2BGPA

Mannan binding module from man5c in bound conformation
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
116
structure length
116
Chain Sequence
SWTYTAASASITAPAQLVGNVGELQGAGSAVIWNVDVPVTGEYRINLTWSSPYSSKVNTLVMDGTALSYAFAEATVPVTYVQTKTLSAGNHSFGVRVGSSDWGYMNVHSLKLELLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Mannan-Specific Family 35 Carbohydrate-Binding Module: Evidence for Significant Conformational Changes Upon Ligand Binding
pubmed doi rcsb
source organism Cellvibrio japonicus
molecule tags Carbohydrate binding protein
molecule keywords ENDO-B1,4-MANNANASE 5C
total genus 12
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2bgpA00
5CZKA 3C7GA 2VM9A 2WN3A 3WNPA 2CDPA 3ZM8A 4CUBA 3VDBA 1K45A 3BGAA 1WKYA 2J1AA 3FN9A 2WO3A 2ZEXA 4MO3M 3CZJA 4ZY9A 2L9LA 4LQRA 3F2ZA 3K75B 2Y6KA 4QX1A 4UI9L 4JKMA 5DN2A 4W4ZA 1JZ5A 4QB6A 2R7EB 2BGOA 4DUWA 4PT6A 4MADA 2VMDA 1UX7A 1UXZA 1XNTA 5IYYA 4A44A 1OH4A 5CYYA 1PMJX 2Y6HA 3T2QA 4YPJA 2WYSA 3CIHA 3FHQA 2C4XA 4PF1A 2EICA 5LA2A 1JI6A 2V4VA 3T2PA 2XONA 3IDAA 1EUUA 4E8CA 3U37A 5A1AA 4DUXA 4CUAA 1K42A 1XNAA 2VQTA 3MUZ1 3MBWA 4L0PA 2VO5A 2QQJA 1JZ2A 2BERA 2YG0A 2VL4A 1UMHA 2YC4A 2YFZA 3WSOA 3I3DA 1MPXA 1XPWA 3OGVA 3WF3A 1JYWA 3VD3A 2WO1A 3ABZA 3DYOA 4KMQA 2XQXA 3K4DA 3VD5A 4D0QA 3E1F1 2W1UA 2E32A 3VD7A 3NRUA 1DYOA 2VCCA 1CZVA 4A41A 2BBAA 4A4AA 1JU4A 2WAAA 3HNYM 2LS6A 1UXXX 2J1SA 4P5YA 2QQOA 4CUCA 2JKXA 1NAEA 2W94A 4DEVA 2B9VA 2DCJA 2DDUA 3UNPA 2YC2A 3WF2A 3P6BA 3MUY1 3MO4A 4UOJA 2VOTA 4CU9A 3CKHA 3OGSA 2VZQA 3LPGA 1DP0A 2E31A 1UYZA 4CU8A 1W9WA 3ECQA 5C7GA 2ZXQA 1L7QA 4LKSA 1US2A 2RV9A 4OMDA 3OBAA 2W9XA 3HNMA 5JUVA 3IIIA 1JYVA 2QQMA 3T0BA 1JZ4A 4XVHA 3T0AA 1JHJA 2W95A 4ZZ5A 2EIBA 3LEKA 2J7MA 3WQBA 2VZRA 3NJXA 3C8XA 3PUIA 2VR4A 4QX3A 3W5NA 2YB7A 1O59A 4XUNA 4QDQA 3P1IA 2V5DA 1OT5A 3CDZB 4PQQA 4BK5A 1O8SA 5JXIA 4OZOA 1ULOA 2QQLA 3SEPA 4CVUA 4W8JA 2ORXA 3EB7A 3K46A 2VCAA 4ET7A 2X09A 3I2GA 3UESA 5B4XA 2JDAA 2W47A 4IUGA 3I2KA 3OEAA 1TVGA 5LCWL 1F4AA 4JKLA 1W9TA 2VCBA 3HN3A 2J1RA 5IJRA 2OKXA 1W99A 2J1UA 3HEIA 2VZUA 3WNMA 3CQOA 4QX2A 3WF1A 1HN1A 3T2OA 3THCA 3T08A 5DMYA 1JZ3A 3NQHA 2Y8KA 2JD9A 3JXSA 3K77A 2VC9A 3WEZA 2PQSA 1R64A 2CDOA 4HG6B 1CIYA 1JU3A 3D3AA 4DXTA 1CX1A 2C9KA 1UZ0A 3LEIA 1SHWB 2HYXA 3IAQA 3J7HA 3WNOA 2X05A 4LHSA 5LA0A 2WUHA 4ZXEA 3HJRA 1W8OA 2ZEYA 1OF4A 2QQIA 4TXWA 3LE0A 2ID4A 3PUHA 1BHGA 1IQDC 1KEXA 4XUTA 1GQPA 1W9SA 2Y6JA 3VD9A 4RN5A 4A6OA 2WO2A 4KI5M 4W50A 1UYXA 1UY2A 2W1WA 5HPOA 4QDRA 3DYMA 2W46A 2W92A 3OEBA 4D8MA 4XZUG 4DEQA 5EJZB 3WNNA 4GWIA 4BJ0A 5DQ0A 4Z2AA 5J1XA 2B4KA 1UMIA 3SKJE 4A45A 2VJXA 2VMEA 4DXSA 2Z4FA 4OYUA 2W1QA 3VDCA 3AC0A 4MGQA 1NX9A 1LNSA 2ZEWA 4GWJA 1GNYA 3UETA 3C7EA 2RVAA 2WN2A 3GDBA 4QX0A 3FHAA 3W5MA 1I5PA 5EIYB 4XURA 2Y64A 2E26A 4QB2A 2HLEA 2E33A 3SEEA 1DLCA 1F4HA 4JHZA 2QBXA 4ZZ8A 1UY1A 2EIDA 3WF4A 3IB3A 2VZ3A 2VZOA 4AAXA 3VDAA 1GUIA 3WNKA 3ACFA 3HPNA 3LEGA 1GOGA 4AG4A 2XOMA 5IHRA 2WDBA 1PX4A 3GM8A 1T2XA 1H6XA 2J1VA 1CZSA 4A3ZA 3OGRA 2C26A 2YFUA 4ARXA 3MV11 3A23A 5JXJA 3HOBA 3I2FA 5G05L 1US3A 3ACHA 1TG7A 1K3IA 3LQCA 3CMGA 3OB8A 3T09A 1SG3A 2VZSA 2WQ8A 1L7RA 3C7FA 3T0DA 3IAPA 3K4AA 1D7PM 1UY4A 2WBKA 1RYYA 2BGPA 4GZ9A 2VZPA 3CZUA 1GOFA 2WABA 3SKVA 3VD4A 1UWWA 2JE8A 2XHNA 2WZ8A 2Y6LA 2BZDA 3HNBM 2QQKA 1GOHA 2W91A 4DUVA 5IFTA 4TTGA 1J83A 2QQNA 1UY0A 4E8DA 4M4PA 3EYPA 4OMCA 3I3EA 4ARYA 4P00B 1J84A 1SDDB 5JR2A 2ZEZA 2J1EA 1P8JA 1H6YA 2VMFA 4DXRA 3WF0A 2WAOA 4QPWA 5HXMA 5JXHA 3BN6A 2V72A 3WNLA 2VZVA 3C7HA 1JZ8A 1W0NA 1UYYA 5JMOA 4JX0A 4CU6A 2W5FA 1GMMA 2X10A 3NNGA 4JKKA 1PMHX 2VTFA 3GGLA 4LPLA 4A42A 2VQUA 3I3BA 2KD7A 2VZTA 3I2JA 1CZTA 4M4RA 4QAWA 5I0DA 3C7OA 2VMCA 2WZEA 4KWUA 2W1SA 1KGYA 5G04L 5C70A 4P08A 2VZ1A 4CU7A 5F7UA 3MV01 5C71A 4XUPA 2Y6GA 3ETPA 4QDSA 5IFPA 3I2IA 2J22A 1YQ2A 4UAPA 5EJ1B 4BDVB 3THDA 3OG2A 2W87A 1WCQA 4OUEA 1NKGA 1W8NA 4QB1A 1JZ6A 2LW8A 3NJVA 2W3JA 3LPFA 1K12A 1PX3A 1ULPA 1UY3A 1NUKA 1O8PA 5DPNA 2DCKA 4MGSA 1EUTA 3A7QA 4MOAA 1XC6A 3I2HA 1JZ7A 3ACIA 4RYDA 3GXUA 3A21A 5FUIA 5JXGA 3A22A 2EIEA 3DECA 4P02B 5B4NA 4BK4A 2ORZA 2RJ2A 1OD3A 1JYXA 3FL7A 4XUQA 4XUOA 2J1TA 1GU3A 4FI9A 5LA1A 4BXSV 3ACGA 3DYPA 3K4ZA 3I97A 1JYNA 1OF3A
chains in the Genus database with same CATH superfamily
5JIAA 2PA7A 4JTOA 1JUHA 4C0HA 1ASJ1 3E5UA 3ZYBA 4M0HA 3UGHA 3Q8FA 1LODA 4GQ7A 5C4WB 5D1IA 3GHNA 3ZYIB 2QVSB 1ASJ2 2RS11 1XSQA 2CDPA 2ZA9A 3M2MA 3ZM8A 3U0ZA 1UMZA 3KMHA 4LBJA 1PGL2 1K45A 2VH9A 2WIIB 4Z82A 2XG3A 5IVEA 3R4UA 4JQRA 2ZEXA 4UF0A 1LOFA 1K5MB 3CZJA 1G9DA 4Q4X3 2BVVA 2OPKA 1REEA 2CV6A 4IW3A 2Z42A 3HR9A 5FZIA 5IW0A 3PVOA 1WBLA 5F5AA 5FP4A 4BXFA 3WNXA 1XYPA 2HWB2 2Z5WA 4UI9L 3ZYJB 3ENRA 2X5IA 1PGSA 1ZREA 5K4LA 2BQPA 2R7EB 1XNKA 4DUWA 1HQLA 4PBOA 4PT6A 5L9RA 4PF5A 1LGBA 1HRI1 3WW4A 4CP1A 2TNFA 3KCYA 2Y26A 2F4PA 4Z1VA 4CDQB 1VBA1 1ENQA 1S0EA 3AXEA 5JSOA 1WCKA 3FFQA 3MLKA 1VPHA 5FMDA 4WM8A 1VBA3 1WW4A 4UYBA 5FPVA 4B1LA 4EJRA 4OUSA 5D2AA 3RJRA 4CCDA 4GKXA 2ZGSA 4LMFA 2EICA 5LA2A 1FOD2 5C4WC 2FZ1A 4Q0UA 1JI6A 2V4VA 5FDBA 5JWPA 3KVAA 4N90A 3MZHA 3LSEA 4BWOA 1FOD1 4JCKA 3ZDVA 4E8CA 1UX6A 3U37A 3FUOA 3OTFA 5A1AA 1K42A 1D4VB 2QNKA 3VDDC 3MUZ1 3ZDSA 2QQWA 2TBVA 4IEZA 2EXJA 3T1LA 2VO5A 2A3WA 2QQJA 2ILMA 3VBHA 1JZ2A 2BERA 5FQ0A 3HT2A 1O4ZA 4RL7A 5FZAA 2A71A 2G9ZA 2QDRA 2YFZA 1XOYA 4SLIA 5CVRA 5L19A 3LEMA 3I3DA 3MIDA 2YY1A 1MPXA 1XPWA 2P3YA 3V65A 2R1DA 4CEYA 4FOQA 3AM2A 4LOSA 1QJU1 4FFHA 4NE9A 2WO1A 1OXCA 2WZR2 2RDRA 2CYFA 4KMQA 4QX7A 4RR3B 3WW2A 1LULA 4Q2FA 3TEXA 3DXTA 3BU0A 3IPVB 1HX6A 2GN7A 3NNJA 2E32A 1LHNA 3VD7A 4AOCA 3MLLA 1RUE1 1PIV3 2JE7A 1E5IA 1OLME 4NAMA 1CZVA 1W6MB 3AYAA 5FUNA 1RITA 5DDJ2 5FFOC 3UK9A 1JU4A 1RUE2 3RG0A 2G4IA 2HWC2 4XAEA 2XKPA 5CKQA 3DPRA 4ZU4A 3GALA 1CONA 2HWC1 5IUQA 5A32A 3RYRA 3TBDA 4BQYA 2DV9A 4ATEA 4DEVA 4DS0A 1SEFA 5JMCA 1DQ1A 3ZXLA 1YUDA 5FPBA 3WF2A 3MO4A 2PLV2 1IS5A 3IKWA 4CU9A 3VDDB 4CEYB 1LTEA 2XVKA 3NWKA 4YM3A 2VZQA 3KGZA 1DBNA 5FZOB 2OUJA 2ZHMA 3B7MA 4RR3A 4CU8A 1W9WA 4H55A 5C7GA 2ZXQA 4FFGA 1ZZ9A 4XFCA 1AUYA 3ZFEA 5A6QA 5A3PA 1Q8SA 1QWRA 4OMDA 3B00A 2W9XA 3EJKA 2OVUA 1NLQA 4NIHA 2MEV2 1GQHA 4AI1A 1C1LA 4NOTA 1LENA 5T55A 3VHPA 3ZXDA 1QJY3 3E6CC 1XYOA 3MPBA 4LBMA 4TSVA 4XVHA 1NCQA 3T0AA 5C8CB 1JHJA 2W95A 4A2UA 3IWZA 4QMAA 1QXRA 2DYCA 4LE3A 4M3CF 2Q0AA 1S0CA 2J7MA 2WNUA 4MGZE 2BEOA 4D7YA 1XBFA 4LLFA 5KHGA 3AMPA 2VVEA 4LE4A 5GLUA 4LTAA 4DY3A 4JQTA 3TWIA 2BFUS 4HKOA 4QX3A 3W5NA 3J4UH 1TZOA 4QDQA 2XGXA 2R063 5FRAA 3AMNA 2E7TA 5A33B 1RUJ1 5JPMB 3GBGA 4QQHA 4BK5A 1S4CA 2ZBJA 1LHVA 3OGGA 2G1MA 4NUBA 3ZN5A 2OIIA 1RB8G 4YARA 4IETA 5JZGC 2QQLA 2ATFA 4OI1A 3SEPA 2E6VA 2CAVA 2LTNA 4Y20A 2ZCWA 3N36A 4W8JA 2GDFA 3VZJA 1YQ8A 2JDZA 5C3PA 2YYOA 4YRDA 4L97A 4Y5Z0 2BWAA 2ZX0A 3OBRA 3ZKUA 2X09A 5FPLA 4Z07A 3ILFA 1OA2A 4UFLA 4MH0E 4XBQA 2RS12 3CF6E 3O1TA 2XPJA 5E8AA 3KZ4C 2GMPA 5ABJC 5LCWL 4JKLA 1Q8VA 1PIV1 2YBKA 3AL5A 4COUA 2FCUA 1RIRA 2RDSA 3HN3A 4R52A 2OKXA 3Q8AA 4I01A 2IXLA 1XQNA 2VZUA 4S2GA 2JWPA 4XFFA 2D97A 1ENRA 1W05A 3LGRA 4QQOA 1HN1A 4RSUA 2HWB1 2UY8A 3WDTA 1FPN2 3GNEA 4N43A 4Y5SA 3THCA 5FZKA 1FMD2 5CKMA 3TN93 4UBGA 5DMYA 3DXUA 2PHDA 2JD9A 1HB2A 3SNMA 2VOWA 3PJYA 3WUDA 5C3OA 2VC9A 4EQVA 1JW6A 3WEZA 4JGYC 5FZBA 4CDUC 2H0VA 2OQ6A 4M3CA 4EZ4A 4OHZA 1IOAA 1JU3A 1X36A 1WMFA 4IEYA 3RPQA 3C2UA 3WDYA 5AVPA 3WV6A 3NV2A 2WUHA 3KV6A 3HJRA 2HWF3 2PAEA 3AKQA 2ID4A 1BHGA 4YW1A 1EPZA 3VKFC 1LHOA 2VD7A 1GQPA 1W9SA 2DCYA 2Y6JA 1XNDA 3POYA 3MICA 3VBRA 4E2SA 2D40A 3E5XA 2R071 1WCSA 1FATA 4Y4YA 2RR12 3VBFA 5IK7A 1QU0A 1AR82 4N43B 1PO21 1ZZBA 2P2KA 4NVPA 4Q27A 1X33A 4DOUA 1GV9A 2W92A 1ONAA 1AR81 5LASA 1GICA 1DFQA 3CNAA 3JB8A 4K6BA 5J7MA 3PUQA 3OD0A 1POV3 5FYIA 2JDPA 1S0GA 5A80A 3K48A 4Y24A 1YQ5A 1DCSA 1DQ5A 2BJSA 2R061 3DKWA 1I5ZA 5J1XA 2B4KA 5LEKA 1YFWA 1R092 4UFMA 5IATA 4Q4V2 2NM1A 1NXMA 4DXSA 5A6XA 1J1LA 4GJZA 2Z69A 2CWSA 4LULA 3ZXFA 3VDCA 5A3LA 1H4GA 3ZSMA 4QM9A 1FNZA 2WR9A 3RZMA 1NX9A 2OS2A 1GWMA 2VNRA 3LIGA 1UOJA 3L9JT 1D4M2 4IQPA 3MIHA 2WFF3 2CAUA 4QPGA 1POQA 4QX0A 3W5MA 2YU2A 3WP3A 1O7FA 3OCPA 5EIYB 3U78A 3PURA 3SQOA 2PHUA 5FZ3A 4CA9A 4H7LA 4QT6A 1CAWA 1SLTA 2P5BA 3WG1A 1DLCA 2LRPA 2ZOEB 4JHZA 4LBKA 4LT5A 4F3JA 5F5IA 2FMYA 1ND2A 3BALA 3VGIA 1VBC2 2EIDA 1W8WA 1N1VA 3IB3A 3ALQA 1OOPC 1PGW1 1C8M3 4FPGA 2KA3A 5EFUA 5H9PA 5IK5A 2VZ3A 2XUEA 1N3OA 4LBQD 1NA1A 3SH3A 3VDAA 1GUIA 3WNKA 3J8F2 2ZZQA 3HPNA 3LEGA 4W6XA 1V00A 5FAXA 2PHTA 2DURA 4H2AA 5BV6A 4AI9A 5IHRA 1PK6B 3ZOIA 4K21A 3RNSA 3GM8A 5A7OA 3RMXA 1LOCA 1B35B 2AZ5A 2ZHNA 2OT7A 4Y5TA 2XXZA 3LF7A 1X8EA 1XE8A 1CZSA 2ZGOA 4QPGB 1UN1A 1MVEA 5J36A 1GZ9A 1H30A 2GC3A 1VBD3 1HRV3 1IG3A 2BWCA 4LLOA 4XJUA 3VBUB 3WW3A 4GMP0 5JXJA 5EQUA 4YYOA 1Q56A 4FP3A 1QJY2 1T6BX 1VBD1 2WZR1 3KT4A 5IAVA 5BXXA 1US3A 5A7WA 1D4M3 1QDCA 3GF6A 3IDBB 3ZMOA 1TG7A 4AEDC 1W28A 2ZHKA 3LQCA 5GZEA 2JG8C 3MW3A 4FT8A 5SV5A 4ZU7A 1BEV2 5FP8A 1SPPA 2HH9A 4PI0A 3OB8A 4JHTA 4Q29A 3T09A 4LITA 2V09A 2X29A 2DCZA 4N53B 5DUXA 4BQXA 3M3CA 4HETA 1L7RA 4AFAA 2VBBA 4XF1A 4D3WA 4LIVA 2D6KA 3C7FA 1G9AA 3T0DA 4MYEA 2I45A 2RJKA 3CJXA 1D7PM 1QJX1 5LA9A 1A8MA 1NCQC 2WBKA 4N7IA 1RUI2 4P9GA 3KCCA 1KFUL 5J09A 1GOFA 2PLV3 4NN0A 4QU1A 2B42B 2YXSA 4YW6A 5I0RA 2AACA 1LAJA 2EAKA 2NMOA 4IV1A 1VE0A 5ISLA 1PK6C 3N3HA 1PGW2 4GAZA 3ZSKA 1GOHA 4DUVA 5IFTA 3CL1A 4COWA 5B2GB 1J83A 4HONA 4FBFA 4RGAA 3EXUA 5FREA 2WKKA 5BNPB 5BNNA 3B9CA 4LUMA 4MX3A 4ARYA 1KD7A 3VBUC 3JCIA 2JDNA 1FV3A 2ZGPA 1CX4A 1GR3A 3O7OA 4WVMB 1YNAA 2J1EA 2WZR3 4IGPA 4XQWA 4AEDB 1H6YA 2HEVF 2DVFA 1Y9MA 5FYTA 4P9IA 4EWAA 1AX1A 5IVFA 3U11A 4BH9A 3UKNA 2PQQA 4LHKA 4N9IA 3WT3A 1EV13 3C7HA 2IFWA 1JZ8A 1W0NA 1QQP2 3ZYPA 1K5MA 3N35A 4Y1ZA 1W2NA 3AJYA 5DG1A 5FLHA 4Q1PA 5C8CA 2ZHLA 4JKKA 2WS92 1LOGA 1TME1 4GIQA 3GGLA 1NCQB 2FDFA 5TSWA 3I3BA 4X8NA 1ZNPA 1HJGA 1QXJA 1DIWA 1Z7S1 3D4KA 5A70A 1FT9A 4QAWA 3HIFA 3OBZA 5I0DA 4OHWA 2H6BA 1LGNA 4OI4A 1Z7S3 4LKDA 1UKRA 2VMCA 5K7PA 3RFRA 1UF2C 4DQAA 5A6ZA 1FPN3 1JXNA 4KGGA 5E16A 3KS7A 3MIFA 3ZYFA 2XJSA 5BNPC 3N4MA 2VXJA 3IMMA 1W6QB 4GXLA 4P08A 5CNAA 3EQEA 5JPNB 5FUPA 5FZ7A 3Q8BA 4LBLA 1HQWA 3OF1A 2CY6A 1CJPA 4NPMA 4AFCA 1V0AA 1MZEA 4XUPA 5C33A 3MIEA 5IFPA 4UAPA 4LKEA 1UYPA 2FBEA 2BNNA 4QQPA 1WCQA 3UGGA 1X9TA 3AP6A 3NNFA 5C9AB 1EV11 5FQ0B 3RZHA 1OA4A 3AYDA 2PN5A 2Q1FA 3AZWA 3ZX7A 3LPFA 3N7MA 1PX3A 4JGZC 2NLRA 1RUE3 1H2KA 2D44A 4YZ1A 2P6HA 1UY3A 1CPNA 1O8PA 1W90A 1H9PA 4KWJA 5T5PA 1DZTA 1XC6A 3GHMA 4WVVA 5T3NA 4QXHA 4AFMA 3JQWA 4XJWA 2HEWF 4V2WA 3TNQA 1AR61 3A21A 5FZHA 5FUIA 1NQJA 1XJAA 3AX4A 3DECA 3MEPA 5KBFA 1X9PA 4L11A 3U07A 