2BGSA

Holo aldose reductase from barley
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
308
structure length
308
Chain Sequence
b'QDHFVLKSGHAMPAVGLGTWRAGSDTAHSVRTAITEAGYRHVDTAAEYGVEKEVGKGLKAAMEAGIDRKDLFVTSKIWCTNLAPERVRPALENTLKDLQLDYIDLYHIHWPFRLKDGAHMPPEAGEVLEFDMEGVWKEMENLVKDGLVKDIGVCNYTVTKLNRLLRSAKIPPAVCQMEMHPGWKNDKIFEACKKHGIHITAYSPLGSSEKNLAHDPVVEKVANKLNKTPGQVLIKWALQRGTSVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSIKDEKRVLTGEELFVNKTHGPYRSARDVWDHEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOSE REDUCTASE
publication title Barley Aldose Reductase: Structure, Cofactor Binding, and Substrate Recognition in the Aldo/Keto Reductase 4C Family.
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Oxidoreductase
total genus 110
structure length 308
sequence length 308
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2005-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2bgsA00
2PDIA 2PDHA 3V0TA 1Z89A 2A79A 4WRHA 4GACA 2CLPA 3RX4A 3UP8A 2IPFA 4LAZA 5C7HA 3UYIA 2PF8A 1VP5A 3VXGA 4WDUA 1EKOA 4YU1A 3M4HA 3GUGA 3BURA 1R38A 1X97A 3LQLA 5KETA 2IQ0A 4XZNX 1AZ2A 3R94A 1S1PA 4XZLX 5M2FX 5HA7A 4HBKA 1SM9A 1Z8AA 1AH0A 4ZFCA 3LD5A 2PEVA 5HNUA 2HV5A 2PDLA 4XO7A 3QKZA 3LQGA 3Q65A 2HVOA 3Q67A 1YNPA 3R8GA 4JQAA 3C3UA 4ICCX 3H4GA 4JQ2A 4DBSA 4H7CA 4FA3A 4PRRA 3O3RA 3CV6A 5JH1A 3CASA 4YVVA 1OG6A 2PD5A 2QXWA 2ACQA 1EL3A 4PUUA 3RX2A 2HVNA 3NTYA 3O0KA 1XF0A 2AGTA 3UZXA 3UWEA 2PDFA 4L1XA 2IKJA 2HE8A 3CAQA 4IJRA 3R58A 2ACUA 1AZ1A 1Q5MA 2PDJA 3GHUA 1MZRA 4FZIA 1ZSXA 4H8NA 2BGSA 2IKHA 1QWKA 2PDNA 4JQ4A 5DANA 4Q3MA 3R8HA 2DUXA 2PDUA 1J96A 1QRQA 4EXBA 3DN5A 2BGQA 2IPJA 2ACRA 1IHIA 4JQ3A 4PR4A 4JTRA 2PD9A 3G5EA 1K8CA 1M9HA 2J8TA 4LB4A 3CAVA 3R43A 4HMNA 1RY8A 5LIXX 4GCAA 1PWMA 3F7JA 1S2AA 4LBRA 2PDWA 2PDMA 3EB3A 3MB9A 2IPWA 2PDCA 4IJCA 1XGDA 5LIYX 4LBSA 1PZ1A 3LN3A 3FJNA 3ONCA 4MHBA 2BP1A 2FZ8A 1Z3NA 2WZMA 3N2TA 4JTQA 1FRBA 3V0SA 4PUWA 4XO6A 1A80A 4WDTA 3T42A 1GVEA 2FZDA 2NVCA 4GIEA 2NVDA 2PDXA 3COTA 4L1WA 3UZZA 3CMFA 4YVXA 2PDGA 3UG8A 4JTCA 2HEJA 4DBUA 3WBYA 1JEZA 3V0UA 4JTAA 2ACSA 2I17A 3UGRA 4JIIX 1VBJA 2PZNA 1PWLA 2HE5A 5AZ0A 3WBWA 2FZBA 3GHSA 3LNMA 2I16A 1AH4A 3GHRA 2IKIA 3BCJA 4GQ0A 4QR6A 1AH3A 2INZA 1X96A 3LBOA 1EXBA 4WDXA 5LIKX 4NKCA 4WEVX 4GABA 3LEPA 2FZ9A 2FGBA 1LWIA 4LB3A 4QXIA 2R9RA 1IEIA 4XVEA 2PDKA 1PZ0A 3M64A 3B3DA 4YS1A 3FX4A 4PMJA 2ISFA 3ONBA 4Q7BA 2DUZA 4XK2A 1RY0A 1US0A 3H7UA 4JQ1A 2IS7A 3WG6A 3N6QA 2DV0A 3V36A 1RALA 1X98A 5HNTA 1S2CA 4GA8A 1AFSA 3WCZA 3P2VA 4DBWA 3BV7A 2PDPA 4IGSA 1C9WA 1PYFA 3EAUA 4XZHA 2F38A 1ZGDA 1YE4A 5LIWX 3V35A 3CV7A 3R7MA 2IQDA 3LENA 3BUVA 3R6IA 4JIHA 5AZ1A 4FALA 1ZUAX 3WBXA 1T40A 2F2KA 2R24A 3UZWA 1HQTA 4I5XA 1LQAA 4JTDA 1MRQA 3GHTA 1ZQ5A 1HW6A 1YE6A 1Q13A 1Z9AA 3D3FA 2FVLA 3G1RA 4XZMX 3LZ3A 4XVDA 4FAMA 3RX3A 4XAPA 2C91A 3UZYA 4OTKA 2ALRA 3MC5A 4WGHA 3S3GA 4RPQA 4GQGA 3KRBA 2P5NA 4QX4A 4YVPA 1YNQA 1EF3A 1UR3M 4R9OA 2PFHA 1S1RA 5JH2A 1T41A 4DZ5A 4AUBA 4WDWA 1MI3A 3EB4A 2PDYA 2INEA 4PRTA 3LZ5A 1XJBA 2IPGA 2WZTA 3DOPA 2HDJA 4ASTA 4F40A 2IKGA 4LAUA 2PDBA 3UFYA 1ADSA 2PDQA 5LIUX 4XZIA 4G5DA 2VDGA 3M0IA 3ERPA 3U2CA 3H7RA 4QBXA 4JIRA 4EXAA 3LUTA
chains in the Genus database with same CATH superfamily
1YPFA 3C2OA 3GLCA 5EMKA 3T0CA 2P0IA 1AD1A 3M5XA 4QLLA 1E9ZB 1E9LA 1QR7A 5CSYA 4LUSB 4BZYA 5DXXA 4UC5A 3GG8A 3W7PA 1LLOA 3SBFA 3WENA 2HSAA 4KETA 3N29A 4C6JA 3GVWA 1GYNA 1DQWA 5C2CA 5D32A 3P80A 4XKYA 1BAGA 5BU9A 4CN6A 5HA7A 3CHVA 2JGQA 1FWHC 1XPYA 4MZ1A 1PUDA 2WXDM 2ZX5A 5HQLA 4J3UA 2XIIA 5JBEA 2DVUA 1MXSA 1R87A 3AZTA 4AQLA 1M68A 3JRKA 2WJFA 3L4WA 4ACZB 3U0HA 2C0AA 4MAVA 1A50A 1G1YA 1BLIA 1MW0A 4IIEA 3VM7A 1UWTA 3SCOA 2J7BA 4WJEA 3DFYA 3WN6A 3VDAA 5HPCA 1QAPA 1BWLA 1EC8A 1YW1A 2VD8A 5HMFA 3ES7A 1W1B1 1R5YA 4TQTA 2VOMA 1OFQA 1QOXA 2WZIA 2FJUB 7TIMA 3GNOA 1ZSXA 3HV9A 4HYWA 4AX6A 4JQ4A 4NXSA 3K8MA 4H01A 5F1UA 3HGSA 4IMEA 3XINA 1B0IA 3MI3A 1EPXA 3HFTA 5CAHA 4DUOA 1NWTA 2BVTA 4H6KA 4LCQA 4H41A 3TMLA 3E02A 2ZZ2A 1TUXA 5HANA 1NM9A 2QDHA 1L0PA 1GOMA 4N42A 5B7ZA 1NF7A 1B9ZA 1I9CB 4PUNA 2QCEA 2HNHA 1XIHA 4M82A 4GLEA 2FB3A 4JN8A 4ZO7A 1MQQA 3UVIA 4DQWA 4Z0SA 2DZUA 1W9XA 2QUVA 4ENLA 2WZMA 5AOUA 4TX9A 1VFMA 1UWUA 3NJ3A 4XB3A 3GTXA 8A3HA 4GD0A 1E4LA 1DIKA 4PB5A 4P8WA 3TZNA 3BLFA 4GIEA 3GWQA 1NH6A 2EPMX 2R14A 1H1ZA 2E5CA 4QCEA 3DG3A 2HEJA 1ZAHA 3AOFA 3ECQA 4HU3A 1KWKA 3WDHA 4ATLA 3TW7A 5IDZA 1TJPA 1Q4WA 2VDIA 3O06A 5JBFA 2X05A 1HKWA 4QEHA 1D7KA 3ABRA 4J3XA 4B4HA 2QAPA 2J7EA 1JCLA 3LA4A 4QTGA 4LEFA 2INZA 4FOKA 1B4EA 1IZCA 4RW3A 3DGRA 2C13A 3LPGA 2OB3A 2NV1A 4ZCWA 4LW7A 3IACA 2ZWZA 4E2OA 2PCEA 3HQPA 4NKCA 1LL7A 4MB4A 2DT2A 2NVAA 2NUXA 3TVAA 4BY3A 1PXGA 6TAAA 2VC5A 3CWOX 1KQZA 2HRWA 1KRMA 1JYVA 3DFTA 1WAUA 3B9DA 4A8LA 3VD4A 3NUKA 4XBSA 1QNSA 4O4VA 3LDVA 4B90A 4N9CA 1KGUA 2XVPA 1MW3A 2QEZA 2YZ5A 3TN5A 1OGSA 4HP5A 3C0JA 4HSOA 4NZFA 4RZ6A 5H8PA 3UWVA 4UTTA 3IIZA 2XH0A 4DUWA 5DMNA 4ECLA 1QO2A 4K38A 3S2JA 3AICA 4JX4A 1PZ2A 3DHDA 3UJRA 1RSCA 1N2VA 3KM8A 5D9MA 4JKLA 2YLLA 2F84A 4MOZA 4IMGA 1KB3A 2XH4A 3H8AA 1VEMA 5G2IA 3KWSA 1EGZA 2QKFA 2XSXA 4RV3A 4O8AA 2AOSA 3O63A 2CHOA 