXYA 1SZBA 4D7SA 5IVFA 4QU1A 5BY5A 4NPMA 4YSFA 2R072 2EALA 1KS5A 1LOFC 1EV13 5A7NA 1AR93 3LFMA 4Q4V1 2DU1A 1MS1A 1PM7A 5I0UA 3VBFB 1QMJA 5CFCB 2XUEA 1VMFA 5J36A 1NLQA 4XQ4A 3E5XA 4K7JA 2MEV2 4AQ2A 3ZPYA 2V09A 4LITA 4QAWA 4XXAA 1OD3A 3T0DA 5FO7B 3T4VA 5JZGC 3LDKA 5J09A 4IE0A 5EYXA 4CCEA 5B4NA 4HVRA 3OUJA 3VBUA 1GP5A 1H9PA 2P6HA 2CAVA 4WZCA 3RDIA 4P00B 5BNPA 5LCWL 3AKSA 2JDNA 1UXXX 4QB6A 3OGSA 2UY8A 1GP6A 2ZGSA 3PHMA 1LKNA 4Z82A 5ANQA 2WFF1 2AREA 1WCSA 5BNOA 3MW3A 3BI3A 1SBDA 2I07B 5EWSA 1PGL2 1G9BA 3ES4A 5IK5A 3S5QA 3GXUA 4UXAA 2CV6A 4E27A 2GMEA 2QQPA 4MHUA 1FMD3 5KXDA 4FPOB 3WG4A 5LBBA 4AHXA 5A32A 1UZVA 2D3PA 3D0JA 1LHVA 2LM3A 4QGNA 2IFRA 4Q0QA 5FUPA 2QZ3A 1F35A 3IWZA 1S0JA 1L7RA 2ZX3A 4YGCA 3FUQA 3EJKA 3L2YA 3MYXA 4O9EA 2D6KA 4MXVA 4C90A 1LEMA 5C3SA 2W9XA 2WSVA 3CJIA 1JZ3A 4N8MA 4BISA 1SBFA 4SLIA 2HEWF 1WLTA 3J7LA 4AI2A 1W8WA 4QKBA 1YWKA 3ZFGB 2HBUA 3KT7A 1HXS3 2AUYA 2OQ7A 4BQYA 4FP2A 5EJ3A 4UBGA 1FV3A 5IFTA 4CPBA 3N9MA 2G1MA 4HXCA 4BCUA 4WM8A 1AL0G 4Q2FA 3X29B 5C6CA 1BEV1 5ABJB 4BXSV 5F9TA 4COYA 4Z1VA 1CESA 4GXLA 1FATA 1QH7A 2VZVA 3T0BA 4AL9A 4AI1A 5FO9B 3LE0A 3DYPA 1IS3A 1AR81 1FOD3 2XQXA 5JXHA 1EY2A 4EN8B 2Q30A 4RQPB 4W8JA 4LO6B 3LOIA 5C9AA 5FR3A 4E4ZA 2R063 3N9QA 3QLQA 3IDAA 1L7LA 4UFJA 5IK4A 4ARXA 2WFPA 5JCTA 2VH9A 1HRV2 4LUMA 2QUOA 4MX3A 1HV1A 4TLGA 1RUF3 1QQP3 1REFA 2DBNA 4UFIA 1JS9A 1GWMA 4BQ2A 2J1SA 5AFEA 2FDHA 1H2KA 1N1TA 1MACA 2XVLA 3D5OA 3EXUA 5GJ6A 2X05A 4I09A 3SCFA 4AI3A 1H2LA 1H1AA 3LD8A 3M3QA 4JGYB 4EWEA 1VBC3 3RJRA 5DUVA 5H9SA 3UYJA 1EV12 2PLV1 1AR92 1XNDA 2EICA 3H3UA 4GKXA 4CCKA 2ZZQA 4FFHA 3VZMA 1G7YA 2HWB1 4CRQA 2BFUL 3ASIA 4XF9A 5JXIA 3EQEA 2HWD1 1XU1A 5FYYA 4QDQA 3UETA 3VBFC 4DNYA 1OF3A 1QXPA 2D93A 2GC0A 2ZOEB 2QQUA 5D8AA 1BJQA 5FOBB 3HR9A 2CGOA 2GNBA 2AR6A 3BTZA 3ZXAC 1XOYA 1C8NA 3BKZA 1BMV1 2HWE3 1C3HA 1QIQA 4QM9A 4BWOA 1NCRB 2XB6C 1T2XA 2D5FA 1D4M1 1C1FA 1Q5OA 4BHPA 3SKJE 2D7FA 1UMIA 1Y3TA 4I30A 4M01A 3O1SA 4CA9A 4DIQA 5KBFA 5A7WB 1FMD2 1PM4A 2YYOA 4ZPIA 3DUIA 3K3NA 5LRRA 3O0WA 1RGSA 3R0RA 4JHTA 2JG8B 4ASLA 3AM2A 3ZSMA 5LZ6A 2W0XA 3ZR5A 1QDCA 3JU9A 4G9SB 1GZ9A 2VZQA 3AFKA 2G9ZA 3VZLA 1HX6A 1HJFA 3J4UH 2QQMA 3NMBA 1C28A 3KZ4C 1JOBA 2HEVF 3WF2A 3H8UA 1EUTA 1HXS2 2ZAHA 3AZWA 5LASA 5JPMB 2Q1MA 1DHKB 1FX5A 4HN1A 2O0OA 2VAUA 3WNPA 2GAUA 4D8MA 1YQCA 2VBDA 5FY4A 1VBB3 5FZFA 3WOGA 1ULOA 3LEKA 3ZFGC 3J7NA 5FYIA 5FZAA 4BB3A 4BE3A 4CDQC 3AP4A 5D1IA 2A6ZA 3WW3A 3B9CA 2D44A 4JC1A 4MOAA 2HJIA 3KGLA 2EF6A 2DCJA 3T2TA 2D6LX 1FOD2 4MXWB 5ABJC 1SG3A 4DY3A 2FDGA 4JQTA 4YFWA 4QPGC 5FZGA 1K5MB 5FMOL 3O1TA 4KG8A 4QPWA 2FZ2A 2R062 1MZ5A 2RS11 4JGZA 4NROA 3ZYHA 4IETA 1RUH1 3GF6A 3FJSA 2ZGRA 5D2AA 4E2SA 1G6NA 5FZCA 5C33A 4GWJA 1HJGA 2VZ1A 2DU0A 2XVKA 5IVJA 3ATGA 5EPAA 4C8DA 4BM8A 4XHBA 1GQPA 1UIJA 2ZA9A 4FCAA 2A71A 2IC1A 3SXWA 1RUI1 4FFIA 4LIVA 1QJEA 1VBC2 2ZX4A 5GLZA 3K2OA 3W5MA 1DCSA 2PHTA 3NNMA 1CAVB 4A2UA 1SLLA 2ZGMA 2V4AA 3KV4A 4YW7A 5FMBA 4BJ0A 3DCQA 4URAA 3MIBA 3THTA 4A41A 5GLWA 2YBSA 3ILNA 4NHMA 1LJ7A 1W6PB 4OULA 3Q8BA 4FPFA 4UF0A 2NYYA 1YYNA 5F32A 2FDIA 2DVGA 1UYPA 3AKRA 3AZXA 1NOVA 3B3QE 1B35C 3IAQA 4N53C 3U07A 4AEKA 5E6HA 1DU3D 2Y26A 4CTEA 4DB5A 2RMU1 2ATFA 4Q26A 3O1UA 3MBWA 3NAPC 4C1XA 4LORA 2WNEA 4TXWA 2HWE2 3M3EA 4HPKA 4YM0A 4QGMA 1GNHA 1W6OB 2QQVA 4S2HA 5T52A 1VJ2A 4GKYA 2Y6GA 3TWIA 1VE0A 1TMF3 3ZPOA 4Y20B 1MEC1 1DGRN 3FLRA 4UW4A 2J1AA 5DPNA 2IVIB 2WZEA 4FVVA 2JDZA 2E7TA 4MH0E 4DOUA 4FQ4A 4Y1XA 5B4XA 5JSRA 1U5YA 1NCRC 5ERLA 2UWBA 1TE1B 3KMHA 2H6BA 2ID4A 4XETA 4V1PA 4BU2A 1CD3G 2R32A 5FYZA 4BXFA 5FZ9A 5CFDB 3TNQA 1M06G 4INDA 2KM2A 3ZSEA 3BIWE 5DZFA 4XJUA 2IXKA 1PO13 4QMAA 5ISLA 2W5FA 2JG8C 4MO3M 4ARYA 1ENXA 2A6XA 1LESA 2P1BA 4CP9B 4W6XA 1J3PA 3JCIA 1ENSA 2P3IA 3VKOA 5I8TA 4Y3OA 2QBXA 4IEUA 3J7MA 4UW5A 1OH4A 2X5IA 1RUG3 1ULCA 1ZVFA 2BDRA 1PX4A 1VBB2 3I2IA 4CEYB 1XNBA 3APBA 3NV4A 1W9YA 2A3YA 3H50A 3OG2A 2DCYA 2ZHLA 2GALA 2ZKLA 3VDAA 4EZHA 3AYDA 4G4FA 4LJHA 3KWVA 4LR4A 4PIZA 3RI8A 1PO21 5IVYA 4XCAA 3WNLA 2LROA 4PF1A 2VW0A 1HB4A 4URTA 3IBMA 1H9WA 4QKNA 5CNAA 3AYAA 4XYXA 4R4XA 1QKQA 3NL1A 5FP9A 1YFYA 3ME2A 1OPMA 2A70A 4IV3A 4AVBA 4EROA 2B8MA 1W8HA 2ZEZA 1O3TA 2Z79A 3HNMA 1VBE2 4P02B 4ZKTB 2HEYF 2GMMA 1R082 2PFWA 1K5MC 3KVBA 3POYA 4P5YA 3WUCA 4ATEA 3ZSKA 1DZRA 1JUHA 1WW6A 3OUIA 5AC93 1ONAA 1JTZX 3GZUC 2C4XA 1GV9A 2BERA 4G3YC 5I0TA 4RHV1 1NA1B 4RGKA 4YGDA 1KITA 1S0DA 4NAMA 3RZHA 5LWBA 1POV0 3NNFA 4CUAA 1DQ2A 5K8SA 1JZ7A 3AX4A 2G9FA 4Y5Z0 3SH4A 1YC61 4AVTA 2B7YA 1AUYA 3M3CA 4XFCA 2WO1A 4O61A 5A80A 1ZZ7A 4B8EA 5KR7A 2HH9A 1ZBA3 1NT0A 1QJX3 2R0FA 1F4HA 1AR61 4PLNA 2IWGB 1CJDA 2E32A 3M2MA 5JI7A 3S57A 1RJ7A 1W2OA 1NE6A 3FUOA 3O1RA 4L11A 1X7NA 3KT4A 3O1VA 1TZOA 4QT6A 1I1EA 1MVEA 2RM21 4DPNA 1WW7A 3JD71 4YG6A 3DXTA 5F5QA 1TMF2 4XQDA 5HXMA 1IGOA 5KC6A 1HB3A 1YI7A 3T2PA 1YLLA 4UYBA 1ALYA 4IV1C 4LHNA 2ZCWA 4QPIB 5EZWA 3HNBM 3NJVA 3FHAA 5I8SA 1D0HA 5FZ7A 2VMHA 1UWWA 1WLWA 4AQSA 1K12A 5FFOC 2J1EA 1QY4A 3G7DA 1UAIA 2VTFA 2AZ5A 3WZ1A 1CR7A 1J83A 2XLGA 5A6XA 3AK0A 1XRUA 2VBBA 1GNZA 3HEIA 4P08A 4LKDA 1CVNA 2WS93 4LT5A 4RR3B 3T2OA 2Z69A 1A78A 1PO12 1CZTA 3G6JB 1V9U1 1W8OA 2RJ2A 4QHZA 2W1UA 5HCFA 1MZEA 1RVF1 3ACIA 2CY6A 2EIBA 3H1MA 4E2QA 5CFDC 2FZ1A 2BGCA 1QJY1 3D4KA 1AYN1 2Y64A 1A3KA 3MUY1 4LEJA 3RNSA 2WT1A 3LDBA 1RUG2 5FJHA 1W05A 4XZPA 3PJQA 4TLFA 3OB8A 4KWUA 4RS5A 5CKMA 5LB6A 5JMOA 3GM8A 3PUHA 2X09A 5T50A 3GZTB 3J9SA 3WG3A 2ET1A 4A44A 3OY8A 1ND2C 4Q5OA 2RS33 3JBG3 5BNNB 3RRDA 4HT1T 3IDCB 4R52A 2Y6HA 4QHBA 2JICA 2VUJA 4M0HA 1QNWA 4V2VA 4V2WA 4B3NA 2ZX2A 2CDPA 1POQA 1Z7S3 3M3OA 4YLZA 3N9OA 1S2EA 2ILMA 4BA6A 5I0RA 2K2SA 3GBWA 4I02A 1JBCA 4EZ4A 5FZ8A 1SHWB 3HPNA 5A6QA 5AC92 3LOBA 3EB7A 4JKLA 4U2AA 1WA4A 1CQ9A 1A8DA 1RITA 1X9TA 3ZXJA 1GWKA 5F5IA 3ZN6B 5F2SA 5F2WA 1DBNA 4XDQA 5FZIA 3KM5A 4BDVB 2VUCA 5F3IA 3BVCA 2ZXQA 2WN3A 1BVVA 1PZ8A 5A3PA 1V6NA 2IXLA 2ENRA 5LBCA 2YHJA 4AOCA 2WKKA 4A6OA 2BW8A 4JTNA 4XJWA 3P5BA 4N43A 1NA1C 3E1F1 4IEOA 4Q0PA 5FK8A 1CAXB 4LE3A 2OZ6A 1W2UA 1ZBA2 1PHMA 3TB0A 2BWAA 1QJX2 1J58A 1UX7A 4XBQA 4QDSA 3PLQA 5GZEA 1OLQA 2E9QA 5A7QA 2ZS6B 4XBNA 3GCWA 4OQ9A 1YQ5A 3UJQA 2YPDA 4Q8KA 3I8TA 1IG3A 1PZ7A 2D6NA 5F3GA 3SITA 2JDAA 3BCWA 1QDOA 4HN0A 4ATFA 2YY1A 2DURA 5DDJ1 4A7YA 3ACGA 3MFAA 4O9GA 5FY0A 5K0UA 2RJKA 1DLCA 5A33A 3OBRA 3OGJA 2YU1A 1HQLA 3WG1A 5C71A 4JAAA 5DG1A 1YEWA 4CCNA 1H4HA 2TUNA 3WQ7A 2ZGOA 4XUNA 1G8WA 2FDKA 3AXEA 4MGTA 2A3WA 3ZMNA 1B09A 1H6YA 4QPIC 2JENA 4D3WA 3VBUB 5HCAA 4YZ5A 3E6CC 2WS92 5C4WA 5BNPB 4H2AA 2JDYA 4QDRA 5FIXA 2X8KA 1LHUA 2ZHKA 1Y9GA 2JG9C 1HV0A 4FP3A 2Q8DA 2A73B 5CBLA 3I54A 1URXA 4ASKA 3Q9OA 2H0VA 5JOYA 1R1A1 4YW5A 2OUJA 5JSPA 1KS4A 1AYM3 2JDHA 5IT6A 1RUOA 4RR3C 3HN1A 2E53A 4JDMA 2QFEA 3HQXA 3QACA 1KDMA 2RS51 1CJPA 1SFNA 2LUWA 1RUF1 2RDSA 4QXKA 5IUQA 4FAGA 1QQP1 4HVOA 1BBT1 4XQWA 3DPRA 5A32B 5IATA 1PIV1 1Y7BA 2WRAA 1ULDA 4KWLA 4XEZA 2WNUA 2RJLA 2RS32 3JBG2 3UKTA 2AACA 4BQ5A 3VZOA 4AF9A 1SLAA 1VBC1 1Y43B 2V73A 4NO4A 4OMCA 1ND3A 2JDKA 2Q0AA 3NKGA 4LBNA 3ZYIB 2XJVA 1EAH1 3AP9A 1O5UA 4NIAA 2NLRA 2OKXA 2YUEA 3WDVA 5IVVA 4ONUA 1K42A 2WC2A 2VNGA 1YQ2A 3IMMA 1R091 1NCQC 3IKWA 1QXJA 3PUAA 5J3UA 4Z8BA 2WSUA 4CU8A 3V0AA 1JU3A 1UPSA 5SV5A 2AC1A 3UGHA 5DUXA 3UKVA 2P2KA 1W0NA 3C7EA 1GQHA 2WAOA 3O1MA 4W6YA 3AZZA 1RUE3 4FPHA 5A1AA 4I3PA 4I3GA 3RSJA 2JDMA 4A45A 3DXUA 3RPQA 1DYOA 5C9AB 1JH5A 3TOJA 2WWUA 5CU1A 4XFHA 2VMIA 4LA2A 2R1DA 2ZTNA 2W46A 1LCLA 2BYVE 4WM7C 4ZXKA 1NX9A 1Q8QA 5HI0A 2DBIA 1ZYBA 2B9VA 4Q4W1 4XIOA 4YGBA 5EYYA 3ZOIA 4BIFA 4EJRA 1GNYA 5JOWA 3POIA 4D6RA 3FLPA 4IE7A 4P9JA 3S6PA 1H30A 4S2DA 3VBSC 4GH4C 1HDKA 1V6KA 5FWEA 4AGGA 4AEDA 3BU0A 1LECA 4GALA 4XFAA 3MPBA 1G9CA 1CZVA 4DINB 3ZDVA 1LGCA 5A3WA 3ZKUA 1MR5A 4C91A 1UW8A 3CMGA 5A3NA 4KI5M 4CCDA 1QHDA 2J1VA 3RVHA 5T5LA 3NQHA 3MIHA 2BV4A 1W06A 1SLIA 1VBB1 4TZDA 1OA2A 4LTAA 2BVBA 1VP6A 1VBD3 1VPHA 3RFRA 3WXPA 3HMYA 1OSGA 1I5ZA 2XR4A 5D8AB 2BU9A 5L73A 2WAAA 3VBHB 1DGWX 1JOJA 1RUNA 2R041 1LEDA 1UXZA 4L97A 4XAAA 5HCBA 1W6QB 4HETA 3CL1A 2WO2A 3HBZA 5F6LB 4M4RA 3CKHA 2WUHA 3J26N 2WR9A 1F31A 4LOSA 2Y33A 5KHJA 5T3NA 2GN7A 1KD7A 4MGKE 1AYM2 3M7AA 4XACA 5DZEA 4DXTA 5AFBA 3KB5A 5BNPC 4M3CA 4N90A 5H9RA 3C7FA 4JKMA 2ZGLA 1X36A 4ZZ5A 3D8CA 1TG7A 2R30A 1MS5A 1W9FA 3AYCA 1DLLA 4OHYA 3R6SA 1JMUB 1LOEA 3LIHA 5H9PA 4CZSA 5C7GA 1GR3A 3FFQA 4RGGA 5AVAA 4CEWA 1WLDA 1H8TA 2QNKA 3ZYJB 3H1WA 1K3IA 4LA3A 4CVUA 3I2KA 4GMP3 2IXJA 2V4VA 3QD6A 4E4SA 1W6MA 