3BVCA 4XUQA 1PVC2 2D43A 4U36A 5FY7A 1RUJ2 1OHFA 4R8HA 4URTA 4ISRA 4XUOA 2ZPXA 2P34A 4QX8A 4NIDA 4JC1A 2N7GA 1VB4A 2R0HA 1ZBA2 4WZFA 3RYKA 3PL0A 1VRH1 4BXSV 2IXKA 4ZS2A 3KB5A 3K4ZA 5CBLA 1UCXA 3QH6A 2VQTA 2WWJA 1YHFA 1W6OB 4LUKA 4R9CA 1OF3A 5CZKA 3UYJA 1VRH3 3RZKA 3TB0A 3AMMA 3IBMA 4UT5A 2YU1A 5FMBA 1FXZA 2WLQA 2ZGNA 1OVSA 3LOIA 4UBHA 2VM9A 4A6SA 5JAXA 1PO22 2QJVA 2LALA 2WN3A 4GWMA 2EA7A 4CUBA 4E4DX 5C9AC 5KC6A 3VDBA 1SACA 1GZCA 1JBCA 3VBRB 5JI7A 4EZHA 1XRUA 1WKYA 4XOGA 2I74A 4P9XA 1RJ7A 1HB4A 1LEMA 2ZAAA 3LDBA 4XIOA 4XTMA 4ZY9A 2XLFA 2QZ2A 1EYBA 2XH6A 2QDNA 3FWEA 4YM0A 3LA7A 4L99A 5LY2A 3WDWA 3J7LA 5FYHA 2JJ6A 1E57A 3PTRB 5DN2A 3VKNA 2RS13 1Y4WA 2W39A 4RR3C 5FPXA 4ASMB 1S1AA 2HEYF 3DEMA 1NA1C 1H8TA 1RUJ3 1VRBA 3VHOA 5IYYA 1PIV2 2AEYA 4YW5A 2VG9A 5FZCA 1NLRA 4CRQA 1OKQA 4UFHA 1OH4A 1UPIA 1ZRRA 2BOJA 2BFUL 3B01A 4PCRA 4TLGA 4XJAA 4YGCA 4YVSB 1UZVA 1VR3A 4IGOA 2R32A 4Q4X1 1AR62 2Y6HA 2Y34A 2GNBA 3THPA 2BPA2 2GMMA 1JTZX 4YPJA 2OYZA 3ELNA 4YGDA 4P9YA 5LY1A 1RHI3 3PVBB 3CIHA 3FHQA 3J26N 1AF9A 4KBZA 3GZAA 4PF1A 1H1IA 4FP2A 4XXPA 3T2PA 2R042 4HN0A 3IDAA 4CCKA 2A6YA 3BTXA 2XVGA 2BV4A 5GZFA 2NYYA 4KH9A 1V6JA 2R072 4CSWA 4DUXA 2JDYA 2AC1A 2RDQA 3H8OA 1R1ZA 2RS31 3J7MA 2DBIA 4UFIA 3BU7A 1YJLA 1NLSA 2YC4A 3WDUA 3RGBA 5JZGB 5I8YA 4ATFA 3RDIA 4BLIA 2XHKA 3AZZA 2Y0OA 4N9HA 4NPRA 5A3WA 4DINB 4FOVA 4DB5A 4BQ3A 1NY71 1RVF1 1PO12 3ES1A 1JYWA 3ABZA 4ASLA 3PMSA 1NY72 4Q0VA 1NXD1 1RVF3 2VVFA 1NYWA 1NA1B 1QQP1 4FPCA 4XEZA 3L2HA 5GM0A 5K0UA 4H7MA 1SLAA 1W3XA 4E2GA 4ZHNA 5BNOA 2YV8A 1L3JA 2AYHA 3NRUA 4Q4Y1 1O3RA 1DYOA 2D6NA 2HWE3 2XR4A 5DUWA 3UV9A 4A41A 1KJLA 4A4AA 5FXZA 4K8FA 2A70A 3K2OA 3NKGA 3QH7A 2JECA 4AI8A 1G9FA 2P3JA 4HK8A 4HMZA 3KQRA 2QQOA 4P5YA 4CCMA 4DXZA 4Y20B 1AXYA 2JKXA 3E6DA 1NAEA 4O9GA 2VW0A 3I59A 3USUA 3ZFFA 4CXYA 3JQXA 2DCJA 2DDUA 4XHBA 4YZ5A 2H0BA 5FPUA 3LFMA 5A1LA 5D8AB 2R073 4XHXA 4UOJA 1MEC1 1QJY1 3I7DA 2Y6FA 4M00A 1ULFA 5DDJ3 4K8RB 3HQUA 3CKHA 1POV0 1W6NB 1DP0A 4IXLA 1DYKA 4URAA 1UYZA 2A3XA 3LIHA 4QM8A 4CP9B 4KGQA 2WQ4A 2R041 5KC5A 4LKSA 1US2A 5LBEA 1OPOA 1OQEA 1H2NA 2VXRA 1EAH1 1HXS3 3OPWA 3H7JA 3U4SA 2XBO3 1VMHA 5JUVA 1W0OA 3S7EA 4K20A 3FLRA 4FTSA 2VGDA 3T0BA 1OURA 2B46X 4AQSA 3ZFFC 4P9LA 4CEWA 2D6MA 4IV3C 3WZ1A 4CDWB 4LBOA 2NZ9A 3NVCA 5ANQA 5A3TA 3OUIA 3VV1A 2Q8DA 3C8XA 5DZGA 3CLPA 1AR71 4FPKA 4GH4A 2WNUB 1URXA 4MZUA 3PUIA 3M3OA 2VR4A 3LA2A 1UOGA 4ORFA 3KV4A 2VUAA 1AYN3 3GZTB 3IPVA 4HANA 4W6WA 3CDZB 4F83A 1AYN2 4NAOA 4XCAA 1CQ9A 2Q1MA 2WJSA 1MEC3 3MIGA 1XB9A 4NHMA 5F5CA 5JOZA 5L7OA 3S5QA 4OZOA 1ULOA 1VRH2 3AFKA 4XF4A 3VBSC 3KM5A 3EMRA 2HYKA 1U5IA 1QEXA 4BLJA 5DABA 5A7QA 1BEV3 1J3RA 1C8M1 2B5HA 3DPRB 2XL9A 3GCXA 4Q0PA 2GP5A 1ZBA3 4R9BA 4XW3A 4COZA 1LOBA 1N1TA 3FLTA 3S57A 5AFBA 2AREA 2C9AA 3I8TA 1R083 2P4EA 5CFCA 1PVC3 2JDAA 5J48A 3PHMA 3I2KA 5FZ1A 2WWSA 2D6OX 5GLVA 1N47A 2HKXA 1M06G 4IEXA 1HRI2 1W9TA 1XNBA 1ZBE2 2VCBA 3N9MA 2ZGKA 2GC0A 2D98A 3HWJA 2BNOA 2J42A 3AK0A 2Q1ZB 4XACA 3U75A 3WOGA 4QX2A 3WF1A 3J8F3 5IAXA 4IEPA 4QD2A 1UL9A 3TAYA 3JBG2 1O4YA 4HPKA 1ZM1A 4DFSA 1VBB3 2Q30A 4PIYA 4LO5B 1DGWA 3NQHA 2Y8KA 1IKPA 1KJRA 4MXWB 4XXAA 4XJ9A 3T3YA 3BYWA 2ZZJA 1F5FA 3AP9A 3K77A 4K7JA 4WM7A 1RUH1 1W39A 1GBGA 2F6BA 4RGGA 3OBTA 4LHLA 3W9AA 1CIYA 2V4AA 3AVRA 4BQ2A 4XPVA 2JENA 2JXAA 1CX1A 4F8AA 1B35C 2X5IB 3O1RA 4BMBA 1OLRA 4CCOA 3J7HA 5EYYA 5K9YA 3KF3A 1D2SA 4LHSA 2DUQA 5LA0A 4KWLA 2VQ0A 5BUVA 4FTEA 2VE1A 1W8OA 3H3UA 2ZEYA 2WWUA 2W08A 4TXWA 5KHKA 3RMYA 4B7EA 4OUMA 4MV2A 1LOAA 1VAMA 2WO2A 1RINA 3BPSA 4KI5M 1UYXA 4W50A 3ROUA 3VZMA 1V6OA 4QHZA 3BTZA 1OA3A 5F2SA 3ON7A 3TRSB 3DYMA 2W46A 3VLBB 4BZ4A 4XQDA 2WFPA 4KNCA 3WG3A 1MR5A 1ZZCA 4D8MA 5ACA2 2BP6A 4WBBA 2Q8OA 1ND3C 2DU1A 5BYNA 5JDBA 1C57A 2WYFA 4OZXA 2O0OA 5F9TA 3KVBA 2W68A 2I07B 5DAVA 1O5LA 1VBB1 4F7ZA 3M1HA 5M0TA 1GNHA 5FOJB 1V6MA 4X8PA 2WS93 2NMNA 1N3QA 4AFDA 4C1XA 5H9RA 5CFCB 3E6BA 2VJXA 1SMVA 1G86A 3I4IA 2Z4FA 5LWBA 1QJEA 4DRRA 3N9OA 4GB31 1W06A 5T50A 5DXDA 1AR83 3G6JB 3O1PA 1RC6A 4PDWA 5FY0A 4XFHA 4IV1C 4M01A 1LNSA 2ZEWA 1PK6A 1SFYA 3AYCA 1OBNA 3GJBA 2G9FA 1GNYA 2TEPA 3KHBA 3LFIA 3VL9A 3WP5A 3UETA 5GJ6A 1AX0A 1UIJA 3CJIB 1RUC2 5C3SA 2RVAA 2WNVC 1U5ZA 3HBKA 3C3VA 1NG0A 1F8VA 1QJFA 1BLZA 5EWSA 2DBNA 1I5PA 2YPDA 1IHMA 3OD4A 5JR7B 5EP9A 1DQ0A 3VZKA 4E8DA 2PLV1 2Z2SB 2Y64A 1UNBA 4MGYE 5A3OA 3SEEA 1F4HA 1F15A 4WVZA 2QBXA 1O91A 5IK4A 5JLVA 2CGNA 1AJOA 2JICA 4Q0SA 5ACA3 4B3NA 2A6XA 3GCWA 1HW5A 2IFRA 4HN1A 4CCCA 5HCAA 2Y33A 2FDKA 1CAXB 3I3QA 1GOGA 5BNPA 2CTVA 4EV0A 3MI8A 3VUOA 3DN7A 4PHZA 4YZ4A 4B4RA 1T2XA 1H6XA 1BXHA 5CU1A 3ZN6B 3I54A 1J58A 2JG8A 1BK1A 3OGRA 1TMF2 4A3ZA 3NSTA 3D0JA 4Y1VA 5EYXA 3PJQA 4D94A 4IV1B 5C6CA 2YFUA 4ARXA 3LD8A 4Y26A 3HOBA 5C8WA 2ZABA 1Q8PA 1OC1A 4EYUA 2ZX2A 1QJX3 4OHVA 3CJIC 3NNMA 3TN91 1K3IA 3PDQA 1VBD2 5T52A 2DU0A 4BISA 4CDXC 3O1MA 3CMGA 1SG3A 1V9U3 1VIWB 2VZSA 2BU9A 3KWVA 1PGL1 4LORA 1SPPB 4S2HA 3T1MA 2XLGA 1XSRA 3NMBA 4BQ1A 1VBB2 4K40A 4C91A 3QOPA 5FJHA 1LKNA 3OPTA 5FJKA 3K4AA 5HXVA 1SBDA 2DTWA 2GAUA 2VU9A 1C8M2 5F39A 2JDMA 5FYMA 2XB6C 4IE4A 3OPZA 2BGPA 4WM7B 2YGMA 5FMOL 4QPIA 3ZLIA 1APNA 2VZPA 4NHKA 3QCWA 3HAGA 3EHKA 1V9U2 3F95A 3PIGA 3VD4A 1G8WA 5FYBA 4Q8LA 2WZ8A 2Y6LA 2BZDA 4IE0A 4GB33 2FD8A 3ZYRA 1CWPA 2D3RA 1GFF2 2PXJA 4WM8C 4RHV3 4QXCA 3EYPA 2PTMA 3I3EA 5FPZA 3AP5A 2OA2A 1ZX5A 4QKBA 4Q0QA 2XJTA 1J84A 2VBPA 2FCTA 2O8QA 4PJYA 3DKQA 3ETQA 4B1MA 3S0MA 1YC61 3VZNA 3ZMNA 2VMFA 3OYWB 2ADDA 4OULA 3KF5A 1JOJA 1WW5A 2YGLA 3OJBA 5DZFA 5A7NA 2Q8CA 4QPWA 1RUH2 5JXHA 3BN6A 2DTYA 4JAAA 1WCDJ 2VZVA 1MS5A 1BBT2 5ABJA 4JX0A 1BJQA 4CU6A 3AVSA 4GULA 2NQYA 2X10A 1T6GC 3SISA 1H2MA 3B3QE 3H8UA 3NL1A 4B4QA 3VBOB 4JV4A 5HV0A 4CDWA 1CAVB 4FPEA 4AK3A 3RSJA 1LECA 2VTFA 2QCSB 2UYBA 2X53S 2VQUA 1ULDA 2UYAA 1PVXA 3D5OA 4QKDA 4LBQB 1WA6X 4M4RA 3POBA 3BOPA 1VBE1 3M3IA 4DPNA 1JH5A 1UPSA 2AEZA 1FAYA 4W6YA 1YO8A 3FFZA 3VKLA 4PQ9A 2BTVC 2RR13 1W3VA 2W1SA 4XYXA 1EY2A 3SCFA 4AEJA 1HJFA 4I3PA 4CDUA 2JDHA 5T5OA 4I0AA 1IQAA 1DU3D 1QXPA 2ZACA 3DCQA 4FOWA 4CU7A 1HLCA 2EF6A 3POSA 4HKLA 5FY9A 1OI6A 1TEIA 3POEA 4NHXA 4YVSC 4BHPA 5C71A 2Y6GA 3ETPA 3U1XA 2ET1A 1YQ2A 4XETA 1FX5A 2HBTA 1O3SA 1YFUA 2VY0A 4J25A 4JTNA 4EWEA 3R05A 5KHJA 3ZIWA 4XABA 1YLLA 4XILA 2A5ZA 3V0BA 4QB1A 5EJ3A 1IS4A 2ZGQA 3ST7A 3NJVA 4UW3A 4RFT0 2W3JA 3NAPC 4IEOA 2R1BA 1SLCA 3O0WA 2PFWA 1ULPA 2VOXA 5FK8A 1R1A1 1AX2A 5T5LA 3VBOC 4MGIE 1NUKA 2RM22 4I0WB 1C5HA 2EXKA 1I3HA 2DCKA 3BIWE 1EUTA 3A7QA 3DF0A 3NV4A 4MOAA 5A7PA 1D4M1 2ETEA 1W9YA 1IPJA 2ARAA 3ACIA 5H9SA 3GXUA 1NE4A 3CEWA 5DAPA 4P02B 3FL7A 2AUYA 3SCHA 1DG6A 5GZGA 3R6SA 1OQDA 1OFSA 4QGMA 2JG9B 4COVA 4JDMA 2ERFA 3BTAA 4XQ4A 4AI2A 5L36A 1NCRA 3VKMA 4FI9A 4WZCA 4O7XA 3H1WA 2YZ4A 5GLZA 5FY4A 4Y1YA 1LGCA 3RQ0A 1JYNA 1RUC3 3ZKYA 1MS3A 3CHXA 4GALA 3ZN4A 1HV0A 1YIFA 3C7GA 2E9QA 5K8SA 5FV3A 5FLIA 1TNFA 3OYWA 3G7DA 3ACLA 5IWFA 1RMU2 3FBYA 4CCNA 3H1MA 1MS1A 1JHNA 3BGAA 1PO11 2J1AA 3FX3A 5D8AC 4HVQA 1RHI2 3M7AA 4J6GA 2WO3A 5FWJA 2L9LA 1REFA 5EHDA 5ANNA 3F2ZA 4LO8A 1G9CA 2ZJCA 2A75A 1VJ2A 1AL22 4QX1A 4XTPA 4E4HA 4C1WA 1MS0A 1QMJA 4JKMA 4EWDA 1H1MA 1GQGA 3D8CA 1W8ZA 4NR1A 2BGOA 4CEWB 5T5JA 2A1XA 2PHXA 4HT1T 1RUG1 3S5AA 3KV9A 2VMDA 1UX7A 2E53A 1UXZA 1XNTA 4DIQA 4A44A 1XNCA 1RUG2 3BODA 4XMIA 2MEV3 4Y22B 5CYYA 1PMJX 4ASKA 3ZFFB 1DF0A 3APBA 1XU2A 2IC1A 2MEV1 5FZDA 5LBCA 2D7FA 1MEC2 4B7KA 2HBUA 1Q8QA 5FZ8A 3LA3A 4QGNA 1YFYA 5F6KA 1RVF2 3IDEA 3QBQA 4JGYA 1X50A 1YRZA 2C4XA 1R093 3OY8B 2DUOA 4AI3A 3OGJA 2RE9A 3MYXA 1A34A 5KXEA 5F32A 4NHLA 4PIXA 2BDRA 3MIBA 1VBC1 4AHWA 5FYZA 2OZJA 1AL0G 1UO9A 1XNAA 1BBT1 1ZYBA 1S0IA 1V6NA 2LROA 3AP7A 4P14A 1RTVA 1YJKA 3MF6A 1GP4A 3JD73 5FZEA 2VUCA 4LBNA 1BZWA 3BI3A 2YPJA 1JYTA 2XUMA 1WLTA 2W0XA 1VBE3 2VL4A 1UMHA 1AVBA 2YG0A 3PUSA 4Y4RA 3M4FA 1YI7A 5FZ4A 3WSOA 4BU2A 4RS5C 3WW1A 1LOEA 2VCMA 3N7JA 1STMA 2JDUA 3OGVA 4HFSA 3UGFA 5H9QA 2K2SA 4OHXA 4L92A 4AVAA 3BIEA 5F6LB 4Z92B 2D3SA 4OQ8A 3R4DB 1BQPA 3MFCA 3DYOA 5C3QA 2PHWA 2XQXA 3BCWA 4IESA 3K4DA 3NW4A 5FKCA 3VD5A 1D0HA 1QJU3 3N7KA 3E1F1 1HRI3 1VB2A 4AE2A 3H8RA 1BK0A 4INDA 1ODNA 5FWEA 3ILRA 2QUOA 3IZOA 2VECA 2VCCA 3QD6A 5BNNC 3IM0A 2BGCA 4DRVA 5CISA 3AXDA 1EP0A 4FOYA 1CPMA 1YEWA 3FE5A 3HQXA 1RXFA 4YW2A 3HNYM 2VMIA 3ORJA 4JRLA 5JCTA 2WNUC 1UXXX 4I30A 4Q1RA 3L2YA 5GLWA 4MSVA 3NV3A 2CU5A 5FP9A 3MW2A 5KWRA 4NHYA 4CUCA 1GZWB 2E7QA 4LOTA 2A6ZA 3QLQA 3VDDA 3UT0A 2VTXJ 1FOD3 5DAWA 2VOTA 5FY1A 4DNYA 1H2LA 1E5HA 4QGLA 3OGSA 3VBSB 3LPGA 3FHIB 3GBWA 2E31A 3W20A 4COYA 2C5DA 2BYVE 3ECQA 1V9U1 4G9SB 1MS4A 3DPRC 4FTBA 1L7QA 1GANA 1O5UA 2X5IC 4XE9A 2EXIA 1PZ9A 2YROA 4XF3A 4CP9A 4UW4A 4A3XA 4BM8A 2P3KA 3OBAA 2CWMA 2WLPA 3I2DA 2HWF1 3VZOA 3IIIA 5JOXA 2QQMA 3AKTA 4QPIB 3VZLA 1PM4A 3JBG1 4HPKB 1PZ8A 1SFPA 2XJPA 3IT8A 4OVEA 3W59A 4A7ZA 1U0AA 4YW7A 2WO7A 3UJQA 1U5XA 1XE7A 4ZZ5A 4YW3A 2EIBA 2OPWA 1ZRDA 5E88A 4E9KA 1GWLA 4DO0A 4QKFA 4CP2A 3WQBA 2VZRA 3NJXA 4BA6A 2HWB3 2HJIA 5HCHA 5J98B 5JSRA 1EAH3 2CSGA 1WD3A 2WT1A 1TE1B 4PLNA 2IVIB 1F35A 1JUIA 1A78A 1LOFC 2NN8A 4HSJA 3PIJA 5A33A 4LA2A 5JVVA 3PU8A 4AAPA 2JDKA 2V5YA 4H3WA 4YVWA 1O59A 4XUNA 1SLLA 1WMDA 2A7AA 3P1IA 3O5SA 4I02A 5LK7B 2V5DA 5FIXA 4PQQA 3A0KA 5CKNA 2AENA 2F4LA 1O8SA 3THTA 5IT6A 5EXOA 5CAZA 5FO9B 3GBFA 3T30A 5GZCA 4HK9A 1QH7A 4CVUA 1C28A 3E97A 3EB7A 1DGWX 2AGSA 1OUXA 4MGKE 4FPOB 5AVAA 5I91A 1QJX2 1RUOA 2XVLA 1LRHA 3K46A 1J59A 1S0FA 3X29B 3HD8B 4D6SA 4ET7A 3I2GA 1UIKA 4HL0A 1CAUA 2WFF2 4KU7A 4O61A 3UESA 4LIUA 5LBFA 3H50A 2JIJA 2W47A 5DDJ1 4ZPIA 5FYSA 2E51A 2R6QA 2WFF1 5C3RA 1F4AA 1Z0HA 5C4WA 2D5HA 5T54A 3ZYGA 4LK7A 4ES8A 5FO8B 2AR6A 4FPJA 4CXXA 4FXKB 3CQOA 2VULA 1R091 1JOBA 1OLMA 1Z78A 3ME2A 4AGVA 4MHUA 1CGPA 1H4HA 3U4XA 4WV8A 3P3NA 4XDPA 5DUVA 4Y3OA 4YM1A 1V6LA 1ENXA 4KG8A 3T2OA 4CXWA 4YNIA 3W58A 3T08A 1LCLA 5CFDB 1MQTB 2JG9A 1ENSA 2GNMA 4A7KA 1JZ3A 5FLJA 5FZ0A 4HZFA 4FAGA 5CFCC 1V70A 4R4ZA 4EN7B 4K9SA 1HIXA 4HVOA 2PQSA 4G4FA 2CDOA 1W8UA 2OQ7A 3KLSA 2VBDA 2BVBA 4LO7A 3SITA 4E4ZA 2IWGB 2UWAA 3J8F1 1ULEA 5FYUA 5LW9A 1RJ8A 1CAWB 1SHWB 2HYXA 1UU5A 1YXWA 4N53A 3WNOA 1TNRA 3UKTA 4ZXEA 3EBRA 4NIIA 3QACA 5FPAA 4ZXKA 2PMWB 1AYN1 3PVEA 5K0UC 1QY4A 3AL6A 3LE0A 1W2AX 2ZX1A 5BNOC 1F31A 1IQDC 3R4SA 2EALA 1R1A3 1VAVA 3KGLA 4XBLA 4XUTA 3V56A 1QJU2 1PNGA 4YFWA 5FP7A 3WCRA 1ND3A 2A6WA 1R1A2 4RN5A 4S2DA 2JG8B 4A6OA 3D82A 3RVHA 5IK8A 2E7AA 1SLBA 1AR72 2D93A 4FPYA 3GZEA 5F8PA 4FVVA 2ZMKA 4QDRA 1AXZA 2IVJA 3URFA 3FC0A 1W2OA 2XDVA 5F2WA 1Q5OA 1C4RA 2B45X 4XZUG 5SV8A 4OFGA 3WCSA 5CEHA 4DEQA 5EJZB 1WBFA 3GZUC 4QXBA 3WNNA 1PVC1 3N7LA 4GWIA 4DZGA 3VBHB 2D5FA 