4CQBA 2IXVA 2YCKX 3RMEA 3K4DA 1HIZA 3UGVA 2DW6A 2J24A 4NNBA 3W1NA 1UA7A 4ZQRA 3FA3A 4AY7A 3IJ8A 4GJJA 4QP0A 4MWAA 4HNLA 3TQ0A 2MNRA 3T0TA 1SO5A 1E4IA 4Z2KA 2YBUA 3G1DA 1K4HA 2VR2A 1SVDA 2Z7GA 1RBLA 1FHVA 1FCUA 4FLSA 3RN6A 3EDEA 2NX3A 5LGZA 3MU7A 1KM6A 5CJNA 4J28A 4EKJA 3H6OA 3BLIA 3L4YA 4QAIA 4RPQA 1W5NA 2E67A 3LCXA 3ZJ6A 3MKCA 3EMZA 2TRSA 2DT1A 1S1RA 3GAKA 4Q8QA 1EH9A 1EOMA 1XLEA 4B91A 1EGVA 5HATA 3CT7A 3CAWA 4GZ7A 5IRPA 3W7JA 2OEJA 4PFMA 3PG9A 3B8IA 5DCEA 2Q6ZA 1DE5A 3KTXA 3AJXA 1DE6A 4V15A 2IKGA 4U33A 3SUWA 3FJ6A 1LOLA 2Y4SA 1BYBA 7CGTA 4F0HA 5CLTA 2PDQA 1WKEA 2XUCA 1W37A 5LIUX 3K13A 3WL0A 1TREA 3GFXA 4J3TA 4MNMA 7ODCA 2Q01A 3W82A 4RZ5A 4QSHA 1Q6CA 2OZ3A 4YCPA 3W29A 5C7VA 2BVYA 4FF7A 1F6PA 3DAQA 3BAWA 1IGSA 3CHEA 2KZHA 2YYUA 4OV9A 4AB4A 1K9TA 4I8DA 1VIWA 1CEOA 1SPQA 3URQA 1X97A 4E38A 2QHAA 1LWJA 4XD6A 3F4WA 1NP0A 1XFBA 4LH8A 3PK7A 3WLLA 1QI2A 2EPHA 1RD6A 1Z8AA 5BXRA 3C5QA 2XYLA 3AAMA 3P6LA 2QCNA 3C56A 5E09A 4JR5A 2GUUA 5D03A 2BOGX 1JGMA 3C3UA 3CB3A 1OHLA 4CEXC 2V30A 1ML1A 4GI6A 5J5DA 1NTHA 1MW2A 5G1TA 4JTSA 7ENLA 3E0LA 3HG3A 3LS9A 3AHVA 3TEVA 1LUCB 4IXXA 1P43A 4X22A 4LAOA 3I10A 4FLQA 2J7FA 4QG8A 2Z0IA 4P8XA 1EP1A 2JFEX 4R88A 4LANA 3TYAA 1V3JA 4O17A 1G7VA 3SADA 2E68A 3DFOA 1QPRA 4BK9A 4K1WA 4C6NA 4W93A 1OX4A 1WDWA 1D3HA 1YHTA 5IHRA 4B2DA 1KM1A 3ATYA 1WUEA 1BEUA 2D0FA 3VINA 5HUPA 1VF8A 2JIEA 2JE8A 3N11A 3LPFA 4C60A 3QZAA 2BY3A 2PDUA 1J96A 5EPDA 3DN5A 1R86A 1UUOA 3TYCA 2XIBA 4MJ2A 4GI4A 2WANA 2HVMA 4AC1X 1K8CA 4ADUA 1GPWA 1XLDA 3FJLA 2ESCA 5RUBA 3GXDA 3BGAA 3UY8A 1S2AA 3PTQA 2CITA 4LNCA 5CPTA 4QG6A 3CUXA 2BY0A 4FEZA 3G0UA 4QQ3A 3QGAC 5HWMA 5LIYX 3FOKA 3LM3A 1O6IA 2A7PA 1QATA 2OWWA 4NX5A 4GY0A 1JF6A 3B9NA 4YWSA 5LA1A 3O8AA 1A80A 1CBGA 3ARYA 3W0KA 3ZVHA 1A5AA 3N9SA 5E1QA 4DIAA 1NWRA 1UKSA 1UR1A 4XX6A 1MYRA 3P74A 3C2FA 4AEOA 3E2RA 3M7SA 2NVDA 2PDXA 3BG9A 4L9ZA 3K8LA 3BE7A 4KRUA 2J4GA 2UY2A 2V8ZA 5DMYA 5AYXA 1JEZA 3TE9A 1F6KA 4B5NA 1W9PA 2AAMA 4C6OA 1KFKA 1Z7AA 4JYEA 5EBAA 5D04C 1H41A 3W2MA 1OYCA 1U2YA 4ZB0A 1YPIA 3S2CA 4M81A 4NZ5A 1IIHA 1QBBA 4HYRA 4DJEA 2VEPA 1WNOA 3MI2A 3H2NA 3DFPA 4BEUA 2ISSA 3OEXA 1W31A 2WMHA 4ZXOA 3EEZA 1KXVA 5A2AA 2FH6A 3SN0A 4RW5A 4PUMA 2E6YA 1IR2A 1S2TA 4NZ3A 1UP2A 2WBGA 1G94A 3EGJA 3DKJA 5K2ZA 4IMAA 2J9YA 1B3YA 5A2CA 4EX4A 1Y5VA 4MJ4A 3OZOA 2D0GA 4CQ8A 1VRDA 1X1OA 3P82A 3GG0A 3ZR6A 3WKZA 3AIBA 2X1UA 5AFDA 2ZQ0A 2E6FA 3ITGA 4Y9AA 1Z48A 5LHFA 1LLWA 4LS0A 4K68A 2OG9A 5K9DA 3B8TA 1VBRA 1DWAM 2YZRA 3LI1A 4IGSA 5A6BA 2RDXA 3A5VA 3VKCA 5AKQA 3RUBL 3L5LA 4YJ5A 3CZJA 4BWLC 5K4ZA 4RPPA 3VO0A 4HIBA 3M0LA 3DFNA 4GZJA 3GNDA 1N55A 2NT0A 4QDMA 4N9DA 1OY0A 3QW3A 4CD7A 3SUSA 2VC9A 2CLFA 1TA3A 2H9AB 3W2NA 5AC5A 3DBNA 4ZE4A 2PC4A 1TIMA 1RHCA 1IIGA 2CERA 4UQBA 3DHFA 1Q45A 2ZOXA 3WQPA 3NM1A 1FWSA 3E2VA 1ZQ5A 2QR6A 4MJZA 1UBPC 3SY8A 2I14A 4IIFA 4JTTA 1VFUA 5CZ0A 3VIJA 4BQ5A 4PCNA 2DJXA 2WM1A 2PTXA 3LHUA 2VFGA 3BG5A 2ZRUA 1WBHA 4CN4A 1AW1A 2YOCA 3B05A 3S2NA 4KEZA 3MC5A 3E49A 2J27A 3L0NA 5A6LA 4B3LA 5EL1A 1ME7A 4CU8A 4WGHA 3NQ2A 1JGIA 4ZE5A 4PSRA 4P7RA 3H21A 1IZKA 3THCA 1HGWA 1RR2A 2DSUA 4O14A 1V02E 1XCFA 5AHFA 2VFEA 1W3JA 4AZGA 1T6MA 3ME3A 4K6AA 5BXTA 1ZU8A 3U5YA 2REQA 2FKPA 2RUSA 2FH8A 4GBDA 3W2JA 4L64A 1QPOA 5F1VA 1JVNA 3TWBA 3CPRA 1HP5A 3U4FA 1V3HA 5DT5A 4DVOA 1FHDA 3E0WA 1QCWA 1R2TA 4RX0A 4O15A 4XZIA 3AISA 3VOFA 4NI8A 1MMFA 1LBFA 3LY0A 4GUIA 4XBKA 2BY2A 2YBVA 4LUSA 1V93A 4FPSA 3PZTA 3L4XA 3NSXA 1NOFA 2NQLA 2WNWA 3LCGA 2VENA 3HFYA 3PWAA 1ODZA 1QI3A 1Q63A 5EFFA 3OYXA 3S9YA 2HJPA 1J0IA 4YU1A 3FXYA 3ZJ7A 1ADDA 3GFZA 3OODA 2WMFA 4HGXA 1GKPA 1PDZA 3LGDA 3WUBA 2OTDA 3KE0A 3OZMA 3R94A 4D2JA 3B0YA 1JIBA 4JN7A 2V63A 1JCTA 5E6ZA 3GXPA 3SFKA 5CH9A 2Q09A 4AZCA 4DF1A 3R2GA 4UWMA 4M80A 3AWNA 2QYGA 5I09A 2POTA 2QPXA 3NQGA 1GQJA 3AMCA 1VCGA 3CAKA 4ACZA 3MANA 4P8UA 1TJ2A 4S39A 2C71A 5FL0A 5ABTA 1KFBA 3M41A 3QQWA 2C1HA 3GUWA 1KFLA 2QXWA 4IOTA 1VFSA 4DAIA 3WQWA 1XF0A 3GNPA 2XVKA 3S2MA 3LGEA 3H2EA 4B3ZA 4I7VA 4MKVA 4Q8TA 1P0EA 4S2CA 1TTPA 1DVJA 4GYPC 5FEPA 3NG3A 3PY2A 2QPSA 1KM0A 1JDAA 1DOSA 1K1DA 3JZUA 1CCWB 4BFAA 3QN3A 1LBLA 4OVXA 4HZMA 3LCHA 2CC0A 3VKJA 3T78A 3TJIA 3VCCA 4LRSA 1W17A 3L2IA 2PD9A 4TOQA 5CPNA 3VGFA 3VDCA 3WMLA 1PKYA 4GZIA 1UZ1A 1PWMA 1HG3A 1L8NA 1TV3A 2BASA 2YDAA 4IUGA 1JZ8A 4OBTA 1TPEA 3IJQA 1J0JA 1V0MA 2UY4A 4Q22A 5I5RA 3LN3A 4E6MA 4I9MA 3VIKA 1TJ0A 1X8FA 1CGYA 2VDHA 1VFHA 4RDWA 3EOLA 3EWBX 5H1WA 5KZEA 3TWAA 3PZQA 4HVXA 4PA8A 4L4PA 5FJJA 3UQNA 4GK8A 3UG8A 5BU6A 3ZM8A 4PODA 2WPGA 3PR2A 2VR4A 4FXJA 1OT1A 2ACSA 1L9WA 1PWLA 1JZ4A 1M53A 1VHNA 3BSMA 5EYWA 5CQ1A 4UNIA 3CUJA 3N2OA 1J93A 3PPFA 1TPC1 4UIOA 2O9OA 2OT0A 2BY1A 3GVRA 4BQ4A 1X96A 3LG3A 3OGVA 1TQJA 1MEHA 2XGBA 2PGEA 4AIOA 2KAUC 1OG0A 4C91A 4PTVA 3QR3A 4HJFA 1T99A 4QXIA 4A3RA 5IM51 2PDKA 3KS5A 3SDOA 1XYBA 3M64A 4YS1A 3B0VC 3GZ3A 3RPTA 5I2UA 1OCBA 4E2VA 3A12A 1TPFA 2PUZA 4UQEA 3P14A 4JBRA 4E4UA 1KA9F 3R13A 1BG4A 4D1IA 2GWNA 2WJEA 1NEYA 1HKMA 3KUMA 5H2ZA 1BYDA 1VKFA 1YYAA 3H2OA 1J0ZA 1E5NA 1RALA 5L9FA 1N8WA 4GA8A 1M7XA 3DUGA 5EGRA 1BVZA 1ME9A 3JW7A 2WLZA 1EHAA 3SIMA 3G22A 2YB1A 2GJXB 1HL8A 4JHZA 4FS9A 4OWGA 3V35A 3W22A 4HHPA 