2BGSA

Holo aldose reductase from barley
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
308
structure length
308
Chain Sequence
QDHFVLKSGHAMPAVGLGTWRAGSDTAHSVRTAITEAGYRHVDTAAEYGVEKEVGKGLKAAMEAGIDRKDLFVTSKIWCTNLAPERVRPALENTLKDLQLDYIDLYHIHWPFRLKDGAHMPPEAGEVLEFDMEGVWKEMENLVKDGLVKDIGVCNYTVTKLNRLLRSAKIPPAVCQMEMHPGWKNDKIFEACKKHGIHITAYSPLGSSEKNLAHDPVVEKVANKLNKTPGQVLIKWALQRGTSVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSIKDEKRVLTGEELFVNKTHGPYRSARDVWDHEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOSE REDUCTASE
publication title Barley Aldose Reductase: Structure, Cofactor Binding, and Substrate Recognition in the Aldo/Keto Reductase 4C Family.
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Oxidoreductase
total genus 110
structure length 308
sequence length 308
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2005-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2bgsA00
3LQLA 2PDCA 1RY0A 4WEVX 1PZ1A 1Z9AA 1RY8A 1AZ1A 3R58A 5HA7A 3LD5A 3LUTA 4JQ3A 4JQ2A 1Z3NA 1EXBA 4Q3MA 2PDYA 4OTKA 2FGBA 3GHSA 3LZ3A 4QBXA 3UYIA 1C9WA 4WDXA 4R9OA 4FALA 3H7UA 5LIXX 4JQAA 2PD5A 2VDGA 4WDUA 1AH4A 1ZSXA 3FJNA 1Z89A 2PZNA 2DUXA 4IJCA 1VP5A 2AGTA 1AFSA 3LBOA 1X98A 4MHBA 2HVOA 2HEJA 3G5EA 1YNQA 4JTQA 2PDJA 3ONCA 2HV5A 2HE8A 1FRBA 5KETA 3WG6A 1Q13A 3O0KA 1US0A 2PDFA 1XGDA 4GCAA 3LZ5A 1Z8AA 1S2AA 3R6IA 1S1PA 3CAQA 5M2FX 2PDXA 4YVPA 1YE6A 4FA3A 3C3UA 3R8HA 4LB4A 2FZ8A 4DZ5A 1GVEA 1RALA 2HVNA 3CMFA 3UZXA 2FZ9A 3G1RA 1QWKA 1T41A 1MRQA 3N6QA 4JIIX 1MI3A 5LIUX 4WGHA 1OG6A 3CV7A 2QXWA 3UGRA 4IGSA 3WCZA 2ALRA 4GABA 4LBSA 2IPJA 4LAUA 4I5XA 2IQDA 3U2CA 1VBJA 3H7RA 2PDKA 4JTDA 4YU1A 1UR3M 4JIRA 4PRTA 3H4GA 4YS1A 4XVDA 4DBSA 4GACA 1ADSA 2ACQA 2ISFA 4GQ0A 3RX4A 3EB3A 2F38A 1IHIA 1LWIA 3MB9A 1SM9A 5LIYX 3LN3A 2R24A 4AUBA 1MZRA 2BP1A 2C91A 3Q65A 1ZQ5A 4ASTA 4L1WA 4PMJA 4XO7A 2ACSA 4QX4A 3RX2A 4XAPA 3GHRA 3GHUA 3LEPA 1X96A 4XZLX 4LBRA 1Q5MA 3QKZA 1HQTA 3UG8A 3WBYA 2NVDA 3RX3A 3UP8A 2J8TA 3CAVA 1PZ0A 1XF0A 1S2CA 2IKGA 4HMNA 4JQ4A 1PWLA 2PDBA 3VXGA 1YNPA 2A79A 2PDHA 1QRQA 2PDWA 4PUUA 2F2KA 4QXIA 1A80A 3F7JA 2R9RA 4JTCA 2IPFA 2ACRA 4XZIA 1ZUAX 4YVVA 3EB4A 3KRBA 3ERPA 3FX4A 4DBUA 2PFHA 4XZNX 2DV0A 4JTAA 4XO6A 3EAUA 4ICCX 2IKHA 3GHTA 1X97A 3V36A 3R8GA 3LNMA 3BV7A 4G5DA 1EF3A 1HW6A 1XJBA 2PDIA 2INZA 3R7MA 1K8CA 3UZZA 2PDLA 4HBKA 4H8NA 3UFYA 4YVXA 5C7HA 1M9HA 4GIEA 4ZFCA 3D3FA 3M4HA 4XZMX 3UWEA 4XK2A 3UZWA 3DOPA 2PF8A 3Q67A 4WDTA 5AZ1A 5LIWX 3LENA 1J96A 2I17A 1S1RA 3M64A 4WRHA 3CV6A 1EL3A 2ACUA 2FZBA 1IEIA 4JIHA 3LQGA 2WZMA 4EXBA 1PYFA 1ZGDA 1LQAA 1R38A 5HNUA 2IPWA 3MC5A 4FAMA 5JH1A 3GUGA 2PDQA 1AH0A 2IPGA 3V0UA 4IJRA 3WBXA 4JQ1A 1T40A 3BCJA 3COTA 2IQ0A 4DBWA 2FVLA 2P5NA 2IKIA 2PDMA 2BGQA 3BUVA 2PD9A 5HNTA 3N2TA 2CLPA 3P2VA 4LAZA 3CASA 2INEA 3NTYA 2I16A 2PDUA 4FZIA 3R43A 2FZDA 4QR6A 3O3RA 3V35A 5AZ0A 2DUZA 4PRRA 4WDWA 3T42A 3BURA 3WBWA 4GA8A 4NKCA 4H7CA 4JTRA 4RPQA 4EXAA 3UZYA 4F40A 2HE5A 3ONBA 4XVEA 2PDGA 1PWMA 3DN5A 4LB3A 1JEZA 4Q7BA 4PUWA 3S3GA 2IS7A 1AH3A 1AZ2A 2PDNA 3B3DA 3V0TA 5LIKX 3M0IA 3R94A 4L1XA 1YE4A 2WZTA 5JH2A 4PR4A 2PDPA 2HDJA 2NVCA 1EKOA 2BGSA 2PEVA 3V0SA 2IKJA 5DANA 4XZHA 4GQGA
chains in the Genus database with same CATH superfamily
3A3XA 4DLMA 1QPRA 4AZIA 2ZWYA 1ME7A 4JQ2A 3FK4A 5LXXA 1K1DA 4JCMA 1WDQA 1HL8A 1GOOA 2PC8A 1EC9A 3AHXA 3BLEA 2QCMA 2NXGA 3AJXA 4W93A 1L6WA 4MWAC 3OO2A 3ZR6A 3CH9A 1DPMA 3OZPA 3LB0A 4MJZA 3GIPA 4KEUA 3CL7A 5A2BA 2WB5A 2J77A 1E4LA 3CHEA 4XD3A 1XLMA 3W1MA 4ML4A 4QCFA 3DG6A 3DZ1A 3KCJA 2ZRVA 5D33A 3GVRA 4K36A 3SCVA 1VAHA 4NVTA 1LL7A 2HE8A 3H7VA 3CHCA 5FL1A 5KZDA 4RJEA 2J7DA 2I7GA 3Q2DA 1DP0A 1F8IA 1GOMA 4BJHA 2XPKA 3BCFA 2D22A 2BODX 4RZBA 3NZGA 3AZSA 1ME8A 4AIOA 3VGFA 5I5RA 3MUIA 2V82A 1HL2A 3UA4A 3KTXA 1T41A 5CBIA 1CGUA 4HPJA 2DZTA 2PWVA 5LIUX 1KCXA 4UTIA 3WSUA 5DF0A 3FN9A 4HCHA 5D30A 5TD4A 2BS9A 1DWAM 1LOQA 1B90A 2XH4A 3HIJA 4Y90A 2J7FA 4AZ6A 1WDRA 1AQFA 3SCUA 1MXDA 4UB9A 2BVTA 5A6BA 2ZIDA 3BLKA 4CD6A 1O12A 5FJJA 1REQB 1VCVA 4ECLA 2VHLA 1IGWA 1NM9A 3RMJA 1K7FA 1MO0A 3THAA 3DHUA 2OMAA 3CC1A 3P84A 1NFBA 4HMEA 4C7DA 2JIWA 3ZIZA 2FLIA 3T6CA 3TTEA 4HNUA 1M68A 3GU9A 4MWAA 5AKQA 1JNDA 1OF8A 3IUIA 1EDTA 4E2VA 4AC7C 4AWTA 4M5PA 4R7JA 4ASTA 1JDFA 4I5RA 4C6PA 1OFPA 3RR4A 5JIPA 3EWBX 4IPLA 3H2CA 1JUBA 4LBRA 2E5CA 1J4EA 3MW7A 3PWGA 1TA3B 1A5KC 4O4WA 4AHPA 3C8FA 3VX1A 1XYLA 2G4JA 3BL3A 4M80A 1W3KA 1EIXA 4WHBA 5CSUA 1T96A 3IARA 5GNXA 1WDDA 2V2HA 1MNSA 2GSHA 1KV8A 5DT7A 3TOYA 2WSKA 4QQ3A 4MY9A 5D9OA 1X6UA 1P4CA 1UR4A 4LPCA 4NASA 4NAFA 3I6TA 3I10A 3POHA 4M24A 4N7QA 3EOEA 7PTDA 4B5UA 1IEQA 4IIGA 3CQHA 1JRBA 4AQLA 2H9AA 4AY7A 4KWVA 1DJZA 1SJCA 3L4TA 3AYVA 3ZT5A 3R0UA 1CXFA 3PJXA 2C8NA 2FFCA 3FYPA 1Q63A 2QUVA 1X97A 3SGUA 1VJSA 2WMIA 3HO8A 