1KS5A 2RS53 2FDIA 3RWKX 3VL8A 1MQTC 1RUI3 2BUKA 4S2FA 4TLFA 1UMIA 2ZGUA 4A45A 3ZR5A 4BOWA 3MGUA 2VMEA 5FXXA 1HV1A 1WMEA 5LBBA 1RUI1 1DHKB 3NJZA 2W1QA 4FO9A 4H14A 4OI0A 1W8TA 1K5JA 2WINB 3AC0A 4RGKA 4AVSA 1F5JA 1WGPA 3M8LA 4BIFA 2CGPA 4YW4A 4WM8B 1FMD1 3HQRA 3OUJA 4YZ2A 4OQ9A 5F1RA 4C0BA 4AEMA 4GWJA 4YG3A 2A73B 1VBA2 1TQ5A 3ASIA 4IL7A 5FR3A 5KR7A 5K0UB 5JSPA 2WN2A 3POWA 1PO13 5GZDA 2WNEA 4RHV2 5AFEA 4XIKA 2JE9A 2ZMNA 4NRQA 5ABJB 3FHAA 1L7LA 1W0PA 2LUWA 2UY9A 1OH3A 1UOFA 4FQ4A 3PTYA 3N9PA 1LHUA 4QB2A 4XFBA 2E33A 1YQCA 2QTWB 1Q43A 1C1FA 4AW7A 4RA0A 1OD5A 4XJ8A 3K3OA 3FUQA 4AFBA 5F3EA 1UY1A 4ZZ8A 5C5TA 4HSLA 3WF4A 4TZDA 3ZXJA 2ZKNA 4QX5A 3SC7X 3LOBA 4V2VA 2VUDA 2VZOA 3ZPOA 4Y22A 4AAXA 5J96B 5FKBA 2D6LX 4XCBA 1OUSA 3O1OA 1RMU3 2PELA 1W6QA 3ACFA 2VW2A 5A3UA 4AG4A 3J7NA 5FZ6A 2WNOA 2C24A 2Y0IA 3RI9A 1X82A 1IGOA 4MUVA 1YYNA 1PX4A 4YZ3A 1COV1 2K46A 5C8CC 2D3PA 1HQNA 2BW8A 4RD7A 2J1VA 5EV7A 2P3IA 1AR63 4AF9A 2V73A 4NWWA 4HBNA 4CDXA 1OLQA 4V1PA 3AMHA 2R30A 4IDZA 5FY8A 2QZ3A 5A7WB 2VPVA 1NZIA 4M3CB 5FZMA 4GWNA 1XE0A 1I1EA 3I2FA 2R0FA 4U2AA 2FQPA 4RFRB 3HMYA 5A32B 3VBUA 4ZU5A 4D7TA 3ACHA 1MS9A 1CJDA 1MZ5A 3ZYHA 1PNFA 3IDCB 1GNZA 2ES3A 1JMUB 4N43C 2OZ6A 2QQPA 4XJZA 4KU8A 4P5HA 5I0TA 4AVCA 2WQ8A 3POIA 4GKYA 1ND2C 2ZAHA 4HLTA 1AR92 4FPHA 2XL7A 3CBNA 4QWNA 3O1UA 3ILNA 1CIWA 1POV1 3KQ4B 4RHV1 2SLIA 1AR91 2A6VA 4IEQA 3FJSA 4JDOA 1UY4A 2VMGA 1OFNA 4JGZB 1PZ7A 1AR93 1RYYA 1ZRFA 1J1TA 4AQ2A 3JZVA 3CZUA 2WABA 3NAPA 5EPAA 2XJVA 2B39A 1UWWA 3SKVA 5BY5A 2WA3A 2XHNA 3M3EA 4YM2A 4PDWC 4CE8A 3HNBM 1AHSA 3AKSA 5DUUA 2QQKA 2WC2A 4QQ2A 5DAXA 3DUIA 3E5QA 3PLQA 4TTGA 2FDJA 4LBQA 2DVGA 1HN0A 1UY0A 1W6NA 3O12A 1LHWA 4OMCA 4LA3A 4LO6B 3RWNA 4P00B 5L7OC 3VBFC 1F9KA 2FDGA 3AKPA 5KXBA 2O8OA 1SDDB 4AEDA 2PHRA 2Q8EA 1ZZ7A 5FY5A 2B7YA 1HXS2 4IEVA 1S55A 1SBFA 4LK6A 1NCRC 2WL1A 5FMCA 1WLDA 4UW6A 4C90A 2QQVA 3POJA 3B94A 1FYUA 4QPYA 5HXMA 2EXHA 2V72A 2IXHA 2GNTA 1ZZ8A 4K1YA 3ZSLA 4AGRA 4FFFA 3AJZA 3JUUA 2IUWA 1JOPA 4LKFA 3USSA 2W5FA 4EN9B 3NAPB 3D0SA 4IGQA 2WZPP 2WQZC 1MVQA 3MHZA 3NNGA 5FYCA 3VBRC 3ZFGA 1PMHX 4L8QA 1YCIA 4A42A 1HB3A 3WDVA 1RMU1 5LRSA 2KD7A 1SCRA 3WDXA 1CAVA 3I2JA 4GD4A 3LCPA 4D7SA 4P9WA 3BUCA 1D0GA 1FMD3 1S2BA 5FMOS 3BOWA 2WZEA 1IS6A 2EIGA 2W52A 2ZMLA 4Q4V1 5FZOA 1GP6A 4NROA 2R16A 3O1SA 3AZVA 4XFGA 3WG2A 3NV1A 2P6CA 1BYHA 1AYM3 3JU9A 1A8DA 1AJKA 4IV3A 5G04L 5C70A 1BKZA 2VZ1A 4UF0B 5CFDA 5ACA1 1M4WA 5FOBB 5APAA 1AZDA 3HVDA 5F7UA 3H3ZA 2XLAA 2NPIA 3AMQA 5L9VA 4AHYA 2UURA 1RUNA 1S2KA 5FZGA 3UL2A 3BTYA 1IG0A 4QDSA 4UFJA 1O3TA 2HWE1 5EJ1B 1RGSA 3KV5A 3OG2A 1QOOA 4CYDA 2C0ZA 2ADEA 2DVDA 3S7IA 3ZFEC 4MXVA 1HKDA 4OUEA 1PM7A 1W8NA 4GB32 5FBJA 5FBZA 1UAIA 1JZ6A 4BQ4A 2Y60A 5JZGA 3NKTA 1SDWA 1K12A 3SXWA 3KT7A 1NOVA 3V0AA 5DPNA 2MPFA 1JYIA 5A6YA 5CIRA 2AH2A 1J3QA 3I2HA 1JZ7A 2GSYA 4RYDA 1NT0A 4NJ4A 2PHFA 5JXGA 3T2TA 3WHTA 1JYCA 1ASJ3 2RJLA 5B4NA 3J9SA 2RJ2A 2KXLA 1VAKA 1OD3A 4UWDA 1JYXA 3FLPA 4J1XA 4RS5A 4BB3A 1COV2 4Q4W3 1HXS1 3WP4A 4AHXA 3ZR6A 3FZ3A 1BVP1 1H8TC 4Y33A 2GP3A 4CUGA 2B9UA 3IMNA 3ZVXA 3ZFGB 2BNMA 4G3YC 1VMJA 2B8MA 3I3MA 1ODMA 3DYPA 3M3QA 5HCFA 4W65A 3I97A 1N1SA 5BNNB 3T4HB 2YHJA 3M70A 5AC91 2YBPA 1C8NA 4FCAA 4AVVA 4NRPA 2FZ2A 1U5YA 3KSCA 4AYUA 5J3UA 4EN6B 5LRRA 3WINE 3TOJA 2XMLA 2RMU2 4JRAA 1W9FA 1GZTA 4O9EA 2QE3A 3WNPA 2K9ZA 5I8TA 3MPPG 4PLMA 2RM23 3NJYA 4FSJA 4AR2A 1TME3 4NIAA 4JDNA 4CTEA 1J3PA 1OOPA 3FN9A 2ZS6B 2VQAA 1CVNA 4I09A 4YLZA 3LKJA 4I0BA 4MO3M 5FCCA 5CADA 1JS9A 3H8XA 2GN3A 4LQRA 3K75B 4RS5B 4NRMA 2Y6KA 4Z8BA 2DF7A 4XDQA 5E89A 1LU2A 4JZRA 3ATGA 4QXKA 4W4ZA 1JZ5A 4QB6A 4SBVA 1O6UA 3RYPA 3WD5A 1IPSA 5D21A 3I49A 1QQP3 4MADA 3IIAA 4TYSA 4QQLA 5F37A 1WWYA 1OMIA 1X8MA 2VVDA 2HWC3 5KHIA 1ZBE1 1OKOA 2Z79A 4Q8KA 4QPIC 3O0XA 2JB4A 1H8TB 1FNYA 1R081 1GZWA 1QDOA 5CG9A 1G7YA 4IV3B 4LR4A 3T2QA 4MGTA 4I2OA 5CG8A 3EO6A 3ZSJA 2CNAA 2YC0A 5HI0A 2PYTA 1W2UA 2WYSA 3WY6A 2ZKLA 5IVYA 2WA4A 4BE3A 4YFZA 4B8EA 3N9QA 1Q8OA 2ZGMA 3MFAA 5I8SA 3ZXKA 2XONA 1CR7A 1QJZA 1ULCA 4IERA 3D6EA 1EUUA 4KL1A 1BCXA 3I2OA 1ZZ6A 3WLUA 1EAH2 4CUAA 1MS8A 2FCVA 1RUC1 3MBWA 3O14A 1RUD3 4L0PA 4XAAA 5A3MA 5FYVA 5JOWA 2Q4SA 3ZXAC 4CP0A 5F3CA 1K5MC 4DY5A 1VALA 2ZGRA 3AB0A 2OUHA 4NPLA 1JODA 3WF3A 2EVXA 3MW4A 2QKDA 3SH4A 1VP6A 1ZBA1 2UU8A 1IPKA 4C8DA 3VHNA 3VD3A 3VHRA 3LDKA 5DZEA 4QHOA 2VW1A 4IE5A 3GJAA 4CPBD 4D0QA 3RZJA 5AC92 3SHRA 4JVAA 1MZ6A 2W1UA 4YVWB 5IVVA 2DVBA 1A3KA 4N7UA 1KXGA 3ZN6A 2ZGLA 1WUVA 2BBAA 4Q4Y2 1SBEA 2QFEA 2SBAA 2WAAA 2XKOA 1Y9QA 2LS6A 3PVNA 1HRV2 2FMDA 2J1SA 4CCEA 4XDOA 1UW8A 1AL23 1H9WA 1W6OA 5IVJA 2W94A 5IVBA 4Q4X2 2B9VA 3UNPA 1D2QA 2YC2A 1W8FA 3MUY1 3P3PA 3P6BA 4XFAA 3JBG3 4AVTA 2ARBA 2GC1A 2ARXA 4QU2A 1QF3A 2WSVA 4LJHA 4BYYA 5ERLA 4RQPB 3FMGA 2NP0A 1BEV1 4CCJA 1FV2A 1QIQA 4AI0A 4IE7A 1WLWA 3Q8EA 2EAAA 1OSGA 1UQXA 2ARCA 2RV9A 2VOVA 3RI8A 4GJYA 4N8MA 3HNMA 4R9AA 4M3CE 2JEMA 1UU6A 1ZBE3 5FZFA 3SH5A 1JYVA 5E6HA 5DG2A 1C3HA 3POGA 5BNOB 4Z2WA 3LSDA 2P37A 1JZ4A 4ISQA 3WXPA 1BMV1 4KQ7A 1PMIA 5FXVA 2FDHA 1VBE2 2O14A 1MACA 4YVWC 2PAMA 3Q9OA 4OHYA 1BMV2 4LEJA 5C9AA 4AVBA 3LEKA 2DUPA 3JD72 1XYNA 2JX9A 4X6QB 4ZONA 3UKVA 1QOSA 1IKQA 2RR11 4YVSA 1AYM2 2HWD3 3MLJA 1N3PA 1ND3B 1TME2 3PMEA 5CFDC 3CU7A 3TN92 1KDKA 2YB7A 3AYEA 3VBHC 4YSFA 2HWD1 3PNAA 5BPXA 4FQZA 1Z7S2 2KM2A 1HDKA 1OT5A 2RS33 2HWD2 4X6RB 4EE2A 1W6PA 2FHRA 1DGLA 4FPFA 5BNQA 4CEYC 5JXIA 1H8VA 1I6XA 2RS52 5FTTC 4D6QA 4RQPC 2C6SA 2ORXA 1GLHA 1EPWA 1B35A 1KQRA 1ZA7A 2OXBA 2WT0A 4AZZA 2VCAA 5LZ6A 3AP4A 3W21A 3B93A 2G19A 2VUJA 4R9DA 5LEJA 1KS4A 5B4XA 4D69A 2WNVB 2GU9A 4IUGA 2R49A 1CAUB 1TVGA 3OEAA 1LB2A 4B29A 4XFIA 3ITQA 2GMEA 3POFA 3V0BB 2J1RA 1RHI1 1YIPA 2RHPA 5IJRA 5GALA 1W99A 2J1UA 2PAKA 3HEIA 2MNGA 3WNMA 1E5RA 1SFNA 4TWTA 1AL21 4RQPA 4AHZA 1RUF3 4YGEA 1H0BA 1W6MA 1QOTA 4NMIA 5IVCA 3AFGA 4XMAA 5A3NA 4ZKTB 1S0JA 3JXSA 3WQ1A 1ST8A 4AGGA 1ZRCA 1CD3G 4LXLA 1R64A 5CB7A 4HG6B 3D3AA 4DXTA 1Q3EA 3WP6A 3RRDA 3UJOA 2C9KA 1UZ0A 4ES9A 2YMZA 3RZLA 3LEIA 3NO8A 3JB4C 3IAQA 3ZIXA 4MHRA 3BKZA 3KT1A 2X05A 3ZSEA 2BOIA 4A7YA 1TMF3 2IXIA 2IXJA 3O0VA 1A6CA 4FXGB 4UW5A 1OF4A 2P1BA 2QQIA 1YQ6A 1G9BA 4R4XA 2W2IA 3PUHA 1TMF1 1KEXA 3H3LA 3TNPB 3TEWA 3VD9A 1KFXL 4BMEA 1SZBA 4EN8B 2BBVA 4CDXB 4Q5OA 4CDWC 1OPMA 1KDMA 1UY2A 2W1WA 3VN4A 3ZPYA 4E27A 3LB9A 4GA9A 4UFKA 5HPOA 3SLIA 4CCLA 2A3YA 3OY8A 3OEBA 4PBPA 1W6PB 1DZQA 4IEUA 1QKQA 1GWKA 4Y1XA 5FYYA 1C5IA 2D6PA 4KWKA 4FAHA 2H6CA 4IE6A 1VLNA 1MZFA 4KBBA 3U10A 1HRV1 2GH2A 2O1QA 4BJ0A 1RUF1 3O1VA 4WM7C 3HT1A 5DQ0A 5HCBA 1ZRIA 4Z2AA 1SCSA 4CDQA 3U14A 2ENRA 4AEKA 1AXKA 2WNVA 3CO2A 3K3NA 3H0OA 4GH4B 4NO4A 3SKJE 4B4PA 1REDA 4PDWB 2R043 4OYUA 3R0RA 1EV12 2P17A 4MGQA 3LDRA 5KHHA 4HVRA 2IZWA 2VMHA 2XBO1 3LWCA 1CN1A 2Y38A 1V6KA 1VBC3 1OVPA 2RM21 5L7OB 3ZXEA 1NE6A 3S6PA 3VBFB 1GYKA 3C7EA 2XJUA 4PI2A 4D6RA 3TEZA 2RG4A 4XZPA 5JI9A 3VB9A 3GDBA 1MQTA 3CJIA 1JN2P 5FXWA 4XURA 1NCRB 4ONUA 1V6IA 4CZSA 1GKBA 1FPN1 1ND2B 5FK7A 2E26A 3WQ7A 5I93A 2HLEA 2JIGA 1QGLA 2YBSA 5FO7B 3ZO0B 2XJQA 4OLLA 2KR2A 2RS32 2K0GA 4E2QA 3WR0A 2WT2A 5KXCA 4HXCA 1DDLA 1RUH3 1O4TA 3T4VA 1S0BA 1W04A 2XOMA 1PO23 2WS91 3FBMA 4JGYB 4CDUB 2XJRA 2WDBA 4GH4C 3RJ2X 2RMU1 1VMFA 1ULGA 1N1YA 1LEDA 2YUEA 5GLTA 4MG2A 3ES4A 5LK5A 3A4UA 2ZX4A 3A0NA 2OX0A 5EZWA 1SQ4A 2IXCA 3WHUA 3IN9A 4P9JA 2C26A 4YG6A 4EN0A 1Y9GA 3OUHA 3MV11 4XBNA 3A23A 5F3IA 1UU4A 3BPZA 3V64A 5L73A 3RZGA 2VNGA 2DFCA 3SMHA 5G05L 1IS3A 3LZZA 2QQUA 5E1RA 1O3QA 2G9GA 2JB8A 3TYJA 2XQRA 1DGRN 1COV3 4Q4W2 3USUB 3PU3A 1GP5A 2DCTA 3H42B 3WVJA 1WW7A 2XBO2 3SCGA 3K51A 4L2NA 5DAQA 3WX5A 4Q4W1 3AZYA 4XF9A 3ZFEB 2R062 4KG0A 4FFIA 1RUF2 4K3UA 2WSUA 2HWF2 3IAPA 3HBZA 1Y3TA 4K1ZA 1YI9A 2DWRA 4YGBA 5FZLA 3V0AB 2XWJB 3VKOA 3MDPA 4IEWA 4QKNA 2GH8A 5L9BA 4GZ9A 2BRTA 3VBOA 1KRIA 4JGZA 1IZ3A 3GYDA 1WLCA 1I9RA 5J37A 4NIGA 3MF9A 2CL2A 4AQTA 2JE8A 1QHDA 4CPBA 1PHMA 4HOOA 1B09A 2E63A 4AWDA 2CHHA 4M0NA 1DQ4A 2W91A 2QQNA 2PHLA 2UWBA 4Y1UA 4J1WA 2HWE2 4ITCA 4MLOA 4OCTA 3H7YA 4M4PA 3VBSA 4QPGC 1Y43B 1DGRA 1W03A 4BCUA 1QNYA 2JG9C 3HN1A 1H1AA 2GALA 4XF0A 5LATA 4LO4B 2JD4A 5JR2A 2GZWA 1NZCA 1NQDA 2ZEZA 4ZS3A 1P8JA 2RS51 2VTXA 4DXRA 1G6NA 5A1FA 2GC2A 3WF0A 5CA6A 4DMIA 1KITA 2WAOA 2VNVA 4YG0A 4AQ6A 1E5SA 2YDEA 1WMXA 1WZXA 3WNLA 4N53C 1LR5A 1UYYA 4YWAA 4TN7A 5JMOA 4Q4V3 4MXWA 3RZZA 1GMMA 1OOPB 2GNDA 1RUD2 2VOKA 1BVVA 2ZTNA 4OI2A 5I0UA 1ALYA 1AYM1 1XXNA 2ZGTA 5JOYA 4FPLA 3KD4A 4LPLA 1U12A 1WD4A 3KHCA 1W8HA 1SLIA 1YWKA 1QNWA 3I59B 1ZVFA 1Y7BA 2VZTA 1CZTA 2DVAA 3WUCA 3B9IA 4AXOA 2LM3A 2RDNA 5KXDA 1OQ1A 1DQ6A 4PIZA 1DZRA 3INAA 1UD1A 3LAGA 3RS6A 5C5UA 3C7OA 1HB1A 3OOXA 5LB6A 2C1FA 4KWUA 4WVWA 1S2EA 1S0DA 4CEWC 3H9AA 1F2NA 1AR73 4BIOA 3PUAA 5I0SA 1KGYA 1CESA 3AZXA 1CAXA 1RXGA 1UZWA 3ZFGC 1RUD1 4BQ5A 1DLLA 3NNLA 4XC9A 1W2TA 1XU1A 1UZZA 2OW4A 4Q26A 3WQ0A 3MV01 3ZXGA 1WW6A 4QHBA 5A7SA 2I2SA 3DGTA 4I3GA 3I2IA 2J22A 4META 1R082 4LNVA 3S30A 3THDA 4BDVB 4EROA 2VAUA 2W87A 1FI2A 4LHNA 1RL3A 3DV8A 3TEYA 1NKGA 3B02A 3P5BA 2LW8A 3N9NA 1UKGA 3B69A 2TUNA 1ACCA 5FZ9A 4WVMA 4E4SA 1YFXA 2Q5TA 3BB6A 4Q4Y3 2XWBB 1BBT3 1X7NA 3Q8CA 4HKWA 5D8AA 1UZYA 3JD71 4O65A 4MVTA 2VNOA 3DL3A 1QH6A 3KCXA 4MGSA 3H1YA 5JIUA 3AKRA 4AL9A 2RMU3 3B5LB 4GMP3 5FP3A 1WA4A 5F5QA 1DQ2A 4L9BA 2ZX3A 2F17A 5AC93 2MHFA 5HV4A 2X8KA 3A22A 2EIEA 4GMP1 5HBAA 4BK4A 1GSLA 1RUG3 2ORZA 2CGOA 2UWCA 2JKBA 1DYPA 2DFBA 2J1TA 4PLOA 1LJ7A 4BQWA 1WCUA 3N9LA 4NWVA 1LU1A 5GKAC 1LESA 1UOBA 4CDQC 1GU3A 5LA1A 3WG4A 2ET7A 3ACGA 5F3GA 3OSDA 2WRAA 4UXAA 1ZA4A 4BPZA
chains in the Genus database with same CATH topology