1Q8OA 1UKGA 4CDXB 2IXCA 4PT6A 1CPNA 5L7OC 2RE9A 3AVSA 2WA4A 5FY9A 5IK8A 5LRSA 3DECA 3U75A 5FZ0A 1QJU3 1UF2C 2E6VA 3I3EA 1APNA 3ZYBA 3TN91 3C7GA 3VBOA 4FPGA 4WVZA 2EA7A 2LALA 1C8M3 2J22A 2NPIA 4N7IA 3JZVA 2RR11 3AP5A 3BN6A 4NIDA 2ZHNA 1HRV3 4M3CF 1WZXA 5EQUA 2DDUA 1RUE2 1XYPA 3OGGA 4JDNA 1DFQA 2YU2A 1POV1 4KWKA 4RFRB 3SHRA 1S1AA 3K4AA 2XLFA 3BPSA 4D7YA 2K0GA 2LTNA 2CGPA 4ASMB 3KV9A 4XJ8A 4JGZB 3VN4A 3WD5A 2N7GA 2YBKA 3IB3A 4BK4A 3SNMA 5IFPA 4DFSA 1ULEA 1S0EA 4XMAA 1LOGA 5FPZA 1Y9QA 2VQAA 3HVDA 1H1IA 3ECQA 1LAJA 4Q4Y1 2A75A 3TEWA 3F2ZA 1OURA 3AMPA 1K45A 1V70A 2ZGPA 5C8WA 4F3JA 3BIEA 3U14A 4OI1A 1HRI1 3C7OA 2GNDA 5HBAA 3P3PA 4Y1VA 1VBA3 2JKBA 3MLJA 1JYWA 1UU4A 3KS7A 2WZR3 4GB33 4CDWB 2YFUA 2NP0A 5GLUA 3A21A 3DEMA 1J84A 3MV11 2FMYA 4UF0B 2HWC3 4Y5TA 2BEOA 1UIKA 4J25A 4YVWA 1A6CA 1VBD2 1UU6A 2DTYA 4PBOA 1O4ZA 2OX0A 2W95A 1AXYA 1JW6A 1JYCA 3WW4A 4JV4A 1DZTA 1NY72 3K3OA 2ERFA 5DUUA 1OLMA 5GZFA 4QU2A 3QH6A 5JXGA 4FXGB 2WBKA 4HPKB 2BP6A 1YJKA 2ZAAA 1PVXA 4EN0A 1Z0HA 1OI6A 5D8AC 4E9KA 3VDDB 3VBHC 2PAKA 3FHIB 1W2NA 1UO9A 5FQ0B 1W6NA 1DF0A 4UBHA 1JZ8A 3O1PA 4D7TA 3R4SA 3SEEA 4RL7A 4K1YA 2BBVA 3LZZA 1X9PA 1I5PA 1W2AX 1H2NA 2W1SA 1O3SA 1PK6C 1PVC3 3MF9A 4PDWA 1U12A 4ITCA 5AC91 1XYOA 1GKBA 3J8F3 1NXMA 1O5LA 2Z42A 3WT3A 2QVSB 2UYAA 3U0ZA 2AGSA 4LOTA 5F7UA 4LHLA 5FKBA 4CCCA 4FBFA 3IDEA 1REDA 1PMHX 5FP4A 2WINB 4LQRA 1D2SA 5FJKA 1LU2A 2A3XA 4CU9A 2BQPA 1QJU2 3LIGA 2P4EA 3NKTA 2QQJA 2Z2SB 4UW6A 4H3WA 1VALA 4D94A 2X5IB 4CDXC 4BQXA 3W9AA 3WNNA 4QHOA 2HLEA 3NRUA 1N3QA 2A6YA 5T5OA 1C8M2 4OUSA 1ZBA1 4GAZA 5EFUA 2OPWA 4YZ4A 1O59A 5GM0A 1PGSA 3WQ0A 3DF0A 1RUC3 1JUIA 2ARCA 3INAA 1W90A 2P34A 5J98B 4A3XA 1LOBA 1AHSA 1C5HA 3K4ZA 1AR71 4Y24A 1E5RA 1LU1A 4YVSA 4RA0A 4XF3A 5IWFA 3HOBA 2YGMA 1D4VB 4NMIA 1UYZA 4IV3B 1DYKA 4P9GA 5FYBA 3OOXA 4PLMA 2IVJA 2MPFA 1LOFA 2VQUA 4NHYA 1EPZA 3A0KA 3R4DB 2C1FA 4Y4YA 1OQ1A 4N9HA 3V65A 4COUA 3ZDSA 3E5UA 1TME1 1RUD1 3FX3A 4JGZC 5FXXA 3SISA 5JZGA 1UZYA 2ZZJA 3E5QA 3ACFA 2R1BA 3CIHA 1T6GC 4ZONA 5CFCC 5GZDA 1UYXA 2YROA 3VLBB 1VBA2 4RN5A 5FYHA 3VKNA 1CX1A 2WZR2 1Q3EA 5T5JA 4TTGA 4GB32 1F8VA 2W68A 1WCQA 4NE9A 2UY9A 3USUA 1RTVA 2WQZC 3POGA 2KD7A 2HWC2 5FREA 3H0OA 1CAWA 1FYUA 2WDBA 3RZLA 4CU6A 3W58A 1XU2A 4CDWC 4Q27A 3FLTA 4CCLA 5FP8A 3I97A 4FFFA 4Q4X1 5JXJA 2HYKA 3UL2A 3ROUA 4COZA 2B42B 5KXBA 3E97A 2EXIA 2VMGA 4BQ4A 4K9SA 4MGIE 3AL5A 4PQQA 1OLRA 1RMU3 3GJBA 3GZEA 2GN3A 5FUNA 4LBJA 2RVAA 5CISA 4X8NA 5IW0A 1Z7S1 5FZOA 1RUJ1 2QQLA 1VMHA 2JWPA 2DVAA 2YB7A 3MDPA 4KU8A 1Q8PA 1PVC2 3FZ3A 3VDDC 1YQ8A 2ZMKA 5LW9A 2PQQA 3VDBA 3AKPA 4QB1A 1JOPA 2FMDA 3J8F2 3AB0A 4B4QA 4Y1YA 4D69A 4FO9A 4LHKA 4Q0SA 3PTRB 3PVOA 2ZHMA 1KRIA 2ZGQA 3P3NA 1HN0A 4F83A 2C9AA 4FOYA 5TSWA 3FL7A 3ZYGA 2BNNA 1J3RA 3LDRA 4CSWA 1RHI1 3DL3A 1W28A 2GNTA 3CO2A 4AQ6A 2C24A 4IGOA 2J1TA 5FZ3A 5KHHA 4EV0A 3QOPA 3UKNA 5IJRA 4RS5B 3RYRA 2DVDA 1VBE3 5JAXA 5I0SA 5FMDA 1U5XA 1R083 1RUC2 3OGRA 2VJXA 1WW4A 3JB8A 1R64A 4RQPC 1MS9A 1ZRFA 1O8SA 3OY8B 3NNLA 5LK5A 4H7LA 3AP7A 1WMFA 3I2HA 1ZBE3 1MPXA 2HWF1 4JHZA 4HKWA 2RDRA 5I0DA 2YPJA 3ELNA 5HXVA 2PHLA 1DQ1A 3B5LB 4PCRA 1W3XA 3M3IA 5FY7A 1OKOA 1FAYA 1Q43A 2DF7A 4LULA 5JVVA 5FO8B 3MHZA 5LBEA 3VGIA 4JGYC 2GNMA 4ZU7A 2TNFA 2WJSA 4HSJA 5A7PA 4YW3A 1COV3 5J37A 4JCKA 3CZJA 3KCCA 4YM2A 5BYNA 4AGRA 3WSOA 1VLNA 4FSJA 3N9NA 1JN2P 4MLOA 4QXHA 2OYZA 1W99A 4DQAA 4YM3A 2W3JA 1F4AA 3MPPG 3T3YA 5A7OA 3SEPA 1T6BX 4P9IA 1DDLA 4FFGA 4N43B 4PI2A 4CP2A 1OVPA 3OF1A 4IEPA 4DMIA 3OJBA 1RIRA 3VKLA 4EYUA 3CHXA 3EO6A 1O8PA 5LEJA 3S0MA 1QJFA 2DV9A 2BGPA 3LPGA 4FQZA 2JB4A 4Y33A 5FP7A 1KXGA 4YW4A 4MSVA 4M0NA 2DCTA 1QXRA 1G9FA 4CXWA 1RMU2 4KL1A 5K9YA 3GCXA 5K0UB 3MV01 3V0BA 3VZJA 5A33B 4LMFA 2QQIA 3KV6A 1SLCA 3ZXFA 4JRAA 4P9LA 4A7KA 2VTXA 2G19A 4DXZA 2VD7A 3HAGA 1IG0A 3JB4C 4I0WB 2AH2A 3O12A 1MZFA 4KH9A 3E6BA 4KNCA 4Q4V3 1U5ZA 3ZFGA 4CDQA 1RC6A 4MHRA 2VNVA 2LRPA 4IE4A 1LGBA 2VO5A 4C0HA 3N7JA 3LCPA 1N3OA 1NZCA 2XBO1 3WW2A 4BQ1A 2WNVA 3LPFA 4OZOA 2ZMNA 5FMCA 5ABJA 2VNOA 1UY2A 2FCVA 1YO8A 1YFUA 3NV1A 4QPGA 4Z2AA 2QDNA 3OEAA 5A6ZA 5G04L 1TQ5A 4Y5SA 1RB8G 5FLIA 2OUHA 2XPJA 2R071 1X33A 2XJRA 3T30A 3ZLIA 2FCTA 1SFYA 1XE8A 3MW4A 3WV6A 3AMNA 3DPRB 3VD7A 4AW7A 1PZ9A 4FOVA 2B5HA 2MEV1 1SCRA 2WNUB 2L9LA 3PUIA 3GBGA 2XDVA 4Y4RA 5FV3A 4AFDA 4XAEA 4XF1A 4P9YA 1LNSA 4YG0A 2YDEA 4XIKA 1ZBE2 2J1RA 1UZZA 1SEFA 1ND3B 1UKRA 2G4IA 4LXLA 5APAA 5C3RA 1WCDJ 4XZUG 3POBA 4QQ2A 2Q4SA 2XLAA 4OCTA 3ACLA 2P3JA 4YARA 4XABA 2HKXA 3UJOA 2VZ3A 4S2GA 2BJSA 5LK7B 3NNGA 2YC4A 3MUZ1 4NVPA 1PGL1 3FBMA 3V0AB 2YFZA 4QPYA 1COV2 4HANA 2XJPA 3MLLA 5JPNB 1B35A 4N53A 1OD5A 1NY71 1WD3A 4LBQB 2D3SA 3RWKX 1BK1A 2VQTA 4OFGA 1P8JA 3ZFFA 3N7LA 4LLFA 2XL7A 2ZJCA 5LATA 5CB7A 1BEV3 3NAPA 5CG9A 1F5JA 2V5YA 2E63A 1FPN2 3AZYA 3H1YA 3HD8B 1XSRA 4FTEA 3D0SA 1AR83 1XBFA 3AJZA 5A3OA 4QX8A 2WZ8A 3VBRB 1C5IA 3RZGA 3OPWA 3CDZB 3WX5A 1NE4A 3VD5A 3DKQA 3RQ0A 1NCRA 4BOWA 4QX5A 1W04A 4AFCA 1GZWB 1AL22 3C3VA 1S0GA 3POFA 3ORJA 3SLIA 2EVXA 5ACA2 4AFMA 4XBLA 2VZOA 3W20A 3ZMOA 3NV2A 2DFBA 1XB9A 2ZEXA 2W2IA 2GH2A 1S0IA 4M3CE 2V72A 2VOKA 4ZZ8A 4AFBA 1Y9MA 3LEIA 5HV4A 4X6QB 5FAXA 1GZTA
chains in the Genus database with same CATH topology
5A1AA 2C9KA 4A45A 1DYOA 1W9TA 4QB2A 1L7RA 2E33A 2W46A 5G05L 1NX9A 2W9XA 4E8DA 1JZ3A 2B9VA 4XUOA 3J7HA 1GNYA 3JXSA 5IFTA 5EJZB 3VD9A 5IHRA 2W87A 4BXSV 1CZVA 3T0BA 3T08A 2VZVA 2VMDA 4LKSA 1W8NA 3LE0A 4JKKA 2ZEYA 4DUVA 3DYPA 3ETPA 3LEGA 3CMGA 4KI5M 2J1VA 2XQXA 5JR2A 3NQHA 5JXHA 1RYYA 1JZ2A 4CU7A 4W8JA 2CDOA 4W4ZA 2VMEA 3IAPA 3IDAA 1CIYA 2WAAA 4ARXA 1UXZA 1HN1A 2X10A 3I3DA 2WO2A 3A23A 4M4RA 3LQCA 3CKHA 2WUHA 3THDA 2BGOA 2J1SA 4DXTA 2XOMA 2X05A 3C7FA 4JKMA 2WYSA 3I2FA 1D7PM 4ZZ5A 1TG7A 3GGLA 4W50A 5C7GA 2W94A 2EICA 1K3IA 4CVUA 2WABA 5JXIA 3I2KA 2V4VA 4PT6A 2E31A 4QDQA 3UETA 1GOFA 1OF3A 3DECA 3P6BA 3I3EA 3T0AA 3C7GA 4AAXA 5DMYA 1T2XA 3THCA 2J22A 3BN6A 3NJXA 1TVGA 3SKJE 1UMIA 1JU4A 1UY1A 1WKYA 2DDUA 4XUPA 4GZ9A 4MGQA 4ZXEA 2W1QA 3K4AA 4AG4A 5LA1A 2JD9A 4BK4A 3IB3A 2J1UA 1GMMA 4QX1A 5IFPA 2VZQA 3FHQA 2QQMA 4OMDA 4DEVA 3WF2A 2HYXA 1EUTA 3HN3A 3ECQA 3DYOA 1NAEA 3F2ZA 1JYVA 1UY0A 1K45A 3WNPA 4D8MA 1KEXA 3C7OA 1US3A 1ULOA 3LEKA 1JYWA 3I3BA 4MOAA 4UI9L 2YFUA 2DCJA 1SG3A 3A21A 1J84A 3I2JA 3MV11 4KMQA 2RV9A 3U37A 4QPWA 2W95A 2V5DA 3CQOA 3VDCA 3WQBA 5JXGA 4GWJA 2VZ1A 2WBKA 1US2A 1JYXA 2VM9A 4DXRA 1GUIA 2VZRA 1GQPA 4A3ZA 4M4PA 2ORZA 2VCAA 2PQSA 1JZ8A 3SEEA 2W1SA 1CZSA 1I5PA 1BHGA 3W5MA 3AC0A 1PX3A 2WO3A 4BJ0A 5CZKA 5HPOA 4A41A 2XHNA 3WF3A 3ZM8A 1JYNA 5F7UA 4RYDA 1JI6A 3IAQA 1PMHX 4LQRA 4CU9A 2YC2A 2QQJA 5C70A 3MBWA 4TXWA 3WNNA 2HLEA 3NRUA 4OUEA 2Y6GA 2Y8KA 4UOJA 3WF1A 4QX0A 1O59A 3GXUA 2J1AA 5DPNA 2WZEA 2JE8A 3A7QA 2QQKA 4DUXA 3GDBA 3K4ZA 5B4XA 1OT5A 2LW8A 4L0PA 2ID4A 3HOBA 1UYZA 1UY3A 2YG0A 2EIEA 2VQUA 2Y6KA 4A4AA 5J1XA 2W5FA 4ARYA 4MO3M 4XURA 1XC6A 4OYUA 2QBXA 3P1IA 2VMCA 1OH4A 1UY4A 2VR4A 3ACFA 4ET7A 3I2IA 1PX4A 3CIHA 3UNPA 2BZDA 1H6XA 1UYXA 3W5NA 1ULPA 3VD3A 2W47A 1GOHA 3OG2A 4RN5A 3VDAA 1CX1A 2E26A 4TTGA 2W91A 3WNLA 1WCQA 1DP0A 4PF1A 1KGYA 2KD7A 4BK5A 4DUWA 4CUBA 2WDBA 4CU6A 5FUIA 2VZPA 4D0QA 2ZEZA 5IYYA 3UESA 3HNMA 3I97A 4P02B 5JXJA 5EJ1B 4YPJA 4P5YA 3T09A 2VZTA 2WN2A 4PQQA 1XPWA 2C4XA 2RVAA 2BERA 2QQLA 2VC9A 2YB7A 4A42A 4CUCA 2DCKA 4CUAA 3VDBA 3K75B 1JZ7A 4HG6B 4QB1A 2QQNA 1XNAA 2Y6LA 1PMJX 2ORXA 2WO1A 3WNOA 2LS6A 5LA0A 4MADA 4LHSA 1F4HA 3FN9A 3K46A 2E32A 3FL7A 2VZSA 3D3AA 2ZEWA 2J1TA 2R7EB 1JZ6A 5IJRA 5HXMA 3T2PA 3IIIA 3OGRA 2VJXA 1EUUA 1R64A 1O8SA 3HNBM 1L7QA 3NJVA 2W1WA 3FHAA 4DEQA 3I2HA 1UWWA 3WF0A 1K12A 1MPXA 2J1EA 4JHZA 1NUKA 5I0DA 2VTFA 1J83A 3HEIA 4P08A 3T2OA 4DXSA 1CZTA 1W8OA 2RJ2A 2W1UA 3ACIA 4MGSA 2EIBA 2VMFA 4LPLA 2Z4FA 2VZUA 3WF4A 3WNKA 3CZJA 2Y64A 3MUY1 1W9SA 4XUTA 3WSOA 3ABZA 2EIDA 3HNYM 1W99A 3OB8A 4KWUA 5JMOA 2W3JA 3GM8A 2X09A 3PUHA 3T2QA 2J7MA 1F4AA 4ZY9A 2C26A 3HJRA 3SEPA 4A44A 2Y6HA 5LA2A 3I2GA 4JX0A 4E8CA 3C7HA 1O8PA 3VD4A 1XNTA 2BGPA 3LPGA 2CDPA 4FI9A 2B4KA 1SHWB 3HPNA 3EYPA 3EB7A 4JKLA 3MV01 2VOTA 3ACHA 3OBAA 2JKXA 3C8XA 2QQIA 2WQ8A 1NKGA 3K77A 1W9WA 4BDVB 4QX3A 2ZXQA 2XONA 4GWIA 2WN3A 3K4DA 4A6OA 2VO5A 3E1F1 2VCCA 3OGVA 3LPFA 4OZOA 4IUGA 2Y6JA 1UY2A 1UX7A 1OF4A 4QDSA 4QX2A 3MO4A 3DYMA 4Z2AA 3OEAA 5G04L 2JDAA 3SKVA 3ACGA 1GOGA 3VD7A 1DLCA 5C71A 2L9LA 3PUIA 5EIYB 1LNSA 4XUNA 1GU3A 1UZ0A 3CZUA 2J1RA 2W92A 5DQ0A 1JZ5A 1JZ4A 2BBAA 1H6YA 4XZUG 5CYYA 5JUVA 3WNMA 1IQDC 1SDDB 