5I06A 5FF4A 1UHVA 3MS8A 3S2CA 1UMYA 4E2DA 2XVGA 4A8IA 2WXDM 4IMCA 1DVJA 1TPUA 3GC4A 1ZALA 4LCQA 4P7OA 1TRIA 1OIFA 1T7LA 4GG9A 3VNIA 3W7KA 1FKXA 3UZZA 3NQ6A 1TQXA 5CKSA 1WE5A 1XKYA 3QZAA 1EH9A 4XWUA 2ZUMA 6XIAA 1HKIA 5HQEA 8RUCA 2NSOA 3KVJA 3M4HA 1QNRA 3UF9A 3HTWA 2G50A 5C8BB 1EOMA 3OZMA 3W1PA 3AMLA 1VIZA 4MYAA 1XDJA 2I17A 4HOXA 4C60A 2ANUA 1R3WA 4QSHA 2ZDRA 4E4PA 3NQVA 3BWWA 2FB2A 2PUZA 3ZT7A 1W54A 3EX2A 4KFOA 4FAMA 3L0KA 1XBZA 5CLTA 3CH0A 3KBMA 1LLWA 3NQ8A 3COTA 2XH2A 2D20A 4DBWA 4H1ZA 3PZOA 4OFCA 1UZ4A 2V9DA 1AL7A 4DY1A 4TIMA 5I3DA 1ECEA 4RE4A 7REQB 4GI9A 4IQEA 3DH7A 2QCLA 2BZNA 4OGZA 3DFHA 3WF1A 4X2RA 5ABEA 3LHUA 3TMQA 4PUNA 3BLPX 1MZHA 1ZPTA 1ZFJA 4M82A 4MPQA 1XBXA 3PTMA 4IT1A 2YBTA 2GQ8A 1AW5A 3FKRA 4RE0A 3ARQA 1XIJA 1WPCA 1YXCA 3I4EA 3WLRA 4OWGA 3W74A 3MV01 4A8RA 1BWKA 2W67A 3WUBA 2ZRUA 1THFD 4UR7A 3WH7A 1EBHA 3LERA 2RGLA 3L12A 1JRCA 2FHFA 1YHTA 2ZZ5A 4KESA 4XB3A 4GK8A 2VX7A 5D03A 4QTGA 4D6EA 1EJUC 1HP4A 3NJ3A 2NT0A 1XUUA 3CL6A 1PB0A 1UBPC 4H7VA 4YTQA 3DG3A 5CGQA 3S1GA 4GQGA 4S3EA 3BOFA 4NYYA 4UQEA 3NQ7A 1GOWA 5GNZA 2QMJA 4JYFA 1NWUA 1MUCA 4EPKA 2D0GA 3LV6A 1Z3NA 4J7RA 1TWZA 2NV1A 3JU2A 4H6EA 3GDMA 2ABBA 1A50A 1JFXA 1T0OA 4R9XA 3U7BA 1BXNA 4FALA 3C2YA 3E12A 1IZJA 4TX6A 3WDIA 5GJMA 4JX4A 2F61A 3QV8A 4OKDA 5JBDA 5C70A 3UVAA 2QIIA 1OJXA 2TAAA 1MUWA 1AFSA 1OHLA 4TMCA 3UXIA 1L6SA 3VDBA 5FACA 5J5DA 5D04C 2J13A 1POKA 1RD6A 3C56A 2IUZA 3KZSA 4PFHA 1OX5A 1TV3A 2V3FA 3RMEA 1PX4A 4FLQA 2Y5JA 2XIOA 1VFFA 1EWEA 1SJDA 3KOZA 3L5MA 1Q6EA 4GCAA 2ASHA 4D6CA 4QIUA 2YL9A 4WGXA 5I78A 1QTWA 3R8HA 2CZDA 4NYUA 3L5LA 2CESA 2ZYFA 1LRTA 3OOQA 4QISA 2YZ5A 2CNCA 3QOKA 4X22A 5HINA 3UZXA 1MNZA 1VR6A 5TQLA 3TSMA 3MDUA 4GQRA 3V75A 3VIFA 1MI3A 3EX6A 3OP2A 1W5PA 4U3CA 3N1AA 4B5WA 3O0FA 1EUAA 2ALDA 8TIMA 1Z69A 2VFGA 2CZVA 3E02A 3TYZA 1J93A 2JKPA 3LTYA 1H60A 2GWNA 5M1TA 2P3ZA 1OG0A 1LF1A 3BARA 3H2EA 5G2HA 4J3WA 1UD8A 3WIJA 3S2LA 2YDAA 2P76A 2Z1VA 1NARA 1ZU8A 2QULA 1SO4A 5HUOA 1QPNA 4Q8UA 2EGZA 3STGA 4BR1A 2FJKA 3LHVA 3THCA 2HZGA 4L9ZA 2D73A 1K3UA 3S5OA 4GIYA 3CT7A 3GTFA 3N6JA 4H8HA 1XPYA 3WLJA 4MKVA 2A6LA 1QUMA 5FESA 1WOBA 4GUJA 5CPQA 1GK8A 4Q4SA 2G97A 1SFTA 3UG8A 1XDLA 3OVRA 1A47A 2VEMA 3WNPA 1OYAA 2YYUA 3V18A 4HU8A 1J0HA 4P8XA 4NQ1A 3NQEA 3EKGA 3EBVA 5KTLA 1W5MA 4PBFA 2QNEA 1G0CA 1QNPA 4HZMA 3W2KA 2YW4A 3S9YA 3WENA 2C13A 1SO6A 3UCDA 5DO8A 3THDA 4RDWA 3R12A 3IJ9A 3FX4A 3UVIA 3VFCA 3WL1A 4RCXA 4FO4A 1QVBA 3UXAA 3TW7A 2ZUWA 3AHZA 2OELA 4J3TA 3TROA 1CBGA 3O16A 5FF7A 2X40A 4O0KA 5BCAA 1F6KA 3UWZA 1GZJA 2VRKA 3WD1A 4AIUA 4ERGA 2GFTA 3WLPA 3LNMA 3IPWA 4QLKA 1N55A 4LSBA 3W7IA 4BEQA 3M46A 1GORA 4QHRA 2GSJA 2PWHA 2YGYA 4V27A 2BG5A 1K8CA 4ZE4A 5C0QA 2VYOA 4FXRA 1XFCA 5EA9A 5A6SA 4FNUA 4DJFC 2E5DA 2TRSA 4BS0A 3J7HA 3WNKA 2WZHA 3B8WA 1EUNA 4E4UA 2PC4A 1V3IA 4XD6A 3UWEA 5B80A 2R82A 3DOPA 5AHLA 4DJDC 2J66A 3EPMA 5I3KA 3ZR4A 4GKLA 1QBBA 1A3XA 1NQ6A 1XYMA 1A0CA 3T81A 2Y7GA 4P7NA 1TE1A 2VD9A 5EMKA 1KWGA 5A8MA 4EXBA 5A6LA 4XZWA 1LQAA 3NDZA 1TG7A 5LKYA 3O6CA 4LUTA 1FX6A 3TJXA 2Y8KA 4RZ5A 2WWCA 5TBOA 1WDSA 3FAWA 3RLVA 4Q8MA 3N2XA 1AQHA 4IL2A 3MMWA 4BWLC 5TIMA 1JZ4A 4CNUA 1PKMA 1Z42A 1YEYA 4GE8A 4HJFA 5KZEA 2RJGA 1CB7B 4E2BA 2YPIA 2Y24A 3C2OA 4HJWA 1R8LA 3EX1A 4YCOA 1E6PA 1OY0A 1RA5A 2V6AA 1VFTA 4ZE5A 3SJ3A 3UWUA 3NPWA 1TE6A 2WVTA 3GIQA 1SZEA 1G4PA 3T42A 3UWQA 4M6QA 2P50A 1KQYA 1JJKA 3TN6A 3SBFA 2QAFA 4O1AA 5E0CA 3ONBA 1DJNA 3MI3A 3W88A 4HP5A 1KM3A 4KGLA 3SAZA 4S2CA 3PB2A 4TQTA 1F4AA 3MUXA 1GPWA 2O55A 3FYOA 1DYSA 1MQPA 2WCAA 3ZJ7A 2QS8A 3WUGA 1UUMA 3TZFA 3QHMA 3TSBA 2P0IA 2R14A 1YE4A 4HB7A 3TCEA 4LEQA 1JNEA 1PEZA 1SSDA 2Y63A 4DJFA 3G1DA 3C52A 4YWIA 1A5CA 4PMQA 2PEVA 1BPLB 5IRPA 1E40A 3A24A 1F2JA 4PN2A 4IPJA 2Y8UA 5D9NA 3EWCA 2QIWA 1PZ1A 4A8LA 3CUFA 3QC0A 2UY2A 4IXHA 5HA7A 1PPIA 1NP2A 6TAAA 2W66A 3IV3A 3VM7A 2E9BA 2VFEA 4JFSA 1QNSA 4NZ4A 3QY6A 3QKEA 6TIMA 1HG3A 1XBVA 4L5ZA 1X7IA 3SZ8A 4BI7A 3IVTA 4UFKA 4NJJA 2ESCA 3F1QA 5CC3A 3CUHA 3EDEA 1KM2A 3KOFA 2QW5A 1FDZA 4LRSA 2C71A 4BWLA 1ECQA 2D2GA 1AH4A 4EX4A 2DSKA 3ITXA 3VGDA 3WLOA 2ZZ2A 1CYGA 4HSOA 2FB3A 4F0HA 3VNJA 3U4AA 4PBEA 4G8TA 1ZBWA 1DTNA 2HVOA 1J0IA 3TONA 1RQEA 3GYEA 1XIIA 4LU0A 2XWDA 1PUDA 4M8UA 2DQWA 4I6KA 3T4WA 1GG1A 5LHEA 1AG1O 4DNHA 1U5JA 1LCOA 3ZLHA 3FV9A 3W85A 3QXBA 4L7ZA 3CAQA 4UFMA 2SFPA 4FP1A 4PYSA 4Y8FA 3LPFA 3GXDA 1JR1A 3LXBA 1P0EA 2FZ8A 2QCGA 4AWUA 1OK6A 3LDVA 2E1WA 3WMLA 3HV9A 4J4KA 1C92A 1XIDA 2VEPA 3PB0A 4AVFA 2ZOXA 4M0XA 3IJIA 3UY7A 4JFVA 3GKFA 2EJ1A 1GW1A 3W02A 1YDOA 4LY4A 4WZHA 4G1KA 1ISXA 2PGWA 1E5JA 3TZNA 3HPZA 4IMEA 1M7XA 4JTDA 4DM1A 2PWGA 2JKAA 3KX6A 3AS2A 3SCSA 3FY1A 3G8RA 4BF7A 1ADSA 4U5IA 2O9PA 2V5BA 3OBAA 3PM6A 5A6MA 3CV2A 2A3LA 3NQDA 3RX4A 5DY2A 2P8BA 4WKHA 4MNJA 2PTXA 1D8CA 1VBUA 1M04A 1XISA 2BP1A 2RDXA 