5CZKA 3C7GA 2VM9A 2WN3A 3WNPA 2CDPA 3ZM8A 4CUBA 3VDBA 1K45A 3BGAA 1WKYA 2J1AA 3FN9A 2WO3A 2ZEXA 4MO3M 3CZJA 4ZY9A 2L9LA 4LQRA 3F2ZA 3K75B 2Y6KA 4QX1A 4UI9L 4JKMA 5DN2A 4W4ZA 1JZ5A 4QB6A 2R7EB 2BGOA 4DUWA 4PT6A 4MADA 2VMDA 1UX7A 1UXZA 1XNTA 5IYYA 4A44A 1OH4A 5CYYA 1PMJX 2Y6HA 3T2QA 4YPJA 2WYSA 3CIHA 3FHQA 2C4XA 4PF1A 2EICA 5LA2A 1JI6A 2V4VA 3T2PA 2XONA 3IDAA 1EUUA 4E8CA 3U37A 5A1AA 4DUXA 4CUAA 1K42A 1XNAA 2VQTA 3MUZ1 3MBWA 4L0PA 2VO5A 2QQJA 1JZ2A 2BERA 2YG0A 2VL4A 1UMHA 2YC4A 2YFZA 3WSOA 3I3DA 1MPXA 1XPWA 3OGVA 3WF3A 1JYWA 3VD3A 2WO1A 3ABZA 3DYOA 4KMQA 2XQXA 3K4DA 3VD5A 4D0QA 3E1F1 2W1UA 2E32A 3VD7A 3NRUA 1DYOA 2VCCA 1CZVA 4A41A 2BBAA 4A4AA 1JU4A 2WAAA 3HNYM 2LS6A 1UXXX 2J1SA 4P5YA 2QQOA 4CUCA 2JKXA 1NAEA 2W94A 4DEVA 2B9VA 2DCJA 2DDUA 3UNPA 2YC2A 3WF2A 3P6BA 3MUY1 3MO4A 4UOJA 2VOTA 4CU9A 3CKHA 3OGSA 2VZQA 3LPGA 1DP0A 2E31A 1UYZA 4CU8A 1W9WA 3ECQA 5C7GA 2ZXQA 1L7QA 4LKSA 1US2A 2RV9A 4OMDA 3OBAA 2W9XA 3HNMA 5JUVA 3IIIA 1JYVA 2QQMA 3T0BA 1JZ4A 4XVHA 3T0AA 1JHJA 2W95A 4ZZ5A 2EIBA 3LEKA 2J7MA 3WQBA 2VZRA 3NJXA 3C8XA 3PUIA 2VR4A 4QX3A 3W5NA 2YB7A 1O59A 4XUNA 4QDQA 3P1IA 2V5DA 1OT5A 3CDZB 4PQQA 4BK5A 1O8SA 5JXIA 4OZOA 1ULOA 2QQLA 3SEPA 4CVUA 4W8JA 2ORXA 3EB7A 3K46A 2VCAA 4ET7A 2X09A 3I2GA 3UESA 5B4XA 2JDAA 2W47A 4IUGA 3I2KA 3OEAA 1TVGA 5LCWL 1F4AA 4JKLA 1W9TA 2VCBA 3HN3A 2J1RA 5IJRA 2OKXA 1W99A 2J1UA 3HEIA 2VZUA 3WNMA 3CQOA 4QX2A 3WF1A 1HN1A 3T2OA 3THCA 3T08A 5DMYA 1JZ3A 3NQHA 2Y8KA 2JD9A 3JXSA 3K77A 2VC9A 3WEZA 2PQSA 1R64A 2CDOA 4HG6B 1CIYA 1JU3A 3D3AA 4DXTA 1CX1A 2C9KA 1UZ0A 3LEIA 1SHWB 2HYXA 3IAQA 3J7HA 3WNOA 2X05A 4LHSA 5LA0A 2WUHA 4ZXEA 3HJRA 1W8OA 2ZEYA 1OF4A 2QQIA 4TXWA 3LE0A 2ID4A 3PUHA 1BHGA 1IQDC 1KEXA 4XUTA 1GQPA 1W9SA 2Y6JA 3VD9A 4RN5A 4A6OA 2WO2A 4KI5M 4W50A 1UYXA 1UY2A 2W1WA 5HPOA 4QDRA 3DYMA 2W46A 2W92A 3OEBA 4D8MA 4XZUG 4DEQA 5EJZB 3WNNA 4GWIA 4BJ0A 5DQ0A 4Z2AA 5J1XA 2B4KA 1UMIA 3SKJE 4A45A 2VJXA 2VMEA 4DXSA 2Z4FA 4OYUA 2W1QA 3VDCA 3AC0A 4MGQA 1NX9A 1LNSA 2ZEWA 4GWJA 1GNYA 3UETA 3C7EA 2RVAA 2WN2A 3GDBA 4QX0A 3FHAA 3W5MA 1I5PA 5EIYB 4XURA 2Y64A 2E26A 4QB2A 2HLEA 2E33A 3SEEA 1DLCA 1F4HA 4JHZA 2QBXA 4ZZ8A 1UY1A 2EIDA 3WF4A 3IB3A 2VZ3A 2VZOA 4AAXA 3VDAA 1GUIA 3WNKA 3ACFA 3HPNA 3LEGA 1GOGA 4AG4A 2XOMA 5IHRA 2WDBA 1PX4A 3GM8A 1T2XA 1H6XA 2J1VA 1CZSA 4A3ZA 3OGRA 2C26A 2YFUA 4ARXA 3MV11 3A23A 5JXJA 3HOBA 3I2FA 5G05L 1US3A 3ACHA 1TG7A 1K3IA 3LQCA 3CMGA 3OB8A 3T09A 1SG3A 2VZSA 2WQ8A 1L7RA 3C7FA 3T0DA 3IAPA 3K4AA 1D7PM 1UY4A 2WBKA 1RYYA 2BGPA 4GZ9A 2VZPA 3CZUA 1GOFA 2WABA 3SKVA 3VD4A 1UWWA 2JE8A 2XHNA 2WZ8A 2Y6LA 2BZDA 3HNBM 2QQKA 1GOHA 2W91A 4DUVA 5IFTA 4TTGA 1J83A 2QQNA 1UY0A 4E8DA 4M4PA 3EYPA 4OMCA 3I3EA 4ARYA 4P00B 1J84A 1SDDB 5JR2A 2ZEZA 2J1EA 1P8JA 1H6YA 2VMFA 4DXRA 3WF0A 2WAOA 4QPWA 5HXMA 5JXHA 3BN6A 2V72A 3WNLA 2VZVA 3C7HA 1JZ8A 1W0NA 1UYYA 5JMOA 4JX0A 4CU6A 2W5FA 1GMMA 2X10A 3NNGA 4JKKA 1PMHX 2VTFA 3GGLA 4LPLA 4A42A 2VQUA 3I3BA 2KD7A 2VZTA 3I2JA 1CZTA 4M4RA 4QAWA 5I0DA 3C7OA 2VMCA 2WZEA 4KWUA 2W1SA 1KGYA 5G04L 5C70A 4P08A 2VZ1A 4CU7A 5F7UA 3MV01 5C71A 4XUPA 2Y6GA 3ETPA 4QDSA 5IFPA 3I2IA 2J22A 1YQ2A 4UAPA 5EJ1B 4BDVB 3THDA 3OG2A 2W87A 1WCQA 4OUEA 1NKGA 1W8NA 4QB1A 1JZ6A 2LW8A 3NJVA 2W3JA 3LPFA 1K12A 1PX3A 1ULPA 1UY3A 1NUKA 1O8PA 5DPNA 2DCKA 4MGSA 1EUTA 3A7QA 4MOAA 1XC6A 3I2HA 1JZ7A 3ACIA 4RYDA 3GXUA 3A21A 5FUIA 5JXGA 3A22A 2EIEA 3DECA 4P02B 5B4NA 4BK4A 2ORZA 2RJ2A 1OD3A 1JYXA 3FL7A 4XUQA 4XUOA 2J1TA 1GU3A 4FI9A 5LA1A 4BXSV 3ACGA 3DYPA 3K4ZA 3I97A 1JYNA 1OF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CZK A;  3C7G A;  2VM9 A;  2WN3 A;  3WNP A;  2CDP A;  3ZM8 A;  4CUB A;  3VDB A;  1K45 A;  3BGA A;  1WKY A;  2J1A A;  3FN9 A;  2WO3 A;  2ZEX A;  4MO3 M;  3CZJ A;  4ZY9 A;  2L9L A;  4LQR A;  3F2Z A;  3K75 B;  2Y6K A;  4QX1 A;  4UI9 L;  4JKM A;  5DN2 A;  4W4Z A;  1JZ5 A;  4QB6 A;  2R7E B;  2BGO A;  4DUW A;  4PT6 A;  4MAD A;  2VMD A;  1UX7 A;  1UXZ A;  1XNT A;  5IYY A;  4A44 A;  1OH4 A;  5CYY A;  1PMJ X;  2Y6H A;  3T2Q A;  4YPJ A;  2WYS A;  3CIH A;  3FHQ A;  2C4X A;  4PF1 A;  2EIC A;  5LA2 A;  1JI6 A;  2V4V A;  3T2P A;  2XON A;  3IDA A;  1EUU A;  4E8C A;  3U37 A;  5A1A A;  4DUX A;  4CUA A;  1K42 A;  1XNA A;  2VQT A;  3MUZ 1;  3MBW A;  4L0P A;  2VO5 A;  2QQJ A;  1JZ2 A;  2BER A;  2YG0 A;  2VL4 A;  1UMH A;  2YC4 A;  2YFZ A;  3WSO A;  3I3D A;  1MPX A;  1XPW A;  3OGV A;  3WF3 A;  1JYW A;  3VD3 A;  2WO1 A;  3ABZ A;  3DYO A;  4KMQ A;  2XQX A;  3K4D A;  3VD5 A;  4D0Q A;  3E1F 1;  2W1U A;  2E32 A;  3VD7 A;  3NRU A;  1DYO A;  2VCC A;  1CZV A;  4A41 A;  2BBA A;  4A4A A;  1JU4 A;  2WAA A;  3HNY M;  2LS6 A;  1UXX X;  2J1S A;  4P5Y A;  2QQO A;  4CUC A;  2JKX A;  1NAE A;  2W94 A;  4DEV A;  2B9V A;  2DCJ A;  2DDU A;  3UNP A;  2YC2 A;  3WF2 A;  3P6B A;  3MUY 1;  3MO4 A;  4UOJ A;  2VOT A;  4CU9 A;  3CKH A;  3OGS A;  2VZQ A;  3LPG A;  1DP0 A;  2E31 A;  1UYZ A;  4CU8 A;  1W9W A;  3ECQ A;  5C7G A;  2ZXQ A;  1L7Q A;  4LKS A;  1US2 A;  2RV9 A;  4OMD A;  3OBA A;  2W9X A;  3HNM A;  5JUV A;  3III A;  1JYV A;  2QQM A;  3T0B A;  1JZ4 A;  4XVH A;  3T0A A;  1JHJ A;  2W95 A;  4ZZ5 A;  2EIB A;  3LEK A;  2J7M A;  3WQB A;  2VZR A;  3NJX A;  3C8X A;  3PUI A;  2VR4 A;  4QX3 A;  3W5N A;  2YB7 A;  1O59 A;  4XUN A;  4QDQ A;  3P1I A;  2V5D A;  1OT5 A;  3CDZ B;  4PQQ A;  4BK5 A;  1O8S A;  5JXI A;  4OZO A;  1ULO A;  2QQL A;  3SEP A;  4CVU A;  4W8J A;  2ORX A;  3EB7 A;  3K46 A;  2VCA A;  4ET7 A;  2X09 A;  3I2G A;  3UES A;  5B4X A;  2JDA A;  2W47 A;  4IUG A;  3I2K A;  3OEA A;  1TVG A;  5LCW L;  1F4A A;  4JKL A;  1W9T A;  2VCB A;  3HN3 A;  2J1R A;  5IJR A;  2OKX A;  1W99 A;  2J1U A;  3HEI A;  2VZU A;  3WNM A;  3CQO A;  4QX2 A;  3WF1 A;  1HN1 A;  3T2O A;  3THC A;  3T08 A;  5DMY A;  1JZ3 A;  3NQH A;  2Y8K A;  2JD9 A;  3JXS A;  3K77 A;  2VC9 A;  3WEZ A;  2PQS A;  1R64 A;  2CDO A;  4HG6 B;  1CIY A;  1JU3 A;  3D3A A;  4DXT A;  1CX1 A;  2C9K A;  1UZ0 A;  3LEI A;  1SHW B;  2HYX A;  3IAQ A;  3J7H A;  3WNO A;  2X05 A;  4LHS A;  5LA0 A;  2WUH A;  4ZXE A;  3HJR A;  1W8O A;  2ZEY A;  1OF4 A;  2QQI A;  4TXW A;  3LE0 A;  2ID4 A;  3PUH A;  1BHG A;  1IQD C;  1KEX A;  4XUT A;  1GQP A;  1W9S A;  2Y6J A;  3VD9 A;  4RN5 A;  4A6O A;  2WO2 A;  4KI5 M;  4W50 A;  1UYX A;  1UY2 A;  2W1W A;  5HPO A;  4QDR A;  3DYM A;  2W46 A;  2W92 A;  3OEB A;  4D8M A;  4XZU G;  4DEQ A;  5EJZ B;  3WNN A;  4GWI A;  4BJ0 A;  5DQ0 A;  4Z2A A;  5J1X A;  2B4K A;  1UMI A;  3SKJ E;  4A45 A;  2VJX A;  2VME A;  4DXS A;  2Z4F A;  4OYU A;  2W1Q A;  3VDC A;  3AC0 A;  4MGQ A;  1NX9 A;  1LNS A;  2ZEW A;  4GWJ A;  1GNY A;  3UET A;  3C7E A;  2RVA A;  2WN2 A;  3GDB A;  4QX0 A;  3FHA A;  3W5M A;  1I5P A;  5EIY B;  4XUR A;  2Y64 A;  2E26 A;  4QB2 A;  2HLE A;  2E33 A;  3SEE A;  1DLC A;  1F4H A;  4JHZ A;  2QBX A;  4ZZ8 A;  1UY1 A;  2EID A;  3WF4 A;  3IB3 A;  2VZ3 A;  2VZO A;  4AAX A;  3VDA A;  1GUI A;  3WNK A;  3ACF A;  3HPN A;  3LEG A;  1GOG A;  4AG4 A;  2XOM A;  5IHR A;  2WDB A;  1PX4 A;  3GM8 A;  1T2X A;  1H6X A;  2J1V A;  1CZS A;  4A3Z A;  3OGR A;  2C26 A;  2YFU A;  4ARX A;  3MV1 1;  3A23 A;  5JXJ A;  3HOB A;  3I2F A;  5G05 L;  1US3 A;  3ACH A;  1TG7 A;  1K3I A;  3LQC A;  3CMG A;  3OB8 A;  3T09 A;  1SG3 A;  2VZS A;  2WQ8 A;  1L7R A;  3C7F A;  3T0D A;  3IAP A;  3K4A A;  1D7P M;  1UY4 A;  2WBK A;  1RYY A;  2BGP A;  4GZ9 A;  2VZP A;  3CZU A;  1GOF A;  2WAB A;  3SKV A;  3VD4 A;  1UWW A;  2JE8 A;  2XHN A;  2WZ8 A;  2Y6L A;  2BZD A;  3HNB M;  2QQK A;  1GOH A;  2W91 A;  4DUV A;  5IFT A;  4TTG A;  1J83 A;  2QQN A;  1UY0 A;  4E8D A;  4M4P A;  3EYP A;  4OMC A;  3I3E A;  4ARY A;  4P00 B;  1J84 A;  1SDD B;  5JR2 A;  2ZEZ A;  2J1E A;  1P8J A;  1H6Y A;  2VMF A;  4DXR A;  3WF0 A;  2WAO A;  4QPW A;  5HXM A;  5JXH A;  3BN6 A;  2V72 A;  3WNL A;  2VZV A;  3C7H A;  1JZ8 A;  1W0N A;  1UYY A;  5JMO A;  4JX0 A;  4CU6 A;  2W5F A;  1GMM A;  2X10 A;  3NNG A;  4JKK A;  1PMH X;  2VTF A;  3GGL A;  4LPL A;  4A42 A;  2VQU A;  3I3B A;  2KD7 A;  2VZT A;  3I2J A;  1CZT A;  4M4R A;  4QAW A;  5I0D A;  3C7O A;  2VMC A;  2WZE A;  4KWU A;  2W1S A;  1KGY A;  5G04 L;  5C70 A;  4P08 A;  2VZ1 A;  4CU7 A;  5F7U A;  3MV0 1;  5C71 A;  4XUP A;  2Y6G A;  3ETP A;  4QDS A;  5IFP A;  3I2I A;  2J22 A;  1YQ2 A;  4UAP A;  5EJ1 B;  4BDV B;  3THD A;  3OG2 A;  2W87 A;  1WCQ A;  4OUE A;  1NKG A;  1W8N A;  4QB1 A;  1JZ6 A;  2LW8 A;  3NJV A;  2W3J A;  3LPF A;  1K12 A;  1PX3 A;  1ULP A;  1UY3 A;  1NUK A;  1O8P A;  5DPN A;  2DCK A;  4MGS A;  1EUT A;  3A7Q A;  4MOA A;  1XC6 A;  3I2H A;  1JZ7 A;  3ACI A;  4RYD A;  3GXU A;  3A21 A;  5FUI A;  5JXG A;  3A22 A;  2EIE A;  3DEC A;  4P02 B;  5B4N A;  4BK4 A;  2ORZ A;  2RJ2 A;  1OD3 A;  1JYX A;  3FL7 A;  4XUQ A;  4XUO A;  2J1T A;  1GU3 A;  4FI9 A;  5LA1 A;  4BXS V;  3ACG A;  3DYP A;  3K4Z A;  3I97 A;  1JYN A;  1OF3 A; 
#chains in the Genus database with same CATH topology
 5JIA A;  2PA7 A;  4JTO A;  1JUH A;  4C0H A;  1ASJ 1;  3E5U A;  3ZYB A;  4M0H A;  3UGH A;  3Q8F A;  1LOD A;  4GQ7 A;  5C4W B;  5D1I A;  3GHN A;  3ZYI B;  2QVS B;  1ASJ 2;  2RS1 1;  1XSQ A;  2CDP A;  2ZA9 A;  3M2M A;  3ZM8 A;  3U0Z A;  1UMZ A;  3KMH A;  4LBJ A;  1PGL 2;  1K45 A;  2VH9 A;  2WII B;  4Z82 A;  2XG3 A;  5IVE A;  3R4U A;  4JQR A;  2ZEX A;  4UF0 A;  1LOF A;  1K5M B;  3CZJ A;  1G9D A;  4Q4X 3;  2BVV A;  2OPK A;  1REE A;  2CV6 A;  4IW3 A;  2Z42 A;  3HR9 A;  5FZI A;  5IW0 A;  3PVO A;  1WBL A;  5F5A A;  5FP4 A;  4BXF A;  3WNX A;  1XYP A;  2HWB 2;  2Z5W A;  4UI9 L;  3ZYJ B;  3ENR A;  2X5I A;  1PGS A;  1ZRE A;  5K4L A;  2BQP A;  2R7E B;  1XNK A;  4DUW A;  1HQL A;  4PBO A;  4PT6 A;  5L9R A;  4PF5 A;  1LGB A;  1HRI 1;  3WW4 A;  4CP1 A;  2TNF A;  3KCY A;  2Y26 A;  2F4P A;  4Z1V A;  4CDQ B;  1VBA 1;  1ENQ A;  1S0E A;  3AXE A;  5JSO A;  1WCK A;  3FFQ A;  3MLK A;  1VPH A;  5FMD A;  4WM8 A;  1VBA 3;  1WW4 A;  4UYB A;  5FPV A;  4B1L A;  4EJR A;  4OUS A;  5D2A A;  3RJR A;  4CCD A;  4GKX A;  2ZGS A;  4LMF A;  2EIC A;  5LA2 A;  1FOD 2;  5C4W C;  2FZ1 A;  4Q0U A;  1JI6 A;  2V4V A;  5FDB A;  5JWP A;  3KVA A;  4N90 A;  3MZH A;  3LSE A;  4BWO A;  1FOD 1;  4JCK A;  3ZDV A;  4E8C A;  1UX6 A;  3U37 A;  3FUO A;  3OTF A;  5A1A A;  1K42 A;  1D4V B;  2QNK A;  3VDD C;  3MUZ 1;  3ZDS A;  2QQW A;  2TBV A;  4IEZ A;  2EXJ A;  3T1L A;  2VO5 A;  2A3W A;  2QQJ A;  2ILM A;  3VBH A;  1JZ2 A;  2BER A;  5FQ0 A;  3HT2 A;  1O4Z A;  4RL7 A;  5FZA A;  2A71 A;  2G9Z A;  2QDR A;  2YFZ A;  1XOY A;  4SLI A;  5CVR A;  5L19 A;  3LEM A;  3I3D A;  3MID A;  2YY1 A;  1MPX A;  1XPW A;  2P3Y A;  3V65 A;  2R1D A;  4CEY A;  4FOQ A;  3AM2 A;  4LOS A;  1QJU 1;  4FFH A;  4NE9 A;  2WO1 A;  1OXC A;  2WZR 2;  2RDR A;  2CYF A;  4KMQ A;  4QX7 A;  4RR3 B;  3WW2 A;  1LUL A;  4Q2F A;  3TEX A;  3DXT A;  3BU0 A;  3IPV B;  1HX6 A;  2GN7 A;  3NNJ A;  2E32 A;  1LHN A;  3VD7 A;  4AOC A;  3MLL A;  1RUE 1;  1PIV 3;  2JE7 A;  1E5I A;  1OLM E;  4NAM A;  1CZV A;  1W6M B;  3AYA A;  5FUN A;  1RIT A;  5DDJ 2;  5FFO C;  3UK9 A;  1JU4 A;  1RUE 2;  3RG0 A;  2G4I A;  2HWC 2;  4XAE A;  2XKP A;  5CKQ A;  3DPR A;  4ZU4 A;  3GAL A;  1CON A;  2HWC 1;  5IUQ A;  5A32 A;  3RYR A;  3TBD A;  4BQY A;  2DV9 A;  4ATE A;  4DEV A;  4DS0 A;  1SEF A;  5JMC A;  1DQ1 A;  3ZXL A;  1YUD A;  5FPB A;  3WF2 A;  3MO4 A;  2PLV 2;  1IS5 A;  3IKW A;  4CU9 A;  3VDD B;  4CEY B;  1LTE A;  2XVK A;  3NWK A;  4YM3 A;  2VZQ A;  3KGZ A;  1DBN A;  5FZO B;  2OUJ A;  2ZHM A;  3B7M A;  4RR3 A;  4CU8 A;  1W9W A;  4H55 A;  5C7G A;  2ZXQ A;  4FFG A;  1ZZ9 A;  4XFC A;  