4I9JA 3U7BA 3QC0A 1V7AA 3MA8A 3ARXA 4CNTA 4S3CA 1P1MA 4GFSA 3FHAA 1JF5A 3BMWA 4ZFMA 1YX1A 3HF3A 1DJWA 1Q13A 1VFTA 1AW2A 4DN1A 3WK2A 3M0MA 1YQ2A 1KBBA 1VC4A 3UPBA 5HMDA 2VFIA 4XZMX 4P7QA 2DDXA 1V02A 4XVDA 4DWSB 1KBLA 2VWTA 3G1XA 4B9YA 1VGAA 4RDVA 5CPLA 5HMEA 1QHOA 1VFFA 5D9NA 3OBKA 5K9XA 3ZIZA 1O1HA 4A4AA 2Z1KA 5D4YA 4OTKA 3KRZA 2O92A 1W32A 4NX0A 2ALRA 1CPUA 1Z41A 1VB9A 3VMPA 3S47A 1AA1B 4E4FA 5FD0A 1UG6A 2CLEA 1TTIA 2VJXA 3W71A 2YA1A 1UB3A 5D9PA 1H7XA 4RCXA 4C6MA 1NAL1 3CHDA 2Z1BA 4WDWA 2J79A 1ALDA 5CC5A 4RJEA 4BI7A 3SECA 3MKKA 1SFTA 1AQMA 4PTNA 4DJDC 8TIMA 1XJBA 4C6KA 1F61A 1I6NA 1KR1A 4MY8A 3BANA 2PTWA 4YLWA 3KRSA 5LXEA 2QCCA 1OFBA 4D8LA 3QHMA 4UOJA 3FSTA 4KWVA 1TPH1 2H90A 3WQDA 3U2CA 2E40A 2E1WA 2ATSA 5F4SA 2NXGA 3NO5A 5DLCA 2PDIA 3C52A 1W9DM 1MNSA 4LYQA 3PZOA 2OZTA 3T4CA 2DSVA 4LYPA 1WZAA 1BTCA 4O4WA 5DRIA 1Q6GA 1E9YB 3VXGA 1QHPA 2WV8A 1IXNA 4EIVA 4FR6A 2CU0A 5FAJA 4QCFA 3THAA 1EJ7L 4D6JA 1ITCA 4GIAA 1QNQA 2XVLA 1TMQA 2GYIA 4KIRA 3FEQA 4FMVA 2D2GA 2PEVA 3N12A 4JCMA 5HNUA 4XO7A 5REQB 2JALA 1EQPA 2HVOA 3GO2A 1TQXA 3AZSA 4WUIA 4CCDA 4ICCX 3L67A 4JQ2A 4GRSA 1OFEA 5JH1A 1LUCA 3C2VA 3DI0A 3NXFA 1DJXA 4NJJA 1HJUA 3WUEA 1UUMA 4IQLA 2GVLA 4U3AA 5D8ZA 5KTLA 4JEJA 4UTLA 1OCNA 3NTYA 5G5IA 3GU9A 1W3TA 1ZFJA 1SU5A 4J27A 5K7JA 2BXVA 4QDWA 3SR7A 2VRQA 3R58A 1VYRA 5HJXA 3PF3A 3VTRA 2WMJA 3OLGA 1RBAA 2PDJA 1XBYA 5CBJA 1HJWA 4BKNA 4MLJA 5BZAA 4FZIA 3MDUA 3URAA 2PDNA 3A22A 2PE4A 5HJLA 3SSZA 2W66A 2GGJA 1BQCA 1B90A 4HOXA 3PJTA 2IPJA 2ACRA 2OXNA 4EP8C 4L61A 1DWGM 4UQ9A 4JTRA 4YYCA 3WD4A 3CO4A 1C93A 1DJGA 5GNYA 3VABA 4LBUA 4XBJA 5FL1A 2G50A 2OQYA 3SY1A 1X6NA 4I8YA 4NZCA 3FV9A 3VU2A 3KOFA 3T4WA 2BXZA 1E43A 4CQDA 2PRHA 3SFWA 5KINA 1KW1A 1Q2RA 3S6DA 1Q6EA 3TK7A 2FZ8A 1YMYA 1UD6A 5I03A 4AEEA 4UR8A 1IZJA 3TMQA 2WW5A 3CHCA 2ISDA 3N2BA 3VX0A 1CXKA 1KLYA 4LVAA 3M0KA 3Q2DA 1JPMA 3BW2A 2EPLX 1M7JA 2OOGA 2Z25A 4Q4RA 3GTNA 1K6AA 1RJPA 3AMKA 4IISA 5HXMA 1V3KA 2J62A 4MDPA 4RE2A 4WXYA 4L4OA 4CNOA 1IV8A 1X6LA 1A0DA 1C7TA 3REQB 1S2WA 2J8GA 1CXFA 2FVMA 2G3NA 2ZE0A 1OSEA 1TMLA 2YCEA 3GC5A 1XISA 4J2MA 2GLKA 3K4WA 1O7AA 5M03A 2E7FA 3LBOA 3HJZA 3HB9A 3MP5A 4AD0A 1SW0A 4GC4A 1TRIA 4GJIA 3L21A 3DECA 4WKHA 2ZX8A 1A0CA 4XG1A 1JD9A 1TRDA 4YTQA 2FHFA 4FB7A 5BROA 3Q37A 2PZ0A 5CGTA 2ZRWA 1IF2A 1KXHA 4XSMA 1M7OA 2WVUA 5DEZA 3AYSA 4JFSA 4AWTA 4CQCA 1QTWA 3DX5A 2EO7A 4LGXA 3QY7A 3BDKA 1AQ0A 4YN5A 3NQDA 4NZJA 1EB3A 3MSRA 3VKDA 2UY5A 1F6YA 1EJVC 2W0UA 3VDBA 3UETA 4C6LA 3QPEA 2IQTA 1T7LA 3W84A 3EA1A 3POCA 2G4FA 1JI2A 3ABQA 4AD5A 2WNQA 3QQ0A 1J18A 3NZRA 2FDMA 3O0FA 3U9IA 5LIWX 4OZOA 1KXTA 2ABAA 4HTYA 4POCA 1GNXA 3R7MA 4DO5A 2H9AA 1H1NA 2Y5EA 1P0NA 2BVWA 2CNCA 1G7UA 3FNDA 2QDGA 4YTTA 1U33A 2J6VA 2W91A 1KO0A 2POZA 3GSMA 3APTA 5GJNA 4C6BA 2H3BA 3HQ1A 3R12A 1ZUAX 1XC6A 2V68A 2WBKA 1HQTA 3C2RA 4TIMA 1EX5A 1T0OA 4AZIA 4WJ8A 3M5ZA 4DJFA 1GOOA 3CQIA 3NL3A 1ZB5A 2QJIA 1UWSA 4AD4A 3T7VA 4IPNB 4PTDA 3EPOA 2GSHA 4J3SA 3RFAA 3RX3A 1XD0A 3VNMA 5MKGB 3NFUA 1JUBA 3M0VA 1MWOA 1VCVA 2XWEA 1SO6A 3LM7A 3NM3A 5DN1A 2EF9A 4Q4PA 3T44A 1NFGA 5IFTA 2NQ9A 4KEVA 1GW1A 3L4TA 3WQOA 4NUWA 1HL2A 4A8NA 2GGGA 4XIAA 3NQVA 3FDGA 4AVOA 4O1EA 4Z1YA 5A6SA 4LUIA 1TCMA 1XRVA 1BGGA 2X7WA 3GW3A 3PB2A 3WDQA 1VJSA 3QYSA 4IIGA 3P84A 4QJ1A 2AL2B 2RAGA 4BA0A 3NIYA 2VCCA 2WLYA 2NWRA 3VIIA 2VC7A 4PUJA 1XX1A 1JDDA 3QBUA 1UD4A 1D2KA 2QS8A 3L9CA 5GJMA 2NUYA 4KQNA 2OYMA 1NELA 3UZJA 4QBXA 2OX4A 4A21A 5XIAA 1YXCA 1HF6A 3F4NA 3HOJA 4XIMA 4CVWA 3WD1A 2PDHA 1PZ3A 1CGWA 4W88A 1OK4A 3N25A 3PZMA 3W1LA 3FGCA 1QK2A 3W7HA 4Z1BA 2G97A 5T91A 2CESA 2WVTA 4Z2HA 3STCA 3TTSA 3HQNA 3F1QA 5DBTA 3I3DA 1K9FA 1ZBKA 1I8JA 1XKYA 1XGEA 3N13A 2RGMA 4WGXA 4RNJA 3BK0A 2A3EA 4C6EA 4LEQA 4REQA 4MB5A 1QW8A 1HJVA 3KZPA 3ARVA 3G8RA 4J3VA 1VHCA 2ZCGA 3R0DA 2XZ7A 2CPUA 4HPGA 3PAJA 2NV2A 3VMNA 1HJQA 2Z1XA 1A3XA 3EOEA 2WCSA 2PDLA 1J8VA 1YNPA 4XAFA 2TPSA 1O94A 4JQAA 4TVDA 3F5KA 2NX9A 2DU2A 2R91A 3IUDA 1DIEA 3WEOA 3W07A 2Z6JA 4PTXA 4PMVA 1DL3A 3DC0A 3ABOA 1XRTA 4Y8FA 2OLAA 1EXPA 4IGNA 3TLQA 4Z17A 1G4PA 1EDTA 5JIPA 3AJ7A 3LSCA 4GNVA 2Q02A 3AS1A 1EBHA 2OOFA 2NW0A 3A23A 4JHMA 3W7KA 3RRAA 4JGDA 1EP3A 4JFVA 1T8XA 2O0TA 3T07A 4QDPA 1XG3A 3EX1A 3VK5A 3URNA 1EF2A 3G8EA 7REQB 1WDPA 5A94A 6XIAA 2FHCA 2Z28A 3ES8A 2Y61A 2I5QA 1AVAA 1H4PA 2QCHA 3FW6A 3CUHA 4NYYA 1JDEA 3RK8A 1P0KA 3W7LA 2VQTA 2EJ1A 3S9ZA 1FKWA 3RMJA 4PMRA 3TC7A 1CGXA 4NNAA 4JQ3A 4D6HA 1W3NA 4UB9A 3L4VA 3OVRA 4LVBA 4WD0A 4NAFB 3VDGA 3B0UX 3FEMA 4QSFA 4RNFA 1A5UA 2GPTA 2PDMA 1ZJHA 3O6CA 4TV6A 5B7YA 1A5LC 1E56A 5FJTA 4NSBA 3PAOA 3A4AA 1E15A 1SMDA 1HVQA 4MFDA 1B4KA 3BG3A 2JF7A 1PZ1A 3VGEA 2Y7EA 3GDKA 2ZX7A 3FJNA 3OZYA 4NG3A 3G18A 5I6SA 4UTWA 2E9BA 3CEPA 3NXLA 3FXGA 2BV9A 2W61A 2X0HA 2NVCA 5AYBA 3OIXA 3UZZA 3CMFA 4X0VA 3UY7A 1NU5A 3HTWA 4NJIA 4WKAA 3MMWA 4JDBA 4HA0A 2E3ZA 2Y1HA 3JS3A 4H9YA 3OHMB 1DPMA 1J12A 3L0GA 3G3DA 3QF0A 1I4NA 4ML9A 1ISWA 5AECA 5HWJA 5CSRA 3AU6A 3OPSA 2C7FA 3VIOA 1X38A 3GHSA 4I5UA 1JL8A 1UR9A 3GHRA 5AN7A 1I0BA 3S83A 4QISA 4UTTC 2VUNA 2I9EA 5AHIA 1TO3A 2P53A 4ZEPA 2E25A 3WNMA 4ADTA 3GIPA 5I77A 2CBIA 3CEUA 5HULA 4U5IA 1UOZA 3SGGA 2CLIA 3P81A 4LB3A 