2EPKX 1TPB1 4RXFA 5BYWA 2REQA 3SB0A 2RAGA 3QZEA 3B8SA 3E9AA 4B16A 1EPXA 3GHUA 3ME3A 4XZLX 3NNTA 1H7PA 3N13A 3LTSA 3T4CA 4US5A 4I7VA 3CIWA 5TF0A 2J8TA 2RDWA 5AY7A 1UZHA 4J28A 1HX0A 1PWLA 1GOIA 4IUGA 3AS0A 1UPMB 1G6CA 2WCSA 4GKTA 1JI2A 3C3NA 1W5NA 4K2SA 4MDPA 3WUFA 3TCSA 3TR9A 1H61A 3R0DA 2ACRA 1MQQA 4D6DA 1JXKA 2GUYA 1G7VA 1EFZA 2DSZA 3HG3A 4OV9A 3NR0A 4UTHA 2OLSA 2WWDA 4LUJA 4OZOA 3UU0A 2BLEA 4K7YA 1GVYA 1H1YA 4XQ6A 1WZLA 2NUWA 2WVVB 4DYKA 1EO5A 5D2TA 4IFKB 2EG6A 2D23A 3E74A 3NDYA 5EGRA 1FWIC 1RXOB 1W6TA 1C7SA 1N2VA 1VRDA 4XTDA 2VFFA 2Y88A 2E40A 2OR2A 1R7AA 1XJBA 3MCMA 1I2PA 1TMHA 4HMDA 1XP3A 4CQ8A 2Z1WA 2GJPA 1UCWA 3MP5A 1ZZMA 3KVMA 5A2AA 4TVUA 3TLLA 1OCQA 4E6MA 2VL4A 2F2HA 4NSBA 3I3DA 5T91A 4KKXA 1ZJHA 4QG9A 1TX0A 2BWGA 1AA1B 4WDTA 1A3WA 5K4ZA 3TQPA 3TX9A 4QAIA 2E28A 5AZ1A 4G7EA 2XFYA 4H9YA 1SFJA 3IGHX 3VINA 1J01A 4L4MA 3RHGA 3ELFA 5AYZA 1E1EA 2V2DA 3WUEA 3AIWA 2JBMA 1LYXA 4KQNA 5HNUA 3S2NA 4DXXA 5F2GA 2J7EA 3HPXA 4GIRA 3DHFA 1P0NA 4KCUA 1EP1A 2QR6A 3AZRA 3RN6A 2UWFA 2A2IA 1VEPA 4HHMA 2XISA 1KM0A 2Z25A 3ZQ9A 1E5NA 4U4MA 3R13A 3U2ZA 3N2TA 4UQBA 2CLPA 3PNUA 2HSAA 3PJUA 2HPMA 2VR4A 2CHOA 5LA2A 3FA3A 3I68A 4GYKA 1KC7A 3N3TA 1MQRA 2VGGA 1W3JA 3O8AA 2I16A 9XIMA 2ABAA 3L67A 4NI8A 3BMWA 2G0WA 3VZZA 3WBEA 4KIRA 3ARVA 1GWJA 4I9MA 1WP6A 4X0NA 3WBWA 1OFEA 3VAVA 3ZOAA 3GG0A 1FWEC 4EXAA 3UZYA 1W8GA 3VI2A 2AL2A 3HMJG 1V6XA 2DT0A 3NG3A 1XYBA 4Q8WA 2BFGA 4N9EA 3WLIA 1SW0A 1UJQA 4NI3A 4MB4A 4C65A 4HA0A 3PFMA 5CSYA 2EPOA 1GZ1A 4OE7A 2CWXA 5REQA 1W9UA 2QV5A 1QT1A 3NQFA 4CEUC 3DYPA 1DIEA 3O07A 5AC5A 3QHOA 3M0KA 4WJXA 1EKOA 3R25A 2XVPA 1NWRA 5A6JA 3F2BA 4V1YA 2UBPC 4IX2A 4OOZA 1RY8A 4LVAA 4DO4A 4E8CA 4JICA 2DIJA 1O1ZA 3MZNA 5C2XA 1RK6A 1HKKA 4TTGA 4IIBA 4Q3MA 4QEEA 3WH8A 2ZZ1A 3DFOA 1UWRA 3BAIA 4IMFA 3N4EA 4GYFA 4O1FA 1NFPA 4FXJA 1OIMA 4IMDA 4RNFA 4FR6A 3RU6A 1XV8A 2NW0A 2Y89A 4QBXA 4GVIA 3ARZA 1Y65A 4MB1A 5LIXX 5D32A 3T7VA 4W9TA 2VENA 3HFTA 5FJUA 3WLNA 2ZZ7A 4YMZA 4POCA 4S3FA 3W87A 1LBFA 1EC7A 2V2CA 2DZVA 1Q7ZA 2PRHA 2QDEA 1VP5A 1UOKA 4DI9A 1DJYA 1HT6A 1LZOA 4HSNA 2OPJA 3DFPA 1DJIA 1YLVA 4UR9A 5J5RA 4EWND 3APYA 2Y1HA 4C6QA 3QN3A 4R53A 1F3TA 4IIEA 1DV7A 1US0A 2PURA 1GKRA 2PDFA 4Y9NA 4KWWA 3MKCA 5BNKA 2YCKX 1S2AA 1S1PA 4LYPA 1LQ2A 3U6WA 3CUZA 3LLDA 1FFRA 1OD8A 3P81A 4W8LA 5DXXA 4F79A 1A5MC 3F4CA 5ABFB 2CZ5A 3EXRA 4TX9A 1HVXA 1IE7C 3S5SA 3GFXA 3BPWA 3F5JA 1PDYA 3JZEA 2XGBA 3NL5A 3N6QA 3S9IA 2VNCA 3QFWA 4WGHA 4S3AA 1VLIA 2YBVA 4IGSA 2E68A 5C9WA 2WJDA 4WSKA 1CIUA 4CD5A 2ALRA 3I6RA 4BY3A 1AQMA 4XAFA 1EF2A 3CYJA 3PZMA 1YBQA 4C6EA 3N14A 3G1VA 4QQUA 4XVDA 3T05A 3CT2A 3E0WA 3UWWA 2D2HA 3N2BA 5H91A 4PFMA 4GY0A 3BLFA 1AVAA 4ZSUA 3WQFA 3LSBA 4KBXA 4CN1A 3C0SA 1CW2A 2QEZA 1ICPA 1MYRA 1H7RA 4NAFB 3S1XA 1ADOA 1QFEA 1YX1A 3A47A 3N2OA 2R1PA 3K1DA 5A69A 4AHQA 1MZRA 1QI2A 3LY0A 4Y9MA 4H6QA 2WKLA 2FMOA 3VGGA 1H50A 3W6LA 5FL0A 2CERA 1YTEA 3GKAA 3BG3A 1C91A 5HWMA 4U5KA 3LLFA 2Z1KA 1ZJIA 2C16A 5JMUA 2OEKA 4IFOA 5GVJA 1PZ0A 4KCVA 1ITQA 4AD1A 1S3TC 3BAYA 3P74A 1V4YA 3GW0A 4YXGA 1UH4A 2WW5A 5B7YA 5DELA 1YNPA 1RSCA 1XWYA 3LM3A 2OXNA 1B3ZA 3EMCA 2OLAA 1YPXA 2J9YA 2QGHA 4DRSA 4NHVA 5BOOA 1PKNA 3RIKA 1VFLA 2V3EA 3OLDA 2WHKA 3MUY1 5FSDC 1H7OA 4AXKA 5I3HA 1JXJA 1QI4A 2DU2A 2DV0A 2X09A 4O12A 3S6OA 4ES4A 4K8EA 2O9TA 3AU2A 4P8WA 1UD3A 2Q3OA 4TO8A 1NEYA 1TPC1 1KBJA 1Y8BA 1Q3NA 3SCOA 3P82A 2E77A 3DUGA 2O4MA 4J3UA 4MJMA 3AIQA 3V36A 3CAKA 4F48A 3QZ6A 4P5UA 3GB6A 4XAGA 3W9ZA 3LBCA 4JIQA 1O5XA 3PVFA 1F5ZA 1SR9A 2I5GA 1V02E 2RDTA 2ZXQA 5BXRA 3MMTA 4J2PA 1G69A 2PLMA 2Z0IA 2XFRA 4IGNA 1BF2A 1EOKA 1IWPA 1XUZA 3PK7A 2PLCA 5MKGA 2OJPA 1G67A 4XK2A 1EWDA 3BICA 3Q67A 3DERA 1PCKA 4FOJA 1UKTA 3VD4A 1E72M 3ZFHA 5LIWX 1OZMA 2YCLA 4OBSA 1BVWA 3K5XA 1OSEA 5BOEA 3QR1A 1WQ5A 4R33A 4FLOA 1AMKA 3GU2A 5ABGA 4JDYA 3S47A 1F61A 1OFDA 4JIEA 1QOPA 3FJ4A 3URQA 2GVYA 6REQA 4D1IA 1PO9A 4LV9A 2OG9A 4WSHA 2EXOA 4M1RA 2YXXA 2WMKA 2MUCA 2XTKA 3SFWA 3BUVA 2X05A 3MMUA 3VVGA 3ZYZA 1F7BA 4C6OA 5HOSA 3ZLFA 3EKZA 4G7FA 3TEVA 4A3YA 2JGYA 3YPIA 2H8ZA 3W1QA 4ZOEA 3WDJA 2V5JA 3BMXA 3KBJA 2BXVA 1FWGC 2ZDSA 2Q3RA 1S5NA 4Z1AA 3APTA 2OKTA 4EF9A 4PRRA 1Q6OA 4WDWA 4GHRA 3OQEA 4BEUA 4BQ2A 4U28A 3QVQA 3THUA 3KTCA 4RPQA 1LJYA 4GLEA 1JULA 1FCVA 4C5ZA 4GI8A 5HATA 4YL2A 3NSNA 3VKKA 3OPSA 1QPQA 3ZWTA 4IL0A 1RHCA 1WCGA 5GQBA 1W1VA 1JEZA 3VU2A 1IXOA 4MMWA 1U33A 5K7JA 3CZEA 1YDVA 4JX5A 3CEPA 3HG2A 2IS7A 4GZJA 4L1GA 1FXPA 1MWOA 4YTTA 1FWSA 5CZJA 4HNOA 4ZO8A 3W1LA 4NJKA 3RLGA 2JFEX 2ZA2A 1BKHA 4MLRA 1P7TA 4NZ1A 3PTQA 1A5LC 2ZFAA 4KEMA 1NH6A 3UCCA 5E5CA 3MQTA 1EJWC 1Z44A 3E5PA 3S5NA 4A35A 1JZ8A 3AIUA 1VCGA 3QY7A 4Y96A 2PTWA 3KXQA 3NQBA 2NV2A 3F4WA 1R46A 3ANVA 1OX6A 1CXLA 3TU9A 1FCQA 2DSVA 4X63A 3W86A 4IHCA 2B31A 3ES8A 4HTBA 5I3FA 3PFRA 4ZL1A 3PBYA 1ZLPA 3LK6A 