1AUY A;  3ZFE A;  5A6Q A;  5A3P A;  1Q8S A;  1QWR A;  4OMD A;  3B00 A;  2W9X A;  3EJK A;  2OVU A;  1NLQ A;  4NIH A;  2MEV 2;  1GQH A;  4AI1 A;  1C1L A;  4NOT A;  1LEN A;  5T55 A;  3VHP A;  3ZXD A;  1QJY 3;  3E6C C;  1XYO A;  3MPB A;  4LBM A;  4TSV A;  4XVH A;  1NCQ A;  3T0A A;  5C8C B;  1JHJ A;  2W95 A;  4A2U A;  3IWZ A;  4QMA A;  1QXR A;  2DYC A;  4LE3 A;  4M3C F;  2Q0A A;  1S0C A;  2J7M A;  2WNU A;  4MGZ E;  2BEO A;  4D7Y A;  1XBF A;  4LLF A;  5KHG A;  3AMP A;  2VVE A;  4LE4 A;  5GLU A;  4LTA A;  4DY3 A;  4JQT A;  3TWI A;  2BFU S;  4HKO A;  4QX3 A;  3W5N A;  3J4U H;  1TZO A;  4QDQ A;  2XGX A;  2R06 3;  5FRA A;  3AMN A;  2E7T A;  5A33 B;  1RUJ 1;  5JPM B;  3GBG A;  4QQH A;  4BK5 A;  1S4C A;  2ZBJ A;  1LHV A;  3OGG A;  2G1M A;  4NUB A;  3ZN5 A;  2OII A;  1RB8 G;  4YAR A;  4IET A;  5JZG C;  2QQL A;  2ATF A;  4OI1 A;  3SEP A;  2E6V A;  2CAV A;  2LTN A;  4Y20 A;  2ZCW A;  3N36 A;  4W8J A;  2GDF A;  3VZJ A;  1YQ8 A;  2JDZ A;  5C3P A;  2YYO A;  4YRD A;  4L97 A;  4Y5Z 0;  2BWA A;  2ZX0 A;  3OBR A;  3ZKU A;  2X09 A;  5FPL A;  4Z07 A;  3ILF A;  1OA2 A;  4UFL A;  4MH0 E;  4XBQ A;  2RS1 2;  3CF6 E;  3O1T A;  2XPJ A;  5E8A A;  3KZ4 C;  2GMP A;  5ABJ C;  5LCW L;  4JKL A;  1Q8V A;  1PIV 1;  2YBK A;  3AL5 A;  4COU A;  2FCU A;  1RIR A;  2RDS A;  3HN3 A;  4R52 A;  2OKX A;  3Q8A A;  4I01 A;  2IXL A;  1XQN A;  2VZU A;  4S2G A;  2JWP A;  4XFF A;  2D97 A;  1ENR A;  1W05 A;  3LGR A;  4QQO A;  1HN1 A;  4RSU A;  2HWB 1;  2UY8 A;  3WDT A;  1FPN 2;  3GNE A;  4N43 A;  4Y5S A;  3THC A;  5FZK A;  1FMD 2;  5CKM A;  3TN9 3;  4UBG A;  5DMY A;  3DXU A;  2PHD A;  2JD9 A;  1HB2 A;  3SNM A;  2VOW A;  3PJY A;  3WUD A;  5C3O A;  2VC9 A;  4EQV A;  1JW6 A;  3WEZ A;  4JGY C;  5FZB A;  4CDU C;  2H0V A;  2OQ6 A;  4M3C A;  4EZ4 A;  4OHZ A;  1IOA A;  1JU3 A;  1X36 A;  1WMF A;  4IEY A;  3RPQ A;  3C2U A;  3WDY A;  5AVP A;  3WV6 A;  3NV2 A;  2WUH A;  3KV6 A;  3HJR A;  2HWF 3;  2PAE A;  3AKQ A;  2ID4 A;  1BHG A;  4YW1 A;  1EPZ A;  3VKF C;  1LHO A;  2VD7 A;  1GQP A;  1W9S A;  2DCY A;  2Y6J A;  1XND A;  3POY A;  3MIC A;  3VBR A;  4E2S A;  2D40 A;  3E5X A;  2R07 1;  1WCS A;  1FAT A;  4Y4Y A;  2RR1 2;  3VBF A;  5IK7 A;  1QU0 A;  1AR8 2;  4N43 B;  1PO2 1;  1ZZB A;  2P2K A;  4NVP A;  4Q27 A;  1X33 A;  4DOU A;  1GV9 A;  2W92 A;  1ONA A;  1AR8 1;  5LAS A;  1GIC A;  1DFQ A;  3CNA A;  3JB8 A;  4K6B A;  5J7M A;  3PUQ A;  3OD0 A;  1POV 3;  5FYI A;  2JDP A;  1S0G A;  5A80 A;  3K48 A;  4Y24 A;  1YQ5 A;  1DCS A;  1DQ5 A;  2BJS A;  2R06 1;  3DKW A;  1I5Z A;  5J1X A;  2B4K A;  5LEK A;  1YFW A;  1R09 2;  4UFM A;  5IAT A;  4Q4V 2;  2NM1 A;  1NXM A;  4DXS A;  5A6X A;  1J1L A;  4GJZ A;  2Z69 A;  2CWS A;  4LUL A;  3ZXF A;  3VDC A;  5A3L A;  1H4G A;  3ZSM A;  4QM9 A;  1FNZ A;  2WR9 A;  3RZM A;  1NX9 A;  2OS2 A;  1GWM A;  2VNR A;  3LIG A;  1UOJ A;  3L9J T;  1D4M 2;  4IQP A;  3MIH A;  2WFF 3;  2CAU A;  4QPG A;  1POQ A;  4QX0 A;  3W5M A;  2YU2 A;  3WP3 A;  1O7F A;  3OCP A;  5EIY B;  3U78 A;  3PUR A;  3SQO A;  2PHU A;  5FZ3 A;  4CA9 A;  4H7L A;  4QT6 A;  1CAW A;  1SLT A;  2P5B A;  3WG1 A;  1DLC A;  2LRP A;  2ZOE B;  4JHZ A;  4LBK A;  4LT5 A;  4F3J A;  5F5I A;  2FMY A;  1ND2 A;  3BAL A;  3VGI A;  1VBC 2;  2EID A;  1W8W A;  1N1V A;  3IB3 A;  3ALQ A;  1OOP C;  1PGW 1;  1C8M 3;  4FPG A;  2KA3 A;  5EFU A;  5H9P A;  5IK5 A;  2VZ3 A;  2XUE A;  1N3O A;  4LBQ D;  1NA1 A;  3SH3 A;  3VDA A;  1GUI A;  3WNK A;  3J8F 2;  2ZZQ A;  3HPN A;  3LEG A;  4W6X A;  1V00 A;  5FAX A;  2PHT A;  2DUR A;  4H2A A;  5BV6 A;  4AI9 A;  5IHR A;  1PK6 B;  3ZOI A;  4K21 A;  3RNS A;  3GM8 A;  5A7O A;  3RMX A;  1LOC A;  1B35 B;  2AZ5 A;  2ZHN A;  2OT7 A;  4Y5T A;  2XXZ A;  3LF7 A;  1X8E A;  1XE8 A;  1CZS A;  2ZGO A;  4QPG B;  1UN1 A;  1MVE A;  5J36 A;  1GZ9 A;  1H30 A;  2GC3 A;  1VBD 3;  1HRV 3;  1IG3 A;  2BWC A;  4LLO A;  4XJU A;  3VBU B;  3WW3 A;  4GMP 0;  5JXJ A;  5EQU A;  4YYO A;  1Q56 A;  4FP3 A;  1QJY 2;  1T6B X;  1VBD 1;  2WZR 1;  3KT4 A;  5IAV A;  5BXX A;  1US3 A;  5A7W A;  1D4M 3;  1QDC A;  3GF6 A;  3IDB B;  3ZMO A;  1TG7 A;  4AED C;  1W28 A;  2ZHK A;  3LQC A;  5GZE A;  2JG8 C;  3MW3 A;  4FT8 A;  5SV5 A;  4ZU7 A;  1BEV 2;  5FP8 A;  1SPP A;  2HH9 A;  4PI0 A;  3OB8 A;  4JHT A;  4Q29 A;  3T09 A;  4LIT A;  2V09 A;  2X29 A;  2DCZ A;  4N53 B;  5DUX A;  4BQX A;  3M3C A;  4HET A;  1L7R A;  4AFA A;  2VBB A;  4XF1 A;  4D3W A;  4LIV A;  2D6K A;  3C7F A;  1G9A A;  3T0D A;  4MYE A;  2I45 A;  2RJK A;  3CJX A;  1D7P M;  1QJX 1;  5LA9 A;  1A8M A;  1NCQ C;  2WBK A;  4N7I A;  1RUI 2;  4P9G A;  3KCC A;  1KFU L;  5J09 A;  1GOF A;  2PLV 3;  4NN0 A;  4QU1 A;  2B42 B;  2YXS A;  4YW6 A;  5I0R A;  2AAC A;  1LAJ A;  2EAK A;  2NMO A;  4IV1 A;  1VE0 A;  5ISL A;  1PK6 C;  3N3H A;  1PGW 2;  4GAZ A;  3ZSK A;  1GOH A;  4DUV A;  5IFT A;  3CL1 A;  4COW A;  5B2G B;  1J83 A;  4HON A;  4FBF A;  4RGA A;  3EXU A;  5FRE A;  2WKK A;  5BNP B;  5BNN A;  3B9C A;  4LUM A;  4MX3 A;  4ARY A;  1KD7 A;  3VBU C;  3JCI A;  2JDN A;  1FV3 A;  2ZGP A;  1CX4 A;  1GR3 A;  3O7O A;  4WVM B;  1YNA A;  2J1E A;  2WZR 3;  4IGP A;  4XQW A;  4AED B;  1H6Y A;  2HEV F;  2DVF A;  1Y9M A;  5FYT A;  4P9I A;  4EWA A;  1AX1 A;  5IVF A;  3U11 A;  4BH9 A;  3UKN A;  2PQQ A;  4LHK A;  4N9I A;  3WT3 A;  1EV1 3;  3C7H A;  2IFW A;  1JZ8 A;  1W0N A;  1QQP 2;  3ZYP A;  1K5M A;  3N35 A;  4Y1Z A;  1W2N A;  3AJY A;  5DG1 A;  5FLH A;  4Q1P A;  5C8C A;  2ZHL A;  4JKK A;  2WS9 2;  1LOG A;  1TME 1;  4GIQ A;  3GGL A;  1NCQ B;  2FDF A;  5TSW A;  3I3B A;  4X8N A;  1ZNP A;  1HJG A;  1QXJ A;  1DIW A;  1Z7S 1;  3D4K A;  5A70 A;  1FT9 A;  4QAW A;  3HIF A;  3OBZ A;  5I0D A;  4OHW A;  2H6B A;  1LGN A;  4OI4 A;  1Z7S 3;  4LKD A;  1UKR A;  2VMC A;  5K7P A;  3RFR A;  1UF2 C;  4DQA A;  5A6Z A;  1FPN 3;  1JXN A;  4KGG A;  5E16 A;  3KS7 A;  3MIF A;  3ZYF A;  2XJS A;  5BNP C;  3N4M A;  2VXJ A;  3IMM A;  1W6Q B;  4GXL A;  4P08 A;  5CNA A;  3EQE A;  5JPN B;  5FUP A;  5FZ7 A;  3Q8B A;  4LBL A;  1HQW A;  3OF1 A;  2CY6 A;  1CJP A;  4NPM A;  4AFC A;  1V0A A;  1MZE A;  4XUP A;  5C33 A;  3MIE A;  5IFP A;  4UAP A;  4LKE A;  1UYP A;  2FBE A;  2BNN A;  4QQP A;  1WCQ A;  3UGG A;  1X9T A;  3AP6 A;  3NNF A;  5C9A B;  1EV1 1;  5FQ0 B;  3RZH A;  1OA4 A;  3AYD A;  2PN5 A;  2Q1F A;  3AZW A;  3ZX7 A;  3LPF A;  3N7M A;  1PX3 A;  4JGZ C;  2NLR A;  1RUE 3;  1H2K A;  2D44 A;  4YZ1 A;  2P6H A;  1UY3 A;  1CPN A;  1O8P A;  1W90 A;  1H9P A;  4KWJ A;  5T5P A;  1DZT A;  1XC6 A;  3GHM A;  4WVV A;  5T3N A;  4QXH A;  4AFM A;  3JQW A;  4XJW A;  2HEW F;  4V2W A;  3TNQ A;  1AR6 1;  3A21 A;  5FZH A;  5FUI A;  1NQJ A;  1XJA A;  3AX4 A;  3DEC A;  3MEP A;  5KBF A;  1X9P A;  4L11 A;  3U07 A;  3BVC A;  4XUQ A;  1PVC 2;  2D43 A;  4U36 A;  5FY7 A;  1RUJ 2;  1OHF A;  4R8H A;  4URT A;  4ISR A;  4XUO A;  2ZPX A;  2P34 A;  4QX8 A;  4NID A;  4JC1 A;  2N7G A;  1VB4 A;  2R0H A;  1ZBA 2;  4WZF A;  3RYK A;  3PL0 A;  1VRH 1;  4BXS V;  2IXK A;  4ZS2 A;  3KB5 A;  3K4Z A;  5CBL A;  1UCX A;  3QH6 A;  2VQT A;  2WWJ A;  1YHF A;  1W6O B;  4LUK A;  4R9C A;  1OF3 A;  5CZK A;  3UYJ A;  1VRH 3;  3RZK A;  3TB0 A;  3AMM A;  3IBM A;  4UT5 A;  2YU1 A;  5FMB A;  1FXZ A;  2WLQ A;  2ZGN A;  1OVS A;  3LOI A;  4UBH A;  2VM9 A;  4A6S A;  5JAX A;  1PO2 2;  2QJV A;  2LAL A;  2WN3 A;  4GWM A;  2EA7 A;  4CUB A;  4E4D X;  5C9A C;  5KC6 A;  3VDB A;  1SAC A;  1GZC A;  1JBC A;  3VBR B;  5JI7 A;  4EZH A;  1XRU A;  1WKY A;  4XOG A;  2I74 A;  4P9X A;  1RJ7 A;  1HB4 A;  1LEM A;  2ZAA A;  3LDB A;  4XIO A;  4XTM A;  4ZY9 A;  2XLF A;  2QZ2 A;  1EYB A;  2XH6 A;  2QDN A;  3FWE A;  4YM0 A;  3LA7 A;  4L99 A;  5LY2 A;  3WDW A;  3J7L A;  5FYH A;  2JJ6 A;  1E57 A;  3PTR B;  5DN2 A;  3VKN A;  2RS1 3;  1Y4W A;  2W39 A;  4RR3 C;  5FPX A;  4ASM B;  1S1A A;  2HEY F;  3DEM A;  1NA1 C;  1H8T A;  1RUJ 3;  1VRB A;  3VHO A;  5IYY A;  1PIV 2;  2AEY A;  4YW5 A;  2VG9 A;  5FZC A;  1NLR A;  4CRQ A;  1OKQ A;  4UFH A;  1OH4 A;  1UPI A;  1ZRR A;  2BOJ A;  2BFU L;  3B01 A;  4PCR A;  4TLG A;  4XJA A;  4YGC A;  4YVS B;  1UZV A;  1VR3 A;  4IGO A;  2R32 A;  4Q4X 1;  1AR6 2;  2Y6H A;  2Y34 A;  2GNB A;  3THP A;  2BPA 2;  2GMM A;  1JTZ X;  4YPJ A;  2OYZ A;  3ELN A;  4YGD A;  4P9Y A;  5LY1 A;  1RHI 3;  3PVB B;  3CIH A;  3FHQ A;  3J26 N;  1AF9 A;  4KBZ A;  3GZA A;  4PF1 A;  1H1I A;  4FP2 A;  4XXP A;  3T2P A;  2R04 2;  4HN0 A;  3IDA A;  4CCK A;  2A6Y A;  3BTX A;  2XVG A;  2BV4 A;  5GZF A;  2NYY A;  4KH9 A;  1V6J A;  2R07 2;  4CSW A;  4DUX A;  2JDY A;  2AC1 A;  2RDQ A;  3H8O A;  1R1Z A;  2RS3 1;  3J7M A;  2DBI A;  4UFI A;  3BU7 A;  1YJL A;  1NLS A;  2YC4 A;  3WDU A;  3RGB A;  5JZG B;  5I8Y A;  4ATF A;  3RDI A;  4BLI A;  2XHK A;  3AZZ A;  2Y0O A;  4N9H A;  4NPR A;  5A3W A;  4DIN B;  4FOV A;  4DB5 A;  4BQ3 A;  1NY7 1;  1RVF 1;  1PO1 2;  3ES1 A;  1JYW A;  3ABZ A;  4ASL A;  3PMS A;  1NY7 2;  4Q0V A;  1NXD 1;  1RVF 3;  2VVF A;  1NYW A;  1NA1 B;  1QQP 1;  4FPC A;  4XEZ A;  3L2H A;  5GM0 A;  5K0U A;  4H7M A;  1SLA A;  1W3X A;  4E2G A;  4ZHN A;  5BNO A;  2YV8 A;  1L3J A;  2AYH A;  3NRU A;  4Q4Y 1;  1O3R A;  1DYO A;  2D6N A;  2HWE 3;  2XR4 A;  5DUW A;  3UV9 A;  4A41 A;  1KJL A;  4A4A A;  5FXZ A;  4K8F A;  2A70 A;  3K2O A;  3NKG A;  3QH7 A;  2JEC A;  4AI8 A;  1G9F A;  2P3J A;  4HK8 A;  4HMZ A;  3KQR A;  2QQO A;  4P5Y A;  4CCM A;  4DXZ A;  4Y20 B;  1AXY A;  2JKX A;  3E6D A;  1NAE A;  4O9G A;  2VW0 A;  3I59 A;  3USU A;  3ZFF A;  4CXY A;  3JQX A;  2DCJ A;  2DDU A;  4XHB A;  4YZ5 A;  2H0B A;  5FPU A;  3LFM A;  5A1L A;  5D8A B;  2R07 3;  4XHX A;  4UOJ A;  1MEC 1;  1QJY 1;  3I7D A;  2Y6F A;  4M00 A;  1ULF A;  5DDJ 3;  4K8R B;  3HQU A;  3CKH A;  1POV 0;  1W6N B;  1DP0 A;  4IXL A;  1DYK A;  4URA A;  1UYZ A;  2A3X A;  3LIH A;  4QM8 A;  4CP9 B;  4KGQ A;  2WQ4 A;  2R04 1;  5KC5 A;  4LKS A;  1US2 A;  5LBE A;  1OPO A;  1OQE A;  1H2N A;  2VXR A;  1EAH 1;  1HXS 3;  3OPW A;  3H7J A;  3U4S A;  2XBO 3;  1VMH A;  5JUV A;  1W0O A;  3S7E A;  4K20 A;  3FLR A;  4FTS A;  2VGD A;  3T0B A;  1OUR A;  2B46 X;  4AQS A;  3ZFF C;  4P9L A;  4CEW A;  2D6M A;  4IV3 C;  3WZ1 A;  4CDW B;  4LBO A;  2NZ9 A;  3NVC A;  5ANQ A;  5A3T A;  3OUI A;  3VV1 A;  2Q8D A;  3C8X A;  5DZG A;  3CLP A;  1AR7 1;  4FPK A;  4GH4 A;  2WNU B;  1URX A;  4MZU A;  3PUI A;  3M3O A;  2VR4 A;  3LA2 A;  1UOG A;  4ORF A;  3KV4 A;  2VUA A;  1AYN 3;  3GZT B;  3IPV A;  4HAN A;  4W6W A;  3CDZ B;  4F83 A;  1AYN 2;  4NAO A;  4XCA A;  1CQ9 A;  2Q1M A;  2WJS A;  1MEC 3;  