4OBRA 5FJUA 1PZ0A 3T2QA 2AQVA 3B3DA 1NWUA 2DZPA 5HINA 1WBJA 3SCUA 4DXXA 1V77A 5AVHA 1JCYA 3ONBA 3VVGA 2Y63A 5A3HA 1GQKA 1UH3A 1KM2A 5A69A 5AHNA 3MJMA 4J9JA 4AY1A 1XBXA 4ONVA 1K9DA 2ISWA 1H63A 3H2CA 4UR9A 2J88A 1X98A 5HNTA 3SUTA 4GFIA 1MZHA 3IEBA 5FJPA 2GJXA 2ZICA 3W2KA 1H49A 3PZ9A 4OKDA 4F9DA 4ATWA 2FB2A 6A3HA 2VFDA 4PTWA 2V5KA 3GQYA 4WSJA 4JNYA 1F05A 5AYIA 5BWFA 2D73A 4BQ2A 2IQDA 2H8ZA 4EANA 3MTWA 3W86A 1EYEA 3G6LA 5G1MA 3ABXA 2ASHA 1ODUA 1E71M 2OODA 4XD3A 2F2KA 4IUOA 1MUMA 2E1DA 4O54A 1L6SA 3VKBA 3FS2A 2E5DA 4H2CA 1A5BA 1BSIA 1J0KA 2CLOA 1HW6A 1IEWA 1FCVA 4DWSA 1L2QA 3WJZA 3WJWA 1XCXA 5ABHA 2WHMA 4OBSA 3FJ4A 1HZYA 2XFWA 1EBGA 1UKQA 2VC6A 4XKMA 1BYCA 2YX0A 4PYSA 4OU1A 2VYOA 2ADAA 1JI1A 4PTMA 2CLMA 2E6AA 5KMYA 2W9MA 2KX9A 1C8YA 3WQ6A 5AC4A 4JY9A 2WHLA 1BSLA 4LUJA 3UW6A 5BYWA 1BVWA 4E8GA 4H3DA 1YNQA 3EPMA 4Y8EA 2ZADA 4KWUA 2YYTA 5JH2A 4HNCA 2V5CA 3FLUA 2R1LA 3QZ6A 2EHHA 4QHRA 1WXYA 2VEGA 1V3MA 4JY8A 4LRTA 5FSEC 2HWGA 2E5BA 3EOUA 4A29A 3VKKA 5DMMA 1CXEA 3MMTA 1GG0A 3ZLFA 3IGXA 1RLCL 2HXUA 1AG1O 5LXXA 1T5AA 3P5YA 5BRPA 2PDBA 1KXQA 1PX4A 5DMLA 3DHUA 2JEPA 4G5DA 2VDGA 1G4EA 5HDRA 4X2PA 4QE1A 5D2VA 4C1LA 3WQEA 4PC8A 4O11A 4EXAA 3IANA 3LUTA 3T81A 3IJLA 4M29A 2PWUA 2YBTA 1Z89A 1JNDA 3RX4A 3PZIA 3W73A 4JTIA 1XYMA 5CPQA 4Y7EA 1DTNA 1UIOA 3UYIA 3QM3A 3A64A 1LWHA 3H70A 1FWBC 3VE9A 4GYPA 3CV2A 4IQEA 4RXFA 1UC4A 1R38A 2WJZA 5G2WA 5BW6A 2YKKA 1H7WA 5C6MA 3T0AA 3KOZA 4P5UA 3THQA 1OF8A 2ZXAA 3PULA 5REQA 1CLXA 4RXGA 2VMFA 3LD5A 1I2RA 3WF4A 4DM2A 5JU6A 3AMGA 3GDLA 5J8LA 2RH9A 3ZLGA 1TPDA 3H4GA 3W83A 2YXXA 3IUIA 4DBSA 2NUWA 3W7CA 4WJXA 3CV1A 3EWUA 4NNCA 5C9RA 4ZSUA 3S5YA 3GTHA 1S3TC 3SW6A 1F7BA 5BWAA 5EY5A 1EL3A 4PULA 2HVNA 4NHVA 4PMNA 4F9JA 3IAQA 4QITA 3B4UA 3PFMA 3LHZA 8CGTA 2WAGA 2WQPA 1DJNA 2GJPA 1XSJA 4MNLA 4R5EA 3PWIA 3PB0A 3TAKA 4GUHA 5CCZA 4FLRA 3I3EA 1UP3A 4AD2A 1REQA 2IKHA 3F4VA 3T05A 2VP8A 2BG5A 3AIRA 3R8HA 4DX3A 2DUXA 3MI6A 4B5WA 3VNJA 3RLHA 1FXQA 4CNUA 1RVKA 2OCZA 1SW7A 4GNKB 2WSPA 2CBUA 3KWXA 4G8TA 3VOIA 3VIMA 3LPPA 2P3EA 5A2BA 3S9IA 3ABZA 4JNZA 3K1GA 1TJ1A 3W6MA 4YHEA 4A35A 3UXLA 1WDRA 1BXCA 1V4YA 2VCBA 4M6UA 1PKNA 2MANA 3DXIA 3RM4A 1K03A 4TMCA 3T9PA 1WKDA 1CW2A 3WZ0E 3ZLHA 4JTKA 4LX4A 2NQZA 3OO2A 1E3XA 2GQ8A 3V1HA 2FVKA 4AZ6A 3IJ7A 2QJNA 3M46A 2R82A 2V3EA 4ML4A 4GXWA 3N2TA 1OX6A 3WELA 2E8ZA 3E0IA 1XLMA 2OEMA 4IZGA 1GVEA 3SCWA 4H7ZA 2FYMA 3GE7A 1RJQA 3T0DA 3LNPA 3RNDA 2WCGA 3BOLA 1XFCA 4JOMA 2DZSA 5T26A 3L68A 3ZMRA 4HD5A 3O9NA 4KH2A 3KX6A 3REQA 4LUTB 2C6QA 3DC8A 6REQA 2W4XA 5K4XA 2Q8XA 1S5NA 3BWWA 1L2UA 1R7AA 2E77A 3SCRA 1PX3A 3GH4A 4AMCA 2ODOA 2WCAA 3LNMA 3W88A 3B8DA 1S46A 3GNXA 3KP1A 2ZE3A 1EPVA 4GE8A 1V6VA 5I3GA 1TPVA 4PCSA 1SW3A 4MY1A 4ZVJA 3HG2A 3IK2A 1J9YA 2ZUNA 1EXBA 1TCDA 3KVJA 3IJ9A 5F7UA 4HA1A 3NQ6A 4MZ8A 2YL8A 4W5UA 2QCLA 4GABA 4PMXA 4AYSA 1MXDA 5FAGA 2CHNA 1ECEA 4A2RA 1NF0A 4O1BA 3BSHA 4FXRA 2R1KA 3E5BA 3K2GA 4W9TA 4E2BA 1DJZA 1M41A 3FX4A 1OIMA 4EWND 4GIYA 3C86A 1PAMA 2PPGA 2DUZA 5FF0A 3GIQA 3QOKA 2QJMA 5TQLA 3VUSA 3EDFA 3WMSA 1HFBA 1E6QM 2Y6ZA 5DY2A 2VQUA 3DHPA 1EOKA 3WEMA 1IEQA 3FYPA 1GK8A 4FI4A 1OGBA 2A3AA 4H8VA 1V5XA 2PDPA 4IGHA 4FXSA 2GDQA 3WMCA 1PB0A 1LDCA 2VO5A 4Z2LA 2F6UA 2G96A 2J7GA 1K7EA 4US5A 3PBMA 4JL2A 1R3TA 1QUMA 4RR4A 1AMYA 1EUAA 3P62A 4DO4A 3LENA 1QJWA 2WC3A 1PE1A 4KCTA 3K8KA 2PLMA 1IWPA 4ZB5A 2NZLA 1V7YA 4NJKA 4DJDA 4Y9OA 3VC6A 2IMRA 2BMBA 5MHBA 5AYZA 1RVGA 3GHTA 1SQ7A 1CENA 3GC2A 5LA2A 2GVGA 4QNEA 2I1OA 4D9PA 3D0CA 3RXZA 3WF0A 4FAMA 3S1XA 4C6QA 1WUFA 4JIEA 1SFJA 4W84A 2J78A 3GDBA 3STFA 4XZBA 3C2YA 3HG5A 2AKMA 1Z69A 4A3YA 1LTDA 1VQTA 4FX7A 1DWJM 3L2LA 1OC5A 1XIIA 4F48A 1CLKA 2WSKA 2GVJA 2D24A 1JYXA 4IG2A 3SB0A 5E6YA 1UWRA 3ZSTA 4P7NA 5HNNA 4HQVA 1P6BA 3U2ZA 1PVNA 4WOQA 3WD3A 1E0XA 2AL2A 1S2UA 4XTIA 3R1ZA 4XV0A 2VOTA 3K46A 1FH8A 3A5FA 4F40A 4K7YA 2WM0A 4HZ7A 4UTHA 1W3IA 4YTSA 2AL1A 3VNZA 4QJ5B 3SRFA 1VJZA 3GR4A 3VNYA 3KOXA 4HU8A 3GRIA 2CEQA 2A3LA 3H7RA 2QJGA 1GKRA 4S38A 1ONRA 4IQJA 4JIRA 1OCJA 3CZGA 3AHZA 3S8HA 3T6CA 3TXZA 3NQ7A 2P88A 3WNOA 3WNLA 2IPFA 4CVUA 1FFQA 1V51A 1KD0A 2F6KA 1VP5A 4BI6A 3VD3A 4W85A 5EKYA 4Q7IA 1WKFA 1LP6A 2V3FA 1UZDA 3B8WA 3M0YA 4WIWA 3CYJA 1XLAA 4ZFCA 4UTIA 1AL7A 1KC7A 1JCNA 3RU8X 4UQDA 3VNKA 4WY0B 2QW5A 3VNDA 1GVIA 4FNRA 4L6OA 1XBVA 2HS6A 2YL5A 1NDVA 4ZO8A 1UPPA 3SQSA 4MYXA 4RNHA 3ZZ1A 1N8IA 3JZEA 3NQEA 2VRJA 4Q6XA 4Y90A 1C8XA 3BLOA 4KWOA 2X1IA 4U5KA 1OADA 2CKRA 2VZOA 1OG6A 1TX0A 1H3GA 4K1GA 2GSEA 4PEKA 1SJDA 4MWAD 2J66A 4ZO9A 5AC8A 4AIBA 1QASA 2X7VA 4K8HA 3UWEA 2PDFA 3KBVA 4L1XA 4M6VA 5D2TA 1IE7C 3L66A 3TLLA 4V33A 3R25A 3E2SA 3TW6A 4KCVA 1I2NA 2PP3A 1ISVA 2EPOA 1LG2A 4NJHA 1SZFA 3LRMA 4GINA 4H8NA 2ZKMX 1OCQA 2ZDSA 1RLDA 4QEEA 3APYA 1XUZA 1U83A 4NAFA 1LQ0A 1XRFA 3AHYA 3KVMA 5DFAA 3L7RA 1S5VA 2QT3A 1KRBC 5DT7A 2GDUA 4V2XA 3MPGA 3TYBA 4D71A 2V6AA 4GGHA 4QNWA 2VWSA 2ZX9A 2CW6A 5XINA 3FVDA 3NOEA 5IBXC 1XYZA 1WZLA 3KS6A 4PMOA 2FLIA 3N18A 3ONCA 2X1TA 4NVTA 1U22A 3STPA 1Q4NX 1PPIA 4UFIA 2QGHA 4WSKA 1ITUA 2VX6A 3UVAA 3AXIA 4DI9A 1ZALA 4O57A 3E2QA 1GVYA 5LNVA 3W85A 1UD2A 3EBVA 3EX4A 1TZZA 3TN6A 2X2YA 3NZGA 3OW1A 4NU7A 2WO5A 4AYGA 3QRHA 