4QDRA 2QQOA 2VZ3A 3A22A 3NNGA 2YC4A 3MUZ1 3OEBA 4XUQA 4XVHA 2YFZA 4UAPA 2VQTA 1P8JA 2VCBA 1UYYA 1UMHA 4QAWA 1OD3A 1JHJA 3T0DA 2WZ8A 4OMCA 3CDZB 5B4NA 3VD5A 2OKXA 1K42A 1YQ2A 5LCWL 4P00B 2VL4A 1UXXX 4QB6A 3OGSA 5DN2A 2VZOA 4CU8A 1JU3A 2ZEXA 2V72A 4ZZ8A 3LEIA 1W0NA 3C7EA 2WAOA 3WEZA 3BGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A1A A;  2C9K A;  4A45 A;  1DYO A;  1W9T A;  4QB2 A;  1L7R A;  2E33 A;  2W46 A;  5G05 L;  1NX9 A;  2W9X A;  4E8D A;  1JZ3 A;  2B9V A;  4XUO A;  3J7H A;  1GNY A;  3JXS A;  5IFT A;  5EJZ B;  3VD9 A;  5IHR A;  2W87 A;  4BXS V;  1CZV A;  3T0B A;  3T08 A;  2VZV A;  2VMD A;  4LKS A;  1W8N A;  3LE0 A;  4JKK A;  2ZEY A;  4DUV A;  3DYP A;  3ETP A;  3LEG A;  3CMG A;  4KI5 M;  2J1V A;  2XQX A;  5JR2 A;  3NQH A;  5JXH A;  1RYY A;  1JZ2 A;  4CU7 A;  4W8J A;  2CDO A;  4W4Z A;  2VME A;  3IAP A;  3IDA A;  1CIY A;  2WAA A;  4ARX A;  1UXZ A;  1HN1 A;  2X10 A;  3I3D A;  2WO2 A;  3A23 A;  4M4R A;  3LQC A;  3CKH A;  2WUH A;  3THD A;  2BGO A;  2J1S A;  4DXT A;  2XOM A;  2X05 A;  3C7F A;  4JKM A;  2WYS A;  3I2F A;  1D7P M;  4ZZ5 A;  1TG7 A;  3GGL A;  4W50 A;  5C7G A;  2W94 A;  2EIC A;  1K3I A;  4CVU A;  2WAB A;  5JXI A;  3I2K A;  2V4V A;  4PT6 A;  2E31 A;  4QDQ A;  3UET A;  1GOF A;  1OF3 A;  3DEC A;  3P6B A;  3I3E A;  3T0A A;  3C7G A;  4AAX A;  5DMY A;  1T2X A;  3THC A;  2J22 A;  3BN6 A;  3NJX A;  1TVG A;  3SKJ E;  1UMI A;  1JU4 A;  1UY1 A;  1WKY A;  2DDU A;  4XUP A;  4GZ9 A;  4MGQ A;  4ZXE A;  2W1Q A;  3K4A A;  4AG4 A;  5LA1 A;  2JD9 A;  4BK4 A;  3IB3 A;  2J1U A;  1GMM A;  4QX1 A;  5IFP A;  2VZQ A;  3FHQ A;  2QQM A;  4OMD A;  4DEV A;  3WF2 A;  2HYX A;  1EUT A;  3HN3 A;  3ECQ A;  3DYO A;  1NAE A;  3F2Z A;  1JYV A;  1UY0 A;  1K45 A;  3WNP A;  4D8M A;  1KEX A;  3C7O A;  1US3 A;  1ULO A;  3LEK A;  1JYW A;  3I3B A;  4MOA A;  4UI9 L;  2YFU A;  2DCJ A;  1SG3 A;  3A21 A;  1J84 A;  3I2J A;  3MV1 1;  4KMQ A;  2RV9 A;  3U37 A;  4QPW A;  2W95 A;  2V5D A;  3CQO A;  3VDC A;  3WQB A;  5JXG A;  4GWJ A;  2VZ1 A;  2WBK A;  1US2 A;  1JYX A;  2VM9 A;  4DXR A;  1GUI A;  2VZR A;  1GQP A;  4A3Z A;  4M4P A;  2ORZ A;  2VCA A;  2PQS A;  1JZ8 A;  3SEE A;  2W1S A;  1CZS A;  1I5P A;  1BHG A;  3W5M A;  3AC0 A;  1PX3 A;  2WO3 A;  4BJ0 A;  5CZK A;  5HPO A;  4A41 A;  2XHN A;  3WF3 A;  3ZM8 A;  1JYN A;  5F7U A;  4RYD A;  1JI6 A;  3IAQ A;  1PMH X;  4LQR A;  4CU9 A;  2YC2 A;  2QQJ A;  5C70 A;  3MBW A;  4TXW A;  3WNN A;  2HLE A;  3NRU A;  4OUE A;  2Y6G A;  2Y8K A;  4UOJ A;  3WF1 A;  4QX0 A;  1O59 A;  3GXU A;  2J1A A;  5DPN A;  2WZE A;  2JE8 A;  3A7Q A;  2QQK A;  4DUX A;  3GDB A;  3K4Z A;  5B4X A;  1OT5 A;  2LW8 A;  4L0P A;  2ID4 A;  3HOB A;  1UYZ A;  1UY3 A;  2YG0 A;  2EIE A;  2VQU A;  2Y6K A;  4A4A A;  5J1X A;  2W5F A;  4ARY A;  4MO3 M;  4XUR A;  1XC6 A;  4OYU A;  2QBX A;  3P1I A;  2VMC A;  1OH4 A;  1UY4 A;  2VR4 A;  3ACF A;  4ET7 A;  3I2I A;  1PX4 A;  3CIH A;  3UNP A;  2BZD A;  1H6X A;  1UYX A;  3W5N A;  1ULP A;  3VD3 A;  2W47 A;  1GOH A;  3OG2 A;  4RN5 A;  3VDA A;  1CX1 A;  2E26 A;  4TTG A;  2W91 A;  3WNL A;  1WCQ A;  1DP0 A;  4PF1 A;  1KGY A;  2KD7 A;  4BK5 A;  4DUW A;  4CUB A;  2WDB A;  4CU6 A;  5FUI A;  2VZP A;  4D0Q A;  2ZEZ A;  5IYY A;  3UES A;  3HNM A;  3I97 A;  4P02 B;  5JXJ A;  5EJ1 B;  4YPJ A;  4P5Y A;  3T09 A;  2VZT A;  2WN2 A;  4PQQ A;  1XPW A;  2C4X A;  2RVA A;  2BER A;  2QQL A;  2VC9 A;  2YB7 A;  4A42 A;  4CUC A;  2DCK A;  4CUA A;  3VDB A;  3K75 B;  1JZ7 A;  4HG6 B;  4QB1 A;  2QQN A;  1XNA A;  2Y6L A;  1PMJ X;  2ORX A;  2WO1 A;  3WNO A;  2LS6 A;  5LA0 A;  4MAD A;  4LHS A;  1F4H A;  3FN9 A;  3K46 A;  2E32 A;  3FL7 A;  2VZS A;  3D3A A;  2ZEW A;  2J1T A;  2R7E B;  1JZ6 A;  5IJR A;  5HXM A;  3T2P A;  3III A;  3OGR A;  2VJX A;  1EUU A;  1R64 A;  1O8S A;  3HNB M;  1L7Q A;  3NJV A;  2W1W A;  3FHA A;  4DEQ A;  3I2H A;  1UWW A;  3WF0 A;  1K12 A;  1MPX A;  2J1E A;  4JHZ A;  1NUK A;  5I0D A;  2VTF A;  1J83 A;  3HEI A;  4P08 A;  3T2O A;  4DXS A;  1CZT A;  1W8O A;  2RJ2 A;  2W1U A;  3ACI A;  4MGS A;  2EIB A;  2VMF A;  4LPL A;  2Z4F A;  2VZU A;  3WF4 A;  3WNK A;  3CZJ A;  2Y64 A;  3MUY 1;  1W9S A;  4XUT A;  3WSO A;  3ABZ A;  2EID A;  3HNY M;  1W99 A;  3OB8 A;  4KWU A;  5JMO A;  2W3J A;  3GM8 A;  2X09 A;  3PUH A;  3T2Q A;  2J7M A;  1F4A A;  4ZY9 A;  2C26 A;  3HJR A;  3SEP A;  4A44 A;  2Y6H A;  5LA2 A;  3I2G A;  4JX0 A;  4E8C A;  3C7H A;  1O8P A;  3VD4 A;  1XNT A;  2BGP A;  3LPG A;  2CDP A;  4FI9 A;  2B4K A;  1SHW B;  3HPN A;  3EYP A;  3EB7 A;  4JKL A;  3MV0 1;  2VOT A;  3ACH A;  3OBA A;  2JKX A;  3C8X A;  2QQI A;  2WQ8 A;  1NKG A;  3K77 A;  1W9W A;  4BDV B;  4QX3 A;  2ZXQ A;  2XON A;  4GWI A;  2WN3 A;  3K4D A;  4A6O A;  2VO5 A;  3E1F 1;  2VCC A;  3OGV A;  3LPF A;  4OZO A;  4IUG A;  2Y6J A;  1UY2 A;  1UX7 A;  1OF4 A;  4QDS A;  4QX2 A;  3MO4 A;  3DYM A;  4Z2A A;  3OEA A;  5G04 L;  2JDA A;  3SKV A;  3ACG A;  1GOG A;  3VD7 A;  1DLC A;  5C71 A;  2L9L A;  3PUI A;  5EIY B;  1LNS A;  4XUN A;  1GU3 A;  1UZ0 A;  3CZU A;  2J1R A;  2W92 A;  5DQ0 A;  1JZ5 A;  1JZ4 A;  2BBA A;  1H6Y A;  4XZU G;  5CYY A;  5JUV A;  3WNM A;  1IQD C;  1SDD B;  4QDR A;  2QQO A;  2VZ3 A;  3A22 A;  3NNG A;  2YC4 A;  3MUZ 1;  3OEB A;  4XUQ A;  4XVH A;  2YFZ A;  4UAP A;  2VQT A;  1P8J A;  2VCB A;  1UYY A;  1UMH A;  4QAW A;  1OD3 A;  1JHJ A;  3T0D A;  2WZ8 A;  4OMC A;  3CDZ B;  5B4N A;  3VD5 A;  2OKX A;  1K42 A;  1YQ2 A;  5LCW L;  4P00 B;  2VL4 A;  1UXX X;  4QB6 A;  3OGS A;  5DN2 A;  2VZO A;  4CU8 A;  1JU3 A;  2ZEX A;  2V72 A;  4ZZ8 A;  3LEI A;  1W0N A;  3C7E A;  2WAO A;  3WEZ A;  3BGA A; 
#chains in the Genus database with same CATH topology
 1DQ5 A;  2O1Q A;  2C9K A;  4YZ2 A;  4C0B A;  3ILF A;  5K0U C;  2CSG A;  1TEI A;  1SLT A;  2PLV 3;  1ZZB A;  2EXK A;  2R0H A;  4PIX A;  2E33 A;  4Q4V 2;  3WDY A;  4MG2 A;  2GC3 A;  2JJ6 A;  1HKD A;  1HRV 1;  1PNF A;  3SMH A;  2P17 A;  3PIG A;  2BVV A;  2Q1Z B;  4XUO A;  4RD7 A;  5E1R A;  4SBV A;  5T5P A;  1YXW A;  2HWD 3;  4NPL A;  1IS4 A;  3JXS A;  4B4R A;  1CN1 A;  4CEY C;  4LKE A;  1AX1 A;  4XF0 A;  4CP0 A;  1S0F A;  2VW2 A;  4M3C B;  4NOT A;  5EJZ B;  3VD9 A;  2W39 A;  2UUR A;  4HK9 A;  4MXW A;  2PYT A;  4FT8 A;  1IPS A;  1EV1 1;  1AR9 1;  5L9R A;  5IHR A;  4IL7 A;  2VVE A;  1GFF 2;  1V6O A;  3MW2 A;  3ZFE A;  4CUG A;  1K5M A;  2VMD A;  4WVV A;  4CEW B;  3KSC A;  3OUH A;  1W8N A;  4IW3 A;  4JKK A;  4EE2 A;  1D4M 3;  1S2K A;  2AEY A;  1MQT A;  3LEG A;  1O3R A;  2K46 A;  2XJS A;  3ZSL A;  2PXJ A;  1RYY A;  2WQ4 A;  1W6M B;  2CDO A;  4W4Z A;  2BNM A;  1FT9 A;  4AI0 A;  3IAP A;  2CHH A;  1CIY A;  2YC0 A;  2ZGN A;  5FXV A;  2ZML A;  2X10 A;  4MV2 A;  5IVC A;  3VBO B;  3I3D A;  1OXC A;  3LQC A;  3PIJ A;  3T1M A;  1HW5 A;  3PL0 A;  3THD A;  1CAV A;  1DYP A;  4Y22 A;  4CE8 A;  1ZRC A;  2XOM A;  2I45 A;  1W0P A;  1FMD 1;  3LA3 A;  4PI0 A;  3U11 A;  5BV6 A;  1IOA A;  1D7P M;  3WDT A;  3GGL A;  4YW2 A;  1X8M A;  5CAD A;  1BEV 2;  2A6V A;  2W94 A;  1D0G A;  3IPV A;  5CA6 A;  1ZRE A;  3OD4 A;  3KF5 A;  1HQW A;  2XKP A;  2BOI A;  5F37 A;  2D6P A;  2WAB A;  1HQN A;  1AR8 2;  2I74 A;  1QF3 A;  4D6S A;  4MET A;  1V0A A;  4CCM A;  4IV1 A;  4S2F A;  1HXS 1;  2E51 A;  4JVA A;  4E2G A;  2E31 A;  3PNA A;  2B45 X;  4W65 A;  1PVC 1;  1GOF A;  4YM1 A;  1OLM E;  3P6B A;  1OUX A;  2A7A A;  4IEX A;  3ZIX A;  3T0A A;  3MIC A;  1RUH 3;  1ZRR A;  3VBR C;  2Y0O A;  3SH3 A;  1Z78 A;  5GAL A;  4Q29 A;  2PTM A;  5DMY A;  4LLO A;  4TYS A;  2IZW A;  5CEH A;  4WVM A;  3B01 A;  3RYK A;  4K1Z A;  2F4P A;  1FOD 1;  4YGE A;  1NXD 1;  2YXS A;  4B4P A;  4E4H A;  4AZZ A;  5CFD A;  4UFH A;  1UY1 A;  1OOP A;  4MGQ A;  4XFB A;  4ZXE A;  4COV A;  4Q0U A;  1RUI 3;  4FXK B;  1ZM1 A;  1E5H A;  4XTP A;  5EXO A;  4ES8 A;  2ZX0 A;  3H9A A;  4UFK A;  4YVW B;  2R06 1;  1DGW A;  5BNO B;  5CAZ A;  3ZYR A;  2PLV 2;  4B7K A;  1C57 A;  5LA1 A;  3B7M A;  2JD9 A;  3POW A;  1UMZ A;  3O14 A;  1RUC 1;  5F3C A;  4XFI A;  3N36 A;  4QX1 A;  2HWB 2;  2CL2 A;  1OFN A;  4PHZ A;  1OPO A;  2EIG A;  4DEV A;  2HWD 2;  1ND2 A;  2HYX A;  3VKF C;  1AX2 A;  3DYO A;  1NAE A;  4A7Z A;  1GSL A;  2SBA A;  1UY0 A;  3WCR A;  3CJI B;  4OHX A;  1W6N B;  4BYY A;  2RMU 3;  3LFI A;  2DWR A;  1JOD A;  1F5F A;  3U78 A;  3RS6 A;  1VAV A;  1BMV 2;  1QOT A;  2MHF A;  5C8C A;  4WZF A;  1ASJ 3;  1XYN A;  2VW1 A;  1DG6 