1AJZA 4PA8A 3L66A 1IXNA 2UY4A 4A22A 3FA5A 1ZSXA 1V5XA 5GJPA 2HS6A 4K38A 1EP3A 1H5VA 3CB3A 2QT3A 1LUCA 4IXXA 4YN5A 4JKLA 5HJLA 1FWFC 3DBNA 3UJFA 1W37A 2XZ7A 1TZ9A 4M29A 1XIMA 1VCFA 3ZVHA 4DBEA 2QCCA 3L4WA 2XSBA 3MUZ1 3WG6A 4UTFA 4NRSA 3VGHA 1DJHA 2YDSA 3GDTA 1ONRA 1G4EA 2A7PA 4V28A 4S3DA 3C3UA 3VOIA 3T09A 3RG6A 2P0OA 3QW3A 1UZ1A 4GX8A 2O9RA 1W2PA 1SVDA 3RCYA 3BAXA 1SZFA 3QGKC 3WQ8A 1XC6A 1U30A 4JNYA 5E0FA 2OZ0A 2BXZA 2WO5A 4AFYA 2X30A 3BW2A 4UFIA 1J8VA 2WV8A 4LAUA 1VFMA 1LWHA 5AVHA 3PUEA 4HHHA 4RPPA 3GWQA 4ZR8A 3BAJA 1I2OA 1P0DA 2G8ZA 3GAYA 5FAGA 3TQVA 2ISFA 1ZAIA 2RJHA 2D3NA 3WKZA 1AQ0A 1CPUA 1B3YA 3U5YA 1XRTA 1NWSA 5LIYX 1V3JA 2F9RA 3TSDA 1NTHA 2DPEA 4NAEB 1GOQA 3ARXA 1ZQ5A 1I8JA 2J78A 4MM1A 1FWBC 3NO1A 3LG3A 4FIRA 1XSIA 1WKFA 1XLLA 2F6XA 1KQZA 2JALA 1ISVA 3PUGA 4DWSB 2WJZA 2INFA 3KFTA 3DYMA 2BMBA 5EMUA 1FQ0A 4O4VA 5A8QA 3EWDA 2VGIA 1S2CA 3M0HA 2BHUA 4JQ4A 2PMQA 3PP7A 4XD5A 1IEWA 4RDVA 3S2JA 4NF7A 4PUUA 1KLYA 3KBWA 4WJEA 3V5OA 3T1GA 2VEIA 3PPGA 2A3HA 3LCFA 5AHMA 1O60A 1GHRA 2QJIA 2VFHA 3BJFA 1M5WA 4NU7A 1R6WA 3GFZA 2IKHA 2QF7A 1BRLB 3WLHA 1Q8JA 3CZGA 1K8ZA 1WKEA 4ZBCA 4B5XA 3ZSTA 4DUOA 3GG7A 3M44A 4W4QA 5M5DA 4CNSA 2JF7A 3ZJ8A 3VA8A 3IIPA 2X0SA 1VENA 4L4PA 1AL8A 3EDKA 1U1HA 1LP6A 1TV8A 3B9DA 3NCOA 5HBFA 2V69A 1XDMA 5FF3A 4HBKA 4MKSA 3W23A 3ABXA 1AW2A 1IR2A 3DFYA 3C86A 4RZ4A 3T78A 3IIVA 3BXWA 5C7HA 2HJPA 1TVNA 5HQMA 3UETA 2OB3A 3M5XA 1V3HA 1ENUA 3MKVA 2GJNA 4ZQCA 3H6OA 4JTTA 1EJSC 4W5ZA 4MZ8A 1TJ0A 2ACUA 1U5HA 1IEIA 3S5YA 3LHYA 4FNRA 4C6NA 1GEHA 3VO0A 2WYSA 2WZMA 3WK2A 3LI1A 4HT3A 2DZAA 2ZXAA 3AMGA 4MY8A 3WBXA 4WK9A 4O13A 4K68A 5FJIA 1K8XA 4DO7A 3II1A 2PLKA 5IHRA 3F2DA 3EEGA 3JR2A 4GVFA 3GVVA 3CZ8A 5KZ6A 1U22A 1V3LA 3N29A 3TTQA 2YFNA 3NTYA 4IQDA 3KWSA 4R5EA 4N6FA 1B1YA 3R43A 2QVHA 8A3HA 1WNOA 3O3RA 5AZ0A 3BLDA 1CB2A 3EXSA 4LC8A 1UA3A 3O9NA 1ZL1A 4LW7A 1DL3A 5EMLA 3U5UA 1BD0A 2OQYA 4ZQOA 1WBJA 4GD0A 9RUBA 1JF6A 2VQUA 2GJRA 3EDFA 2G96A 1KKOA 1RPXA 5BW6A 4EP8C 1OQFA 4UFHA 2BASA 4UOQA 2W79A 4LNCA 1VJZA 3MUCA 2PDNA 2YA1A 4Q4OA 1XQKA 5LIKX 1C7TA 3R94A 4Z2KA 4LAMA 2ZX6A 3VKDA 1KV5A 2Z29A 4UTTC 4JZ5A 2GJLA 1D3HA 3UERA 3WQ6A 1JUKA 2X42A 3MTWA 3W75A 1ICSA 4N9CA 1V0LA 3DU0A 2C14A 1V6YA 4DQWA 1XCWA 3VIPA 1JYWA 1B54A 4XAYA 4E0CA 1BLIA 1CLVA 4MLJA 3STEA 2YCIX 3REQA 2QVNA 2VCBA 1SJAA 3T40A 4GZIA 4PGLA 3OLEA 4YCPA 4EVZA 1A4LA 4GI6A 1E9YB 4W7VA 1HIZA 2BOFX 1LORA 1GQLA 3W71A 4YHEA 4R7OA 3S4TA 3W73A 1MEWA 1XH2A 3O6AA 4L56A 4BA0A 3GE7A 3HF3A 2VGFA 3HA1A 3FKKA 3HGRA 4DZIA 1J0YA 1Q8AA 1TV7A 5CC5A 4IF2A 3QM3A 3ANUA 1UH3A 1BXCA 2ATMA 1CI1A 3CO4A 1X98A 1H3GA 2HEJA 1O6IA 2X0HA 4N6EA 3XIMA 3ONCA 3ITYA 4BZYA 4P8UA 4XAZA 3WQ4A 3I65A 4ZXOA 2WVUA 4BK9A 4R34A 4RW3A 2Y62A 2QPUA 1NF0A 3HBLA 3KBVA 3UR8A 2YB4A 4HPNA 2O7QA 2NQLA 3LTPA 4AZ7A 4DELA 1E56A 2FZ9A 2Y7FA 1F07A 5D2YA 4R27A 1GTHA 2YDRA 2E9MA 3L2LA 2ZXBA 2W4XA 5HMSA 4UTTA 3UR5A 3GDBA 2GVJA 5CPMA 1VHCA 2ZX7A 2B4GA 1ZRQA 5A3HA 4LUSB 2XINA 1K9TA 2O7SA 2F6KA 3W1XA 1OF6A 4U31A 2XM2A 2ACQA 2J6XA 3CO8A 1J6PA 5DMYA 1GQNA 3VZXA 2OZ8A 4IG2A 3NZPA 4RKAA 4W88A 3LHWA 4HQVA 4M7TA 4XISA 1G01A 1WKYA 2DH3A 3JS3A 2DIKA 4AD4A 3GLCA 4F0MA 3BW4A 5D2WA 1GJUA 4PMJA 3SCNA 4REQA 3G1XA 5FIPA 5A1AA 2HQAA 3TFCA 1M6JA 3A4AA 4ENLA 3DKLA 1MFUA 4B92A 2X1UA 4LQ1A 5J04A 2C7FA 2ZBTA 1DIDA 1JQXA 4S3GA 1W5QA 1OYCA 2ICSA 3TN4A 2OZ3A 1JCMP 1KM1A 1BYDA 3EOOA 4PUMA 3VXGA 1HUVA 2PSNA 2OX1A 4H4IA 1XH1A 3MVTA 4IH3A 4DJED 1KGXA 2FDMA 2PDWA 3VNKA 4ZEPA 1OX4A 1JDDA 2WC4A 4OJYA 4FR1A 3FLUA 2A3AA 3UY8A 1UYQA 4KIEA 1GT8A 1WZMA 1KXVA 4O17A 1GVIA 3D46A 4G7EB 3B0PA 2PFHA 2W5FA 3LM7A 2Q8ZA 4IOTA 1XYCA 4YTRA 1IWAA 1MXGA 1ML1A 2HMCA 4KRZA 1UUQA 2W3ZA 4UNLA 5E09A 3EWYA 2PP3A 1F4HA 3W7GA 3MBDA 3AI0A 4HPXA 4NL1A 1RP8A 4L9XA 1NFGA 5CQ1A 3LMYA 4W7WA 5DBUA 3A23A 4Y2WA 4WIWA 1JZ5A 4G6CA 1FWRA 3L68A 1KWKA 4BI5A 1SMAA 3E96A 3UZJA 1DWGM 3QSTA 2PDLA 2X7VA 3ARRA 5HWJA 5CPTA 2WJFA 1VBGA 1XI3A 1MUMA 1UJPA 1CX9A 3A9BA 2VR5A 3T2PA 3W2JA 3EA2A 3RPDA 1HNYA 1OFQA 4GYPC 4AD5A 1VPXA 2J9XA 4UC5A 3JW7A 2OTDA 3CV6A 4I6VA 4KETA 1A5BA 4JIHA 3W6MA 5C55A 4C6JA 1AJ2A 1JPMA 3C2RA 4MJ2A 4Q7NA 4ZOAA 3CMGA 2X41A 2V0TA 5D2VA 1J2BA 4LS1A 4F2BA 5DFAA 3QMRA 3IUDA 3GH4A 4AVOA 4AC1X 3STCA 4FXFA 4IX0A 3RLUA 4D8ZA 3FSTA 3IAPA 3ABRA 3GO2A 4Q7IA 1B3WA 4LRTA 4C90A 3ZJ6A 5CC7A 3GR7A 3VD9A 2Q8XA 4HGXA 3C0JA 3EWUA 3AXKA 4QG8A 1TIMA 3HQ1A 4XTIA 3NM1A 3E0FA 1TJPA 1LLOA 2BVDA 1TCMA 1JCNA 4G1NA 1S2TA 4Q8TA 1K7EA 1E6RA 4FXSA 4C6BA 1LROA 1XLEA 4B9YA 1BAGA 3E2SA 4H04A 3B97A 2FH8A 5KSWA 3MSYA 3VD7A 4ACZA 4HHLA 3A5FA 5F1UA 1XLIA 2NUYA 5KITA 3TVAA 2OWCA 4ZFMA 2EPMX 4Y8EA 3W7NA 1EPVA 3MMDA 3M0IA 4CLMA 3MI6A 2R1KA 5JH2A 4AD3A 3QLLA 2HDJA 3IJ7A 5EU9A 4TV6A 4O11A 4KWUA 3RF9A 4Z2IA 6A3HA 1SFLA 3CGTA 1EBGA 2IKJA 4UMBA 2GWGA 2KAUC 3FW6A 4JR5A 1FP8A 2YX0A 2TYSA 1SQ7A 5CZ0A 3PAJA 4MSSA 4X0VA 2HCVA 3LUTA 2G4FA 3IJ8A 2PU0A 3L0NA 1RLCL 3QR0A 2G3NA 1JF5A 2JEPA 1SGJA 2QCDA 3WDPP 2IW0A 4ROQA 1KFCA 3W53A 1WDWA 1C9WA 1E4NA 2OKOA 4XKMA 5CGMA 3N04A 2PB1A 3A4WA 3WNNA 3QRHA 1SSGA 4HOZA 1TPH1 1J10A 2VDGA 3ITOA 2VD8A 1F76A 4LUYA 5D9PA 3W1RA 4PH6A 3HMCA 1PZ3A 2BY2A 3IGXA 3RU8X 4AY8A 1M7OA 4JNMA 4JGDA 5CZSA 3RDKA 1NDVA 1HF6A 2OGYA 3OEXA 4LYQA 3HU7A 2XSXA 1YNQA 4B5TA 1M1BA 2FVMA 2WMGA 3MCOA 1CENA 3KEHA 1Q13A 2OYKA 4O54A 1VRXA 4DEFA 3EPOA 4JEJA 1WZAA 4FOUA 4H9TA 1C29A 1K9FA 1KFLA 3B9AA 5AYIA 1UIPA 1EXPA 1FWDC 2OEJA 1PTGA 2BVYA 1RAKA 3C0QA 1LRNA 1XQLA 2J7GA 1GVEA 1WAUA 1RALA 4QSFA 3WD2A 2C15A 1O95A 4LC6A 1X8CA 4EKJA 3S1VA 4U2ZA 4WXZA 1EJXC 1I0BA 4PE8A 3RPTA 3LGEA 4WCJA 3ES7A 4KFNA 3HJZA 1ITUA 3WL0A 3F03K 3KLKA 4L9YA 3NFUA 3DFSA 4QGCA 2IQDA 3U2CA 2W9MA 4ERAA 5BROA 4YU1A 4Q8VA 3ZT6A 1RBOB 4UOJA 4YS1A 2ZA1A 3G6MA 4IM4A 4Q4RA 3SRHA 5LGZA 4DBSA 3N9KA 3OTRA 4L65A 3GXMA 1KRCC 3E2RA 4K8HA 1PL9A 1Y0EA 4XSMA 7ODCA 1U1JA 5FCZA 3BGAA 4ZB2A 1TWSA 3NYDA 4PMOA 4LAKA 1KB3A 1MW3A 3NQ2A 2G95A 4R3UA 2R24A 2DDXA 3H70A 4IPPA 4JTUA 4JTJA 3RK8A 3HZ3A 3VDCA 5ECUA 3UJSA 1FWJC 4UMAA 4LS2A 1JDEA 5BRPA 1SZRA 2Y6ZA 4U10A 3VDHA 3SQSA 1QJWA 3GR8A 1Y7VA 5ABHA 2NV9A 1RBAA 4PB5A 1J2WA 3M07A 4ONVA 3MPGA 1Q7QA 3O63A 4IQJA 2PCEA 2PTYA 1FWNA 4H2CA 3GD6A 1CWYA 1JFHA 2PDBA 1W1ZA 2FDSA 1TUFA 3OVGA 5T8GA 3BC9A 5EPDA 4GZ7A 2ZRYA 1CGTA 6CGTA 1YW1A 1CEOA 2DVXA 3FNDA 2DH2A 1JYNA 5A6TC 4G56A 3TXVA 1X7FA 3QGVA 3A21A 1E9IA 3E0LA 2RH9A 4D6GA 2PBOA 4HA1A 1TIWA 4NJGA 3MYPA 3UJRA 3KBSA 5FF0A 3URAA 3K4AA 4E38A 7ENLA 3M9YA 4B5NA 5EMYA 3GHTA 2WPGA 3WEZA 3MI2A 4ZQPA 2DW6A 4GJ1A 3SI9A 4XUYA 2WMFA 1VFUA 3GVQA 2WMHA 3OLGA 1RJRA 1TPWA 4CU6A 4FX8A 4AMCA 1AUSL 4UNIA 2GVLA 4QJ1A 4IIHA 2C3ZA 2RKXA 4Q4KA 2C1HA 3LA4A 2VFDA 1R9ZA 3TR2A 2POZA 4H9XA 1PBGA 1R0MA 1KBLA 2IQTA 2VO5A 2XGIA 4DB7A 1RA0A 3GXTA 1NP0A 4JY8A 3EEZA 1PE1A 4IIFA 3QFEA 1TPVA 4GIEA 1HFBA 3BQ6A 1H7NA 3VGEA 1RVGA 3UW6A 4BQ3A 1G7UA 1HGYA 4OQVA 2P10A 2X2GA 3TE9A 3W38A 1FOBA 3ORWA 3PZVA 3NDOA 3W7RA 2QCHA 3M47A 3WD4A 5AC4A 1S39A 1PYFA 2Y85A 4O1DA 1HTIA 2YW3A 1FDYA 3ABSA 4EANA 1RK5A 1ITXA 1C93A 3LCIA 2CBUA 1T40A 3WLSA 4FF7A 3RAOA 3VC6A 5I03A 2CXGA 3W00A 4E8DA 1KM5A 4R7WA 2XIJA 3HOJA 2BTMA 3KL5A 3ZM8A 2E1DA 2NXHA 2CYGA 1BWVA 2CKRA 4RE3A 3R10A 3VNLA 2XH7A 2PDUA 5AB3A 3VILA 4QJ3B 4QR6A 2DT3A 5FEWA 3V35A 4J3VA 4IP5A 4F4RA 1QO5A 5SWUA 4QITA 2DJXA 2JIEA 3BTNA 2A0NA 4E4FA 5DXYA 2Z2UA 2CEQA 5F2IA 5A6BD 1C90A 1TTPA 2VC7A 4XVEA 4CQAA 1C8XA 1PWMA 1R30A 2W91A 3FXYA 2HISA 1H49A 4O52A 5CC6A 4ZOCA 3M0VA 3GBEA 4JIPA 1KFWA 1SW7A 2ZE3A 3BSHA 4JXCA 3V0TA 2AMGA 3CV1A 3PJWA 2DSWA 1H41A 2ZICA 1K03A 1FFQA 1W17A 1Q4NX 3BO9A 3LRKA 1T6MA 2VZTA 1MDRA 4NP7A 2BGSA 2TSYA 1EEPA 1JDAA 3RM8A 4JS3A 3ZVHB 5E6ZA 3CMJA 1AZ1A 2BGNE 2VVNA 4F66A 4ZB5A 5H8UA 2DZPA 1W1TA 3CUJA 4BKNA 3VD5A 1WXYA 3GHSA 3UR7A 1GHSA 2QJJA 1LTDA 1DQUA 3SFKA 3P5YA 7TAAA 4XSLA 2J4GA 3DDMA 1EX5A 1GVOA 5EBAA 3NXLA 1K02A 2E25A 3QJAA 1XKJA 2A6NA 3V5FA 1QPKA 1UKPA 3WEOA 3AHVA 2X0YA 4B3ZA 2DUXA 1KTBA 4QLLA 3HGJA 4UTUA 1P48A 4S3CA 4JTGA 2E7FA 2J8FA 2OQHA 2IXUA 4IFRA 1H63A 1GPFA 3DIPA 4JFTA 1KTNA 1KXHA 3P61A 1OABA 4LYKA 5BWFA 3W7MA 4D72A 4IZGA 3DG7A 1ODUA 3SSJA 4GCXA 4LTSA 1SPQA 4MB3A 2PE4A 2YYTA 4Y9PA 2VZUA 2Y5EA 2NQJA 1Z6KA 3GXFA 2XG9A 2J27A 4ZA0A 2ZCGA 3WLKX 1HKMA 4CVWA 4Q8OA 2D2OA 2GK1B 2QJGA 5M3WA 2PWDA 4IMAA 3EOSA 1Q6QA 1OGBA 2J9ZA 1XIBA 5CCZA 3CZJA 4TMBA 3LI0A 1BYCA 2HVNA 3CMFA 1SFSA 2ZE0A 3G1RA 3ATYA 1JUEA 4AX7A 5LYRA 3WLLA 3WJYA 3D47A 3H2NA 3SCPA 1H2JA 3PG8A 1DXEA 1L8NA 1XLKA 4DF0A 2MANA 4WVXA 4IPNB 2X1SA 1XW8A 1QCWA 3NSXA 7REQA 1WOAA 1UQYA 4XV0A 1F3EA 3VCNA 5CEWA 1J0KA 2D24A 2OT1A 1IF2A 3PHAA 5BU6A 4S39A 3USZA 1XXXA 4N2YA 4GC3A 2FZNA 2D0FA 3VCCA 1R2RA 4C6MA 3PPHA 3S1UA 3RM9A 1UB3A 2Y2WA 2H3DA 4LALA 4LX4A 3M16A 3CUGA 2J7BA 5E0KA 3ARSA 3A6OA 3MB9A 3P8JA 3AXXA 3RGTA 3CK5A 3VIGA 1EA0A 4AUBA 3F4DA 3Q65A 3QV6A 3B06A 3OIHA 3PTDA 2QJHA 3DC8A 3QV9A 4AEFA 5F1VA 3N18A 2ZVIA 4HA4A 3OZOA 2E8YA 2XHYA 2ZKMX 1D9EA 1ZS2A 5D8ZA 4K6AA 1KM6A 2WNNA 1NELA 1K6WA 3PAOA 4HYVA 1FA2A 3C0LA 1RD5A 1XLDA 4QE4A 4PTXA 1HKVA 1TPEA 3SN4A 2LLEA 1WYIA 5K2ZA 3RITA 2V3GA 2ISWA 3TC6A 4HU0A 3F5KA 1A80A 1IR1A 2NWRA 3NGJA 1EHNA 1ZUAX 3PBGA 3VKCA 5C9ZA 2F8QA 2QUTA 3MV11 4M19A 2B7QA 1DEDA 1W1YA 2V5KA 3ERPA 4DBUA 1IZCA 1E0TA 4CNTA 3MANA 3OGSA 2WANA 2W62A 3H2MA 2EEXA 4L64A 6ENLA 3KW3A 4LJ3A 1OC6A 4GY1A 1XSJA 2J74A 1M7PA 4A3QA 1A5AA 1UASA 1F6PA 4HK7A 1ODZA 4NY2A 1B3OA 4ZTXA 1HW6A 4HNCA 4HCDA 1KLZA 7TIMA 3SQLA 3NQGA 4D8LA 1OINA 2PDIA 4MADA 3N11A 3FCPA 1E43A 4EAMA 1J0JA 2Z00A 4FX7A 3GYCA 5K9XA 3GNDA 2J6VA 3MWCA 4TUFA 4DWDA 1TV4A 4HKPA 4H6KA 4PTDA 1I45A 3T9PA 2Z4GA 1M9HA 1D7KA 1O1HA 1CXEA 1KM4A 3T0BA 2NWSA 5CSRA 