4O52A 1ZBWA 4JTCA 4XSLA 1R9YA 3JU2A 3EX2A 3W72A 3SURA 1JYNA 4NI3A 4HCDA 4FIRA 1K02A 4M6PA 3PZGA 3LLFA 1GHSA 4JIIX 1VEPA 3VIPA 1HJSA 4LVGA 3EOOA 1I45A 1W1ZA 2QPUA 2XIMA 4D6CA 4ZSTA 4IF2A 5GJPA 4GI9A 2EQDA 3W27A 5AYYA 2J6XA 3W28A 5AY7A 3PN8A 1TPB1 4TMBA 2TYSA 4F8XA 4Q8NA 3R0KA 2P10A 4BEQA 4TU1A 3FVMA 4CNSA 1XDJA 1WO2A 3WQGA 4Q8WA 2XVGA 2J8FA 3U6WA 3GDMA 4Q8VA 4X0NA 1K4GA 4I6KA 4MKSA 3R89A 3GM8A 4DXKA 3V1PA 2YL9A 4RZ4A 1GZ1A 2JK2A 4AVNA 1MSSA 3WJSA 1OFAA 3VIFA 3E12A 1W1TA 1S5TA 4F0MA 3W7NA 5T9CE 2TAAA 2OLSA 3GBDA 2VR5A 3MHFA 5CC3A 1JZ3A 2WQDA 1H7RA 1JPHA 1E5JA 4TV5A 2GK1B 2J7DA 4Q6JA 4B16A 3WQ4A 4C1KA 5I0DA 3N6QA 2HNEA 2PWDA 3KXQA 4W8BA 1CB2A 3AMLA 3WEZA 2LLEA 3DYMA 2XPKA 4GXMA 5E0FA 4WVXA 3T09A 1O5KA 1SMAA 4LC6A 2PS2A 4JX5A 1E6RA 2VCAA 2WMIB 5H6HA 3KHDA 4DPQA 1PIIA 2X8RA 1W1PA 2YA2A 3LPOA 2DZBA 1VS1A 4PUEA 2C15A 2ZXQA 4WX2A 3FAWA 3V3WA 1E73M 3CMJA 4HK7A 2P50A 4HK5A 4C7DA 2NT1A 1AK5A 4OIFA 1JRCA 3W25A 1M65A 1BYAA 4MAZA 4D72A 2X2GA 3F5JA 2Z4GA 3C0QA 3WLMA 1LQAA 4S3EA 1TPWA 4MB3A 1E9IA 5C9UA 1RCXB 4KFPA 1FDZA 1ZBCA 1ZNNA 1P7TB 5ECVA 3M44A 1KGXA 3HMJG 1MEIA 3VCNA 3SM0A 4RKAA 1J6PA 1LCOA 4HSHA 1OGGA 1NP2A 3EYPA 3WQFA 1AW5A 1IXOA 1FTXA 5CPMA 4PBFA 1AODA 4CN1A 3KRUA 1HP4A 3AXMA 4GVIA 2GOUA 1QW7A 4H4IA 4S2BA 4J40A 1KBIA 1UD3A 4ZXLA 1QBAA 1Q6OA 1GTHA 1QW9A 3UT0A 1Q6FA 5HR6A 4PEEA 3A4JA 5TIMA 1MI3A 1GUVA 3CIVA 4M7SA 2DIJA 1VPXA 3MVTA 3DDMA 4DJED 1ONEA 1H5VA 1L8PA 1Q6QA 1K77A 1UMLA 1GJWA 3VMOA 2I56A 2ZA2A 4UNLA 1E4MM 3MUAA 4HJWA 3EXTA 4W7VA 4LF1A 1GZJA 1OIFA 4CCZA 4X61A 3AHXA 3R11A 4JKMA 2V2HA 5GQBA 3SCQA 1M3UA 3LBCA 3Q94A 4LVDA 4AISA 4WRHA 1MQRA 3ID7A 1PCKA 2CLPA 1P6CA 4TVUA 5JUVA 3WK0A 1FP8A 3R79A 4HHMA 2AMGA 1CXIA 3SJ3A 4IFOA 1ZCOA 4D6DA 3UR7A 4H9VA 4D6IA 1R6WA 3VCRA 4FF5A 1KFJA 1AZ2A 3ANUA 3T08A 1SM9A 2OSYA 1TWSA 2F7FA 3OB8A 1FWFC 2QAFA 4HKPA 2BS9A 3B9OA 3M47A 2AQWA 1GEQA 1Y0EA 1WDQA 4I5RA 2Z2UA 2ZA1A 1JZ2A 4ZL1A 2VD9A 5KZMA 1VD6A 3SQLA 4FSAA 3GR7A 2J9XA 3T40A 2CZ5A 3TC3A 1ITXA 2J7CA 3QPYA 4GQBA 2CZDA 1EDGA 2TMDA 2R6OA 2J77A 4HMEA 4AXKA 4KCUA 5FSDC 2G95A 3OZPA 1SYTA 3GD6A 4LOCA 1CECA 2PLCA 3KCOA 3TN3A 1DQXA 3OJGA 2IKJA 1KQYA 3CAQA 3TYDA 1ZP3A 1HVXA 1TTQA 3UCQA 1G4SA 4XAZA 3TTEA 5A1AA 5D09A 2VXNA 1RQBA 4DXVA 3KBMA 2XIQA 1K8ZA 1DHPA 3CMGA 2VGFA 2WB5A 4AHQA 3HPZA 3ANYA 3UJSA 3CWNA 4LAMA 1CXLA 2Y8UA 1LQ2A 4RV8A 4PR4A 3UERA 4Q8PA 1W0MA 3R43A 4BF9A 3WK1A 2I5IA 5LIXX 2DIEA 1A0EA 1YIXA 2V2DA 4BF5A 3I6EA 2C8NA 4N9BA 3W4RA 3QEZA 1Z42A 4OUEA 1R7OA 2OLHA 4M6QA 4C90A 3BPWA 3EX6A 2WOQA 1GT8A 4CGTA 1MFVA 4PB4A 4KWSA 2DW7A 3WH5A 1YKWA 2XIJA 4UR7A 2PTZA 3MO7A 2Y5JA 2WHJA 1GONA 4HK6A 4XZWA 1YBQB 1K8YA 2RDTA 4NILA 2D3LA 3UXDA 1UPMB 3PFRA 1AMKA 4I7WA 4EPDC 5PTDA 4C5ZA 1EGMA 1L6WA 3EA3A 3E5PA 4R9XA 4AHPA 1FWWA 2PBOA 5DO8A 3F2BA 4LUTA 2V2CA 4AC7C 3A4WA 4UFKA 4FO4A 3ATZA 4JTAA 2WYSA 4AFYA 3N4EA 1A47A 3TNBA 3UWWA 4XAGA 3PUOA 1LF1A 1NOWA 4UTKA 2NQJA 3CIWA 3OLDA 3BCJA 4YPJA 3KBSA 4HSNA 4QR6A 3UJEA 2WPBA 4TXEA 1NJJA 2GQ9A 1M6JA 3CTTA 4DY1A 4QJ3B 4U10A 4KCWA 4CD8A 4LNYA 3DEQA 3BZGA 3P60A 2DSKA 5GPRA 5ABEA 3ARQA 2NLIA 4NIRA 1OEPA 1RBOB 5C8BB 2WWCA 5H91A 4UMCA 1H51A 3WK3A 2Y5SA 1KFEA 2L5HA 1NDYA 1N8FA 1DV7A 5A8QA 2PP1A 1QNPA 2VEKA 1RK5A 2HCVA 4WLCA 4MDOA 5EMUA 3HMCA 5KSWA 1OD8A 3EZ4A 1OQFA 4DJFC 1A5OC 3UESA 2XM1A 5FACA 4ZQNA 3ARUA 1B3XA 4KGLA 1OYAA 4LUYA 5CG7A 4GWEA 1WYIA 4Y6GA 2QUMA 4DNMA 4MSSA 3C0SA 3PJUA 2A5HA 3LTYA 1XINA 3IS4A 3NZQA 4G2DA 1H61A 4KFNA 3O16A 5CAKA 2J75A 3LV6A 4CEUC 3NO1A 1TB3A 2AGKA 4D8AA 1NOUA 4M5PA 4JCLA 2R24A 3RR1A 4JNMA 4IIHA 3TDFA 1TYGA 1VYSX 4F79A 1LYXA 1LT8A 3WF1A 3MQTA 4AF0A 1MVYA 1VBHA 4QRNA 1XSKA 1I2QA 2HBXA 3SSJA 4EPBC 3BLPX 1FA2A 3C3NA 4S3JA 3WDRA 2C91A 5A6KA 3N04A 3NL5A 4G1KA 3VA8A 5DQPA 4MIMA 3R5EA 3QR0A 3DZ1A 4N9EA 3F4CA 1TVNA 5D33A 1K70A 3MJYA 1HO1A 1UR3M 3W00A 4OV4A 1XYAA 4GUGA 2VVNA 4K7VA 1W8SA 4GOAA 2B4GA 4A3UA 2PDYA 3KLLA 3QTPA 3V7PA 1JAKA 1ZAIA 3MWCA 1UJPA 3OG2A 3V16A 1I1WA 3NVTA 3MSYA 5GNZA 2C0HA 1K3UA 4LY8A 3HA1A 2AMXA 3K5XA 4B5XA 4OUIA 1P0BA 3KBNA 3B0PA 3SY5A 3ZOAA 3GR8A 3M0IA 3W24A 4C1NA 2WK2A 1RCQA 2PCQA 4UTFA 4NZ1A 3NURA 1R3WA 5H8MA 4H6QA 3C2EA 3WIJA 1AD4A 4P2VA 3V0TA 2DEPA 3S1WA 5I07A 3AHTA 1U5HA 2VZTA 2QDDA 1UA3A 1WAWA 5C7HA 1SFSA 4M8UA 4C7FA 1QWGA 2HPMA 4BJHA 3LX9A 3N73A 2CXGA 1GVFA 3LQLA 2IQ0A 3AU2A 3S5ZA 4BCEA 5KETA 3KW3A 2XFFA 4WY0A 4TTGA 2VNCA 3SRKA 3LI0A 1H09A 2QCFA 2J7HA 3LBMA 4MWAB 1A4LA 3Q65A 4A3QA 3NQBA 4GGBA 6TIMA 3W23A 4JZ5A 5I06A 2DUAA 3TCSA 4H7CA 3W7DA 1X8CA 4PMYA 4FIQA 3VILA 3VOCA 3GYEA 3O3RA 5HJYA 1P5BA 3VZXA 1H0IA 2R8WA 1L6FA 1FWEC 2D2HA 3M7WA 2OZ8A 1UJQA 5CZKA 1J11A 3NQFA 1NDZA 1PTDA 5A5WA 9RUBA 2ICSA 3LOTA 4BI5A 4LSBA 3GVQA 4ZODA 4IFKA 3CWHA 4S3KA 2BLEA 3CT2A 4DF0A 1Q5MA 1MDLA 1WP6A 3U2OA 5F4XA 5I24A 3W7QA 4MTVA 1Z32X 1PTGA 1POJA 8XIMA 2FPVA 1D3GA 4UTWC 3VI2A 4GUFA 1GQIA 1QWKA 3E0VA 5DANA 2Z7KA 2X41A 4HPXA 4JS3A 3GBEA 4UOQA 5FEZA 4O8RA 2WWDA 4S3GA 3MP4A 3VZYA 1WX0A 3WJXA 1PBGA 3TZFA 3BH4A 3FCPA 5FA5A 1SUXA 1W9VA 4H1ZA 3TQKA 1M9HA 3WDPP 1XLBA 3RCMA 5LKYA 1WOAA 1BPLB 1GYLA 4V1YA 4LBRA 3WL1A 2PDCA 3UG5A 1GKQA 3R4IA 3IAPA 3BVJA 3M0XA 2PWGA 5I23A 1V8EA 