A;  5BNN C;  1D4M 2;  3MIG A;  4UI9 L;  3WY6 A;  4WM8 B;  1UPI A;  3BB6 A;  4XF4 A;  5F39 A;  3M70 A;  4HON A;  1Q8V A;  4OI2 A;  2FDJ A;  4COW A;  2RV9 A;  3T4H B;  5EHD A;  1ENQ A;  3U37 A;  1BYH A;  1KDK A;  2F17 A;  3ZO0 B;  4CCJ A;  2D97 A;  3UGF A;  1ULG A;  3CQO A;  2CWM A;  1H2M A;  3PTY A;  3VDC A;  1H4G A;  3I3M A;  2HWE 1;  3MID A;  4IXL A;  5L19 A;  3R4U A;  5T54 A;  1R1Z A;  3VHR A;  2RG4 A;  5CKN A;  2XKO A;  1UNB A;  1US2 A;  2DVB A;  3AFG A;  4N9I A;  1XSQ A;  4XE9 A;  4DY5 A;  3NST A;  4DXR A;  1RL3 A;  1JYX A;  1V00 A;  2VZR A;  1V6J A;  2X53 S;  4M4P A;  5B2G B;  1E5S A;  1X82 A;  2ORZ A;  2PHW A;  3BAL A;  2VCA A;  2PQS A;  4ORF A;  1NYW A;  1YI9 A;  5DZG A;  4W6W A;  2MNG A;  3RJ2 X;  1CZS A;  3U10 A;  4AK3 A;  3AC0 A;  3NW4 A;  1PX3 A;  3KQR A;  1LOD A;  3H7Y A;  4EWA A;  1W0O A;  3USS A;  3IT8 A;  3K51 A;  3VV1 A;  2XHN A;  1MS0 A;  5CG8 A;  1PO2 3;  2VQ0 A;  4MVT A;  3ZM8 A;  3O0V A;  3FC0 A;  4OHV A;  1JYN A;  3NJY A;  1REE A;  4HK8 A;  1JI6 A;  2Y60 A;  3PVN A;  4NIG A;  1YCI A;  5DG2 A;  1DGL A;  2PHU A;  5I93 A;  4LIU A;  3WIN E;  1LR5 A;  1QJZ A;  4CDU A;  4D6Q A;  2RS1 2;  5JZG B;  5FRA A;  1CIW A;  5C70 A;  1AZD A;  2C6S A;  3NNJ A;  1RUH 2;  4L9B A;  4BLJ A;  2VBP A;  2UWA A;  2PHD A;  3VHN A;  4R9A A;  2Y8K A;  4R9B A;  4F8A A;  3FMG A;  5FPX A;  2GH8 A;  4QX0 A;  4Z92 B;  2JG9 A;  1I9R A;  1W03 A;  1WLC A;  5KC5 A;  3F95 A;  4NIH A;  3R05 A;  3ITQ A;  3A7Q A;  3RGB A;  3TEX A;  2QQK A;  3USU B;  3GZA A;  5LY2 A;  1XQN A;  3GDB A;  1RUI 2;  1OT5 A;  1LHO A;  4I0B A;  4OZX A;  4L0P A;  4RR3 A;  3VBU C;  1CAW B;  4IGQ A;  4LK6 A;  3KT1 A;  3GAL A;  3BUC A;  3BOW A;  4JTO A;  4ZHN A;  1VBE 1;  5FPU A;  4CP1 A;  2EIE A;  1R08 1;  1J59 A;  2Y6K A;  5FK7 A;  1AJO A;  2QTW B;  4A4A A;  5BNO C;  1FXZ A;  1XNC A;  2QE3 A;  3IDB B;  4YVW C;  2EXH A;  4L99 A;  3L9J T;  1ZBE 1;  4XUR A;  5A1F A;  1XC6 A;  2ARA A;  3AYE A;  3GHN A;  1AR6 3;  4OYU A;  1LOC A;  1VB4 A;  2XGX A;  3N7K A;  4NPR A;  3TAY A;  3WW1 A;  2RMU 2;  2YBP A;  3S7E A;  1UY4 A;  4B29 A;  4F7Z A;  4DZG A;  5FZO B;  2D6O X;  3VUO A;  2BZD A;  1H6X A;  2XH6 A;  2B46 X;  1ULP A;  2RM2 3;  1ASJ 2;  2GC2 A;  3VD3 A;  1GOH A;  2W47 A;  2F4L A;  3JD7 3;  3SCG A;  4B7E A;  1NCQ A;  3ST7 A;  4XFF A;  3CJI C;  3TRS B;  2WWJ A;  4XDP A;  1MEC 2;  3Q8C A;  1EP0 A;  2ARB A;  1SPP A;  1DP0 A;  4OLL A;  5C3P A;  1RXG A;  1CX4 A;  2FDF A;  4CUB A;  2PHR A;  3I3Q A;  3OTF A;  3WDU A;  4NWW A;  2DTW A;  5IAV A;  4WM8 C;  4RGA A;  4D0Q A;  1XXN A;  5IYY A;  1FNZ A;  1ZZC A;  2VU9 A;  4LBM A;  5BPX A;  1CWP A;  4HMZ A;  1SQ4 A;  1ZNP A;  4K20 A;  3U1X A;  3PME A;  1GAN A;  2XXZ A;  1UCX A;  2VNR A;  1BK0 A;  3VZN A;  3ZN5 A;  1TMF 1;  4HSL A;  4K40 A;  4WM7 A;  4LBQ D;  4Q0V A;  3T09 A;  4FTS A;  1V9U 3;  3SC7 X;  2PHF A;  4R8H A;  4YNI A;  1XPW A;  1I3H A;  3JQW A;  3S30 A;  4XJZ A;  3WR0 A;  1QJY 3;  4ISQ A;  1AYN 3;  5C9A C;  4QKD A;  2YGL A;  4DO0 A;  2IFW A;  1VRH 3;  5FYS A;  3UGG A;  2QCS B;  3EBR A;  4A42 A;  2FCU A;  4GH4 A;  3VBS A;  3VKM A;  4CUC A;  1EYB A;  2ES3 A;  1W8T A;  3K75 B;  2C5D A;  1QH6 A;  1W8U A;  1ULF A;  1XNA A;  2JEC A;  1PMJ X;  1PO2 2;  3WNO A;  1PO1 1;  4J1W A;  5SV8 A;  2LS6 A;  4OUM A;  2XML A;  5LA0 A;  2VE1 A;  4MZU A;  4LHS A;  5F5C A;  3HQR A;  3K46 A;  1N3P A;  1ZX5 A;  5FZ1 A;  4KQ7 A;  1O4T A;  4OI0 A;  2JE9 A;  5DAX A;  3UT0 A;  1RUG 1;  5FYC A;  3H42 B;  4XPV A;  3SCH A;  4ZU4 A;  3D3A A;  2ZEW A;  2W08 A;  4FOQ A;  3CBN A;  1JZ6 A;  3JUU A;  1PGW 2;  1YNA A;  2PA7 A;  4BZ4 A;  3AZV A;  1A8M A;  2KR2 A;  3PJY A;  1UOG A;  3III A;  4BLI A;  3RZM A;  4R9D A;  3RG0 A;  3VL8 A;  2X29 A;  4GMP 0;  3N4M A;  3MLK A;  5FYT A;  1WMX A;  3WNX A;  4H7M A;  3WF0 A;  4RHV 2;  1M4W A;  5H9Q A;  4IE6 A;  1NUK A;  4MUV A;  2JE7 A;  4I2O A;  1IPJ A;  1HIX A;  2NN8 A;  3PUS A;  3THP A;  4A6S A;  3LSE A;  1KQR A;  4DXS A;  2VOW A;  1BCX A;  4MGS A;  3I49 A;  1OC1 A;  2Z4F A;  2R16 A;  3WG2 A;  3ZXD A;  1BKZ A;  4XJ9 A;  1AR6 2;  3CU7 A;  3V0B B;  3WNK A;  4DRV A;  1JYI A;  5L7O A;  4NUB A;  3V56 A;  4JQR A;  4XUT A;  5A1L A;  3ETQ A;  2Q1F A;  5FYM A;  3WHU A;  3O0X A;  2ZGU A;  2UWC A;  4P14 A;  1DZQ A;  2RM2 2;  3HNY M;  3JD7 2;  3QH7 A;  2CYF A;  4Q1P A;  2RDQ A;  5DAV A;  2O14 A;  3T2Q A;  1OBN A;  1DQ6 A;  2VUD A;  1SFP A;  1W39 A;  2ZGK A;  5DDJ 3;  4CDQ B;  1K5J A;  3H8O A;  3HJR A;  3O5S A;  4K3U A;  5KHK A;  2AEZ A;  3IMN A;  1OUS A;  3LSD A;  3I4I A;  3AKT A;  1QJX 1;  2JIG A;  4Y1Z A;  5C5U A;  2WNV B;  3Q8A A;  5FY1 A;  5LA2 A;  3FWE A;  4NJ4 A;  3VD4 A;  2QZ2 A;  2XWB B;  1XNT A;  4QPG B;  3ZXG A;  1YQ6 A;  4BPZ A;  2OPK A;  1YRZ A;  3AVR A;  2VEC A;  2XJT A;  4GJY A;  2VY0 A;  2B4K A;  1KFU L;  2RDN A;  2P37 A;  1V9U 2;  3BPZ A;  3HIF A;  2EAK A;  5AVP A;  1RVF 2;  5FKC A;  5JOX A;  1R1A 3;  1CGP A;  3ACH A;  1QJY 2;  3OBA A;  1AYN 2;  2VCM A;  3K77 A;  4HL0 A;  2PAE A;  1VRH 2;  1W9W A;  3ZR6 A;  1AVB A;  1FNY A;  1ZA4 A;  2RS5 3;  2XL9 A;  5K4L A;  4Y1U A;  4NAO A;  3ZN4 A;  5C3O A;  3M1H A;  5FYV A;  1BBT 3;  2H0B A;  2WS9 1;  1PIV 3;  1UU5 A;  2DYC A;  3WQ1 A;  4Y26 A;  1PNG A;  1OA3 A;  1VAM A;  2VCC A;  1ZA7 A;  4K8R B;  2EXJ A;  4LO5 B;  4PLO A;  1OF4 A;  1OKQ A;  4L8Q A;  2P3K A;  3MO4 A;  2SLI A;  5FZ6 A;  3WP3 A;  3LGR A;  1EAH 3;  5L9V A;  5FCC A;  2OVU A;  1B35 B;  4N53 B;  2WL1 A;  3WP4 A;  1MVQ A;  4YG3 A;  1GQG A;  1R09 3;  2VOX A;  4GA9 A;  3ZFF B;  5FPA A;  3NAP B;  5IVB A;  3H3Z A;  4BQ3 A;  1G9D A;  5FBZ A;  3ZSJ A;  1VR3 A;  5EV7 A;  4YYO A;  4E4D X;  2RS3 1;  3JBG 1;  4QQL A;  5JIA A;  1LRH A;  3BTA A;  4EQV A;  3VBH A;  5HV0 A;  2Q8C A;  1ST8 A;  4IEW A;  5F3E A;  3M8L A;  4NHX A;  1LEN A;  3B93 A;  3DN7 A;  2JD4 A;  2CTV A;  1BVP 1;  1GU3 A;  1UZ0 A;  1W6Q A;  2RHP A;  3PU3 A;  4J6G A;  5DQ0 A;  3WUD A;  1ZZ8 A;  3ZKY A;  5GZG A;  3PMS A;  3AKQ A;  2PHX A;  4LUK A;  5CYY A;  4BH9 A;  1PK6 A;  3BOP A;  2AYH A;  3WNM A;  1IQD C;  4J1X A;  1CAU A;  4PJY A;  5FWJ A;  1U0A A;  2XVG A;  1ENR A;  2XJU A;  1MS4 A;  4FPY A;  4CCO A;  4Q4W 3;  2VGD A;  3I59 A;  5JR7 B;  4XVH A;  1S2B A;  3POS A;  1VB2 A;  4JZR A;  4YW6 A;  1DIW A;  1G86 A;  2D98 A;  3RZK A;  2P5B A;  3C2U A;  4KBZ A;  2YV8 A;  4AHZ A;  4CPB D;  4UAP A;  4NN0 A;  4LE4 A;  1LOA A;  5DAP A;  5FLJ A;  5JIU A;  2VCB A;  5KHG A;  2VXR A;  1H1M A;  4CDX A;  1QNY A;  4P9W A;  5DAB A;  1UYY A;  1UMH A;  3MI8 A;  4FPE A;  4MGY E;  5DDJ 2;  3ZXE A;  4LNV A;  1ODM A;  1VIW B;  3OYW A;  3LWC A;  1JHJ A;  3AJY A;  4Q1R A;  5J96 B;  4R9C A;  2I2S A;  2X5I C;  1BQP A;  1CPM A;  2DUQ A;  4JRL A;  1YHF A;  2JDU A;  1E57 A;  2VL4 A;  2ZX1 A;  3E6D A;  2R04 3;  2WNV C;  2Y0I A;  5DN2 A;  5JOZ A;  5BXX A;  3S5A A;  4KBB A;  1YUD A;  2BRT A;  1N1V A;  5FPV A;  3CJX A;  4KWJ A;  3UK9 A;  3ZFE B;  3GYD A;  2ZAB A;  1R1A 2;  3PU8 A;  3QCW A;  4AVV A;  1MQT B;  3WEZ A;  3BGA A;  4IV3 C;  4QKF A;  1S55 A;  3IN9 A;  3RZJ A;  1YJL A;  4UT5 A;  3AP6 A;  3LA2 A;  2NQY A;  1STM A;  3KD4 A;  4FPC A;  4H14 A;  2PMW B;  4K8F A;  3V64 A;  2RS5 2;  1AF9 A;  1RUF 2;  3VBF A;  1QQP 2;  1W9T A;  1BBT 2;  4QB2 A;  4RFT 0;  3LF7 A;  5CFC A;  3TEY A;  1PIV 2;  2DFC A;  2R49 A;  1TNR A;  5G05 L;  4BME A;  4E8D A;  3HT2 A;  3K48 A;  1N47 A;  4XTM A;  5KXC A;  3BOD A;  3J7H A;  1PMI A;  4AE2 A;  1FPN 3;  1U5I A;  3BU7 A;  3Q8E A;  3CEW A;  1AYM 1;  5HCH A;  3N9L A;  3FFZ A;  5EP9 A;  2R6Q A;  3LA7 A;  4Y22 B;  1AXZ A;  1EAH 2;  2FQP A;  1LTE A;  4GJZ A;  4LO8 A;  4WBB A;  4AWD A;  1GYK A;  3M4F A;  1F9K A;  4WVW A;  4L92 A;  3WHT A;  3ZXK A;  4CDW A;  4HVQ A;  4AVA A;  2W87 A;  3D82 A;  1H0B A;  4GQ7 A;  1R09 2;  3TN9 3;  4AI9 A;  5K7P A;  2CNA A;  2BPA 2;  4MGZ E;  3T08 A;  1BLZ A;  3IPV B;  4LKS A;  5FTT C;  1AL2 3;  4FPK A;  5FZE A;  2ZEY A;  3MIE A;  5FXW A;  4DUV A;  2RR1 3;  3B02 A;  3ETP A;  1IKQ A;  2W52 A;  4R4Z A;  5ACA 3;  1GLH A;  5JR2 A;  2VG9 A;  4N7U A;  3ZFF C;  2UU8 A;  3KLS A;  4NII A;  4AQT A;  5IVE A;  1JZ2 A;  3MF6 A;  4IV1 B;  2D5H A;  4CU7 A;  3T1L A;  1MZ6 A;  1POV 3;  1TNF A;  2VME A;  3MIF A;  1ASJ 1;  2J42 A;  3N35 A;  3OSD A;  5FZK A;  1NLS A;  3VDD A;  1X50 A;  1SAC A;  2JDP A;  4LK7 A;  1HN1 A;  2OW4 A;  4OHZ A;  5FQ0 A;  1JYT