4MF4A 5FAJA 1BTMA 5FKYA 3P0WA 1HO1A 4FF5A 2XJ7A 4CD8A 1E0WA 2RFGA 4D6HA 3W24A 3UT0A 3PC0A 2DZUA 1B9ZA 1M41A 3M5VA 1B4EA 2ZZ3A 3GUGA 3D6NA 3GNOA 3ITCA 4IJRA 2Z28A 3VIHA 2QCFA 4UTWC 3W7LA 2IKIA 5TAOA 4FSAA 1AD1A 1GJWA 4E2OA 3V3WA 5E70A 5HNTA 3TYEA 5HPCA 4H2HA 4IICA 1I75A 1NQKA 1RH9A 3AMDA 3WELA 1PHQA 1CTNA 3PSVA 4XG1A 4KRTA 4GJIA 3FIGA 5JQ9A 4J35A 4HIBA 2WZEA 3TYAA 1XLBA 1XRSA 2C79A 1E51A 1GVQA 1E0XA 3B8UA 4Z1YA 4KERA 2XIIA 3K46A 3H8AA 3WH9A 3S46A 4MUZA 1X1OA 3VMOA 3VD3A 2EG8A 2XIMA 3HM7A 4S3JA 2NX9A 2FPVA 2Y8VA 4K39A 2EPHA 1YYAA 4ZQRA 2JKEA 1O94A 2CXEA 1YDNA 3GTIA 2DIEA 4TXEA 3B0XA 4HCLA 3A4JA 2GQAA 5HJYA 4FOKA 1LLZA 1XGZA 3LPGA 1S2VA 1S5VA 3WJWA 3SUUA 1TZZA 4MOZA 3OLIA 3TA9A 1UBSA 2A1YA 5DRIA 4LS0A 4NX5A 1HJVA 2YIHA 1PZ2A 3TYDA 1NWTA 1F05A 4WEVX 3LRLA 1R9YA 2OQLA 3VNDA 5BXPA 2WM0A 1KFEA 1P1XA 1EXBA 3GTNA 3VNYA 2E9LA 3OW1A 4C1NB 4HZ7A 2I1OA 5CJMA 2FGBA 2VR2A 1DTUA 5I23A 4UUIA 2VZOA 2E4TA 3TH6A 3TAOA 1J5TA 4GJJA 2CLMA 3W81A 4TTUA 4E8GA 1IXQA 4O8AA 3GAKA 4AWEA 4HK6A 3VMNA 1GOXA 3TJLA 4NRRA 2W0UA 4WY0A 3N9RA 2Y7DA 2VX6A 3Q94A 1XC4A 2VDHA 3SN0A 5U7SA 4MNLA 4IJCA 4FEZA 3M7SA 4A3RA 5AHEA 1GG0A 2J75A 3FEMA 1GNXA 2J88A 3PZUA 4N9BA 4MHBA 4AX6A 5I0DA 3QHNA 1E3ZA 4KWSA 2WZIA 4AZCB 1VEOA 1VJIA 4DWSD 1VC4A 1EZ2A 1M53A 4RDYA 1XGDA 3GM8A 2DUAA 3ZLGA 1US3A 3M6DA 3R6IA 2NLIA 3KP1A 1KA9F 2VJXA 4HD5A 5FOOA 1H0IA 4FNTA 3W2LA 4AWSA 1R85A 1K4GA 4LB4A 4JFUA 4MFEA 1EGZA 5DMMA 2UZ9A 3WMBA 2WLYA 1XYZA 2JQXA 4NNAA 4ADSA 1I4NA 2H90A 4AF0B 3LPOA 4RW5A 1MW0A 1RJQA 1TR9A 1V93A 7XIMA 3BG5A 4H8VA 3E6EA 1A4MA 2PI6A 2TMDA 3DAQA 3NQAA 1PTAA 1US2A 1A5SA 2NZLA 5AYXA 4M6VA 1ZJAA 4UXDA 4XKYB 1Q6FA 1E3XA 1ITCA 3VNZA 1WXJA 4X9YA 2Z7GA 3DFNA 2OVLA 4P61A 3CHVA 4JTSA 1F6YA 1XHGA 1ZCOA 3M0JA 2Y0FA 1FXQA 2PU1A 2F84A 4MUPA 2OO0A 4OIFA 3B9EA 2ZRZA 1W9DM 1OCJA 1RVKA 1GYLA 4LT9A 2NSXA 5HDRA 2AQVA 3TQ0A 2YL6A 4RK8A 4DF2A 1PJ9A 2NX1A 2QDDA 3PBMA 4GQQA 2GJXA 1WX0A 4CNPA 4PCSA 1FP9A 3K4WA 3WLTA 2OT0A 2X1RA 3NPVA 3RX2A 3VC5A 1X96A 5KZMA 2YA0A 3ARPA 3H2AA 3O06A 3GQYA 1VZWA 1XIFA 1BKSA 1P43A 3WMCA 1TYGA 1KW1A 3CAVA 2PA6A 4Q8NA 1XLJA 2VELA 1BGAA 3O7UA 3E3HA 2VFIA 5HR7A 2J7HA 3ITVA 4I7WA 3FJ6A 4KFPA 1EQPA 2GLKA 3NPUA 2R8WA 3LCXA 1S2UA 4CQ9A 4EK7A 1FCUA 4I5UA 3WQPA 1U83A 3W29A 2R9RA 3AXIA 2BDQA 2W6RA 4GGBA 4YVVA 3R0KA 4PSRA 5BWAA 3KRBA 2YCJA 3M41A 1BFNA 1B3VA 2AQWA 2VC5A 2JE8A 3VNMA 2WQPA 5DQPA 1K9DA 1E4MM 2DZSA 1LQ0A 1OD0A 3EAUA 1TMQA 5A8NA 4ERIA 3SRDA 4UR8A 2Z27A 5TNVA 3A3HA 1W9XA 5A8GA 5BRQA 5E6YA 3R8RA 1B0IA 5JVLA 1QOQA 4O10A 1T8QA 3BCDA 2FTWA 4NX0A 4OUEA 4PTVA 3LMZA 3DKJA 4QROA 2CLOA 1KNWA 4AU0A 1E4IA 2I9EA 2FIQA 1LOSA 5BMXA 2DT2A 3LU2A 1E0VA 4AMAA 1AK5A 4PB4A 5EY5A 4H9UA 3HG4A 1JGIA 1X1ZA 5LGXA 1Q6DA 1V7AA 2XUCA 4X2PA 5BXSA 2DZBA 3AXHA 4DJDA 5BRBA 2WBGA 2Z1XA 3C2EA 3LENA 3BLLA 1DWJM 4DO6A 3URNA 2PZ0A 3T08A 4MZ1A 4ZO7A 4JTFA 4UMCA 3LCWA 3OA5A 1L9WA 3W4RA 1D8WA 3GH7A 3S42A 1OCNA 1FKWA 3MSDA 3E0VA 1GYNA 2V8ZA 5JH1A 2HVMA 1AH0A 3HB9A 1VYPX 4LFYA 1DOSA 4K37A 3GSMA 1W3NA 2DZXA 4FMVA 1Q66A 1CGWA 3AALA 1JYXA 1JD9A 3FGCA 3W7JA 3UGVA 2YOCA 4TR9A 4FB7A 4L6DA 3UPBA 1BTCA 3P67A 4W7UA 1J18A 3S0CA 4M81A 3G3DA 4IP4A 2J47A 1RCXB 4CU7A 3DYOA 4DAIA 1RJPA 5DLCA 2ATSA 2CLFA 5C9XA 4GI4A 2CHNA 1R2SA 4PZVA 4CQDA 2XU2A 1M65A 2R6OA 4UNKA 3PPFA 3VIIA 1N8IA 2E6AA 2GDUA 1R3RA 3DN5A 3VOJA 4LB3A 4FHAA 1I2RA 3AC0A 3UYCA 4S23A 4HK5A 4GRSA 4ORIA 1E1CB 2R1NA 3S3GA 4TVCA 3W2MA 3K30A 3UWVA 2CZEA 2VUNA 4JHZA 4PR4A 1DORA 5CZTA 3MUAA 3VDGA 3NURA 4GFSA 3C4UA 4TX8A 4EWJA 2C18A 3WQCA 3VZYA 5JBEA 3DGRA 1RQBA 3HN3A 3K1GA 3WQOA 5AC6A 1I1XA 5HQLA 3R58A 4GIAA 4BQ5A 1RCOB 3QY8A 2X1IA 1R3VA 3CQJA 3UNDA 4US5D 2PDYA 2BVWA 2WVVA 4OTKA 2WHLA 3OGRA 4UCGA 3DHPA 2J62A 3L2IA 1MW2A 3BK0A 3IK4A 4HU3A 4RV8A 5D05A 4J3SA 1KGUA 4C6IA 3ITGA 2VP8A 1LRQA 4JQAA 3PZNA 2RDUA 5GJNA 4UQCA 1LG2A 3MKKA 2X1TA 4XBKA 1PAMA 4F3HA 5CG7A 4GUFA 1Z89A 3KOXA 4BCEA 5LNSA 1KBIA 4LV4A 5HMEA 3LBOA 5MHBA 3C6CA 2E6YA 2E09A 5K9CA 3S2MA 4AH7A 2P88A 4CN4A 1LT8A 1P0KA 5DY3A 2WVSA 4Z08A 3FYYA 2BOEX 3LZ5A 4LVDA 1BG4A 1ONEA 2Z1SA 2QUMA 2CU0A 1D7FA 1A3HA 4ILSA 4KF1A 3BQ5A 1NSJA 4ZODA 5BMWA 5I3GA 1XG3A 1CT5A 1CXHA 3R4IA 1K7XA 1QPOA 3HJEA 4GGHA 1XCXA 1V6UA 4DPQA 2J25A 3C61A 4LVBA 1E6SM 4ZQNA 3INPA 3DENA 1WKDA 2ZZ6A 3A13A 3QQWA 4NZ3A 4QS6A 2AAMA 1V6TA 4IIDA 1TREA 4M6PA 3OGVA 4ZB0A 3UR2A 3CTTA 5H1WA 1BVNP 4JIRA 3EWZA 2BBFA 4IWWA 1R2TA 4K1WA 2BX7A 4I8DA 1BEUA 4GACA 5F2MA 3FS2A 4NXSA 4AZ5A 3APGA 7A3HA 3HV8A 4PCTA 1QNQA 3EB3A 2CC0A 2IMRA 4DZAA 4ADUA 3S5ZA 5I24A 4GC4A 2EBNA 3W1NA 3KCOA 3TWBA 3QF0A 3RJYA 5DT5A 1FWAC 2C91A 4ADTA 3TTOA 4CQCA 4G9PA 3WJXA 1DWFM 2B81A 3KRSA 3I4KA 3FJLA 1WDPA 2O56A 3FAXA 3CYVA 1BVZA 1UH2A 2E8ZA 1KRAC 1R7OA 4XBJA 1O5QA 1BQGA 4O57A 4NXKA 3WDQA 3WBYA 2NVDA 1E6ZA 4GISA 1F3XA 