3GH7A 1J2BA 4JTGA 1KWGA 3H2AA 2FZMA 2VRKA 4PFHA 3H24A 3PG8A 5T9BG 4BHYA 3WD2A 2HXTA 4J2PA 1RD5A 3RLGA 3TUUA 1S2VA 1Q7QA 2OSWA 4KIEA 1N82A 3IRDA 3ZWSA 2VZUA 2A6LA 1KTNA 4J3WA 2D20A 2X30A 3OBEA 4DI8A 4DBUA 3IIXA 3IK4A 3KBJA 1ZJAA 3RDKA 8RUCA 2OX1A 3R0UA 5HOSA 2PTDA 4AZ7A 5CZSA 1ISXA 4RL3A 4UTMA 5HK4A 2CWNA 2SFPA 2QVHA 3PZNA 3W1RA 1JRBA 1F5ZA 1R85A 4Q33A 2IKIA 3V5CA 1HUVA 3MV01 3G3MA 3WLQA 2ZYFA 2BB0A 1GORA 3G1FA 2YCLB 1AH3A 3HQOA 3IGSA 4LTSA 3AMDA 5T8GA 4Y9MA 1P4CA 3B03A 4A22A 4AIUA 3DGBA 3VOJA 3WY1A 3O07A 2ZZ7A 3M6YA 4AH7A 1X6UA 3GX9A 3PPHA 4XZ9A 5IDIA 4D6GA 4HNVA 1TMHA 4P7OA 2BTMA 3H7UA 1W9UA 4WR3A 3KHJA 4US6A 3WSUA 3MBDA 1Q8JA 1U1HA 1PDYA 3SN1A 1H62A 3WFLA 4HCHA 1XH1A 4DWSC 4RLIA 1W1A1 3HURA 2B7OA 4QROA 3SEPA 4BR1A 1TR9A 3CC1A 1AFSA 3KOYA 3P2VA 1F3XA 2E0PA 2G3FA 1C9WA 2Y85A 3KL0A 4RDYA 3PWGA 1KV5A 2AQOA 1W2VA 3U8GA 3AUJA 4JD4A 1EHNA 4N2YA 1RZMA 1J79A 4X60A 2OPJA 1XIGA 5HMSA 3UCCA 3MHGA 3BMVA 3N14A 4UTUA 4HOWA 4Z1CA 1ZBVA 1EUNA 4H04A 4IX0A 3ZVHB 2G3JA 4H83A 2CCRA 2P8BA 3WLPA 1HKVA 4I5XA 3V5OA 3ZT6A 5EFDA 1CGVA 1MRQA 4CD4A 1P7TA 4MNKA 5FEWA 1BXNA 1JZ6A 1HKKA 1XIEA 4L65A 4MGGA 5CG0A 1O5XA 3M0JA 2QMKA 3IWPA 2OELA 3C8FA 1F73A 1XBZA 1KV8A 2ZZ1A 2W6RA 5ENLA 2D3NA 5TD4A 2NQHA 3OVGA 2ZZ4A 3C4UA 3KFTA 4NJGA 3PBYA 4O53A 3W26A 3T2PA 3CB8A 3UWZA 5D2YA 5E70A 4JFUA 4PRWA 4P61A 2VM8A 2ZFAA 1XQKA 3RILA 1JDFA 1N7KA 1GYMA 1OX5A 1A5SA 3W1PA 4DZ5A 4AUBA 2W79A 2BWGA 5BRQA 1XG4A 1VRXA 2EEXA 1BVNP 4V28A 2GFTA 4JYFA 2JIWA 2FTWA 4OQVA 1V03A 2IPGA 3CXOA 3F5LA 1QI0A 4MVAA 4UCGA 1ZY9A 3CTLA 4KF1A 3CUGA 4M7TA 3VGHA 3GVGA 2PWEA 2EPKX 2P3ZA 4AD1A 1XW8A 3HM7A 2GQ3A 2E4TA 1FWDC 4O1FA 4HPJA 4ADSA 3H4WA 2PRMA 1UWIA 2WNZA 1TZ9A 3TA6A 3RAOA 4C6IA 3DYOA 4ZA0A 1UQZA 4S1FA 3ZFHA 2OMAA 1NQ6A 3DG7A 1WPCA 5C71A 1F4AA 2DT3A 4LS2A 3IVSA 1V6UA 5TNVA 1M01A 2GL5A 4AZHA 4MG4A 2XU2A 4LAZA 3ITTA 1R9XA 3WMBA 1O5RA 3B8SA 4PMDA 4IP7A 4IT1A 4DB7A 5AC7A 4LQ1A 4IFRA 1KBKA 3EDDA 1P48A 2F8QA 5C70A 4M0XA 3M4HA 1A3HA 1OFDA 1TA3B 1NDWA 1UMYA 3I68A 3UXAA 5EMLA 3QZEA 1AH0A 2XTKA 1TWDA 1W6TA 4K2SA 3O1NA 1E51A 1RQHA 3T55A 3TQPA 1JAEA 4MPKA 3MBFA 4PCPA 2WNNA 4ZB2A 3VUPA 2R94A 3VDHA 4S3FA 3LCWA 3AUOA 3BGJA 3QV8A 1JXKA 4H19A 2OQLA 1CLVA 4GKLA 1FDYA 4K39A 2J74A 5DXYA 5HUOA 2E09A 5E93A 3CV6A 1H50A 3P67A 3BXWA 3UR5A 5IBXA 4DJFD 4DBDA 3BCFA 3ZO9A 1JJKA 5EMMA 4OFCA 1LORA 4LFYA 2GJNA 3S42A 1TG7A 1E6XM 4DO6A 1BGAA 3TA9A 4DM1A 4M3PA 1W9BM 3B06A 9XIMA 1GWJA 3QLDA 2BGSA 1BG9A 1XICA 3IPWA 2REQB 5E9XA 2OGYA 1VEOA 2NXHA 3O05A 1AL8A 2X0YA 4ZR8A 3HG4A 1E0WA 2XN0A 3FAXA 5A8NA 3I65A 2J8TA 4NY2A 3ARRA 4HN8A 5D38A 1E1CB 1UR8A 1C90A 3T0BA 2YB4A 3DG6A 3SCNA 5BOEA 1YTKA 4H7VA 4DO7A 4UFHA 3QTGA 1YBQA 2PWFA 4Y9NA 5CJ5A 4L6DA 2FGZA 2HROA 1E55A 3L65A 2OZ0A 2V0TA 4FNSA 4JTQA 3AIWA 2YPIA 4IL2A 1DKWA 3ITOA 3TC6A 3BJTA 3MP3A 1JZ7A 3O6YX 2J47A 3MCOA 3HPAA 2QMJA 4F0RA 4QIUA 4AVFA 3STGA 1A3WA 4W7UA 4TO8A 2GJLA 4AZCB 4HNTA 1QOQA 1BQGA 5CZTA 1IGWA 4DUVA 3M07A 3II1A 1K9EA 4FOUA 4QE4A 2PC8A 5JBDA 4AY8A 4LYKA 1B1YA 2ZUMA 3PUDA 2NWSA 3AI0A 2Y2WA 2ZRVA 1PHWA 2DZAA 4PMZA 2PGRA 2VUYA 2YL6A 3S2LA 4I9TA 2P0OA 3BOXA 2XH2A 3OQEA 1Q66A 1G6CA 1J10A 3QQ1A 3W87A 5BRBA 3CH9A 3WNPA 4M1BA 1S3HA 3NNTA 2O9TA 3W70A 2Z26A 2GGHA 3KBWA 5EA9A 3DYPA 3VOHA 1J0YA 4AU0A 2FGBA 4B3KA 4H00A 3BJFA 1OFOA 1FDJA 3KVLA 4IMFA 4HHLA 2O7QA 3NQAA 1WZKA 4PMJA 2D22A 2Y7GA 2Z1SA 3G0XA 3W7EA 4Z1AA 1MEWA 3HBLA 5G4HC 1NIUA 1VR6A 3IRSA 4S23A 3ZWTA 5XIMA 2V5BA 4DF2A 4KWWA 4M19A 4XUGA 2IS7A 4K3ZA 2QUNA 3H4XA 1GOIA 2INFA 3FY1A 3LXAA 3RG6A 2EG7A 1M5WA 3FK4A 1TR1A 4GISA 3WLKX 1R3QA 4A6GA 2V67A 3TCEA 3LHVA 3EKGA 4HU0A 4G56A 2P8CA 3Q4DA 5I3IA 5D37A 2V5DA 1TE1A 1FUYA 1Y7VA 3VZZA 4JIHA 2C19A 4Q4KA 3LCLA 2XSBA 3LRLA 1A53A 3EWYA 3JUGA 3P61A 4M56A 4B5UA 1V0LA 2OQHA 3Q58A 4RK8A 1UKPA 3TFXA 6XIMA 3A21A 3NOYA 1HKIA 1B3OA 2W63A 3OLIA 3UF9A 4WSHA 1E4NA 4TR9A 1F74A 2PGWA 3W74A 3LTPA 2YDQA 3UPMA 4OE7A 3PSWA 2Y8KA 2TODA 3OLEA 1EP2A 3CZ8A 2W3ZA 1JNEA 1OWQA 3WF3A 3S4TA 2CZFA 3NDOA 1JG9A 2HBVA 1Y8BA 5EBUA 1NQKA 1GVOA 2NXIA 2ZUVA 2B7NA 1B31A 3QC3A 3F03K 2FTPA 2R1MA 4YTUA 1T41A 2PWHA 1KKRA 3BAYA 5A95A 3TU9A 1XYFA 4DLMA 1G9HA 4J4KA 5HBFA 3VNIA 3LU2A 1ECQA 4NXKA 1HKJA 2OFJA 2G8ZA 1XM3A 4O50A 1SJAA 2CZVA 4D1JA 4EPKA 4GIRA 3TSDA 2WVVB 4AZBA 3MMDA 3XISA 1O95A 1Y65A 1V0NA 3MS8A 1GW9A 1XLCA 3KTCA 1E6PA 1JPKA 2Y8VA 5D05A 2CHRA 4AWUA 1W56A 3VPLA 4EOUA 1UHVA 4CKQA 3KTSA 1LOSA 1JPDX 2JEQA 4ZOBA 1IYXA 2EG8A 7PTDA 2A79A 2GWGA 2FPTA 2X1RA 1XIJA 3UP8A 3A9IA 1ESWA 2VFFA 3ALGA 2FMOA 2GVYA 4IP4A 3RPDA 3L5MA 2Y70A 4GYFA 4L4LA 2FPYA 3NCOA 5DRCA 4IMCA 3N3TA 4W86A 4C6CA 4N4PA 3LLDA 1VBUA 5M2FX 1RH9A 2VGGA 3W1XA 1UIPA 4JKKA 1UROA 5AC6A 4L9YA 3WNKA 1CZ1A 1TV2A 2Y0FA 1IWAA 4JFTA 1SR0A 1YDOA 1FP9A 2DH3A 4G9PA 4D6EA 3KDNA 3LSBA 3OOQA 3TXVA 3PC0A 3P0XA 2YW3A 2QVNA 3EPNA 1XIBA 3QMTA 1B9BA 4LCRA 3ITLA 5G2HA 1VLWA 3LRKA 3P3BA 3AZRA 3TAOA 3D47A 4E3TA 1UD8A 2CWXA 2HS8A 4PUUA 4DWSD 1FCBA 3GTIA 4GNJA 4KEMA 4LPCA 4HZ8A 3BLLA 1A4MA 1MW1A 4IWWA 2RJGA 4TVCA 3BZJA 4DBEA 4AZ5A 3MV11 4LXFA 4GKTA 2HMCA 1SO4A 4DYKA 1EC7A 4R7WA 1LROA 1DTUA 3N9KA 1OT2A 4MUZA 1EZWA 1TWZA 1CX9A 1HL9A 1H60A 