A;  1XE0 A;  3VB9 A;  3A23 A;  4Q4W 2;  3OPT A;  5GLV A;  1EPW A;  2BGO A;  4WVM B;  5FY8 A;  2CGN A;  2ADD A;  5C4W B;  1Y4W A;  1UL9 A;  3NJZ A;  1RUE 1;  4Q4Y 3;  3WDX A;  2WYS A;  3FE5 A;  3I2F A;  4ES9 A;  1OOP B;  4I0A A;  4IER A;  3B9I A;  1HRI 3;  3GJA A;  4QXB A;  1ZZ9 A;  3Q8F A;  4W50 A;  3I2O A;  2PAM A;  5GZC A;  1QWR A;  3RI9 A;  3IIA A;  1O91 A;  2Q8E A;  4B1L A;  2Z5W A;  1QU0 A;  1QEX A;  5JLV A;  2E7Q A;  3L2H A;  4KU7 A;  3KF3 A;  4OHW A;  2QDR A;  2WFF 3;  4RQP A;  1OVS A;  1AXK A;  5A70 A;  2CU5 A;  1IZ3 A;  1ND2 B;  1YFX A;  4LBK A;  2WO7 A;  1VAK A;  5FLH A;  3URF A;  4RS5 C;  4UFM A;  4FAH A;  2R04 2;  4AAX A;  2XHK A;  1SBE A;  4IEV A;  4QQH A;  5LY1 A;  2B39 A;  2VUL A;  4EN7 B;  5C8C B;  3THC A;  2O8Q A;  1GBG A;  2XUM A;  3NJX A;  4AHY A;  5FPB A;  1TVG A;  2GMP A;  5FZL A;  2VTX J;  5LBF A;  2WA3 A;  4AVC A;  1HB2 A;  1JU4 A;  4JGY A;  1WKY A;  4X6R B;  4XUP A;  4GZ9 A;  3GBF A;  2W1Q A;  1VBD 1;  3ZFE C;  4AVS A;  3JQX A;  4AG4 A;  2JIJ A;  1PGW 1;  4LO7 A;  4GWM A;  1O4Y A;  1MQT C;  2ZBJ A;  3W21 A;  1SMV A;  3LEM A;  4IE5 A;  1C1L A;  1GMM A;  2J1U A;  3WCS A;  3NWK A;  1YIF A;  4AI8 A;  4HLT A;  1D2Q A;  4I01 A;  5F1R A;  3FHQ A;  3TBD A;  4OMD A;  5F5A A;  3VL9 A;  2TBV A;  3HN3 A;  4Q8L A;  1JYV A;  5FBJ A;  1DGR A;  1OHF A;  4XOG A;  4JDO A;  4ZS2 A;  1RJ8 A;  4QD2 A;  1KEX A;  1J3Q A;  1ACC A;  3H7J A;  5KXE A;  5LEK A;  1US3 A;  4CYD A;  3TN9 2;  3TYJ A;  4ZU5 A;  1J1L A;  3ZYP A;  1V6L A;  2Y6F A;  3OBT A;  4N43 C;  4WV8 A;  3I3B A;  4AR2 A;  5FXZ A;  2F6B A;  3CNA A;  2RR1 2;  1IKP A;  2NMN A;  2DCZ A;  4GMP 1;  4NHK A;  3SH5 A;  4AED B;  2WT2 A;  4TN7 A;  5A7W A;  4EWD A;  2ZPX A;  1UOJ A;  2Q5T A;  3I2J A;  3U4X A;  3RYP A;  4KMQ A;  4EN9 B;  2GU9 A;  2VXJ A;  1KFX L;  2WT0 A;  2WII B;  1AR7 3;  1QOO A;  4QQP A;  3RMY A;  2JG8 A;  4LKF A;  1QJU 1;  2V5D A;  2YZ4 A;  1OH3 A;  1IS6 A;  2BWC A;  2A6W A;  4NRM A;  5FZB A;  1I6X A;  4U36 A;  4CDU B;  3TEZ A;  3WQB A;  2DUO A;  3A4U A;  2E7A A;  4GUL A;  5E16 A;  2VUA A;  1C8M 1;  2O8O A;  4LBO A;  3WP5 A;  1CON A;  2K9Z A;  1WWY A;  2VM9 A;  5FZ4 A;  1GUI A;  4KGQ A;  4A3Z A;  3NV3 A;  1UOF A;  1TME 3;  1RUD 3;  2JG9 B;  3AMH A;  2HWB 3;  2CAU A;  4Q4Y 2;  1ZRD A;  4GIQ A;  3PUQ A;  4HFS A;  2H6C A;  2DUP A;  4IEZ A;  2GP3 A;  4O65 A;  1BHG A;  4YZ1 A;  1HRI 2;  4ISR A;  3B69 A;  2WO3 A;  5C4W C;  2ZGT A;  5CZK A;  4AGV A;  1VMJ A;  5HPO A;  1LHN A;  1IQA A;  4X8P A;  1OOP C;  1IS5 A;  1OA4 A;  1WUV A;  2GZW A;  3EMR A;  3WF3 A;  3ZX7 A;  3ALQ A;  4RYD A;  3ZIW A;  3D6E A;  2ADE A;  1VRB A;  1VRH 1;  2WFF 2;  3I2D A;  1QOS A;  1H8T B;  4NRQ A;  2D40 A;  3LKJ A;  3H8X A;  1WME A;  5CVR A;  2A1X A;  4H55 A;  2NMO A;  2B9U A;  2YC2 A;  4OVE A;  4PBP A;  1S0B A;  1NQD A;  1NLR A;  4QX7 A;  3DPR C;  4Q4X 3;  3IM0 A;  1OQE A;  4UFL A;  4ZS3 A;  1VBA 1;  3RZZ A;  4EN6 B;  4OUE A;  3O1O A;  2WNU C;  2VVF A;  2WZR 1;  1LUL A;  1GZC A;  4GB3 1;  4UOJ A;  3WF1 A;  1NCQ B;  2OT7 A;  2XQR A;  1G9A A;  2P3Y A;  2JE8 A;  1SPP B;  1ND3 C;  4AAP A;  2KA3 A;  2HWC 1;  4PF5 A;  1E5I A;  4DUX A;  5I91 A;  1ZRI A;  5C3Q A;  5C8C C;  2BNO A;  2LW8 A;  5J48 A;  1RUJ 3;  4P9X A;  1ZZ6 A;  5ANN A;  4C1W A;  5JI9 A;  5F8P A;  2UYB A;  4FTB A;  5E88 A;  4OQ8 A;  1WBL A;  2BOJ A;  3U4S A;  1UY3 A;  2GP5 A;  2YG0 A;  1WMD A;  2BFU S;  1W6P A;  3HT1 A;  4UW3 A;  1KJR A;  4IEY A;  4QQO A;  4HZF A;  5J1X A;  4WM7 B;  4PIY A;  4QM8 A;  2D43 A;  1Q56 A;  3OCP A;  1F15 A;  2OZJ A;  3MEP A;  3P1I A;  3RWN A;  1NZI A;  1BXH A;  1IPK A;  2VMC A;  5LA9 A;  1W2T A;  2VR4 A;  3KV5 A;  4ET7 A;  4YRD A;  1W6O A;  5FOJ B;  3UNP A;  1RHI 3;  3W5N A;  3PVB B;  1WCU A;  1OMI A;  4FOW A;  4GH4 B;  5L9B A;  3VBS B;  1WD4 A;  3H3L A;  2RS1 3;  2Y38 A;  3J8F 1;  4Y20 A;  1JXN A;  2IXH A;  2E26 A;  1Q8S A;  4XJA A;  2W91 A;  1WCK A;  3UV9 A;  4YFZ A;  1KGY A;  1SLB A;  1UZW A;  4XFG A;  3N7M A;  4BK5 A;  4DUW A;  1AR7 2;  3AL6 A;  3LAG A;  3POE A;  2G9G A;  5E89 A;  5FUI A;  2VZP A;  3CLP A;  2HWF 3;  1YIP A;  4IDZ A;  4AED C;  3KVA A;  3UES A;  3HBK A;  1RXF A;  1A34 A;  5EJ1 B;  1J1T A;  2OA2 A;  5GKA C;  5CKQ A;  4YPJ A;  3O7O A;  4KG0 A;  4MYE A;  2HBT A;  4CP9 A;  5I8Y A;  2EAA A;  3LB9 A;  2VZT A;  1FV2 A;  2WN2 A;  2WZP P;  1AJK A;  1UOB A;  4CDU C;  1TME 2;  1RUD 2;  1WA6 X;  2IUW A;  2FD8 A;  3ON7 A;  4TWT A;  1XNK A;  3A0N A;  1XJA A;  4GWN A;  2TEP A;  2VC9 A;  4CEY A;  2YMZ A;  4PQ9 A;  4AXO A;  5D21 A;  2QKD A;  3WLU A;  4AFA A;  3KHC A;  2DCK A;  3OBZ A;  4HG6 B;  1WW5 A;  5DXD A;  2QQN A;  1MS8 A;  2WWS A;  2Y6L A;  1SDW A;  1HLC A;  5FZD A;  2ORX A;  3ZYF A;  5FYU A;  5FP3 A;  5FY5 A;  4B1M A;  5FMO S;  4PDW B;  3HQU A;  2XJQ A;  4XMI A;  4MAD A;  3FN9 A;  1MEC 3;  1RIN A;  1AX0 A;  5JDB A;  4XXP A;  4K6B A;  3N9P A;  4NRP A;  5DUW A;  1GWL A;  1NG0 A;  2VZS A;  2VPV A;  3IZO A;  5L7O B;  1O6U A;  2AEN A;  4CEW C;  4Q4X 2;  1QGL A;  1H8T C;  2OII A;  3WVJ A;  2R7E B;  5KWR A;  4FPL A;  4Z2W A;  3WDW A;  4BQW A;  2XG3 A;  1DQ0 A;  5FPL A;  2PEL A;  3BYW A;  4CXX A;  2NZ9 A;  1EUU A;  3BTX A;  4DRR A;  3B94 A;  2ZKN A;  1L7Q A;  2W1W A;  5FZM A;  2WLP A;  4DEQ A;  1NA1 A;  1Z7S 2;  1RUJ 2;  4HKO A;  1F2N A;  1V6I A;  3CF6 E;  4XDO A;  4IES A;  3VBO C;  3POJ A;  2JB8 A;  5M0T A;  1KJL A;  3B00 A;  2VOV A;  2P6C A;  2WNO A;  4XCB A;  2C0Z A;  3EHK A;  4XIL A;  4YVS B;  1GP4 A;  4L2N A;  4LBQ A;  2WYF A;  3SQO A;  2XBO 3;  3KGZ A;  5A3L A;  1RMU 1;  2VMF A;  4LPL A;  5A3U A;  5E8A A;  2VZU A;  3HWJ A;  3WF4 A;  5IK7 A;  3H8R A;  3AMQ A;  1DQ4 A;  3DV8 A;  1W9S A;  3BTY A;  3PVE A;  5IAX A;  1RHI 2;  2ARX A;  3ABZ A;  2JX9 A;  4KGG A;  4UWD A;  2Q8O A;  2NM1 A;  2Y34 A;  5JMC A;  1UN1 A;  2EID A;  2R07 3;  2QJV A;  3PUR A;  3ZXL A;  3GNE A;  4YWA A;  3VBR A;  1W8F A;  1WBF A;  2J7M A;  3VZK A;  4AEM A;  2A5Z A;  1C4R A;  4ZY9 A;  2C26 A;  4QPI A;  5BNQ A;  1S4C A;  1MS3 A;  2OQ6 A;  4IGP A;  2MEV 3;  3MGU A;  4AYU A;  3FBY A;  4GD4 A;  1GZW A;  3MFC A;  1O7F A;  4QWN A;  4O7X A;  4BMB A;  1GIC A;  2ZAC A;  3I2G A;  4JX0 A;  4E8C A;  2D6M A;  2HWF 2;  3C7H A;  2XWJ B;  4FI9 A;  4XW3 A;  2GSY A;  1XE7 A;  5J7M A;  3OD0 A;  1IHM A;  4RHV 3;  2FBE A;  1H8V A;  2D3R A;  4XHX A;  2ETE A;  2QQW A;  2IXI A;  3EYP A;  3DGT A;  1N1Y A;  5JWP A;  4XC9 A;  5F6K A;  2VOT A;  3RMX A;  2OS2 A;  5FDB A;  2DVF A;  2JKX A;  3C8X A;  5A3M A;  2WQ8 A;  3N3H A;  1NKG A;  2GDF A;  5A3T A;  5DAQ A;  5BUV A;  3NO8 A;  4IQP A;  4QXC A;  4QX3 A;  5L36 A;  3VHP A;  2XON A;  4GWI A;  1BZW A;  4QGL A;  4YW1 A;  1LHW A;  3KCY A;  3K4D A;  1O3Q A;  1LB2 A;  3DKW A;  4AHW A;  4BIO A;  2GC1 A;  3KQ4 B;  3VHO A;  1JHN A;  1PK6 B;  3I7D A;  4DS0 A;  5BNN A;  4HOO A;  1CAU B;  2PN5 A;  3ENR A;  5A6Y A;  3OGV A;  2CWS A;  4RSU A;  4IUG A;  2Y6J A;  1X8E A;  5DAW A;  4QX2 A;  1COV 1;  1UD1 A;  3I59 B;  3ILR A;  3S7I A;  3DYM A;  1ODN A;  3ZVX A;  4YZ3 A;  1S0C A;  2OXB A;  4NWV A;  1NQJ A;  2FHR A;  4HBN A;  4PDW C;  5GLT A;  1LGN A;  4OI4 A;  3PDQ A;  5T55 A;  2KXL A;  1WGP A;  2JXA A;  3QBQ A;  1FPN 1;  2VVD A;  3SKV A;  1GOG A;  3KCX A;  4IEQ A;  4TSV A;  5A7S A;  3ZN6 A;  4NR1 A;  1OFS A;  4FPJ A;  3OPZ A;  3WP6 A;  3OYW B;  2BUK A;  4LO4 B;  5EIY B;  1RVF 3;  3AMM A;  4Z07 A;  3CZU A;  4LBL A;  5KHI A;  2W92 A;  4P5H A;  4HKL A;  1W8Z A;  1L3J A;  1JZ5 A;  1JZ4 A;  2BBA A;  1AL2 1;  3ES1 A;  5JUV A;  1UX6 A;  3MZH A;  3NVC A;  1W3V A;  5C5T A;  1FI2 A;  2BTV C;  2ET7 A;  3GHM A;  1SDD B;  4M00 A;  5ACA 1;  1CAX A;  5JSO A;  3AXD A;  1OQD A;  1SCS A;  3KHB A;  2QQO A;  3A22 A;  1V6M A;  5FZH A;  1YFW A;  2XBO 2;  2JEM A;  3W59 A;  3OEB A;  4K21 A;  4XUQ A;  3TNP B;  1N1S A;  4NHL A;  1HB1 A;  5CIR A;  4YVS C;  1UQX A;  4AEJ A;  2WLQ A;  4CXY A;  1SZB A;  4D7S A;  5IVF A;  4QU1 A;  5BY5 A;  4NPM A;  4YSF A;  2R07 2;  2EAL A;  1KS5 A;  1LOF C;  1EV1 3;  5A7N A;  1AR9 3;  3LFM A;  4Q4V 1;  2DU1 A;  1MS1 A;  1PM7 A;  5I0U A;  3VBF B;  1QMJ A;  5CFC B;  2XUE A;  1VMF A;  5J36 A;  1NLQ A;  4XQ4 A;  3E5X A;  4K7J A;  2MEV 2;  4AQ2 A;  3ZPY A;  2V09 A;  4LIT A;  4QAW A;  4XXA A;  1OD3 A;  3T0D A;  5FO7 B;  3T4V A;  5JZG C;  3LDK A;  5J09 A;  4IE0 A;  5EYX A;  4CCE A;  5B4N A;  4HVR A;  3OUJ A;  3VBU A;  1GP5 A;  1H9P A;  2P6H A;  2CAV A;  4WZC A;  3RDI A;  4P00 B;  5BNP A;  5LCW L;  3AKS A;  2JDN A;  1UXX X;  4QB6 A;  3OGS A;  2UY8 A;  1GP6 A;  2ZGS A;  3PHM A;  1LKN A;  4Z82 A;  5ANQ A;  2WFF 1;  2ARE A;  1WCS A;  5BNO A;  3MW3 A;  3BI3 A;  1SBD A;  2I07 B;  5EWS A;  1PGL 2;  1G9B A;  3ES4 A;  5IK5 A;  3S5Q A;  3GXU A;  4UXA A;  2CV6 A;  4E27 A;  2GME A;  2QQP A;  4MHU A;  1FMD 3;  5KXD A;  4FPO B;  3WG4 A;  5LBB A;  4AHX A;  5A32 A;  1UZV A;  2D3P A;  3D0J A;  1LHV A;  2LM3 A;  4QGN A;  2IFR A;  4Q0Q A;  5FUP A;  2QZ3 A;  1F35 A;  3IWZ A;  1S0J A;  1L7R A;  2ZX3 A;  4YGC A;  3FUQ A;  3EJK A;  3L2Y A;  3MYX A;  4O9E A;  2D6K A;  4MXV A;  4C90 A;  1LEM A;  5C3S A;  2W9X A;  2WSV A;  3CJI A;  1JZ3 A;  4N8M A;  4BIS A;  1SBF A;  4SLI A;  2HEW F;  1WLT A;  3J7L A;  4AI2 A;  1W8W A;  4QKB A;  1YWK A;  3ZFG B;  2HBU A;  3KT7 A;  1HXS 3;  2AUY A;  2OQ7 A;  4BQY A;  4FP2 A;  5EJ3 A;  4UBG A;  1FV3 A;  5IFT A;  4CPB A;  3N9M A;  2G1M A;  4HXC A;  4BCU A;  4WM8 A;  1AL0 G;  4Q2F A;  3X29 B;  5C6C A;  1BEV 1;  5ABJ B;  4BXS V;  5F9T A;  4COY A;  4Z1V A;  1CES A;  4GXL A;  1FAT A;  1QH7 A;  2VZV A;  3T0B A;  4AL9 A;  4AI1 A;  5FO9 B;  3LE0 A;  3DYP A;  1IS3 A;  1AR8 1;  1FOD 3;  2XQX A;  5JXH A;  1EY2 A;  4EN8 B;  2Q30 A;  4RQP B;  4W8J A;  4LO6 B;  3LOI A;  5C9A A;  5FR3 A;  4E4Z A;  2R06 3;  3N9Q A;  3QLQ A;  3IDA A;  1L7L A;  4UFJ A;  5IK4 A;  4ARX A;  2WFP A;  5JCT A;  2VH9 A;  1HRV 2;  4LUM A;  2QUO A;  4MX3 A;  1HV1 A;  4TLG A;  1RUF 3;  1QQP 3;  1REF A;  2DBN A;  4UFI A;  1JS9 A;  1GWM A;  4BQ2 A;  2J1S A;  5AFE A;  2FDH A;  1H2K A;  1N1T A;  1MAC A;  2XVL A;  3D5O A;  3EXU A;  5GJ6 A;  2X05 A;  4I09 A;  3SCF A;  4AI3 A;  1H2L A;  1H1A A;  3LD8 A;  3M3Q A;  4JGY B;  4EWE A;  1VBC 3;  3RJR A;  5DUV A;  5H9S A;  3UYJ A;  1EV1 2;  2PLV 1;  1AR9 2;  1XND A;  2EIC A;  3H3U A;  4GKX A;  4CCK A;  2ZZQ A;  4FFH A;  3VZM A;  1G7Y A;  2HWB 1;  4CRQ A;  2BFU L;  3ASI A;  4XF9 A;  5JXI A;  3EQE A;  2HWD 1;  1XU1 A;  5FYY A;  4QDQ A;  3UET A;  3VBF C;  4DNY A;  1OF3 A;  1QXP A;  2D93 A;  2GC0 A;  2ZOE B;  2QQU A;  5D8A A;  1BJQ A;  5FOB B;  3HR9 A;  2CGO A;  2GNB A;  2AR6 A;  3BTZ A;  3ZXA C;  1XOY A;  1C8N A;  3BKZ A;  1BMV 1;  2HWE 3;  1C3H A;  1QIQ A;  4QM9 A;  4BWO A;  1NCR B;  2XB6 C;  1T2X A;  2D5F A;  1D4M 1;  1C1F A;  1Q5O A;  4BHP A;  3SKJ E;  2D7F A;  1UMI A;  1Y3T A;  4I30 A;  4M01 A;  3O1S A;  4CA9 A;  4DIQ A;  5KBF A;  5A7W B;  1FMD 2;  1PM4 A;  2YYO A;  4ZPI A;  3DUI A;  3K3N A;  5LRR A;  3O0W A;  1RGS A;  3R0R A;  4JHT A;  2JG8 B;  4ASL A;  3AM2 A;  3ZSM A;  5LZ6 A;  2W0X A;  3ZR5 A;  1QDC A;  3JU9 A;  4G9S B;  1GZ9 A;  2VZQ A;  3AFK A;  2G9Z A;  3VZL A;  1HX6 A;  1HJF A;  3J4U H;  2QQM A;  3NMB A;  1C28 A;  3KZ4 C;  1JOB A;  2HEV F;  3WF2 A;  3H8U A;  1EUT A;  1HXS 2;  2ZAH A;  3AZW A;  5LAS A;  5JPM B;  2Q1M A;  1DHK B;  1FX5 A;  4HN1 A;  2O0O A;  2VAU A;  3WNP A;  2GAU A;  4D8M A;  1YQC A;  2VBD A;  5FY4 A;  1VBB 3;  5FZF A;  3WOG A;  1ULO A;  3LEK A;  3ZFG C;  3J7N A;  5FYI A;  5FZA A;  4BB3 A;  4BE3 A;  4CDQ C;  3AP4 A;  5D1I A;  2A6Z A;  3WW3 A;  3B9C A;  2D44 A;  4JC1 A;  4MOA A;  2HJI A;  3KGL A;  2EF6 A;  2DCJ A;  3T2T A;  2D6L X;  1FOD 2;  4MXW B;  5ABJ C;  1SG3 A;  4DY3 A;  2FDG A;  4JQT A;  4YFW A;  4QPG C;  5FZG A;  1K5M B;  5FMO L;  3O1T A;  4KG8 A;  4QPW A;  2FZ2 A;  2R06 2;  1MZ5 A;  2RS1 1;  4JGZ A;  4NRO A;  3ZYH A;  4IET A;  1RUH 1;  3GF6 A;  3FJS A;  2ZGR A;  5D2A A;  4E2S A;  1G6N A;  5FZC A;  5C33 A;  4GWJ A;  1HJG A;  2VZ1 A;  2DU0 A;  2XVK A;  5IVJ A;  3ATG A;  5EPA A;  4C8D A;  4BM8 A;  4XHB A;  1GQP A;  1UIJ A;  2ZA9 A;  4FCA A;  2A71 A;  2IC1 A;  3SXW A;  1RUI 1;  4FFI A;  4LIV A;  1QJE A;  1VBC 2;  2ZX4 A;  5GLZ A;  3K2O A;  3W5M A;  1DCS A;  2PHT A;  3NNM A;  1CAV B;  4A2U A;  1SLL A;  2ZGM A;  2V4A A;  3KV4 A;  4YW7 A;  5FMB A;  4BJ0 A;  3DCQ A;  4URA A;  3MIB A;  3THT A;  4A41 A;  5GLW A;  2YBS A;  3ILN A;  4NHM A;  1LJ7 A;  1W6P B;  4OUL A;  3Q8B A;  4FPF A;  4UF0 A;  2NYY A;  1YYN A;  5F32 A;  2FDI A;  2DVG A;  1UYP A;  3AKR A;  3AZX A;  1NOV A;  3B3Q E;  1B35 C;  3IAQ A;  4N53 C;  3U07 A;  4AEK A;  5E6H A;  1DU3 D;  2Y26 A;  4CTE A;  4DB5 A;  2RMU 1;  2ATF A;  4Q26 A;  3O1U A;  3MBW A;  3NAP C;  4C1X A;  4LOR A;  2WNE A;  4TXW A;  2HWE 2;  3M3E A;  4HPK A;  4YM0 A;  4QGM A;  1GNH A;  1W6O B;  2QQV A;  4S2H A;  5T52 A;  1VJ2 A;  4GKY A;  2Y6G A;  3TWI A;  1VE0 A;  1TMF 3;  3ZPO A;  4Y20 B;  1MEC 1;  1DGR N;  3FLR A;  4UW4 A;  2J1A A;  5DPN A;  2IVI B;  2WZE A;  4FVV A;  2JDZ A;  2E7T A;  4MH0 E;  4DOU A;  4FQ4 A;  4Y1X A;  5B4X A;  5JSR A;  1U5Y A;  1NCR C;  5ERL A;  2UWB A;  1TE1 B;  3KMH A;  2H6B A;  2ID4 A;  4XET A;  4V1P A;  4BU2 A;  1CD3 G;  2R32 A;  5FYZ A;  4BXF A;  5FZ9 A;  5CFD B;  3TNQ A;  1M06 G;  4IND A;  2KM2 A;  3ZSE A;  3BIW E;  5DZF A;  4XJU A;  2IXK A;  1PO1 3;  4QMA A;  5ISL A;  2W5F A;  2JG8 C;  4MO3 M;  4ARY A;  1ENX A;  2A6X A;  1LES A;  2P1B A;  4CP9 B;  4W6X A;  1J3P A;  3JCI A;  1ENS A;  2P3I A;  3VKO A;  5I8T A;  4Y3O A;  2QBX A;  4IEU A;  3J7M A;  4UW5 A;  1OH4 A;  2X5I A;  1RUG 3;  1ULC A;  1ZVF A;  2BDR A;  1PX4 A;  1VBB 2;  3I2I A;  4CEY B;  1XNB A;  3APB A;  3NV4 A;  1W9Y A;  2A3Y A;  3H50 A;  3OG2 A;  2DCY A;  2ZHL A;  2GAL A;  2ZKL A;  3VDA A;  4EZH A;  3AYD A;  4G4F A;  4LJH A;  3KWV A;  4LR4 A;  4PIZ A;  3RI8 A;  1PO2 1;  5IVY A;  4XCA A;  3WNL A;  2LRO A;  4PF1 A;  2VW0 A;  1HB4 A;  4URT A;  3IBM A;  1H9W A;  4QKN A;  5CNA A;  3AYA A;  4XYX A;  4R4X A;  1QKQ A;  3NL1 A;  5FP9 A;  1YFY A;  3ME2 A;  1OPM A;  2A70 A;  4IV3 A;  4AVB A;  4ERO A;  2B8M A;  1W8H A;  2ZEZ A;  1O3T A;  2Z79 A;  3HNM A;  1VBE 2;  4P02 B;  4ZKT B;  2HEY F;  2GMM A;  1R08 2;  2PFW A;  1K5M C;  3KVB A;  3POY A;  4P5Y A;  3WUC A;  4ATE A;  3ZSK A;  1DZR A;  1JUH A;  1WW6 A;  3OUI A;  5AC9 3;  1ONA A;  1JTZ X;  3GZU C;  2C4X A;  1GV9 A;  2BER A;  4G3Y C;  5I0T A;  4RHV 1;  1NA1 B;  4RGK A;  4YGD A;  1KIT A;  1S0D A;  4NAM A;  3RZH A;  5LWB A;  1POV 0;  3NNF A;  4CUA A;  1DQ2 A;  5K8S A;  1JZ7 A;  3AX4 A;  2G9F A;  4Y5Z 0;  3SH4 A;  1YC6 1;  4AVT A;  2B7Y A;  1AUY A;  3M3C A;  4XFC A;  2WO1 A;  4O61 A;  5A80 A;  1ZZ7 A;  4B8E A;  5KR7 A;  2HH9 A;  1ZBA 3;  1NT0 A;  1QJX 3;  2R0F A;  1F4H A;  1AR6 1;  4PLN A;  2IWG B;  1CJD A;  2E32 A;  3M2M A;  5JI7 A;  3S57 A;  1RJ7 A;  1W2O A;  1NE6 A;  3FUO A;  3O1R A;  4L11 A;  1X7N A;  3KT4 A;  3O1V A;  1TZO A;  4QT6 A;  1I1E A;  1MVE A;  2RM2 1;  4DPN A;  1WW7 A;  3JD7 1;  4YG6 A;  3DXT A;  5F5Q A;  1TMF 2;  4XQD A;  5HXM A;  1IGO A;  5KC6 A;  1HB3 A;  1YI7 A;  3T2P A;  1YLL A;  4UYB A;  1ALY A;  4IV1 C;  4LHN A;  2ZCW A;  4QPI B;  5EZW A;  3HNB M;  3NJV A;  3FHA A;  5I8S A;  1D0H A;  5FZ7 A;  2VMH A;  1UWW A;  1WLW A;  4AQS A;  1K12 A;  5FFO C;  2J1E A;  1QY4 A;  3G7D A;  1UAI A;  2VTF A;  2AZ5 A;  3WZ1 A;  1CR7 A;  1J83 A;  2XLG A;  5A6X A;  3AK0 A;  1XRU A;  2VBB A;  1GNZ A;  3HEI A;  4P08 A;  4LKD A;  1CVN A;  2WS9 3;  4LT5 A;  4RR3 B;  3T2O A;  2Z69 A;  1A78 A;  1PO1 2;  1CZT A;  3G6J B;  1V9U 1;  1W8O A;  2RJ2 A;  4QHZ A;  2W1U A;  5HCF A;  1MZE A;  1RVF 1;  3ACI A;  2CY6 A;  2EIB A;  3H1M A;  4E2Q A;  5CFD C;  2FZ1 A;  2BGC A;  1QJY 1;  3D4K A;  1AYN 1;  2Y64 A;  1A3K A;  3MUY 1;  4LEJ A;  3RNS A;  2WT1 A;  3LDB A;  1RUG 2;  5FJH A;  1W05 A;  4XZP A;  3PJQ A;  4TLF A;  3OB8 A;  4KWU A;  4RS5 A;  5CKM A;  5LB6 A;  5JMO A;  3GM8 A;  3PUH A;  2X09 A;  5T50 A;  3GZT B;  3J9S A;  3WG3 A;  2ET1 A;  4A44 A;  3OY8 A;  1ND2 C;  4Q5O A;  2RS3 3;  3JBG 3;  5BNN B;  3RRD A;  4HT1 T;  3IDC B;  4R52 A;  2Y6H A;  4QHB A;  2JIC A;  2VUJ A;  4M0H A;  1QNW A;  4V2V A;  4V2W A;  4B3N A;  2ZX2 A;  2CDP A;  1POQ A;  1Z7S 3;  3M3O A;  4YLZ A;  3N9O A;  1S2E A;  2ILM A;  4BA6 A;  5I0R A;  2K2S A;  3GBW A;  4I02 A;  1JBC A;  4EZ4 A;  5FZ8 A;  1SHW B;  3HPN A;  5A6Q A;  5AC9 2;  3LOB A;  3EB7 A;  4JKL A;  4U2A A;  1WA4 A;  1CQ9 A;  1A8D A;  1RIT A;  1X9T A;  3ZXJ A;  1GWK A;  5F5I A;  3ZN6 B;  5F2S A;  5F2W A;  1DBN A;  4XDQ A;  5FZI A;  3KM5 A;  4BDV B;  2VUC A;  5F3I A;  3BVC A;  2ZXQ A;  2WN3 A;  1BVV A;  1PZ8 A;  5A3P A;  1V6N A;  2IXL A;  2ENR A;  5LBC A;  2YHJ A;  4AOC A;  2WKK A;  4A6O A;  2BW8 A;  4JTN A;  4XJW A;  3P5B