1XLHA 2VM8A 4Y6GA 1FCBA 5E9XA 3CHDA 4G2DA 2EPLX 4CN6A 2QKFA 3GX9A 3EB2A 5I77A 3LNPA 4QXIA 1J11A 2A7RA 3W6YA 3PNZA 3PBUA 5AYBA 1TWIA 2HRWA 3WBAA 2BNJA 2Z2BA 3RUBL 2H6RA 2XIQA 1TO3A 3UA3A 1XG4A 1J0ZA 2V30A 3GTHA 1UWSA 2WC3A 3MHGA 4MAVA 4ICCX 3NXFA 4AG0A 3L4ZA 4OUIA 2O92A 2ZA3A 1XICA 1X6NA 1IQ8A 3WN6A 2YXGA 1WUFA 4DVOA 3L4XA 3IRDA 3FOKA 1FHVA 1B2YA 5CXPA 2G5WA 3NZQA 1X39A 4RNIA 3KZPA 3KS5A 4IP7A 5EFDA 4N4PA 4LOCA 4FLSA 1V51A 4O18A 4H6RA 4AYGA 1YXDA 4GUHA 3D3FA 3G18A 4QG6A 4L6OA 1IWBA 4A2RA 1QW7A 2PF8A 1R3QA 1LBLA 5ABFA 3G1YA 1HN1A 3W76A 1HP5A 3Q45A 3SECA 3WQDA 3S8HA 1EDQA 1V8EA 1EL3A 3CQKA 2FZBA 1GOKA 2P1FA 3AHTA 3D0CA 1JPDX 3GXNA 1P6CA 2CPUA 2VCAA 1TMLA 3U57A 1OGGA 1ISYA 2EAWA 1JZ7A 5T9BG 4UTJA 4PMNA 2G41A 2XFWA 4QFUA 2A3BA 1LM1A 5HAOA 4JBRA 1EEXA 4LXFA 3S83A 1LBMA 3L21A 1OYBA 1J12A 2GQ3A 4LAZA 1E6QM 5F4WA 1JAKA 3FSUA 4HA3A 4LF2A 1W56A 3N2MA 4MVAA 3OVQA 4Q32A 1QAPA 4GNVA 3R1ZA 2FZDA 4US6A 3TLQA 2D0HA 2VC9A 3FHAA 4Y9AA 1D2KA 1JD7A 4EOUA 3BURA 1GTEA 3GC2A 4HYWA 4H7CA 3VIOA 3CJPA 2HE5A 4D6JA 5C71A 1I9CB 4P8VA 1O5RA 3PZTA 4MWAB 3PR2A 3F4NA 2V67A 1ZBCA 5JUVA 2YCEA 3G24A 4PUWA 1EC8A 2V5CA 4GBUA 3CBWA 1V0MA 4HPGA 5XIMA 1YPIA 3HQNA 1JYVA 2GDQA 3R89A 3WF0A 4O15A 1WV2A 2Y70A 3CS2A 1FTXA 3BMVA 1I2NA 1Y5XA 2YJQA 4PCFA 3HQOA 5DANA 1QI0A 2B7NA 4PMZA 2DORA 2YXOA 3TK7A 4M1BA 3NM3A 4OOUA 3HURA 2ZTJA 5G2IA 3LBMA 3UXKA 3BGJA 2VEGA 4U33A 2YLAA 3A22A 2WSPA 2PRMA 4D8AA 3M5ZA 1OB0A 3UESA 1IXPA 3L2MA 3KDNA 4X61A 4RNJA 3WF4A 1V3MA 3DI1A 4ZSTA 5ECVA 3PPCA 1SO3A 3IJLA 3RPMA 3AOFA 1UD6A 3ARWA 3LXAA 3LCGA 3AYSA 3F5LA 3UCQA 3W3OA 4M56A 2H9AB 5FJTA 2QJMA 1QDSA 4UQ9A 4GOAA 1OBAA 3EWXA 1E9ZB 4EE9A 1AD4A 1GW9A 2QDGA 4PBGA 2WMIB 4UQAA 3N17A 1O5KA 3AICA 3EOUA 3G5EA 3PG9A 3EMZA 4JTQA 2CBVA 4LBUA 3NL2A 4AZBA 3DBPA 5CAKA 3TFXA 3TYCA 5AN7A 4CCDA 4O53A 3KAOA 1M7JA 5G4WA 2NVAA 1FWTA 5JXQA 4AVNA 4C6KA 2D69A 3HG5A 2OYMA 2AGKA 5U4NA 2ONEA 2X8RA 2R94A 1T5AA 3LCHA 1Q7MA 3DESA 1LT7A 1ESWA 2WHMA 1MW1A 1VKFA 3JUGA 3QPYA 2V68A 4W85A 4JIIX 1XYAA 1FHDA 4W87A 2YL8A 3EMQA 3EOLA 3O2LA 4CKQA 1KO0A 4O0QA 1NAL1 3GW3A 4PMDA 5BOFA 1KXQA 3W70A 4Z1DA 1T8XA 4MGGA 2WNZA 3IGSA 4LF1A 4RR4A 1KFJA 1VLWA 4YIWA 4JD4A 2FJUB 3B03A 2C6QA 4UTLA 3KE0A 4HN8A 3Q4DA 1TRDA 3MJMA 3OIXA 3O15A 1Q6CA 3MBFA 2OWWA 4KS0A 1TTQA 4HNTA 3PBWA 4ATLA 3M6YA 3W7EA 2PWUA 2NLYA 3N9SA 5EBUA 8XIMA 4MPKA 3ZZ1A 1E6NA 4AIEA 5IFTA 1R87A 1FH7A 1UWTA 1LL4A 2HS8A 4PL2A 5M03A 3W27A 2OODA 3E2VA 3S6TA 2Z7KA 3WQVA 4NZFA 1OM0A 3RYSA 4XIMA 4I8YA 1PDZA 1HQTA 4PUDA 2Z2AA 3RX3A 3LV5A 1VBRA 4C6LA 2QUNA 4C6DA 3AZTA 2ZUUA 1BQCA 2QLYA 3KWXA 3NUKA 5I00A 3V7PA 1MDLA 3WQ5A 5CPSA 4M3PA 1VF8A 5IOBA 3SADA 3NVTA 3QC3A 1J79A 4I9JA 3BE7A 1JCYA 3IWPA 2CW6A 2DVUA 3LHTA 4GH1A 4H9MA 4UTMA 3QSRA 1M01A 4MNKA 5T9CE 3MA8A 1TR1A 4J9JA 5HPOA 3MJYA 4U3AA 4CU8A 4AB4A 4O28A 1KD0A 3QPEA 3NL6A 5ABTA 4DWSC 3TA6A 4G5DA 3B04A 1G4TA 2CBIA 3LSCA 3ZJKA 3OBEA 3T0CA 3PS7A 2WBKA 4AYSA 3VKBA 1JGMA 3TAKA 1G1YA 1GQIA 1UD2A 1R3SA 4EIVA 2GZXA 1XSKA 4GXWA 3TMLA 2W92A 1Q2SA 3AMCA 5D8WA 3OYZA 3TP4A 1G4SA 1H11A 3EX4A 2YSWA 1EYEA 1TZ7A 1FBAA 3H26A 4S3KA 5LNRA 5CLWA 1LWJA 1W3LA 1JIBA 2BHZA 3W7OA 3T2OA 2E3ZA 2VOTA 3UZ5A 3K8LA 1BF6A 3CXOA 4ZZ9A 1FVPA 3LQGA 2C19A 5I6SA 4A05A 3BOXA 1DIKA 4LNYA 3URBA 1KKRA 3VOGA 4QCEA 1QOXA 4S1FA 1ZENA 2XM1A 1DWHM 3CQ0A 3RRAA 4WF7A 3WK3A 1EDGA 4JTEA 1QI5A 3NL3A 2OSWA 3L7RA 2QZRA 5A2CA 3CZLA 1CLXA 2CFFA 3VUSA 1EJVC 4HNLA 3CTLA 1JPIA 1IZKA 3OYXA 1CGVA 2ZUTA 5LNVA 4JTKA 1PCWA 2ON3A 3I7RA 4GNKB 3SY8A 1H1ZA 1Q4WA 4NKCA 2FMNA 3MO4A 2Y7EA 5D9MA 4NAEA 4PMXA 4JPGA 5K9DA 1GQJA 4XD4A 1UMLA 3OG2A 4Y9OA 3W28A 5IBXC 3KP0A 1YADA 3WZ0E 2XZ9A 3UXLA 4RXGA 4XX6A 4DWSA 5HWNA 1ZP3A 4WY0F 5HANA 2XN0A 1OADA 5EL1A 1SW3A 3UG5A 2FFIA 3VCRA 5HMFA 4A6GA 1QK0A 1QHZA 4WY0B 3KBNA 2TPSA 3GR4A 3UBPC 1Q6LA 1GONA 1B30A 2I5IA 4DX3A 5IDIA 3W7DA 3BG9A 2B7PA 2VQTA 1RUSA 3NYZA 1HJSA 1DXIA 2FTYA 3MSRA 4XZHA 3SJNA 2G3IA 2FH6A 2QHAA 3FDGA 4NUWA 2DP3A 3QMSA 4FLRA 3N6HA 3V16A 1XFBA 2WNWA 2Z6IA 4WD0A 3V4BA 1N8FA 3LD5A 1PKLA 3W7HA 1B9BA 4JHOA 1ICQA 3TW6A 2VOMA 2GYIA 4WXYA 3U2EA 2ZXDA 3N34A 1I1WA 3U8GA 3KCLA 3HFYA 2PPGA 1BRLA 2CITA 3BLOA 1MEHA 3G2GA 1TFVA 3GU1A 3Q58A 2VC6A 5HNNA 5GNYA 4MY1A 3L23A 1E73M 3BAWA 2PRLA 4O50A 3T0TA 1XLAA 4A3UA 4CNNA 3W2UA 4JDBA 2WCGA 2AOSA 1I0DA 3SW6A 1VBHA 1MVYA 2YL5A 4CEXC 2OSYA 3BSMA 3SEPA 4H01A 2VKZG 5JBFA 5KMYA 4O1CA 3GTXA 4Z17A 4PUEA 1WBHA 4AEEA 1DIOA 3GH5A 2GPTA 3B0UX 3IJQA 4F0KA 3B8DA 1JZ6A 4B90A 2ZX9A 3GG1A 1Q6RA 1XLFA 3U7VA 1HGWA 2Q01A 2PDXA 5M17A 2VTFA 5IBXA 1UR1A 1X38A 3EGJA 2QPXA 3H22A 2PAJA 5JU6A 1IEXA 5DX7A 1JQVA 1UP2A 3M43A 1KCZA 2GJXB 1TTJA 4YPJA 1CGYA 2D1ZA 3K4DA 3OHMB 8XIAA 5DCBA 4K3ZA 3V1HA 3SRFA 3KVLA 3G1AA 4LUTB 4LH8A 2YLLA 5BU9A 2QXWA 3LYEA 5CH9A 3U9IA 4DZHA 4LWWA 4GABA 