3HPFA 3MZNA 5CPOA 4GY1A 1KBJA 4B5SA 4JEQA 1FVPA 3RO8A 4QJ4B 1HJXA 4JN6A 3CAVA 4J3ZA 2VEMA 4ACYA 1WZMA 3NSMA 4S3BA 3G1VA 2W5FA 3DIPA 2IPWA 3W6YA 3N2CA 1JUEA 3CUZA 3W7MA 3BQ5A 1UUQA 1GVRA 4K8EA 4HHHA 1IR1A 2C1IA 1KM3A 3IJ6A 1O1ZA 3QV9A 3PS7A 1MUWA 1VFOA 4LCSA 3URBA 3ARSA 4UQAA 2JBMA 1PCWA 1MQPA 5I7GA 4MPQA 1TELA 4L1WA 5FCZA 2JF6A 3PANA 4ORMA 3ITXA 5E0KA 1K6WA 4PMQA 3W01A 2A7RA 4KGJA 1O66A 3RU6A 2WVSA 3TKFA 3A9BA 1O12A 1VBGA 2A2IA 1KCKA 1UH2A 2GVEA 3WH7A 3CQKA 3UGRA 3PBWA 1Y5WA 2DZTA 4M51A 3ICJA 1OZMA 3B9AA 1DYSA 3PJWA 3W7IA 1F3TA 4IGMA 4QGCA 3RLUA 3I6RA 5C9WA 1FH9A 1OJXA 3IVTA 1HX0A 3STEA 3W3OA 5JXQA 2YCLA 9CGTA 3F2CA 5BCAA 1AH4A 3TROA 3N4FA 2G4JA 1U1JA 1NVMA 3U2EA 2NSOA 4W8AA 4FLOA 3TOYA 1OFRA 1C92A 4A8RA 4IP5A 2BFGA 2E9LA 2PU1A 3V75A 4INFA 3BC9A 2O9PA 1R0MA 1PKMA 1KRCC 3THDA 3KEHA 3GFYA 4UQCA 3W2UA 4PH6A 1X1NA 4OT7A 3B4YA 4XVEA 1U5JA 1RA5A 1XLGA 4HA3A 4IXHA 3PNZA 4UMAA 4DZHA 2BX7A 4LC8A 1FWAC 4IMDA 1NSJA 3HGJA 4Z2IA 2Z1WA 4OECA 4NL1A 1FWRA 1XL9A 1QFEA 4KMQA 3TSMA 4MM1A 3HZ3A 4GVGA 2FFIA 4Q4SA 4GYKA 3ITVA 3IV8A 1IT8A 1AJZA 4X9YA 3MW7A 4FHAA 4ZOEA 2V81A 2UZ9A 3FYYA 3LTSA 3VOGA 1PYFA 3R10A 1FWNA 1TPUA 1CGUA 3HPSA 3QV6A 4L80A 1LL6A 4KT2A 2OEKA 1WDSA 1ZP4A 2GZXA 3QHNA 3CV7A 1SR9A 4H8HA 2J13A 3UNDA 2B7QA 5A8GA 2ZBTA 3W1AA 2C3ZA 3GXTA 2O9RA 4YCOA 4KERA 5AZ1A 1W1YA 1XGZA 4YTRA 3U3HA 1WOBA 1WV2A 3BAIA 4K8GA 4GHRA 3LYEA 4MY9A 3NR0A 3UWYA 3O7UA 3HGOA 4EAYA 3LZ3A 5CKSA 1XRSA 3TOPA 4GPNA 3D46A 1PO9A 3BLDA 3NYZA 1VH7A 1PKLA 1JCMP 3A4XA 4OHQA 2BHUA 3ISIX 4KEUA 3SN4A 6CGTA 3TYUA 4ROQA 2GUBA 3UXKA 1TTJA 4WK9A 3PJXA 5KEZA 3N1AA 4GQGA 3KRBA 1I2PA 5D2XA 4QLJA 3MCMA 4J5NA 4ALDA 3BCDA 1M7PA 3EWDA 4N02A 5BMWA 2QF8A 2A4AA 4Z0JA 2NV9A 3EB4A 1SJBA 3EB2A 5DCDA 3DFSA 4PRTA 4LALA 3KL5A 3EOSA 4CCEA 4O0QA 2DZVA 3DBPA 2GDVA 5BXSA 3RO6A 5J5RA 2VEIA 3GVVA 2YW4A 1DHKA 2ALDA 2O56A 4GJ1A 2XH7A 4W89A 3AWOA 3CS2A 2P76A 3B04A 3S6OA 4MNJA 4O1CA 1DXEA 3WD0A 2BZNA 2ZTKA 4GACA 1RQEA 4IIBA 1HO4A 1IXQA 1G69A 2HK0A 1MO0A 4WDUA 1EJTC 4F0LA 2ZXDA 1US3A 4H6EA 1CTNA 3UA4A 1DXFA 3MUCA 1UD5A 2D69A 4L7ZA 1C8VA 4C65A 3N34A 1B57A 1DWHM 3NDYA 4S3AA 1FFRA 3M43A 4CNPA 4CQAA 4US5D 3P93A 3CIXA 2HV5A 4AWSA 2WSYA 3RYSA 1OC6A 2D1ZA 3R8GA 3OHIA 4DJDD 1HNYA 2QGYA 3PM6A 1W3HA 5DF0A 1DIDA 3GG7A 1E40A 3QSRA 1H7OA 3HJEA 5FOOA 3RRXA 1O5QA 3ABSA 2PD5A 5LNRA 2PRLA 4YWIA 1H5YA 5D02A 4FNUA 5SWUA 5FJRA 2XM2A 5CEWA 4GVFA 4ZOCA 2AGTA 3UZXA 3FDKA 3P5ZA 4PSPA 1C29A 1LRQA 3FN9A 3UEQA 4Q7NA 4GH3A 1W5MA 5I00A 1HXJA 1IT0A 2A0NA 4HB7A 4E0CA 1GJPA 4DUXA 3HN3A 1ZS2A 3FKRA 1WA3A 3GNNA 4B92A 4S3DA 3PHAA 4MJMA 1YDNA 4EXBA 1R47A 2QF7A 3M0HA 2FGLA 3H26A 3JR2A 1E1CA 1CIUA 4HTBA 3DKLA 1D8CA 4Z2JA 3FFSA 1WDDA 1RY8A 4P7LA 2PDWA 3S1UA 1DWFM 3MKVA 1XGDA 5EMJA 4CQ9A 1GG1A 1E0UA 1UZHA 4GVHA 4O0KA 4G7EB 3XIMA 4D6FA 1XH2A 1H2JA 2F9RA 2BHZA 1KNWA 2XFYA 1ICPA 1XUUA 3FGCB 3TTYA 1GOWA 1ONXA 2IW0A 3WO8A 5GNXA 2BODX 1ISYA 5FJIA 3H2FA 3WFZA 3E3HA 3G6MA 4XO6A 1KFWA 1IEVA 4WDTA 3D3AA 2HISA 2VT0A 3PP7A 2PWVA 3TJ4A 4M1RA 1J5SA 4JTLA 4REQB 2VFHA 3VD5A 3ZJ8A 4Y96A 4W7WA 4ZQCA 3NL6A 1YNYA 1GQLA 2ZRYA 4IPPA 3PTDA 5ABFB 2PLJA 5K9CA 1XD1A 2TSYA 2YFOA 1R30A 1R46A 4JHOA 4CU7A 2UWFA 1ZPTA 3QMSA 1R3RA 4H9UA 1EIXA 4O1AA 4RE3A 2UV8G 3QYQA 1V79A 1T8QA 3USZA 1ELSA 1RK6A 3BTNA 4R27A 1ADOA 2X0SA 2YLAA 5KITA 2CLLA 1JULA 4J1OA 1UR2A 4RUBA 3MUZ1 2VX7A 3TP4A 2P1FA 2DQWA 3GTFA 1VLIA 1I2OA 1CNVA 3ARZA 4I90A 4FK9A 4KS0A 2OU4A 1KCZA 4A8IA 4MB1A 1IEIA 4GQQA 4R7OA 3NQMA 3UU0A 1X7FA 1B3WA 1XH0A 3BMXA 2E28A 4FR1A 3OTRA 3E1F1 3GW0A 4C7GA 1ZLPA 4LYRA 2C16A 1HT6A 3HIJA 3CJPA 4C6DA 4V27A 3HU7A 1CXHA 2CYGA 5KZDA 4FXFA 3TNOA 3GXNA 4GXPA 4W8LA 1AJ2A 3TR2A 4ES4A 3V18A 3M6DA 1QNRA 1QPKA 4AXNA 5ECUA 2OO6A 3CUIA 1XKJA 3VD9A 3ITYA 3NEVA 4YHGA 1K8XA 3OQ8A 3IJDA 5CGMA 3AXHA 1PJ9A 5MF5A 4IICA 5LHEA 3DI1A 3TONA 1ZGDA 4JIPA 4GBUA 1Q2SA 3W53A 2HZGA 1IXPA 1Q3NA 4RE0A 3KOWA 4C5YA 1GZGA 3P7YA 4U2ZA 1E72M 4AW7A 2MUCA 4QAWA 2FTYA 3ZXWA 3GXIA 3UZWA 1I75A 3VFCA 3TQVA 1ICQA 3WUFA 2DGAA 3S1GA 4JTEA 2ZVRA 3RR4A 5HQEA 4I3GA 3A13A 3D3FA 4R7JA 3ORWA 3PUEA 4JX6A 3W1QA 3QY8A 4Z1DA 1UOKA 1H11A 2JGYA 3BLKA 5FESA 3E38A 3WX7A 4L9XA 5I3KA 3AROA 2HTMA 3ALFA 5DBUA 3TN4A 3ZSSA 1DP0A 2Y7FA 1G4TA 4J7RA 3BSGA 4LVFA 4W87A 2W67A 2ZVIA 1KFCA 4OGZA 4O10A 4QFUA 4BQ3A 3W7OA 2DVXA 2G5WA 3C6CA 3SRDA 4H8UA 3S3GA 2PU0A 5TF0A 2OT1A 1GCYA 3J7HA 3EDJA 3OA5A 4R9OA 2PFHA 3P8IA 4HYVA 3I3BA 3OGRA 1UQYA 3ZR5A 2FQIA 1FWTA 2ONEA 3G1AA 6ENLA 2INEA 5AHLA 1Q6RA 2D0HA 4JTJA 2CLKA 1LOQA 4EPEC 4WY0F 2WVVA 3NZPA 5BNKA 1ZJBA 1UASA 1ITQA 1EIBA 2ZUWA 4XUYA 4MF4A 1AQFA 2YIHA 3PZUA 2QV4A 4E5TA 2WMGA 2OSXA 1X1ZA 1ADSA 3GXMA 3WUGA 1XYCA 3RGTA 4EACA 1H7PA 3A6OA 1FKXA 1XDMA 1I0DA 1TVLA 2DQXA 1A5KC 3QH2A 2Q8LA 3MWAA 4IPJA 1IWBA 5C0QA 5E0CA 4Z08A 4DYEA 1Y5XA 2I7GA 3LCFA 1KRAC 3SJNA 1QU4A 4ZGYA 1W1IE 1XIDA 1S5WA 3NDZA 4WF7A 1C7SA 1H1YA 5CC7A 2YXGA 3INPA 3W02A 1B2YA 1LT7A 2Q8ZA 1V6TA 3GY1A 2CBJA 3DESA 2DZWA 1QI4A 5G4WA 2PB1A 4NQ1A 1QPNA 4CNNA 4H6RA 2DY3A 2VX4A 4GYJA 2O4QA 1SJCA 1YXYA 1C91A 2Y7DA 2WSQA 3GZAA 4KESA 5F2GA 2QCMA 1FBAA 3Q45A 4Q4OA 5LSMA 3SQMA 6PTDA 3MT1A 1FHUA 1SZRA 2NX1A 3QGKC 4L56A 