A;  4N43 A;  1NA1 C;  3E1F 1;  4IEO A;  4Q0P A;  5FK8 A;  1CAX B;  4LE3 A;  2OZ6 A;  1W2U A;  1ZBA 2;  1PHM A;  3TB0 A;  2BWA A;  1QJX 2;  1J58 A;  1UX7 A;  4XBQ A;  4QDS A;  3PLQ A;  5GZE A;  1OLQ A;  2E9Q A;  5A7Q A;  2ZS6 B;  4XBN A;  3GCW A;  4OQ9 A;  1YQ5 A;  3UJQ A;  2YPD A;  4Q8K A;  3I8T A;  1IG3 A;  1PZ7 A;  2D6N A;  5F3G A;  3SIT A;  2JDA A;  3BCW A;  1QDO A;  4HN0 A;  4ATF A;  2YY1 A;  2DUR A;  5DDJ 1;  4A7Y A;  3ACG A;  3MFA A;  4O9G A;  5FY0 A;  5K0U A;  2RJK A;  1DLC A;  5A33 A;  3OBR A;  3OGJ A;  2YU1 A;  1HQL A;  3WG1 A;  5C71 A;  4JAA A;  5DG1 A;  1YEW A;  4CCN A;  1H4H A;  2TUN A;  3WQ7 A;  2ZGO A;  4XUN A;  1G8W A;  2FDK A;  3AXE A;  4MGT A;  2A3W A;  3ZMN A;  1B09 A;  1H6Y A;  4QPI C;  2JEN A;  4D3W A;  3VBU B;  5HCA A;  4YZ5 A;  3E6C C;  2WS9 2;  5C4W A;  5BNP B;  4H2A A;  2JDY A;  4QDR A;  5FIX A;  2X8K A;  1LHU A;  2ZHK A;  1Y9G A;  2JG9 C;  1HV0 A;  4FP3 A;  2Q8D A;  2A73 B;  5CBL A;  3I54 A;  1URX A;  4ASK A;  3Q9O A;  2H0V A;  5JOY A;  1R1A 1;  4YW5 A;  2OUJ A;  5JSP A;  1KS4 A;  1AYM 3;  2JDH A;  5IT6 A;  1RUO A;  4RR3 C;  3HN1 A;  2E53 A;  4JDM A;  2QFE A;  3HQX A;  3QAC A;  1KDM A;  2RS5 1;  1CJP A;  1SFN A;  2LUW A;  1RUF 1;  2RDS A;  4QXK A;  5IUQ A;  4FAG A;  1QQP 1;  4HVO A;  1BBT 1;  4XQW A;  3DPR A;  5A32 B;  5IAT A;  1PIV 1;  1Y7B A;  2WRA A;  1ULD A;  4KWL A;  4XEZ A;  2WNU A;  2RJL A;  2RS3 2;  3JBG 2;  3UKT A;  2AAC A;  4BQ5 A;  3VZO A;  4AF9 A;  1SLA A;  1VBC 1;  1Y43 B;  2V73 A;  4NO4 A;  4OMC A;  1ND3 A;  2JDK A;  2Q0A A;  3NKG A;  4LBN A;  3ZYI B;  2XJV A;  1EAH 1;  3AP9 A;  1O5U A;  4NIA A;  2NLR A;  2OKX A;  2YUE A;  3WDV A;  5IVV A;  4ONU A;  1K42 A;  2WC2 A;  2VNG A;  1YQ2 A;  3IMM A;  1R09 1;  1NCQ C;  3IKW A;  1QXJ A;  3PUA A;  5J3U A;  4Z8B A;  2WSU A;  4CU8 A;  3V0A A;  1JU3 A;  1UPS A;  5SV5 A;  2AC1 A;  3UGH A;  5DUX A;  3UKV A;  2P2K A;  1W0N A;  3C7E A;  1GQH A;  2WAO A;  3O1M A;  4W6Y A;  3AZZ A;  1RUE 3;  4FPH A;  5A1A A;  4I3P A;  4I3G A;  3RSJ A;  2JDM A;  4A45 A;  3DXU A;  3RPQ A;  1DYO A;  5C9A B;  1JH5 A;  3TOJ A;  2WWU A;  5CU1 A;  4XFH A;  2VMI A;  4LA2 A;  2R1D A;  2ZTN A;  2W46 A;  1LCL A;  2BYV E;  4WM7 C;  4ZXK A;  1NX9 A;  1Q8Q A;  5HI0 A;  2DBI A;  1ZYB A;  2B9V A;  4Q4W 1;  4XIO A;  4YGB A;  5EYY A;  3ZOI A;  4BIF A;  4EJR A;  1GNY A;  5JOW A;  3POI A;  4D6R A;  3FLP A;  4IE7 A;  4P9J A;  3S6P A;  1H30 A;  4S2D A;  3VBS C;  4GH4 C;  1HDK A;  1V6K A;  5FWE A;  4AGG A;  4AED A;  3BU0 A;  1LEC A;  4GAL A;  4XFA A;  3MPB A;  1G9C A;  1CZV A;  4DIN B;  3ZDV A;  1LGC A;  5A3W A;  3ZKU A;  1MR5 A;  4C91 A;  1UW8 A;  3CMG A;  5A3N A;  4KI5 M;  4CCD A;  1QHD A;  2J1V A;  3RVH A;  5T5L A;  3NQH A;  3MIH A;  2BV4 A;  1W06 A;  1SLI A;  1VBB 1;  4TZD A;  1OA2 A;  4LTA A;  2BVB A;  1VP6 A;  1VBD 3;  1VPH A;  3RFR A;  3WXP A;  3HMY A;  1OSG A;  1I5Z A;  2XR4 A;  5D8A B;  2BU9 A;  5L73 A;  2WAA A;  3VBH B;  1DGW X;  1JOJ A;  1RUN A;  2R04 1;  1LED A;  1UXZ A;  4L97 A;  4XAA A;  5HCB A;  1W6Q B;  4HET A;  3CL1 A;  2WO2 A;  3HBZ A;  5F6L B;  4M4R A;  3CKH A;  2WUH A;  3J26 N;  2WR9 A;  1F31 A;  4LOS A;  2Y33 A;  5KHJ A;  5T3N A;  2GN7 A;  1KD7 A;  4MGK E;  1AYM 2;  3M7A A;  4XAC A;  5DZE A;  4DXT A;  5AFB A;  3KB5 A;  5BNP C;  4M3C A;  4N90 A;  5H9R A;  3C7F A;  4JKM A;  2ZGL A;  1X36 A;  4ZZ5 A;  3D8C A;  1TG7 A;  2R30 A;  1MS5 A;  1W9F A;  3AYC A;  1DLL A;  4OHY A;  3R6S A;  1JMU B;  1LOE A;  3LIH A;  5H9P A;  4CZS A;  5C7G A;  1GR3 A;  3FFQ A;  4RGG A;  5AVA A;  4CEW A;  1WLD A;  1H8T A;  2QNK A;  3ZYJ B;  3H1W A;  1K3I A;  4LA3 A;  4CVU A;  3I2K A;  4GMP 3;  2IXJ A;  2V4V A;  3QD6 A;  4E4S A;  1W6M A;  1Q8O A;  1UKG A;  4CDX B;  2IXC A;  4PT6 A;  1CPN A;  5L7O C;  2RE9 A;  3AVS A;  2WA4 A;  5FY9 A;  5IK8 A;  5LRS A;  3DEC A;  3U75 A;  5FZ0 A;  1QJU 3;  1UF2 C;  2E6V A;  3I3E A;  1APN A;  3ZYB A;  3TN9 1;  3C7G A;  3VBO A;  4FPG A;  4WVZ A;  2EA7 A;  2LAL A;  1C8M 3;  2J22 A;  2NPI A;  4N7I A;  3JZV A;  2RR1 1;  3AP5 A;  3BN6 A;  4NID A;  2ZHN A;  1HRV 3;  4M3C F;  1WZX A;  5EQU A;  2DDU A;  1RUE 2;  1XYP A;  3OGG A;  4JDN A;  1DFQ A;  2YU2 A;  1POV 1;  4KWK A;  4RFR B;  3SHR A;  1S1A A;  3K4A A;  2XLF A;  3BPS A;  4D7Y A;  2K0G A;  2LTN A;  2CGP A;  4ASM B;  3KV9 A;  4XJ8 A;  4JGZ B;  3VN4 A;  3WD5 A;  2N7G A;  2YBK A;  3IB3 A;  4BK4 A;  3SNM A;  5IFP A;  4DFS A;  1ULE A;  1S0E A;  4XMA A;  1LOG A;  5FPZ A;  1Y9Q A;  2VQA A;  3HVD A;  1H1I A;  3ECQ A;  1LAJ A;  4Q4Y 1;  2A75 A;  3TEW A;  3F2Z A;  1OUR A;  3AMP A;  1K45 A;  1V70 A;  2ZGP A;  5C8W A;  4F3J A;  3BIE A;  3U14 A;  4OI1 A;  1HRI 1;  3C7O A;  2GND A;  5HBA A;  3P3P A;  4Y1V A;  1VBA 3;  2JKB A;  3MLJ A;  1JYW A;  1UU4 A;  3KS7 A;  2WZR 3;  4GB3 3;  4CDW B;  2YFU A;  2NP0 A;  5GLU A;  3A21 A;  3DEM A;  1J84 A;  3MV1 1;  2FMY A;  4UF0 B;  2HWC 3;  4Y5T A;  2BEO A;  1UIK A;  4J25 A;  4YVW A;  1A6C A;  1VBD 2;  1UU6 A;  2DTY A;  4PBO A;  1O4Z A;  2OX0 A;  2W95 A;  1AXY A;  1JW6 A;  1JYC A;  3WW4 A;  4JV4 A;  1DZT A;  1NY7 2;  3K3O A;  2ERF A;  5DUU A;  1OLM A;  5GZF A;  4QU2 A;  3QH6 A;  5JXG A;  4FXG B;  2WBK A;  4HPK B;  2BP6 A;  1YJK A;  2ZAA A;  1PVX A;  4EN0 A;  1Z0H A;  1OI6 A;  5D8A C;  4E9K A;  3VDD B;  3VBH C;  2PAK A;  3FHI B;  1W2N A;  1UO9 A;  5FQ0 B;  1W6N A;  1DF0 A;  4UBH A;  1JZ8 A;  3O1P A;  4D7T A;  3R4S A;  3SEE A;  4RL7 A;  4K1Y A;  2BBV A;  3LZZ A;  1X9P A;  1I5P A;  1W2A X;  1H2N A;  2W1S A;  1O3S A;  1PK6 C;  1PVC 3;  3MF9 A;  4PDW A;  1U12 A;  4ITC A;  5AC9 1;  1XYO A;  1GKB A;  3J8F 3;  1NXM A;  1O5L A;  2Z42 A;  3WT3 A;  2QVS B;  2UYA A;  3U0Z A;  2AGS A;  4LOT A;  5F7U A;  4LHL A;  5FKB A;  4CCC A;  4FBF A;  3IDE A;  1RED A;  1PMH X;  5FP4 A;  2WIN B;  4LQR A;  1D2S A;  5FJK A;  1LU2 A;  2A3X A;  4CU9 A;  2BQP A;  1QJU 2;  3LIG A;  2P4E A;  3NKT A;  2QQJ A;  2Z2S B;  4UW6 A;  4H3W A;  1VAL A;  4D94 A;  2X5I B;  4CDX C;  4BQX A;  3W9A A;  3WNN A;  4QHO A;  2HLE A;  3NRU A;  1N3Q A;  2A6Y A;  5T5O A;  1C8M 2;  4OUS A;  1ZBA 1;  4GAZ A;  5EFU A;  2OPW A;  4YZ4 A;  1O59 A;  5GM0 A;  1PGS A;  3WQ0 A;  3DF0 A;  1RUC 3;  1JUI A;  2ARC A;  3INA A;  1W90 A;  2P34 A;  5J98 B;  4A3X A;  1LOB A;  1AHS A;  1C5H A;  3K4Z A;  1AR7 1;  4Y24 A;  1E5R A;  1LU1 A;  4YVS A;  4RA0 A;  4XF3 A;  5IWF A;  3HOB A;  2YGM A;  1D4V B;  4NMI A;  1UYZ A;  4IV3 B;  1DYK A;  4P9G A;  5FYB A;  3OOX A;  4PLM A;  2IVJ A;  2MPF A;  1LOF A;  2VQU A;  4NHY A;  1EPZ A;  3A0K A;  3R4D B;  2C1F A;  4Y4Y A;  1OQ1 A;  4N9H A;  3V65 A;  4COU A;  3ZDS A;  3E5U A;  1TME 1;  1RUD 1;  3FX3 A;  4JGZ C;  5FXX A;  3SIS A;  5JZG A;  1UZY A;  2ZZJ A;  3E5Q A;  3ACF A;  2R1B A;  3CIH A;  1T6G C;  4ZON A;  5CFC C;  5GZD A;  1UYX A;  2YRO A;  3VLB B;  1VBA 2;  4RN5 A;  5FYH A;  3VKN A;  1CX1 A;  2WZR 2;  1Q3E A;  5T5J A;  4TTG A;  4GB3 2;  1F8V A;  2W68 A;  1WCQ A;  4NE9 A;  2UY9 A;  3USU A;  1RTV A;  2WQZ C;  3POG A;  2KD7 A;  2HWC 2;  5FRE A;  3H0O A;  1CAW A;  1FYU A;  2WDB A;  3RZL A;  4CU6 A;  3W58 A;  1XU2 A;  4CDW C;  4Q27 A;  3FLT A;  4CCL A;  5FP8 A;  3I97 A;  4FFF A;  4Q4X 1;  5JXJ A;  2HYK A;  3UL2 A;  3ROU A;  4COZ A;  2B42 B;  5KXB A;  3E97 A;  2EXI A;  2VMG A;  4BQ4 A;  4K9S A;  4MGI E;  3AL5 A;  4PQQ A;  1OLR A;  1RMU 3;  3GJB A;  3GZE A;  2GN3 A;  5FUN A;  4LBJ A;  2RVA A;  5CIS A;  4X8N A;  5IW0 A;  1Z7S 1;  5FZO A;  1RUJ 1;  2QQL A;  1VMH A;  2JWP A;  2DVA A;  2YB7 A;  3MDP A;  4KU8 A;  1Q8P A;  1PVC 2;  3FZ3 A;  3VDD C;  1YQ8 A;  2ZMK A;  5LW9 A;  2PQQ A;  3VDB A;  3AKP A;  4QB1 A;  1JOP A;  2FMD A;  3J8F 2;  3AB0 A;  4B4Q A;  4Y1Y A;  4D69 A;  4FO9 A;  4LHK A;  4Q0S A;  3PTR B;  3PVO A;  2ZHM A;  1KRI A;  2ZGQ A;  3P3N A;  1HN0 A;  4F83 A;  2C9A A;  4FOY A;  5TSW A;  3FL7 A;  3ZYG A;  2BNN A;  1J3R A;  3LDR A;  4CSW A;  1RHI 1;  3DL3 A;  1W28 A;  2GNT A;  3CO2 A;  4AQ6 A;  2C24 A;  4IGO A;  2J1T A;  5FZ3 A;  5KHH A;  4EV0 A;  3QOP A;  3UKN A;  5IJR A;  4RS5 B;  3RYR A;  2DVD A;  1VBE 3;  5JAX A;  5I0S A;  5FMD A;  1U5X A;  1R08 3;  1RUC 2;  3OGR A;  2VJX A;  1WW4 A;  3JB8 A;  1R64 A;  4RQP C;  1MS9 A;  1ZRF A;  1O8S A;  3OY8 B;  3NNL A;  5LK5 A;  4H7L A;  3AP7 A;  1WMF A;  3I2H A;  1ZBE 3;  1MPX A;  2HWF 1;  4JHZ A;  4HKW A;  2RDR A;  5I0D A;  2YPJ A;  3ELN A;  5HXV A;  2PHL A;  1DQ1 A;  3B5L