3MIG A;  1XB9 A;  4NHM A;  5F5C A;  5JOZ A;  5L7O A;  3S5Q A;  4OZO A;  1ULO A;  1VRH 2;  3AFK A;  4XF4 A;  3VBS C;  3KM5 A;  3EMR A;  2HYK A;  1U5I A;  1QEX A;  4BLJ A;  5DAB A;  5A7Q A;  1BEV 3;  1J3R A;  1C8M 1;  2B5H A;  3DPR B;  2XL9 A;  3GCX A;  4Q0P A;  2GP5 A;  1ZBA 3;  4R9B A;  4XW3 A;  4COZ A;  1LOB A;  1N1T A;  3FLT A;  3S57 A;  5AFB A;  2ARE A;  2C9A A;  3I8T A;  1R08 3;  2P4E A;  5CFC A;  1PVC 3;  2JDA A;  5J48 A;  3PHM A;  3I2K A;  5FZ1 A;  2WWS A;  2D6O X;  5GLV A;  1N47 A;  2HKX A;  1M06 G;  4IEX A;  1HRI 2;  1W9T A;  1XNB A;  1ZBE 2;  2VCB A;  3N9M A;  2ZGK A;  2GC0 A;  2D98 A;  3HWJ A;  2BNO A;  2J42 A;  3AK0 A;  2Q1Z B;  4XAC A;  3U75 A;  3WOG A;  4QX2 A;  3WF1 A;  3J8F 3;  5IAX A;  4IEP A;  4QD2 A;  1UL9 A;  3TAY A;  3JBG 2;  1O4Y A;  4HPK A;  1ZM1 A;  4DFS A;  1VBB 3;  2Q30 A;  4PIY A;  4LO5 B;  1DGW A;  3NQH A;  2Y8K A;  1IKP A;  1KJR A;  4MXW B;  4XXA A;  4XJ9 A;  3T3Y A;  3BYW A;  2ZZJ A;  1F5F A;  3AP9 A;  3K77 A;  4K7J A;  4WM7 A;  1RUH 1;  1W39 A;  1GBG A;  2F6B A;  4RGG A;  3OBT A;  4LHL A;  3W9A A;  1CIY A;  2V4A A;  3AVR A;  4BQ2 A;  4XPV A;  2JEN A;  2JXA A;  1CX1 A;  4F8A A;  1B35 C;  2X5I B;  3O1R A;  4BMB A;  1OLR A;  4CCO A;  3J7H A;  5EYY A;  5K9Y A;  3KF3 A;  1D2S A;  4LHS A;  2DUQ A;  5LA0 A;  4KWL A;  2VQ0 A;  5BUV A;  4FTE A;  2VE1 A;  1W8O A;  3H3U A;  2ZEY A;  2WWU A;  2W08 A;  4TXW A;  5KHK A;  3RMY A;  4B7E A;  4OUM A;  4MV2 A;  1LOA A;  1VAM A;  2WO2 A;  1RIN A;  3BPS A;  4KI5 M;  1UYX A;  4W50 A;  3ROU A;  3VZM A;  1V6O A;  4QHZ A;  3BTZ A;  1OA3 A;  5F2S A;  3ON7 A;  3TRS B;  3DYM A;  2W46 A;  3VLB B;  4BZ4 A;  4XQD A;  2WFP A;  4KNC A;  3WG3 A;  1MR5 A;  1ZZC A;  4D8M A;  5ACA 2;  2BP6 A;  4WBB A;  2Q8O A;  1ND3 C;  2DU1 A;  5BYN A;  5JDB A;  1C57 A;  2WYF A;  4OZX A;  2O0O A;  5F9T A;  3KVB A;  2W68 A;  2I07 B;  5DAV A;  1O5L A;  1VBB 1;  4F7Z A;  3M1H A;  5M0T A;  1GNH A;  5FOJ B;  1V6M A;  4X8P A;  2WS9 3;  2NMN A;  1N3Q A;  4AFD A;  4C1X A;  5H9R A;  5CFC B;  3E6B A;  2VJX A;  1SMV A;  1G86 A;  3I4I A;  2Z4F A;  5LWB A;  1QJE A;  4DRR A;  3N9O A;  4GB3 1;  1W06 A;  5T50 A;  5DXD A;  1AR8 3;  3G6J B;  3O1P A;  1RC6 A;  4PDW A;  5FY0 A;  4XFH A;  4IV1 C;  4M01 A;  1LNS A;  2ZEW A;  1PK6 A;  1SFY A;  3AYC A;  1OBN A;  3GJB A;  2G9F A;  1GNY A;  2TEP A;  3KHB A;  3LFI A;  3VL9 A;  3WP5 A;  3UET A;  5GJ6 A;  1AX0 A;  1UIJ A;  3CJI B;  1RUC 2;  5C3S A;  2RVA A;  2WNV C;  1U5Z A;  3HBK A;  3C3V A;  1NG0 A;  1F8V A;  1QJF A;  1BLZ A;  5EWS A;  2DBN A;  1I5P A;  2YPD A;  1IHM A;  3OD4 A;  5JR7 B;  5EP9 A;  1DQ0 A;  3VZK A;  4E8D A;  2PLV 1;  2Z2S B;  2Y64 A;  1UNB A;  4MGY E;  5A3O A;  3SEE A;  1F4H A;  1F15 A;  4WVZ A;  2QBX A;  1O91 A;  5IK4 A;  5JLV A;  2CGN A;  1AJO A;  2JIC A;  4Q0S A;  5ACA 3;  4B3N A;  2A6X A;  3GCW A;  1HW5 A;  2IFR A;  4HN1 A;  4CCC A;  5HCA A;  2Y33 A;  2FDK A;  1CAX B;  3I3Q A;  1GOG A;  5BNP A;  2CTV A;  4EV0 A;  3MI8 A;  3VUO A;  3DN7 A;  4PHZ A;  4YZ4 A;  4B4R A;  1T2X A;  1H6X A;  1BXH A;  5CU1 A;  3ZN6 B;  3I54 A;  1J58 A;  2JG8 A;  1BK1 A;  3OGR A;  1TMF 2;  4A3Z A;  3NST A;  3D0J A;  4Y1V A;  5EYX A;  3PJQ A;  4D94 A;  4IV1 B;  5C6C A;  2YFU A;  4ARX A;  3LD8 A;  4Y26 A;  3HOB A;  5C8W A;  2ZAB A;  1Q8P A;  1OC1 A;  4EYU A;  2ZX2 A;  1QJX 3;  4OHV A;  3CJI C;  3NNM A;  3TN9 1;  1K3I A;  3PDQ A;  1VBD 2;  5T52 A;  2DU0 A;  4BIS A;  4CDX C;  3O1M A;  3CMG A;  1SG3 A;  1V9U 3;  1VIW B;  2VZS A;  2BU9 A;  3KWV A;  1PGL 1;  4LOR A;  1SPP B;  4S2H A;  3T1M A;  2XLG A;  1XSR A;  3NMB A;  4BQ1 A;  1VBB 2;  4K40 A;  4C91 A;  3QOP A;  5FJH A;  1LKN A;  3OPT A;  5FJK A;  3K4A A;  5HXV A;  1SBD A;  2DTW A;  2GAU A;  2VU9 A;  1C8M 2;  5F39 A;  2JDM A;  5FYM A;  2XB6 C;  4IE4 A;  3OPZ A;  2BGP A;  4WM7 B;  2YGM A;  5FMO L;  4QPI A;  3ZLI A;  1APN A;  2VZP A;  4NHK A;  3QCW A;  3HAG A;  3EHK A;  1V9U 2;  3F95 A;  3PIG A;  3VD4 A;  1G8W A;  5FYB A;  4Q8L A;  2WZ8 A;  2Y6L A;  2BZD A;  4IE0 A;  4GB3 3;  2FD8 A;  3ZYR A;  1CWP A;  2D3R A;  1GFF 2;  2PXJ A;  4WM8 C;  4RHV 3;  4QXC A;  3EYP A;  2PTM A;  3I3E A;  5FPZ A;  3AP5 A;  2OA2 A;  1ZX5 A;  4QKB A;  4Q0Q A;  2XJT A;  1J84 A;  2VBP A;  2FCT A;  2O8Q A;  4PJY A;  3DKQ A;  3ETQ A;  4B1M A;  3S0M A;  1YC6 1;  3VZN A;  3ZMN A;  2VMF A;  3OYW B;  2ADD A;  4OUL A;  3KF5 A;  1JOJ A;  1WW5 A;  2YGL A;  3OJB A;  5DZF A;  5A7N A;  2Q8C A;  4QPW A;  1RUH 2;  5JXH A;  3BN6 A;  2DTY A;  4JAA A;  1WCD J;  2VZV A;  1MS5 A;  1BBT 2;  5ABJ A;  4JX0 A;  1BJQ A;  4CU6 A;  3AVS A;  4GUL A;  2NQY A;  2X10 A;  1T6G C;  3SIS A;  1H2M A;  3B3Q E;  3H8U A;  3NL1 A;  4B4Q A;  3VBO B;  4JV4 A;  5HV0 A;  4CDW A;  1CAV B;  4FPE A;  4AK3 A;  3RSJ A;  1LEC A;  2VTF A;  2QCS B;  2UYB A;  2X53 S;  2VQU A;  1ULD A;  2UYA A;  1PVX A;  3D5O A;  4QKD A;  4LBQ B;  1WA6 X;  4M4R A;  3POB A;  3BOP A;  1VBE 1;  3M3I A;  4DPN A;  1JH5 A;  1UPS A;  2AEZ A;  1FAY A;  4W6Y A;  1YO8 A;  3FFZ A;  3VKL A;  4PQ9 A;  2BTV C;  2RR1 3;  1W3V A;  2W1S A;  4XYX A;  1EY2 A;  3SCF A;  4AEJ A;  1HJF A;  4I3P A;  4CDU A;  2JDH A;  5T5O A;  4I0A A;  1IQA A;  1DU3 D;  1QXP A;  2ZAC A;  3DCQ A;  4FOW A;  4CU7 A;  1HLC A;  2EF6 A;  3POS A;  4HKL A;  5FY9 A;  1OI6 A;  1TEI A;  3POE A;  4NHX A;  4YVS C;  4BHP A;  5C71 A;  2Y6G A;  3ETP A;  3U1X A;  2ET1 A;  1YQ2 A;  4XET A;  1FX5 A;  2HBT A;  1O3S A;  1YFU A;  2VY0 A;  4J25 A;  4JTN A;  4EWE A;  3R05 A;  5KHJ A;  3ZIW A;  4XAB A;  1YLL A;  4XIL A;  2A5Z A;  3V0B A;  4QB1 A;  5EJ3 A;  1IS4 A;  2ZGQ A;  3ST7 A;  3NJV A;  4UW3 A;  4RFT 0;  2W3J A;  3NAP C;  4IEO A;  2R1B A;  1SLC A;  3O0W A;  2PFW A;  1ULP A;  2VOX A;  5FK8 A;  1R1A 1;  1AX2 A;  5T5L A;  3VBO C;  4MGI E;  1NUK A;  2RM2 2;  4I0W B;  1C5H A;  2EXK A;  1I3H A;  2DCK A;  3BIW E;  1EUT A;  3A7Q A;  3DF0 A;  3NV4 A;  4MOA A;  5A7P A;  1D4M 1;  2ETE A;  1W9Y A;  1IPJ A;  2ARA A;  3ACI A;  5H9S A;  3GXU A;  1NE4 A;  3CEW A;  5DAP A;  4P02 B;  3FL7 A;  2AUY A;  3SCH A;  1DG6 A;  5GZG A;  3R6S A;  1OQD A;  1OFS A;  4QGM A;  2JG9 B;  4COV A;  4JDM A;  2ERF A;  3BTA A;  4XQ4 A;  4AI2 A;  5L36 A;  1NCR A;  3VKM A;  4FI9 A;  4WZC A;  4O7X A;  3H1W A;  2YZ4 A;  5GLZ A;  5FY4 A;  4Y1Y A;  1LGC A;  3RQ0 A;  1JYN A;  1RUC 3;  3ZKY A;  1MS3 A;  3CHX A;  4GAL A;  3ZN4 A;  1HV0 A;  1YIF A;  3C7G A;  2E9Q A;  5K8S A;  5FV3 A;  5FLI A;  1TNF A;  3OYW A;  3G7D A;  3ACL A;  5IWF A;  1RMU 2;  3FBY A;  4CCN A;  3H1M A;  1MS1 A;  1JHN A;  3BGA A;  1PO1 1;  2J1A A;  3FX3 A;  5D8A C;  4HVQ A;  1RHI 2;  3M7A A;  4J6G A;  2WO3 A;  5FWJ A;  2L9L A;  1REF A;  5EHD A;  5ANN A;  3F2Z A;  4LO8 A;  1G9C A;  2ZJC A;  2A75 A;  1VJ2 A;  1AL2 2;  4QX1 A;  4XTP A;  4E4H A;  4C1W A;  1MS0 A;  1QMJ A;  4JKM A;  4EWD A;  1H1M A;  1GQG A;  3D8C A;  1W8Z A;  4NR1 A;  2BGO A;  4CEW B;  5T5J A;  2A1X A;  2PHX A;  4HT1 T;  1RUG 1;  3S5A A;  3KV9 A;  2VMD A;  1UX7 A;  2E53 A;  1UXZ A;  1XNT A;  4DIQ A;  4A44 A;  1XNC A;  1RUG 2;  3BOD A;  4XMI A;  2MEV 3;  4Y22 B;  5CYY A;  1PMJ X;  4ASK A;  3ZFF B;  1DF0 A;  3APB A;  1XU2 A;  2IC1 A;  2MEV 1;  5FZD A;  5LBC A;  2D7F A;  1MEC 2;  4B7K A;  2HBU A;  1Q8Q A;  5FZ8 A;  3LA3 A;  4QGN A;  1YFY A;  5F6K A;  1RVF 2;  3IDE A;  3QBQ A;  4JGY A;  1X50 A;  1YRZ A;  2C4X A;  1R09 3;  3OY8 B;  2DUO A;  4AI3 A;  3OGJ A;  2RE9 A;  3MYX A;  1A34 A;  5KXE A;  5F32 A;  4NHL A;  4PIX A;  2BDR A;  3MIB A;  1VBC 1;  4AHW A;  5FYZ A;  2OZJ A;  1AL0 G;  1UO9 A;  1XNA A;  1BBT 1;  1ZYB A;  1S0I A;  1V6N A;  2LRO A;  3AP7 A;  4P14 A;  1RTV A;  1YJK A;  3MF6 A;  1GP4 A;  3JD7 3;  5FZE A;  2VUC A;  4LBN A;  1BZW A;  3BI3 A;  2YPJ A;  1JYT A;  2XUM A;  1WLT A;  2W0X A;  1VBE 3;  2VL4 A;  1UMH A;  1AVB A;  2YG0 A;  3PUS A;  4Y4R A;  3M4F A;  1YI7 A;  5FZ4 A;  3WSO A;  4BU2 A;  4RS5 C;  3WW1 A;  1LOE A;  2VCM A;  3N7J A;  1STM A;  2JDU A;  3OGV A;  4HFS A;  3UGF A;  5H9Q A;  2K2S A;  4OHX A;  4L92 A;  4AVA A;  3BIE A;  5F6L B;  4Z92 B;  2D3S A;  4OQ8 A;  3R4D B;  1BQP A;  3MFC A;  3DYO A;  5C3Q A;  2PHW A;  2XQX A;  3BCW A;  4IES A;  3K4D A;  3NW4 A;  5FKC A;  3VD5 A;  1D0H A;  1QJU 3;  3N7K A;  3E1F 1;  1HRI 3;  1VB2 A;  4AE2 A;  3H8R A;  1BK0 A;  4IND A;  1ODN A;  5FWE A;  3ILR A;  2QUO A;  3IZO A;  2VEC A;  2VCC A;  3QD6 A;  5BNN C;  3IM0 A;  2BGC A;  4DRV A;  5CIS A;  3AXD A;  1EP0 A;  4FOY A;  1CPM A;  1YEW A;  3FE5 A;  3HQX A;  1RXF A;  4YW2 A;  3HNY M;  2VMI A;  3ORJ A;  4JRL A;  5JCT A;  2WNU C;  1UXX X;  4I30 A;  4Q1R A;  3L2Y A;  5GLW A;  4MSV A;  3NV3 A;  2CU5 A;  5FP9 A;  3MW2 A;  5KWR A;  4NHY A;  4CUC A;  1GZW B;  2E7Q A;  4LOT A;  2A6Z A;  3QLQ A;  3VDD A;  3UT0 A;  2VTX J;  1FOD 3;  5DAW A;  2VOT A;  5FY1 A;  4DNY A;  1H2L A;  1E5H A;  4QGL A;  3OGS A;  3VBS B;  3LPG A;  3FHI B;  3GBW A;  2E31 A;  3W20 A;  4COY A;  2C5D A;  2BYV E;  3ECQ A;  1V9U 1;  4G9S B;  1MS4 A;  3DPR C;  4FTB A;  1L7Q A;  1GAN A;  1O5U A;  2X5I C;  4XE9 A;  2EXI A;  1PZ9 A;  2YRO A;  4XF3 A;  4CP9 A;  4UW4 A;  4A3X A;  4BM8 A;  2P3K A;  3OBA A;  2CWM A;  2WLP A;  3I2D A;  2HWF 1;  3VZO A;  3III A;  5JOX A;  2QQM A;  3AKT A;  4QPI B;  3VZL A;  1PM4 A;  3JBG 1;  4HPK B;  1PZ8 A;  1SFP A;  2XJP A;  3IT8 A;  4OVE A;  3W59 A;  4A7Z A;  1U0A A;  4YW7 A;  2WO7 A;  3UJQ A;  1U5X A;  1XE7 A;  4ZZ5 A;  4YW3 A;  2EIB A;  2OPW A;  1ZRD A;  5E88 A;  4E9K A;  1GWL A;  4DO0 A;  4QKF A;  4CP2 A;  3WQB A;  2VZR A;  3NJX A;  4BA6 A;  2HWB 3;  2HJI A;  5HCH A;  5J98 B;  5JSR A;  1EAH 3;  2CSG A;  1WD3 A;  2WT1 A;  1TE1 B;  4PLN A;  2IVI B;  1F35 A;  1JUI A;  1A78 A;  1LOF C;  2NN8 A;  4HSJ A;  3PIJ A;  5A33 A;  4LA2 A;  5JVV A;  3PU8 A;  4AAP A;  2JDK A;  2V5Y A;  4H3W A;  4YVW A;  1O59 A;  4XUN A;  1SLL A;  1WMD A;  2A7A A;  3P1I A;  3O5S A;  4I02 A;  5LK7 B;  2V5D A;  5FIX A;  4PQQ A;  3A0K A;  5CKN A;  2AEN A;  2F4L A;  1O8S A;  3THT A;  5IT6 A;  5EXO A;  5CAZ A;  5FO9 B;  3GBF A;  3T30 A;  5GZC A;  4HK9 A;  1QH7 A;  4CVU A;  1C28 A;  3E97 A;  3EB7 A;  1DGW X;  2AGS A;  1OUX A;  4MGK E;  4FPO B;  5AVA A;  5I91 A;  1QJX 2;  1RUO A;  2XVL A;  1LRH A;  3K46 A;  1J59 A;  1S0F A;  3X29 B;  3HD8 B;  4D6S A;  4ET7 A;  3I2G A;  1UIK A;  4HL0 A;  1CAU A;  2WFF 2;  4KU7 A;  4O61 A;  3UES A;  4LIU A;  5LBF A;  3H50 A;  2JIJ A;  2W47 A;  5DDJ 1;  4ZPI A;  5FYS A;  2E51 A;  2R6Q A;  2WFF 1;  5C3R A;  1F4A A;  1Z0H A;  5C4W A;  2D5H A;  5T54 A;  3ZYG A;  4LK7 A;  4ES8 A;  