1XS2A 3ZT5A 4R53A 1UW9A 3GG1A 4ORIA 2B0MA 4E4PA 2J25A 1VAHA 4ZO6A 1KGWA 3GU2A 4KFOA 3WQ8A 2DVTA 3CZKA 3L5AA 4YVVA 2ZTJA 2EAWA 1B5TA 1UP0A 3IIVA 3S1VA 1Q65A 3BGGA 2BGNE 3K30A 2OJPA 1SGJA 3VIHA 2G3MA 1PSCA 2ZX6A 2Y88A 3GKFA 5IXEA 1MZRA 4G6CA 4HT3A 1JR1A 2BVDA 4LV9A 5AHEA 1F07A 3AIQA 2ZDRA 3G77A 3U7VA 3LGGA 3NYDA 1S39A 1KM5A 5A8PA 4PCFA 1IHIA 3MDWA 3G5EA 1FHLA 1ZHAA 1XC4A 3RCYA 4H9ZA 4K36A 4Q4MA 2JKAA 3SRHA 2ZUSA 1IEXA 4GCAA 3A3HA 3AS0A 3EB3A 1UWQA 1W91A 1QPQA 3IARA 4O18A 3RPMA 5GVJA 1RAKA 3EXSA 4L4MA 3YPIA 3HV8A 3RCNA 3OVQA 1DORA 1SSDA 3ZJKA 4D8ZA 4KPLA 1HN1A 1B30A 1QDSA 2A1YA 4XD5A 1JUKA 1RUSA 2VELA 4A05A 1FWGC 4QG9A 2RDWA 5IHSA 2PDGA 4K37A 4DZAA 1F9CA 5CXPA 1P6WA 1Z6KA 3KCLA 3AALA 4Q4QA 3O6AA 4FX8A 3MYPA 1TKKA 1G67A 2G41A 1VBJA 4DRSA 5MKGA 1DBTA 4HA4A 4XQ6A 3VYLA 4UFMA 4TX6A 2V5LA 3WBWA 2QCDB 2Z6IA 2UBPC 2FJKA 4GX9A 4HOZA 2C14A 1GVQA 2YDRA 4NRSA 4RNIA 4A2SA 4WHBA 4F4RA 3LHYA 5BOOA 1RP9A 4GQ0A 1UBSA 2FHBA 3EWXA 5HWNA 2B31A 3FA4A 2G0WA 3LMYA 2HQAA 1PYMA 4GMEA 1CYGA 3B97A 4F66A 1R3SA 3LEPA 3AYVA 2XHYA 2YCIX 1BHGA 4DNHA 2ZXBA 3QXBA 1A5NC 1EYWA 1FX6A 3VGGA 3MSGA 2Z27A 2CKSA 2FMNA 4O16A 4F0KA 3HO8A 1BWKA 1A5MC 1PS9A 3RJYA 1G0CA 4QE5A 4X3ZA 3ZT7A 1SFLA 5M1TA 1REQB 4ZTXA 1F3EA 2XG9A 3KL3A 1US0A 1DJQA 5A8OA 1UKTA 1V6YA 3QSTA 5DY3A 3I7SA 2H8XA 2DZXA 3MUY1 4OOUA 3G2GA 4GZEA 3E9AA 2DV0A 3V36A 1Q7MA 3W1MA 4PL1A 3WCZA 1OBAA 4Q8MA 1J01A 4IM4A 3T1GA 4UTJA 3MCNA 4XISA 1Q6DA 4XAYA 3EXRA 3CPUA 3U4AA 1W3KA 1DWIM 5D2WA 5FF4A 3M0ZA 4N7QA 2WC4A 2V5JA 1THFD 1JQVA 3WLIA 3C61A 3WDJA 3W75A 1TVPA 4RE4A 3BUVA 5TBOA 1D7FA 4AMAA 3R8RA 3AO0A 4N0RA 3K1DA 4FALA 1R3VA 1T40A 1YPXA 4XD4A 5HQMA 1M04A 3H54A 3GYCA 1FXPA 1XHGA 3H22A 3PZVA 1Z9AA 3CZLA 3TSBA 2ZZ3A 3CNYA 3MUXA 2CBVA 1ZCCA 6REQB 2ZRZA 2H3DA 2XZ9A 4ICNA 1Z44A 1BFNA 2V69A 2WKLA 3UCDA 3EDKA 2D2JA 3CBWA 1FCQA 5A6MA 2A85A 3IVUA 2V82A 4LAKA 1CWYA 3I6TA 2P5NA 2ZIDA 3LV5A 4CLMA 3PTKA 1QI5A 3UWUA 4YVPA 1EF3A 3EEGA 2YDSA 4PL2A 1SZGA 3UJ2A 4GO9A 1YTDA 1NFBA 7REQA 2C79A 2VGIA 2XGIA 2PF0A 4NAEB 2BHYA 5C5YA 4Z2GA 5KZ6A 3CQ0A 3DOPA 3KLKA 4ASTA 4DWDA 2PGFA 3T2OA 4O12A 1JCJA 2V3DA 4LAUA 3S5OA 2O55A 3MY9A 4Y2WA 3WLRA 4FNTA 3WBAA 1HGYA 1MUCA 3BW3A 3H7VA 3TR9A 3GDRA 1CI1A 3CL7A 1XPGA 5AVNA 1JFXA 3WNNA 3M9YA 2XINA 2YFNA 1QO5A 1Q7ZA 4IX2A 5JQ9A 3U5UA 3AC0A 4O19A 5A6TC 2I9UA 1A49A 3F4DA 1X7IA 2WKJA 3OU8A 5EMYA 4PCTA 4I7UA 3W37A 3AYTA 1S1PA 4XZLX 4AHOA 5K3VA 1L6YA 3WBEA 2OWCA 3L4ZA 1YDVA 3Q67A 1P1XA 5LNSA 1TV5A 3QGVA 3CM4A 4BS0A 2Q3OA 3H53A 1TZ7A 4ERIA 3PPCA 3KZSA 3E6EA 4FA3A 4JICA 3W9ZA 4NT0A 1FWCC 3QY6A 4PRRA 1OF6A 1LLZA 2XWDA 3BQ6A 1E1EA 5LZLA 4ZENA 1KTBA 3PUGA 3VD7A 2ACQA 2XIOA 2FFCA 1W1VA 4JDYA 3TW9A 4EVZA 2RKXA 3CLMA 3CPGA 1TJRA 1EQCA 1QT1A 1C9DA 4IG2B 3C8NA 4HU4A 1VENA 3HPXA 1UC5A 2CZEA 1AZ1A 3BAKA 4TX8A 2OR2A 3N15A 3GHUA 3ARWA 1F8MA 3P8JA 3QMRA 1M03A 3LXCA 3W7RA 1C3FA 4MMWA 3ENLA 4NYUA 4Q3MA 5M3WA 2ZRXA 3L23A 4WZHA 2BGQA 3WLHA 1TUFA 1O68A 5FI8A 4UBPC 4U3CA 1CT5A 1TWWA 4JL1A 2ZUTA 3IIPA 3QJAA 1O60A 4IL0A 8XIAA 2WC7A 3QVQA 1E0VA 1V6XA 3EKLA 2QNEA 3IIOA 4X63A 5H8UA 4G7EA 1OVDA 4LS1A 4B2DD 3WH9A 4IJCA 3WLNA 4GX8A 4DEFA 4I9AA 4JIQA 3WDIA 7TAAA 3N2MA 3VX1A 1R3YA 3B40A 5FEXA 4MHBA 3AIUA 1Z3NA 4GUJA 3USBA 1JFHA 3UYCA 2BDQA 3T42A 1BWVA 1CGTA 1LRNA 3QFWA 2OVLA 1OB0A 4DELA 3COTA 2AAAA 2OKOA 5ABFA 4UFJA 3NGFA 3WF2A 1V08A 2QQ6A 4LWWA 1LM1A 1YRRA 3EKZA 2QLYA 3BARA 2NQ5A 3CYVA 1PIFA 3VIGA 5BOFA 3TYEA 1W5QA 3W2LA 1WB0A 2X16A 1BF2A 5LNWA 3NPVA 4QLKA 1RV8A 2QDEA 3E0FA 2PP0A 5I3FA 3NWRA 4PBGA 3QFEA 3LMZA 1TSIA 3TIMA 4ATDA 3OYZA 4PN2A 3B0XA 1EDQA 2A21A 4C6FA 2OKTA 5AZ0A 4EF9A 2VZVA 2CLHA 2FZBA 4Q8UA 3SI9A 2H6RA 3S46A 3WLOA 5EU9A 5E5CA 4WKFA 3N9RA 1WXJA 3S6TA 1LRTA 4WDXA 2GGEA 3GH5A 3UG3A 3QPZA 3E74A 2QIWA 4NF7A 1F8IA 3EMCA 2V3GA 1KCLA 1J2WA 4JYDA 2BOEX 3FSUA 3FA5A 1FWIC 4UZSA 2PI6A 1YEYA 2ISFA 4KKXA 1RA0A 4Q7BA 4ILSA 1RY0A 1QVBA 5I02A 3PBUA 2A7NA 2WKGA 3IGHX 3C0LA 5F2IA 1UH4A 1W54A 2F6XA 4JXCA 2Z24A 1OK6A 3VFLA 4B15A 1PHQA 2Q3RA 4DHGA 3CL8A 3MYOA 4NZ4A 3FKKA 1RP8A 1CB7B 4HZ6A 3CUFA 2JKPA 1XLKA 5TAOA 5J04A 3N3MA 1PX8A 1XV8A 3O15A 4ICMA 3AXKA 1XCWA 2WMKA 4XZHA 2F38A 3LLXA 5CSSA 1TX2A 3BAJA 3CK5A 1YE4A 4EF8A 1QNVA 1OM0A 1JZ5A 1W5OA 1EJUC 1U30A 4G7FA 4GC3A 1ISZA 2ON3A 3SCTA 1GOKA 1FY6A 5A6BD 4WCJA 2VURA 3SGZA 4PE8A 5ABGA 1PIGA 2PAJA 5HR7A 1GHRA 4IH3A 2W92A 4DPPA 5CSUA 3G1RA 3WYZA 5D8WA 3DENA 2VEFA 2CETA 1SO3A 1DJYA 3RJXA 4BWLA 2XGZA 4HNNA 2QUUA 3GC4A 3DFQA 2A3CA 1XYLA 1POKA 1F2JA 3ITCA 3L0KA 3I4KA 2O7SA 2BXYA 4EK7A 1E6SM 1XDLA 1J0HA 3SAZA 1U5VA 1UWAA 5LYRA 1G5AA 3LCIA 3PSVA 1NY1A 4QM1A 4MYAA 5CBBA 1BRLB 1D8WA 1XLFA 2GJRA 3QKEA 3TJLA 4AD3A 1B3VA 1S38A 3GAYA 4FNPA 2QJHA 3PVFA 2VL4A 2XN1A 4DZIA 4DYJA 2WZTA 2JKEA 3UR8A 3EWCA 1I60A 4MZYA 1MDRA 4JPGA 3FHQA 5M5DA 2F2HA 4ERGA 4HNUA 2YXOA 3TJXA 1LZOA 2Y89A 4AEFA 3O6DA 3G1SA 4KW2A 4MWAC 2CFFA 1PEZA 1SZNA 3SCPA 3UFYA 2FZNA 4AG0A 4B5TA 1R2RA 3T8LA 1R9ZA 1FWJC 5HNRA 2GSJA 1BKSA 4MADA 4O28A 4WXZA 4GO8A 2YJQA 2Z2BA 4X2RA 3SO7A 1H0GA 1TV7A 1QOPA 4BF7A 4Q8OA 4CUCA 2X40A 4HN4A 1VPYA 2HPIA 2Z00A 4LU0A 2PA6A 3AXXA 3CLWA 2DORA 2PF8A 4R3UA 1ZZMA 1YTEA 4L5ZA 4Y9PA