B;  4PCR A;  1W3X A;  3M3I A;  5FY7 A;  1OKO A;  1FAY A;  1Q43 A;  2DF7 A;  4LUL A;  5JVV A;  5FO8 B;  3MHZ A;  5LBE A;  3VGI A;  4JGY C;  2GNM A;  4ZU7 A;  2TNF A;  2WJS A;  4HSJ A;  5A7P A;  4YW3 A;  1COV 3;  5J37 A;  4JCK A;  3CZJ A;  3KCC A;  4YM2 A;  5BYN A;  4AGR A;  3WSO A;  1VLN A;  4FSJ A;  3N9N A;  1JN2 P;  4MLO A;  4QXH A;  2OYZ A;  1W99 A;  4DQA A;  4YM3 A;  2W3J A;  1F4A A;  3MPP G;  3T3Y A;  5A7O A;  3SEP A;  1T6B X;  4P9I A;  1DDL A;  4FFG A;  4N43 B;  4PI2 A;  4CP2 A;  1OVP A;  3OF1 A;  4IEP A;  4DMI A;  3OJB A;  1RIR A;  3VKL A;  4EYU A;  3CHX A;  3EO6 A;  1O8P A;  5LEJ A;  3S0M A;  1QJF A;  2DV9 A;  2BGP A;  3LPG A;  4FQZ A;  2JB4 A;  4Y33 A;  5FP7 A;  1KXG A;  4YW4 A;  4MSV A;  4M0N A;  2DCT A;  1QXR A;  1G9F A;  4CXW A;  1RMU 2;  4KL1 A;  5K9Y A;  3GCX A;  5K0U B;  3MV0 1;  3V0B A;  3VZJ A;  5A33 B;  4LMF A;  2QQI A;  3KV6 A;  1SLC A;  3ZXF A;  4JRA A;  4P9L A;  4A7K A;  2VTX A;  2G19 A;  4DXZ A;  2VD7 A;  3HAG A;  1IG0 A;  3JB4 C;  4I0W B;  2AH2 A;  3O12 A;  1MZF A;  4KH9 A;  3E6B A;  4KNC A;  4Q4V 3;  1U5Z A;  3ZFG A;  4CDQ A;  1RC6 A;  4MHR A;  2VNV A;  2LRP A;  4IE4 A;  1LGB A;  2VO5 A;  4C0H A;  3N7J A;  3LCP A;  1N3O A;  1NZC A;  2XBO 1;  3WW2 A;  4BQ1 A;  2WNV A;  3LPF A;  4OZO A;  2ZMN A;  5FMC A;  5ABJ A;  2VNO A;  1UY2 A;  2FCV A;  1YO8 A;  1YFU A;  3NV1 A;  4QPG A;  4Z2A A;  2QDN A;  3OEA A;  5A6Z A;  5G04 L;  1TQ5 A;  4Y5S A;  1RB8 G;  5FLI A;  2OUH A;  2XPJ A;  2R07 1;  1X33 A;  2XJR A;  3T30 A;  3ZLI A;  2FCT A;  1SFY A;  1XE8 A;  3MW4 A;  3WV6 A;  3AMN A;  3DPR B;  3VD7 A;  4AW7 A;  1PZ9 A;  4FOV A;  2B5H A;  2MEV 1;  1SCR A;  2WNU B;  2L9L A;  3PUI A;  3GBG A;  2XDV A;  4Y4R A;  5FV3 A;  4AFD A;  4XAE A;  4XF1 A;  4P9Y A;  1LNS A;  4YG0 A;  2YDE A;  4XIK A;  1ZBE 2;  2J1R A;  1UZZ A;  1SEF A;  1ND3 B;  1UKR A;  2G4I A;  4LXL A;  5APA A;  5C3R A;  1WCD J;  4XZU G;  3POB A;  4QQ2 A;  2Q4S A;  2XLA A;  4OCT A;  3ACL A;  2P3J A;  4YAR A;  4XAB A;  2HKX A;  3UJO A;  2VZ3 A;  4S2G A;  2BJS A;  5LK7 B;  3NNG A;  2YC4 A;  3MUZ 1;  4NVP A;  1PGL 1;  3FBM A;  3V0A B;  2YFZ A;  4QPY A;  1COV 2;  4HAN A;  2XJP A;  3MLL A;  5JPN B;  1B35 A;  4N53 A;  1OD5 A;  1NY7 1;  1WD3 A;  4LBQ B;  2D3S A;  3RWK X;  1BK1 A;  2VQT A;  4OFG A;  1P8J A;  3ZFF A;  3N7L A;  4LLF A;  2XL7 A;  2ZJC A;  5LAT A;  5CB7 A;  1BEV 3;  3NAP A;  5CG9 A;  1F5J A;  2V5Y A;  2E63 A;  1FPN 2;  3AZY A;  3H1Y A;  3HD8 B;  1XSR A;  4FTE A;  3D0S A;  1AR8 3;  1XBF A;  3AJZ A;  5A3O A;  4QX8 A;  2WZ8 A;  3VBR B;  1C5I A;  3RZG A;  3OPW A;  3CDZ B;  3WX5 A;  1NE4 A;  3VD5 A;  3DKQ A;  3RQ0 A;  1NCR A;  4BOW A;  4QX5 A;  1W04 A;  4AFC A;  1GZW B;  1AL2 2;  3C3V A;  1S0G A;  3POF A;  3ORJ A;  3SLI A;  2EVX A;  5ACA 2;  4AFM A;  4XBL A;  2VZO A;  3W20 A;  3ZMO A;  3NV2 A;  2DFB A;  1XB9 A;  2ZEX A;  2W2I A;  2GH2 A;  1S0I A;  4M3C E;  2V72 A;  2VOK A;  4ZZ8 A;  4AFB A;  1Y9M A;  3LEI A;  5HV4 A;  4X6Q B;  5FAX A;  1GZT A; 
#chains in the Genus database with same CATH homology
 5A1A A;  2C9K A;  4A45 A;  1DYO A;  1W9T A;  4QB2 A;  1L7R A;  2E33 A;  2W46 A;  5G05 L;  1NX9 A;  2W9X A;  4E8D A;  1JZ3 A;  2B9V A;  4XUO A;  3J7H A;  1GNY A;  3JXS A;  5IFT A;  5EJZ B;  3VD9 A;  5IHR A;  2W87 A;  4BXS V;  1CZV A;  3T0B A;  3T08 A;  2VZV A;  2VMD A;  4LKS A;  1W8N A;  3LE0 A;  4JKK A;  2ZEY A;  4DUV A;  3DYP A;  3ETP A;  3LEG A;  3CMG A;  4KI5 M;  2J1V A;  2XQX A;  5JR2 A;  3NQH A;  5JXH A;  1RYY A;  1JZ2 A;  4CU7 A;  4W8J A;  2CDO A;  4W4Z A;  2VME A;  3IAP A;  3IDA A;  1CIY A;  2WAA A;  4ARX A;  1UXZ A;  1HN1 A;  2X10 A;  3I3D A;  2WO2 A;  3A23 A;  4M4R A;  3LQC A;  3CKH A;  2WUH A;  3THD A;  2BGO A;  2J1S A;  4DXT A;  2XOM A;  2X05 A;  3C7F A;  4JKM A;  2WYS A;  3I2F A;  1D7P M;  4ZZ5 A;  1TG7 A;  3GGL A;  4W50 A;  5C7G A;  2W94 A;  2EIC A;  1K3I A;  4CVU A;  2WAB A;  5JXI A;  3I2K A;  2V4V A;  4PT6 A;  2E31 A;  4QDQ A;  3UET A;  1GOF A;  1OF3 A;  3DEC A;  3P6B A;  3I3E A;  3T0A A;  3C7G A;  4AAX A;  5DMY A;  1T2X A;  3THC A;  2J22 A;  3BN6 A;  3NJX A;  1TVG A;  3SKJ E;  1UMI A;  1JU4 A;  1UY1 A;  1WKY A;  2DDU A;  4XUP A;  4GZ9 A;  4MGQ A;  4ZXE A;  2W1Q A;  3K4A A;  4AG4 A;  5LA1 A;  2JD9 A;  4BK4 A;  3IB3 A;  2J1U A;  1GMM A;  4QX1 A;  5IFP A;  2VZQ A;  3FHQ A;  2QQM A;  4OMD A;  4DEV A;  3WF2 A;  2HYX A;  1EUT A;  3HN3 A;  3ECQ A;  3DYO A;  1NAE A;  3F2Z A;  1JYV A;  1UY0 A;  1K45 A;  3WNP A;  4D8M A;  1KEX A;  3C7O A;  1US3 A;  1ULO A;  3LEK A;  1JYW A;  3I3B A;  4MOA A;  4UI9 L;  2YFU A;  2DCJ A;  1SG3 A;  3A21 A;  1J84 A;  3I2J A;  3MV1 1;  4KMQ A;  2RV9 A;  3U37 A;  4QPW A;  2W95 A;  2V5D A;  3CQO A;  3VDC A;  3WQB A;  5JXG A;  4GWJ A;  2VZ1 A;  2WBK A;  1US2 A;  1JYX A;  2VM9 A;  4DXR A;  1GUI A;  2VZR A;  1GQP A;  4A3Z A;  4M4P A;  2ORZ A;  2VCA A;  2PQS A;  1JZ8 A;  3SEE A;  2W1S A;  1CZS A;  1I5P A;  1BHG A;  3W5M A;  3AC0 A;  1PX3 A;  2WO3 A;  4BJ0 A;  5CZK A;  5HPO A;  4A41 A;  2XHN A;  3WF3 A;  3ZM8 A;  1JYN A;  5F7U A;  4RYD A;  1JI6 A;  3IAQ A;  1PMH X;  4LQR A;  4CU9 A;  2YC2 A;  2QQJ A;  5C70 A;  3MBW A;  4TXW A;  3WNN A;  2HLE A;  3NRU A;  4OUE A;  2Y6G A;  2Y8K A;  4UOJ A;  3WF1 A;  4QX0 A;  1O59 A;  3GXU A;  2J1A A;  5DPN A;  2WZE A;  2JE8 A;  3A7Q A;  2QQK A;  4DUX A;  3GDB A;  3K4Z A;  5B4X A;  1OT5 A;  2LW8 A;  4L0P A;  2ID4 A;  3HOB A;  1UYZ A;  1UY3 A;  2YG0 A;  2EIE A;  2VQU A;  2Y6K A;  4A4A A;  5J1X A;  2W5F A;  4ARY A;  4MO3 M;  4XUR A;  1XC6 A;  4OYU A;  2QBX A;  3P1I A;  2VMC A;  1OH4 A;  1UY4 A;  2VR4 A;  3ACF A;  4ET7 A;  3I2I A;  1PX4 A;  3CIH A;  3UNP A;  2BZD A;  1H6X A;  1UYX A;  3W5N A;  1ULP A;  3VD3 A;  2W47 A;  1GOH A;  3OG2 A;  4RN5 A;  3VDA A;  1CX1 A;  2E26 A;  4TTG A;  2W91 A;  3WNL A;  1WCQ A;  1DP0 A;  4PF1 A;  1KGY A;  2KD7 A;  4BK5 A;  4DUW A;  4CUB A;  2WDB A;  4CU6 A;  5FUI A;  2VZP A;  4D0Q A;  2ZEZ A;  5IYY A;  3UES A;  3HNM A;  3I97 A;  4P02 B;  5JXJ A;  5EJ1 B;  4YPJ A;  4P5Y A;  3T09 A;  2VZT A;  2WN2 A;  4PQQ A;  1XPW A;  2C4X A;  2RVA A;  2BER A;  2QQL A;  2VC9 A;  2YB7 A;  4A42 A;  4CUC A;  2DCK A;  4CUA A;  3VDB A;  3K75 B;  1JZ7 A;  4HG6 B;  4QB1 A;  2QQN A;  1XNA A;  2Y6L A;  1PMJ X;  2ORX A;  2WO1 A;  3WNO A;  2LS6 A;  5LA0 A;  4MAD A;  4LHS A;  1F4H A;  3FN9 A;  3K46 A;  2E32 A;  3FL7 A;  2VZS A;  3D3A A;  2ZEW A;  2J1T A;  2R7E B;  1JZ6 A;  5IJR A;  5HXM A;  3T2P A;  3III A;  3OGR A;  2VJX A;  1EUU A;  1R64 A;  1O8S A;  3HNB M;  1L7Q A;  3NJV A;  2W1W A;  3FHA A;  4DEQ A;  3I2H A;  1UWW A;  3WF0 A;  1K12 A;  1MPX A;  2J1E A;  4JHZ A;  1NUK A;  5I0D A;  2VTF A;  1J83 A;  3HEI A;  4P08 A;  3T2O A;  4DXS A;  1CZT A;  1W8O A;  2RJ2 A;  2W1U A;  3ACI A;  4MGS A;  2EIB A;  2VMF A;  4LPL A;  2Z4F A;  2VZU A;  3WF4 A;  3WNK A;  3CZJ A;  2Y64 A;  3MUY 1;  1W9S A;  4XUT A;  3WSO A;  3ABZ A;  2EID A;  3HNY M;  1W99 A;  3OB8 A;  4KWU A;  5JMO A;  2W3J A;  3GM8 A;  2X09 A;  3PUH A;  3T2Q A;  2J7M A;  1F4A A;  4ZY9 A;  2C26 A;  3HJR A;  3SEP A;  4A44 A;  2Y6H A;  5LA2 A;  3I2G A;  4JX0 A;  4E8C A;  3C7H A;  1O8P A;  3VD4 A;  1XNT A;  2BGP A;  3LPG A;  2CDP A;  4FI9 A;  2B4K A;  1SHW B;  3HPN A;  3EYP A;  3EB7 A;  4JKL A;  3MV0 1;  2VOT A;  3ACH A;  3OBA A;  2JKX A;  3C8X A;  2QQI A;  2WQ8 A;  1NKG A;  3K77 A;  1W9W A;  4BDV B;  4QX3 A;  2ZXQ A;  2XON A;  4GWI A;  2WN3 A;  3K4D A;  4A6O A;  2VO5 A;  3E1F 1;  2VCC A;  3OGV A;  3LPF A;  4OZO A;  4IUG A;  2Y6J A;  1UY2 A;  1UX7 A;  1OF4 A;  4QDS A;  4QX2 A;  3MO4 A;  3DYM A;  4Z2A A;  3OEA A;  5G04 L;  2JDA A;  3SKV A;  3ACG A;  1GOG A;  3VD7 A;  1DLC A;  5C71 A;  2L9L A;  3PUI A;  5EIY B;  1LNS A;  4XUN A;  1GU3 A;  1UZ0 A;  3CZU A;  2J1R A;  2W92 A;  5DQ0 A;  1JZ5 A;  1JZ4 A;  2BBA A;  1H6Y A;  4XZU G;  5CYY A;  5JUV A;  3WNM A;  1IQD C;  1SDD B;  4QDR A;  2QQO A;  2VZ3 A;  3A22 A;  3NNG A;  2YC4 A;  3MUZ 1;  3OEB A;  4XUQ A;  4XVH A;  2YFZ A;  4UAP A;  2VQT A;  1P8J A;  2VCB A;  1UYY A;  1UMH A;  4QAW A;  1OD3 A;  1JHJ A;  3T0D A;  2WZ8 A;  4OMC A;  3CDZ B;  5B4N A;  3VD5 A;  2OKX A;  1K42 A;  1YQ2 A;  5LCW L;  4P00 B;  2VL4 A;  1UXX X;  4QB6 A;  3OGS A;  5DN2 A;  2VZO A;  4CU8 A;  1JU3 A;  2ZEX A;  2V72 A;  4ZZ8 A;  3LEI A;  1W0N A;  3C7E A;  2WAO A;  3WEZ A;  3BGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...