5FO8 B;  2AR6 A;  4FPJ A;  4CXX A;  4FXK B;  3CQO A;  2VUL A;  1R09 1;  1JOB A;  1OLM A;  1Z78 A;  3ME2 A;  4AGV A;  4MHU A;  1CGP A;  1H4H A;  3U4X A;  4WV8 A;  3P3N A;  4XDP A;  5DUV A;  4Y3O A;  4YM1 A;  1V6L A;  1ENX A;  4KG8 A;  3T2O A;  4CXW A;  4YNI A;  3W58 A;  3T08 A;  1LCL A;  5CFD B;  1MQT B;  2JG9 A;  1ENS A;  2GNM A;  4A7K A;  1JZ3 A;  5FLJ A;  5FZ0 A;  4HZF A;  4FAG A;  5CFC C;  1V70 A;  4R4Z A;  4EN7 B;  4K9S A;  1HIX A;  4HVO A;  2PQS A;  4G4F A;  2CDO A;  1W8U A;  2OQ7 A;  3KLS A;  2VBD A;  2BVB A;  4LO7 A;  3SIT A;  4E4Z A;  2IWG B;  2UWA A;  3J8F 1;  1ULE A;  5FYU A;  5LW9 A;  1RJ8 A;  1CAW B;  1SHW B;  2HYX A;  1UU5 A;  1YXW A;  4N53 A;  3WNO A;  1TNR A;  3UKT A;  4ZXE A;  3EBR A;  4NII A;  3QAC A;  5FPA A;  4ZXK A;  2PMW B;  1AYN 1;  3PVE A;  5K0U C;  1QY4 A;  3AL6 A;  3LE0 A;  1W2A X;  2ZX1 A;  5BNO C;  1F31 A;  1IQD C;  3R4S A;  2EAL A;  1R1A 3;  1VAV A;  3KGL A;  4XBL A;  4XUT A;  3V56 A;  1QJU 2;  1PNG A;  4YFW A;  5FP7 A;  3WCR A;  1ND3 A;  2A6W A;  1R1A 2;  4RN5 A;  4S2D A;  2JG8 B;  4A6O A;  3D82 A;  3RVH A;  5IK8 A;  2E7A A;  1SLB A;  1AR7 2;  2D93 A;  4FPY A;  3GZE A;  5F8P A;  4FVV A;  2ZMK A;  4QDR A;  1AXZ A;  2IVJ A;  3URF A;  3FC0 A;  1W2O A;  2XDV A;  5F2W A;  1Q5O A;  1C4R A;  2B45 X;  4XZU G;  5SV8 A;  4OFG A;  3WCS A;  5CEH A;  4DEQ A;  5EJZ B;  1WBF A;  3GZU C;  4QXB A;  3WNN A;  1PVC 1;  3N7L A;  4GWI A;  4DZG A;  3VBH B;  2D5F A;  1KS5 A;  2RS5 3;  2FDI A;  3RWK X;  3VL8 A;  1MQT C;  1RUI 3;  2BUK A;  4S2F A;  4TLF A;  1UMI A;  2ZGU A;  4A45 A;  3ZR5 A;  4BOW A;  3MGU A;  2VME A;  5FXX A;  1HV1 A;  1WME A;  5LBB A;  1RUI 1;  1DHK B;  3NJZ A;  2W1Q A;  4FO9 A;  4H14 A;  4OI0 A;  1W8T A;  1K5J A;  2WIN B;  3AC0 A;  4RGK A;  4AVS A;  1F5J A;  1WGP A;  3M8L A;  4BIF A;  2CGP A;  4YW4 A;  4WM8 B;  1FMD 1;  3HQR A;  3OUJ A;  4YZ2 A;  4OQ9 A;  5F1R A;  4C0B A;  4AEM A;  4GWJ A;  4YG3 A;  2A73 B;  1VBA 2;  1TQ5 A;  3ASI A;  4IL7 A;  5FR3 A;  5KR7 A;  5K0U B;  5JSP A;  2WN2 A;  3POW A;  1PO1 3;  5GZD A;  2WNE A;  4RHV 2;  5AFE A;  4XIK A;  2JE9 A;  2ZMN A;  4NRQ A;  5ABJ B;  3FHA A;  1L7L A;  1W0P A;  2LUW A;  2UY9 A;  1OH3 A;  1UOF A;  4FQ4 A;  3PTY A;  3N9P A;  1LHU A;  4QB2 A;  4XFB A;  2E33 A;  1YQC A;  2QTW B;  1Q43 A;  1C1F A;  4AW7 A;  4RA0 A;  1OD5 A;  4XJ8 A;  3K3O A;  3FUQ A;  4AFB A;  5F3E A;  1UY1 A;  4ZZ8 A;  5C5T A;  4HSL A;  3WF4 A;  4TZD A;  3ZXJ A;  2ZKN A;  4QX5 A;  3SC7 X;  3LOB A;  4V2V A;  2VUD A;  2VZO A;  3ZPO A;  4Y22 A;  4AAX A;  5J96 B;  5FKB A;  2D6L X;  4XCB A;  1OUS A;  3O1O A;  1RMU 3;  2PEL A;  1W6Q A;  3ACF A;  2VW2 A;  5A3U A;  4AG4 A;  3J7N A;  5FZ6 A;  2WNO A;  2C24 A;  2Y0I A;  3RI9 A;  1X82 A;  1IGO A;  4MUV A;  1YYN A;  1PX4 A;  4YZ3 A;  1COV 1;  2K46 A;  5C8C C;  2D3P A;  1HQN A;  2BW8 A;  4RD7 A;  2J1V A;  5EV7 A;  2P3I A;  1AR6 3;  4AF9 A;  2V73 A;  4NWW A;  4HBN A;  4CDX A;  1OLQ A;  4V1P A;  3AMH A;  2R30 A;  4IDZ A;  5FY8 A;  2QZ3 A;  5A7W B;  2VPV A;  1NZI A;  4M3C B;  5FZM A;  4GWN A;  1XE0 A;  1I1E A;  3I2F A;  2R0F A;  4U2A A;  2FQP A;  4RFR B;  3HMY A;  5A32 B;  3VBU A;  4ZU5 A;  4D7T A;  3ACH A;  1MS9 A;  1CJD A;  1MZ5 A;  3ZYH A;  1PNF A;  3IDC B;  1GNZ A;  2ES3 A;  1JMU B;  4N43 C;  2OZ6 A;  2QQP A;  4XJZ A;  4KU8 A;  4P5H A;  5I0T A;  4AVC A;  2WQ8 A;  3POI A;  4GKY A;  1ND2 C;  2ZAH A;  4HLT A;  1AR9 2;  4FPH A;  2XL7 A;  3CBN A;  4QWN A;  3O1U A;  3ILN A;  1CIW A;  1POV 1;  3KQ4 B;  4RHV 1;  2SLI A;  1AR9 1;  2A6V A;  4IEQ A;  3FJS A;  4JDO A;  1UY4 A;  2VMG A;  1OFN A;  4JGZ B;  1PZ7 A;  1AR9 3;  1RYY A;  1ZRF A;  1J1T A;  4AQ2 A;  3JZV A;  3CZU A;  2WAB A;  3NAP A;  5EPA A;  2XJV A;  2B39 A;  1UWW A;  3SKV A;  5BY5 A;  2WA3 A;  2XHN A;  3M3E A;  4YM2 A;  4PDW C;  4CE8 A;  3HNB M;  1AHS A;  3AKS A;  5DUU A;  2QQK A;  2WC2 A;  4QQ2 A;  5DAX A;  3DUI A;  3E5Q A;  3PLQ A;  4TTG A;  2FDJ A;  4LBQ A;  2DVG A;  1HN0 A;  1UY0 A;  1W6N A;  3O12 A;  1LHW A;  4OMC A;  4LA3 A;  4LO6 B;  3RWN A;  4P00 B;  5L7O C;  3VBF C;  1F9K A;  2FDG A;  3AKP A;  5KXB A;  2O8O A;  1SDD B;  4AED A;  2PHR A;  2Q8E A;  1ZZ7 A;  5FY5 A;  2B7Y A;  1HXS 2;  4IEV A;  1S55 A;  1SBF A;  4LK6 A;  1NCR C;  2WL1 A;  5FMC A;  1WLD A;  4UW6 A;  4C90 A;  2QQV A;  3POJ A;  3B94 A;  1FYU A;  4QPY A;  5HXM A;  2EXH A;  2V72 A;  2IXH A;  2GNT A;  1ZZ8 A;  4K1Y A;  3ZSL A;  4AGR A;  4FFF A;  3AJZ A;  3JUU A;  2IUW A;  1JOP A;  4LKF A;  3USS A;  2W5F A;  4EN9 B;  3NAP B;  3D0S A;  4IGQ A;  2WZP P;  2WQZ C;  1MVQ A;  3MHZ A;  3NNG A;  5FYC A;  3VBR C;  3ZFG A;  1PMH X;  4L8Q A;  1YCI A;  4A42 A;  1HB3 A;  3WDV A;  1RMU 1;  5LRS A;  2KD7 A;  1SCR A;  3WDX A;  1CAV A;  3I2J A;  4GD4 A;  3LCP A;  4D7S A;  4P9W A;  3BUC A;  1D0G A;  1FMD 3;  1S2B A;  5FMO S;  3BOW A;  2WZE A;  1IS6 A;  2EIG A;  2W52 A;  2ZML A;  4Q4V 1;  5FZO A;  1GP6 A;  4NRO A;  2R16 A;  3O1S A;  3AZV A;  4XFG A;  3WG2 A;  3NV1 A;  2P6C A;  1BYH A;  1AYM 3;  3JU9 A;  1A8D A;  1AJK A;  4IV3 A;  5G04 L;  5C70 A;  1BKZ A;  2VZ1 A;  4UF0 B;  5CFD A;  5ACA 1;  1M4W A;  5FOB B;  5APA A;  1AZD A;  3HVD A;  5F7U A;  3H3Z A;  2XLA A;  2NPI A;  3AMQ A;  5L9V A;  4AHY A;  2UUR A;  1RUN A;  1S2K A;  5FZG A;  3UL2 A;  3BTY A;  1IG0 A;  4QDS A;  4UFJ A;  1O3T A;  2HWE 1;  5EJ1 B;  1RGS A;  3KV5 A;  3OG2 A;  1QOO A;  4CYD A;  2C0Z A;  2ADE A;  2DVD A;  3S7I A;  3ZFE C;  4MXV A;  1HKD A;  4OUE A;  1PM7 A;  1W8N A;  4GB3 2;  5FBJ A;  5FBZ A;  1UAI A;  1JZ6 A;  4BQ4 A;  2Y60 A;  5JZG A;  3NKT A;  1SDW A;  1K12 A;  3SXW A;  3KT7 A;  1NOV A;  3V0A A;  5DPN A;  2MPF A;  1JYI A;  5A6Y A;  5CIR A;  2AH2 A;  1J3Q A;  3I2H A;  1JZ7 A;  2GSY A;  4RYD A;  1NT0 A;  4NJ4 A;  2PHF A;  5JXG A;  3T2T A;  3WHT A;  1JYC A;  1ASJ 3;  2RJL A;  5B4N A;  3J9S A;  2RJ2 A;  2KXL A;  1VAK A;  1OD3 A;  4UWD A;  1JYX A;  3FLP A;  4J1X A;  4RS5 A;  4BB3 A;  1COV 2;  4Q4W 3;  1HXS 1;  3WP4 A;  4AHX A;  3ZR6 A;  3FZ3 A;  1BVP 1;  1H8T C;  4Y33 A;  2GP3 A;  4CUG A;  2B9U A;  3IMN A;  3ZVX A;  3ZFG B;  2BNM A;  4G3Y C;  1VMJ A;  2B8M A;  3I3M A;  1ODM A;  3DYP A;  3M3Q A;  5HCF A;  4W65 A;  3I97 A;  1N1S A;  5BNN B;  3T4H B;  2YHJ A;  3M70 A;  5AC9 1;  2YBP A;  1C8N A;  4FCA A;  4AVV A;  4NRP A;  2FZ2 A;  1U5Y A;  3KSC A;  4AYU A;  5J3U A;  4EN6 B;  5LRR A;  3WIN E;  3TOJ A;  2XML A;  2RMU 2;  4JRA A;  1W9F A;  1GZT A;  4O9E A;  2QE3 A;  3WNP A;  2K9Z A;  5I8T A;  3MPP G;  4PLM A;  2RM2 3;  3NJY A;  4FSJ A;  4AR2 A;  1TME 3;  4NIA A;  4JDN A;  4CTE A;  1J3P A;  1OOP A;  3FN9 A;  2ZS6 B;  2VQA A;  1CVN A;  4I09 A;  4YLZ A;  3LKJ A;  4I0B A;  4MO3 M;  5FCC A;  5CAD A;  1JS9 A;  3H8X A;  2GN3 A;  4LQR A;  3K75 B;  4RS5 B;  4NRM A;  2Y6K A;  4Z8B A;  2DF7 A;  4XDQ A;  5E89 A;  1LU2 A;  4JZR A;  3ATG A;  4QXK A;  4W4Z A;  1JZ5 A;  4QB6 A;  4SBV A;  1O6U A;  3RYP A;  3WD5 A;  1IPS A;  5D21 A;  3I49 A;  1QQP 3;  4MAD A;  3IIA A;  4TYS A;  4QQL A;  5F37 A;  1WWY A;  1OMI A;  1X8M A;  2VVD A;  2HWC 3;  5KHI A;  1ZBE 1;  1OKO A;  2Z79 A;  4Q8K A;  4QPI C;  3O0X A;  2JB4 A;  1H8T B;  1FNY A;  1R08 1;  1GZW A;  1QDO A;  5CG9 A;  1G7Y A;  4IV3 B;  4LR4 A;  3T2Q A;  4MGT A;  4I2O A;  5CG8 A;  3EO6 A;  3ZSJ A;  2CNA A;  2YC0 A;  5HI0 A;  2PYT A;  1W2U A;  2WYS A;  3WY6 A;  2ZKL A;  5IVY A;  2WA4 A;  4BE3 A;  4YFZ A;  4B8E A;  3N9Q A;  1Q8O A;  2ZGM A;  3MFA A;  5I8S A;  3ZXK A;  2XON A;  1CR7 A;  1QJZ A;  1ULC A;  4IER A;  3D6E A;  1EUU A;  4KL1 A;  1BCX A;  3I2O A;  1ZZ6 A;  3WLU A;  1EAH 2;  4CUA A;  1MS8 A;  2FCV A;  1RUC 1;  3MBW A;  3O14 A;  1RUD 3;  4L0P A;  4XAA A;  5A3M A;  5FYV A;  5JOW A;  2Q4S A;  3ZXA C;  4CP0 A;  5F3C A;  1K5M C;  4DY5 A;  1VAL A;  2ZGR A;  3AB0 A;  2OUH A;  4NPL A;  1JOD A;  3WF3 A;  2EVX A;  3MW4 A;  2QKD A;  3SH4 A;  1VP6 A;  1ZBA 1;  2UU8 A;  1IPK A;  4C8D A;  3VHN A;  3VD3 A;  3VHR A;  3LDK A;  5DZE A;  4QHO A;  2VW1 A;  4IE5 A;  3GJA A;  4CPB D;  4D0Q A;  3RZJ A;  5AC9 2;  3SHR A;  4JVA A;  1MZ6 A;  2W1U A;  4YVW B;  5IVV A;  2DVB A;  1A3K A;  4N7U A;  1KXG A;  3ZN6 A;  2ZGL A;  1WUV A;  2BBA A;  4Q4Y 2;  1SBE A;  2QFE A;  2SBA A;  2WAA A;  2XKO A;  1Y9Q A;  2LS6 A;  3PVN A;  1HRV 2;  2FMD A;  2J1S A;  4CCE A;  4XDO A;  1UW8 A;  1AL2 3;  1H9W A;  1W6O A;  5IVJ A;  2W94 A;  5IVB A;  4Q4X 2;  2B9V A;  3UNP A;  1D2Q A;  2YC2 A;  1W8F A;  3MUY 1;  3P3P A;  3P6B A;  4XFA A;  3JBG 3;  4AVT A;  2ARB A;  2GC1 A;  2ARX A;  4QU2 A;  1QF3 A;  2WSV A;  4LJH A;  4BYY A;  5ERL A;  4RQP B;  3FMG A;  2NP0 A;  1BEV 1;  4CCJ A;  1FV2 A;  1QIQ A;  4AI0 A;  4IE7 A;  1WLW A;  3Q8E A;  2EAA A;  1OSG A;  1UQX A;  2ARC A;  2RV9 A;  2VOV A;  3RI8 A;  4GJY A;  4N8M A;  3HNM A;  4R9A A;  4M3C E;  2JEM A;  1UU6 A;  1ZBE 3;  5FZF A;  3SH5 A;  1JYV A;  5E6H A;  5DG2 A;  1C3H A;  3POG A;  5BNO B;  4Z2W A;  3LSD A;  2P37 A;  1JZ4 A;  4ISQ A;  3WXP A;  1BMV 1;  4KQ7 A;  1PMI A;  5FXV A;  2FDH A;  1VBE 2;  2O14 A;  1MAC A;  4YVW C;  2PAM A;  3Q9O A;  4OHY A;  1BMV 2;  4LEJ A;  5C9A A;  4AVB A;  3LEK A;  2DUP A;  3JD7 2;  1XYN A;  2JX9 A;  4X6Q B;  4ZON A;  3UKV A;  1QOS A;  1IKQ A;  2RR1 1;  4YVS A;  1AYM 2;  2HWD 3;  3MLJ A;  1N3P A;  1ND3 B;  1TME 2;  3PME A;  5CFD C;  3CU7 A;  3TN9 2;  1KDK A;  2YB7 A;  3AYE A;  3VBH C;  4YSF A;  2HWD 1;  3PNA A;  5BPX A;  4FQZ A;  1Z7S 2;  2KM2 A;  1HDK A;  1OT5 A;  2RS3 3;  2HWD 2;  4X6R B;  4EE2 A;  1W6P A;  2FHR A;  1DGL A;  4FPF A;  5BNQ A;  4CEY C;  5JXI A;  1H8V A;  1I6X A;  2RS5 2;  5FTT C;  4D6Q A;  4RQP C;  2C6S A;  2ORX A;  1GLH A;  1EPW A;  1B35 A;  1KQR A;  1ZA7 A;  2OXB A;  2WT0 A;  4AZZ A;  2VCA A;  5LZ6 A;  3AP4 A;  3W21 A;  3B93 A;  2G19 A;  2VUJ A;  4R9D A;  5LEJ A;  1KS4 A;  5B4X A;  4D69 A;  2WNV B;  2GU9 A;  4IUG A;  2R49 A;  1CAU B;  1TVG A;  3OEA A;  1LB2 A;  4B29 A;  4XFI A;  3ITQ A;  2GME A;  3POF A;  3V0B B;  2J1R A;  1RHI 1;  1YIP A;  2RHP A;  5IJR A;  5GAL A;  1W99 A;  2J1U A;  2PAK A;  3HEI A;  2MNG A;  3WNM A;  1E5R A;  1SFN A;  4TWT A;  1AL2 1;  4RQP A;  4AHZ A;  1RUF 3;  4YGE A;  1H0B A;  1W6M A;  1QOT A;  4NMI A;  5IVC A;  3AFG A;  4XMA A;  5A3N A;  4ZKT B;  1S0J A;  3JXS A;  3WQ1 A;  1ST8 A;  4AGG A;  1ZRC A;  1CD3 G;  4LXL A;  1R64 A;  5CB7 A;  4HG6 B;  3D3A A;  4DXT A;  1Q3E A;  3WP6 A;  3RRD A;  3UJO A;  2C9K A;  1UZ0 A;  4ES9 A;  2YMZ A;  3RZL A;  3LEI A;  3NO8 A;  3JB4 C;  3IAQ A;  3ZIX A;  4MHR A;  3BKZ A;  3KT1 A;  2X05 A;  3ZSE A;  2BOI A;  4A7Y A;  1TMF 3;  2IXI A;  2IXJ A;  3O0V A;  1A6C A;  4FXG B;  4UW5 A;  1OF4 A;  2P1B A;  2QQI A;  1YQ6 A;  1G9B A;  4R4X A;  2W2I A;  3PUH A;  1TMF 1;  1KEX A;  3H3L A;  3TNP B;  3TEW A;  3VD9 A;  1KFX L;  4BME A;  1SZB A;  4EN8 B;  2BBV A;  4CDX B;  4Q5O A;  4CDW C;  1OPM A;  1KDM A;  1UY2 A;  2W1W A;  3VN4 A;  3ZPY A;  4E27 A;  3LB9 A;  4GA9 A;  4UFK A;  5HPO A;  3SLI A;  4CCL A;  2A3Y A;  3OY8 A;  3OEB A;  4PBP A;  1W6P B;  1DZQ A;  4IEU A;  1QKQ A;  1GWK A;  4Y1X A;  5FYY A;  1C5I A;  2D6P A;  4KWK A;  4FAH A;  2H6C A;  4IE6 A;  1VLN A;  1MZF A;  4KBB A;  3U10 A;  1HRV 1;  2GH2 A;  2O1Q A;  4BJ0 A;  1RUF 1;  3O1V A;  4WM7 C;  3HT1 A;  5DQ0 A;  5HCB A;  1ZRI A;  4Z2A A;  1SCS A;  4CDQ A;  3U14 A;  2ENR A;  4AEK A;  1AXK A;  2WNV A;  3CO2 A;  3K3N A;  3H0O A;  4GH4 B;  4NO4 A;  3SKJ E;  4B4P A;  1RED A;  4PDW B;  2R04 3;  4OYU A;  3R0R A;  1EV1 2;  2P17 A;  4MGQ A;  3LDR A;  5KHH A;  4HVR A;  2IZW A;  2VMH A;  2XBO 1;  3LWC A;  1CN1 A;  2Y38 A;  1V6K A;  1VBC 3;  1OVP A;  2RM2 1;  5L7O B;  3ZXE A;  1NE6 A;  3S6P A;  3VBF B;  1GYK A;  3C7E A;  2XJU A;  4PI2 A;  4D6R A;  3TEZ A;  2RG4 A;  4XZP A;  5JI9 A;  3VB9 A;  3GDB A;  1MQT A;  3CJI A;  1JN2 P;  5FXW A;  4XUR A;  1NCR B;  4ONU A;  1V6I A;  4CZS A;  1GKB A;  1FPN 1;  1ND2 B;  5FK7 A;  2E26 A;  3WQ7 A;  5I93 A;  2HLE A;  2JIG A;  1QGL A;  2YBS A;  5FO7 B;  3ZO0 B;  2XJQ A;  4OLL A;  2KR2 A;  2RS3 2;  2K0G A;  4E2Q A;  3WR0 A;  2WT2 A;  5KXC A;  4HXC A;  1DDL A;  1RUH 3;  1O4T A;  3T4V A;  1S0B A;  1W04 A;  2XOM A;  1PO2 3;  2WS9 1;  3FBM A;  4JGY B;  4CDU B;  2XJR A;  2WDB A;  4GH4 C;  3RJ2 X;  2RMU 1;  1VMF A;  1ULG A;  1N1Y A;  1LED A;  2YUE A;  5GLT A;  4MG2 A;  3ES4 A;  5LK5 A;  3A4U A;  2ZX4 A;  3A0N A;  2OX0 A;  5EZW A;  1SQ4 A;  2IXC A;  3WHU A;  3IN9 A;  4P9J A;  2C26 A;  4YG6 A;  4EN0 A;  1Y9G A;  3OUH A;  3MV1 1;  4XBN A;  3A23 A;  5F3I A;  1UU4 A;  3BPZ A;  3V64 A;  5L73 A;  3RZG A;  2VNG A;  2DFC A;  3SMH A;  5G05 L;  1IS3 A;  3LZZ A;  2QQU A;  5E1R A;  1O3Q A;  2G9G A;  2JB8 A;  3TYJ A;  2XQR A;  1DGR N;  1COV 3;  4Q4W 2;  3USU B;  3PU3 A;  1GP5 A;  2DCT A;  3H42 B;  3WVJ A;  1WW7 A;  2XBO 2;  3SCG A;  3K51 A;  4L2N A;  5DAQ A;  3WX5 A;  4Q4W 1;  3AZY A;  4XF9 A;  3ZFE B;  2R06 2;  4KG0 A;  4FFI A;  1RUF 2;  4K3U A;  2WSU A;  2HWF 2;  3IAP A;  3HBZ A;  1Y3T A;  4K1Z A;  1YI9 A;  2DWR A;  4YGB A;  5FZL A;  3V0A B;  2XWJ B;  3VKO A;  3MDP A;  4IEW A;  4QKN A;  2GH8 A;  5L9B A;  4GZ9 A;  2BRT A;  3VBO A;  1KRI A;  4JGZ A;  1IZ3 A;  3GYD A;  1WLC A;  1I9R A;  5J37 A;  4NIG A;  3MF9 A;  2CL2 A;  4AQT A;  2JE8 A;  1QHD A;  4CPB A;  1PHM A;  4HOO A;  1B09 A;  2E63 A;  4AWD A;  2CHH A;  4M0N A;  1DQ4 A;  2W91 A;  2QQN A;  2PHL A;  2UWB A;  4Y1U A;  4J1W A;  2HWE 2;  4ITC A;  4MLO A;  4OCT A;  3H7Y A;  4M4P A;  3VBS A;  4QPG C;  1Y43 B;  1DGR A;  1W03 A;  4BCU A;  1QNY A;  2JG9 C;  3HN1 A;  1H1A A;  2GAL A;  4XF0 A;  5LAT A;  4LO4 B;  2JD4 A;  5JR2 A;  2GZW A;  1NZC A;  1NQD A;  2ZEZ A;  4ZS3 A;  1P8J A;  2RS5 1;  2VTX A;  4DXR A;  1G6N A;  5A1F A;  2GC2 A;  3WF0 A;  5CA6 A;  4DMI A;  1KIT A;  2WAO A;  2VNV A;  4YG0 A;  4AQ6 A;  1E5S A;  2YDE A;  1WMX A;  1WZX A;  3WNL A;  4N53 C;  1LR5 A;  1UYY A;  4YWA A;  4TN7 A;  5JMO A;  4Q4V 3;  4MXW A;  3RZZ A;  1GMM A;  1OOP B;  2GND A;  1RUD 2;  2VOK A;  1BVV A;  2ZTN A;  4OI2 A;  5I0U A;  1ALY A;  1AYM 1;  1XXN A;  2ZGT A;  5JOY A;  4FPL A;  3KD4 A;  4LPL A;  1U12 A;  1WD4 A;  3KHC A;  1W8H A;  1SLI A;  1YWK A;  1QNW A;  3I59 B;  1ZVF A;  1Y7B A;  2VZT A;  1CZT A;  2DVA A;  3WUC A;  3B9I A;  4AXO A;  2LM3 A;  2RDN A;  5KXD A;  1OQ1 A;  1DQ6 A;  4PIZ A;  1DZR A;  3INA A;  1UD1 A;  3LAG A;  3RS6 A;  5C5U A;  3C7O A;  1HB1 A;  3OOX A;  5LB6 A;  2C1F A;  4KWU A;  4WVW A;  1S2E A;  1S0D A;  4CEW C;  3H9A A;  1F2N A;  1AR7 3;  4BIO A;  3PUA A;  5I0S A;  1KGY A;  1CES A;  3AZX A;  1CAX A;  1RXG A;  1UZW A;  3ZFG C;  1RUD 1;  4BQ5 A;  1DLL A;  3NNL A;  4XC9 A;  1W2T A;  1XU1 A;  1UZZ A;  2OW4 A;  4Q26 A;  3WQ0 A;  3MV0 1;  3ZXG A;  1WW6 A;  4QHB A;  5A7S A;  2I2S A;  3DGT A;  4I3G A;  3I2I A;  2J22 A;  4MET A;  1R08 2;  4LNV A;  3S30 A;  3THD A;  4BDV B;  4ERO A;  2VAU A;  2W87 A;  1FI2 A;  4LHN A;  1RL3 A;  3DV8 A;  3TEY A;  1NKG A;  3B02 A;  3P5B A;  2LW8 A;  3N9N A;  1UKG A;  3B69 A;  2TUN A;  1ACC A;  5FZ9 A;  4WVM A;  4E4S A;  1YFX A;  2Q5T A;  3BB6 A;  4Q4Y 3;  2XWB B;  1BBT 3;  1X7N A;  3Q8C A;  4HKW A;  5D8A A;  1UZY A;  3JD7 1;  4O65 A;  4MVT A;  2VNO A;  3DL3 A;  1QH6 A;  3KCX A;  4MGS A;  3H1Y A;  5JIU A;  3AKR A;  4AL9 A;  2RMU 3;  3B5L B;  4GMP 3;  5FP3 A;  1WA4 A;  5F5Q A;  1DQ2 A;  4L9B A;  2ZX3 A;  2F17 A;  5AC9 3;  2MHF A;  5HV4 A;  2X8K A;  3A22 A;  2EIE A;  4GMP 1;  5HBA A;  4BK4 A;  1GSL A;  1RUG 3;  2ORZ A;  2CGO A;  2UWC A;  2JKB A;  1DYP A;  2DFB A;  2J1T A;  4PLO A;  1LJ7 A;  4BQW A;  1WCU A;  3N9L A;  4NWV A;  1LU1 A;  5GKA C;  1LES A;  1UOB A;  4CDQ C;  1GU3 A;  5LA1 A;  3WG4 A;  2ET7 A;  3ACG A;  5F3G A;  3OSD A;  2WRA A;  4UXA A;  1ZA4 A;  4BPZ A; 
#chains in the Genus database with same CATH homology
 5CZK A;  3C7G A;  2VM9 A;  2WN3 A;  3WNP A;  2CDP A;  3ZM8 A;  4CUB A;  3VDB A;  1K45 A;  3BGA A;  1WKY A;  2J1A A;  3FN9 A;  2WO3 A;  2ZEX A;  4MO3 M;  3CZJ A;  4ZY9 A;  2L9L A;  4LQR A;  3F2Z A;  3K75 B;  2Y6K A;  4QX1 A;  4UI9 L;  4JKM A;  5DN2 A;  4W4Z A;  1JZ5 A;  4QB6 A;  2R7E B;  2BGO A;  4DUW A;  4PT6 A;  4MAD A;  2VMD A;  1UX7 A;  1UXZ A;  1XNT A;  5IYY A;  4A44 A;  1OH4 A;  5CYY A;  1PMJ X;  2Y6H A;  3T2Q A;  4YPJ A;  2WYS A;  3CIH A;  3FHQ A;  2C4X A;  4PF1 A;  2EIC A;  5LA2 A;  1JI6 A;  2V4V A;  3T2P A;  2XON A;  3IDA A;  1EUU A;  4E8C A;  3U37 A;  5A1A A;  4DUX A;  4CUA A;  1K42 A;  1XNA A;  2VQT A;  3MUZ 1;  3MBW A;  4L0P A;  2VO5 A;  2QQJ A;  1JZ2 A;  2BER A;  2YG0 A;  2VL4 A;  1UMH A;  2YC4 A;  2YFZ A;  3WSO A;  3I3D A;  1MPX A;  1XPW A;  3OGV A;  3WF3 A;  1JYW A;  3VD3 A;  2WO1 A;  3ABZ A;  3DYO A;  4KMQ A;  2XQX A;  3K4D A;  3VD5 A;  4D0Q A;  3E1F 1;  2W1U A;  2E32 A;  3VD7 A;  3NRU A;  1DYO A;  2VCC A;  1CZV A;  4A41 A;  2BBA A;  4A4A A;  1JU4 A;  2WAA A;  3HNY M;  2LS6 A;  1UXX X;  2J1S A;  4P5Y A;  2QQO A;  4CUC A;  2JKX A;  1NAE A;  2W94 A;  4DEV A;  2B9V A;  2DCJ A;  2DDU A;  3UNP A;  2YC2 A;  3WF2 A;  3P6B A;  3MUY 1;  3MO4 A;  4UOJ A;  2VOT A;  4CU9 A;  3CKH A;  3OGS A;  2VZQ A;  3LPG A;  1DP0 A;  2E31 A;  1UYZ A;  4CU8 A;  1W9W A;  3ECQ A;  5C7G A;  2ZXQ A;  1L7Q A;  4LKS A;  1US2 A;  2RV9 A;  4OMD A;  3OBA A;  2W9X A;  3HNM A;  5JUV A;  3III A;  1JYV A;  2QQM A;  3T0B A;  1JZ4 A;  4XVH A;  3T0A A;  1JHJ A;  2W95 A;  4ZZ5 A;  2EIB A;  3LEK A;  2J7M A;  3WQB A;  2VZR A;  3NJX A;  3C8X A;  3PUI A;  2VR4 A;  4QX3 A;  3W5N A;  2YB7 A;  1O59 A;  4XUN A;  4QDQ A;  3P1I A;  2V5D A;  1OT5 A;  3CDZ B;  4PQQ A;  4BK5 A;  1O8S A;  5JXI A;  4OZO A;  1ULO A;  2QQL A;  3SEP A;  4CVU A;  4W8J A;  2ORX A;  3EB7 A;  3K46 A;  2VCA A;  4ET7 A;  2X09 A;  3I2G A;  3UES A;  5B4X A;  2JDA A;  2W47 A;  4IUG A;  3I2K A;  3OEA A;  1TVG A;  5LCW L;  1F4A A;  4JKL A;  1W9T A;  2VCB A;  3HN3 A;  2J1R A;  5IJR A;  2OKX A;  1W99 A;  2J1U A;  3HEI A;  2VZU A;  3WNM A;  3CQO A;  4QX2 A;  3WF1 A;  1HN1 A;  3T2O A;  3THC A;  3T08 A;  5DMY A;  1JZ3 A;  3NQH A;  2Y8K A;  2JD9 A;  3JXS A;  3K77 A;  2VC9 A;  3WEZ A;  2PQS A;  1R64 A;  2CDO A;  4HG6 B;  1CIY A;  1JU3 A;  3D3A A;  4DXT A;  1CX1 A;  2C9K A;  1UZ0 A;  3LEI A;  1SHW B;  2HYX A;  3IAQ A;  3J7H A;  3WNO A;  2X05 A;  4LHS A;  5LA0 A;  2WUH A;  4ZXE A;  3HJR A;  1W8O A;  2ZEY A;  1OF4 A;  2QQI A;  4TXW A;  3LE0 A;  2ID4 A;  3PUH A;  1BHG A;  1IQD C;  1KEX A;  4XUT A;  1GQP A;  1W9S A;  2Y6J A;  3VD9 A;  4RN5 A;  4A6O A;  2WO2 A;  4KI5 M;  4W50 A;  1UYX A;  1UY2 A;  2W1W A;  5HPO A;  4QDR A;  3DYM A;  2W46 A;  2W92 A;  3OEB A;  4D8M A;  4XZU G;  4DEQ A;  5EJZ B;  3WNN A;  4GWI A;  4BJ0 A;  5DQ0 A;  4Z2A A;  5J1X A;  2B4K A;  1UMI A;  3SKJ E;  4A45 A;  2VJX A;  2VME A;  4DXS A;  2Z4F A;  4OYU A;  2W1Q A;  3VDC A;  3AC0 A;  4MGQ A;  1NX9 A;  1LNS A;  2ZEW A;  4GWJ A;  1GNY A;  3UET A;  3C7E A;  2RVA A;  2WN2 A;  3GDB A;  4QX0 A;  3FHA A;  3W5M A;  1I5P A;  5EIY B;  4XUR A;  2Y64 A;  2E26 A;  4QB2 A;  2HLE A;  2E33 A;  3SEE A;  1DLC A;  1F4H A;  4JHZ A;  2QBX A;  4ZZ8 A;  1UY1 A;  2EID A;  3WF4 A;  3IB3 A;  2VZ3 A;  2VZO A;  4AAX A;  3VDA A;  1GUI A;  3WNK A;  3ACF A;  3HPN A;  3LEG A;  1GOG A;  4AG4 A;  2XOM A;  5IHR A;  2WDB A;  1PX4 A;  3GM8 A;  1T2X A;  1H6X A;  2J1V A;  1CZS A;  4A3Z A;  3OGR A;  2C26 A;  2YFU A;  4ARX A;  3MV1 1;  3A23 A;  5JXJ A;  3HOB A;  3I2F A;  5G05 L;  1US3 A;  3ACH A;  1TG7 A;  1K3I A;  3LQC A;  3CMG A;  3OB8 A;  3T09 A;  1SG3 A;  2VZS A;  2WQ8 A;  1L7R A;  3C7F A;  3T0D A;  3IAP A;  3K4A A;  1D7P M;  1UY4 A;  2WBK A;  1RYY A;  2BGP A;  4GZ9 A;  2VZP A;  3CZU A;  1GOF A;  2WAB A;  3SKV A;  3VD4 A;  1UWW A;  2JE8 A;  2XHN A;  2WZ8 A;  2Y6L A;  2BZD A;  3HNB M;  2QQK A;  1GOH A;  2W91 A;  4DUV A;  5IFT A;  4TTG A;  1J83 A;  2QQN A;  1UY0 A;  4E8D A;  4M4P A;  3EYP A;  4OMC A;  3I3E A;  4ARY A;  4P00 B;  1J84 A;  1SDD B;  5JR2 A;  2ZEZ A;  2J1E A;  1P8J A;  1H6Y A;  2VMF A;  4DXR A;  3WF0 A;  2WAO A;  4QPW A;  5HXM A;  5JXH A;  3BN6 A;  2V72 A;  3WNL A;  2VZV A;  3C7H A;  1JZ8 A;  1W0N A;  1UYY A;  5JMO A;  4JX0 A;  4CU6 A;  2W5F A;  1GMM A;  2X10 A;  3NNG A;  4JKK A;  1PMH X;  2VTF A;  3GGL A;  4LPL A;  4A42 A;  2VQU A;  3I3B A;  2KD7 A;  2VZT A;  3I2J A;  1CZT A;  4M4R A;  4QAW A;  5I0D A;  3C7O A;  2VMC A;  2WZE A;  4KWU A;  2W1S A;  1KGY A;  5G04 L;  5C70 A;  4P08 A;  2VZ1 A;  4CU7 A;  5F7U A;  3MV0 1;  5C71 A;  4XUP A;  2Y6G A;  3ETP A;  4QDS A;  5IFP A;  3I2I A;  2J22 A;  1YQ2 A;  4UAP A;  5EJ1 B;  4BDV B;  3THD A;  3OG2 A;  2W87 A;  1WCQ A;  4OUE A;  1NKG A;  1W8N A;  4QB1 A;  1JZ6 A;  2LW8 A;  3NJV A;  2W3J A;  3LPF A;  1K12 A;  1PX3 A;  1ULP A;  1UY3 A;  1NUK A;  1O8P A;  5DPN A;  2DCK A;  4MGS A;  1EUT A;  3A7Q A;  4MOA A;  1XC6 A;  3I2H A;  1JZ7 A;  3ACI A;  4RYD A;  3GXU A;  3A21 A;  5FUI A;  5JXG A;  3A22 A;  2EIE A;  3DEC A;  4P02 B;  5B4N A;  4BK4 A;  2ORZ A;  2RJ2 A;  1OD3 A;  1JYX A;  3FL7 A;  4XUQ A;  4XUO A;  2J1T A;  1GU3 A;  4FI9 A;  5LA1 A;  4BXS V;  3ACG A;  3DYP A;  3K4Z A;  3I97 A;  1JYN A;  1OF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...