2GVEA 1A5OC 1VBJA 1HZYA 3P62A 4V33A 2DVTA 3PY2A 4PRTA 4AD2A 3H4GA 1OK4A 1IIHA 4BHYA 4W8AA 3P3BA 4AIBA 2XH0A 3TV8A 4HZ6A 4MB5A 5CPLA 5FF2A 4C7FA 1JZ3A 3P93A 1IHIA 5K4XA 1SM9A 2VRJA 1FWHC 2XN1A 1Z48A 3IVSA 3GZ3A 4Q4PA 4PMYA 5DEZA 3CM4A 3KUMA 1RCQA 4NT0A 5CBBA 3WH5A 4XAPA 3M0XA 2GVGA 2RHGA 3I7SA 3ALFA 4M51A 4IQLA 2ZZ4A 3R79A 3QOMA 3UP8A 3PANA 1XF0A 4DXKA 2GGGA 4X9SA 4HMNA 5B7ZA 2B7OA 1QU4A 4NZ5A 3FVDA 3NO5A 3GG8A 2OEMA 4F9JA 3OHIA 3GNNA 3WLQA 4RZ6A 3WK0A 3SGGA 2ZADA 4JY9A 1RR2A 3NQMA 2QQ6A 1O68A 1NIUA 2QCNA 3PULA 2ISSA 3BV4A 4P7LA 3SSZA 2D2JA 1C8QA 4HN4A 3N15A 3K8MA 5D09A 2Q8LA 4DHGA 4MWAE 2DFAA 2FYMA 4PCPA 3WDHA 1S5WA 3CU2A 3IK2A 3UG4A 2VURA 2CCRA 1EZWA 3RXZA 3BGGA 2D3LA 3LOTA 4KWOA 1WZKA 3FGCB 3WK1A 1EA9C 5L6UA 3BLIA 4PUJA 3B4UA 4Q6XA 3O6YX 5T26A 4KGJA 1UOZA 2X2YA 4YVXA 4JHMA 1YTKA 3OZYA 2RGMA 3V5CA 4GH3A 1NOFA 1R3YA 4DBDA 1TUXA 3L65A 4EPEC 1H7XA 1S5TA 2CBJA 5D37A 4LYRA 1KFKA 1S1RA 3N2CA 3OA3A 2HK1A 1ONWA 3RILA 1IIGA 3QMTA 1BYAA 1S3HA 5E1QA 3VOHA 1RZMA 1A53A 3TNBA 1Y5VA 3SURA 4HNNA 1V7YA 3LGGA 3CPRA 2PDMA 5EMJA 4LUSA 3IJDA 3AIBA 3SUSA 3AUOA 3B05A 5A94A 2YR1A 3QR3A 1I60A 5FJPA 3DFQA 3B9NA 1TX2A 1UC5A 1PIIA 1YQ2A 3WQWA 3SM0A 1NDWA 1L0PA 1XH0A 3P0XA 3JRKA 4HTYA 2GDVA 1UWIA 4DYEA 3AQUA 1W8SA 3T55A 1L6GA 4JTRA 4L80A 4PULA 3UXDA 1VH7A 5G2WA 4KEVA 4JKMA 1XPGA 1L6FA 3D5HA 1E15A 4EF8A 3LLXA 2GGEA 2CLHA 1MFVA 2WK2A 3ABQA 4FNPA 1A0DA 3G8EA 4Q7BA 4J1OA 4B3LA 2WM1A 3BDKA 2OCZA 4CVUA 3KHJA 9CGTA 2REQB 4B2DD 1AZ2A 3B9OA 3B3DA 3NIYA 1H51A 5G1TA 2HPIA 2WZTA 3UNTA 5IXEA 1FDJA 4YTUA 2PF0A 2QMKA 1BSIA 1VB9A 3DHDA 2NQ9A 2WKJA 3ITTA 2PGEA 3WX7A 2Z26A 1MEIA 2QF8A 1F73A 1EYWA 4EAYA 1C9DA 4GNJA 2PDCA 2CZFA 4PMUA 3ZVIA 5I7GA 1B5TA 3SIMA 1YKWA 1P1MA 4MFDA 4J27A 5FEXA 4UZUA 3QLDA 4EACA 1RLDA 4RLIA 2C1IA 1DQXA 5XIAA 3GDRA 4O19A 3AISA 3K2GA 1WAWA 1TJRA 4AW7A 4F0RA 1G94A 4GVHA 4NZJA 4D9PA 1YDYA 1PIGA 2ZWZA 4Z2GA 3WJZA 3RFAA 3U48A 3K8KA 2NQ5A 3H53A 2NX3A 4GO9A 3W25A 4HMCA 3CEUA 1A5NC 2ZUSA 3LS9A 3MY9A 2PZNA 2VDIA 3SY5A 3HPFA 4H83A 4W84A 4ZGYA 2NT1A 3F2CA 3VFLA 2QPSA 3QTGA 3QQ0A 4DM2A 3RCMA 1K4HA 3G77A 1R3TA 5KETA 2R1LA 4F8XA 2GL5A 1TPFA 3LCLA 1Z8AA 2WSRA 1DHKA 2X16A 4H9ZA 3TNOA 1DBTA 5EB8A 1YE6A 3W7CA 4PB3A 1CGXA 2QAPA 3PTKA 3VOFA 1UKOA 4ATDA 2FZMA 1LOLA 3LPPA 4LVGA 3I3EA 3S9ZA 4Q4QA 1TWDA 3PWAA 4JN8A 4HU4A 2V5LA 2WHJA 3GRIA 2BB0A 1QNVA 1XM3A 2G3FA 3CV7A 3PZGA 1YIXA 3H4WA 3W0KA 1CECA 3W1TA 4LANA 3WQEA 3W72A 1WXZA 4K8GA 4WUIA 1UR9A 1XGEA 1HL9A 3NA8A 5A8OA 4YWSA 1W3HA 3CWHA 4LEFA 4ZXLA 4RNHA 4D71A 1WA3A 1H5YA 1KGWA 1H4PA 4GQ0A 4E5TA 5D2XA 4H3DA 2OFJA 3STPA 4TVDA 1CZ1A 1VPQA 3BZJA 2E67A 3TC7A 4QE5A 3N4AA 1A0EA 5F2LA 3AWOA 4ACYA 3VM5A 1U1UA 3T8LA 3W84A 2VX4A 4DI8A 3W7QA 3EKLA 3KVKA 4V15A 3H2FA 3LHZA 2HTMA 2AL2B 4C5YA 2EO7A 3IV8A 1E1FA 1SUXA 2ACSA 1X8FA 3ITLA 2F7FA 4B5VA 3AAMA 2QJNA 4HZ8A 4X3ZA 4J3XA 1XR2A 5MF5A 1Q5MA 1QW9A 3LX9A 1W31A 2CHRA 3ZSSA 5REQB 4Q33A 3POCA 3SDOA 3CIXA 4QEHA 4UOZA 2V38A 3VIJA 1H0GA 1HKJA 1XLGA 3KOWA 2GUUA 4MYXA 4CCCA 1TVPA 3QQ1A 5EYWA 4JX6A 4Q22A 3GY1A 1YMYA 5A6KA 2GGJA 3ENLA 2F2KA 3C5QA 3F7JA 3P8IA 1W91A 1A5UA 3L0GA 3GDKA 3H12A 5F4SA 3RM4A 1OCBA 3G1HA 4I9TA 3OJGA 4CCEA 3MYOA 1Q65A 4O8RA 4P7RA 1YRRA 1QBAA 3EDDA 4JTAA 4O0ZA 1E0UA 1DJGA 1P6BA 4KH2A 2KZHA 5GPRA 1E70M 3VE7A 1BG9A 4NJIA 2V3DA 1B4KA 4J2MA 3NVDA 1TSIA 5E9AA 4FNQA 3P14A 1GKPA 4YYCA 1S38A 4OV4A 3CPUA 1UD4A 3VDAA 2VEKA 4WX2A 1CDGA 1VYSX 4WOQA 4A8NA 4HYRA 3CQIA 2JGQA 2YZRA 4CCZA 4C6CA 4ZQMA 1ALDA 4MZYA 4W5UA 2VCCA 3I7QA 4FK9A 4H8NA 4A3HA 4ZVJA 1ELSA 4ZCWA 3UFYA 1V3KA 4PODA 4Y7EA 4ZFCA 5AECA 3G22A 4IPIA 4MG4A 5AC7A 3AS1A 2BY3A 3BZGA 4GYPA 3M5YA 3P80A 5D02A 3T8QA 1VGAA 5G1MA 1Q85A 3WFAA 3BW3A 4K7VA 4TU1A 5LZLA 2HXTA 4C1KA 1KBKA 1D3GA 5FI8A 1ZP4A 3ICJA 3TW9A 3WDRA 4GFIA 2PDQA 3V0UA 3PSWA 4KT2A 4JQ1A 3IUHA 2FVLA 4R85A 2EJAA 2XSAA 3WD0A 2XN2A 2YB1A 3KL0A 3WF3A 3RNDA 4C7GA 3AUJA 1V6VA 1V79A 4XZBA 2CLKA 3P2VA 3EXTA 4YLWA 2INEA 2P8CA 4JNZA 1POJA 1YBQB 4PMRA 1JCJA 2VVSA 1DJQA 1QK2A 1W1PA 2J79A 1W0MA 2OX4A 4ZMGA 1NU5A 3NEHA 1Z41A 4JTLA 2YKKA 3EA1A 4FX6M 3TC3A 3ATZA 3AYRA 4U2YA 4KPLA 4HSHA 4H19A 4AZGA 4EXQA 4IGMA 4FNSA 4LUIA 3SCQA 2FPYA 5G4EA 2PDGA 2XFFA 3QW4B 3E1F1 4Z2LA 3OU8A 4V2XA 1W3IA 2I57A 4BQ4A 5I2UA 1W32A 1NF7A 4DLFA 3ARUA 3MZ2A 4YNGA 1OVDA 4AD0A 2NVCA 4MAZA 3UG3A 3VYLA 1K9EA 3D3AA 1EP2A 1HXJA 4QDPA 3OG3A 3ABZA 3ZXWA 4H41A 5HMDA 4UBPC 3TYBA 1I2QA 1RY0A 1Z9AA 3OODA 4DN1A 1AJ0A 2ZC8A 1Q45A 1MMFA 6PTDA 1X1NA 4HNVA 1RQHA 4Z2JA 4E3TA 3T44A 1V0KA 5C2GA 1ZB5A 4GBDA 1C8VA 1UR8A 1GGOA 3LZ3A 1UR2A 2A85A 4HVXA 3SQMA 2Z1BA 3M7WA 4CQBA 4R9OA 1O4UA 3MHFA 3OBKA 1G5AA 1F9CA 2AL1A 2EHHA 4XUGA 3QYQA 4B4FA 1UUOA 1YXYA 3QYSA 3PUOA 1OZQA 3WYZA 2ZQ0A 5AHNA 1LG1A 1GVSA 3NAVA 2NXIA 3U4FA 4C1LA 4Z0JA 2TODA 3AXMA 4W8BA 2GSEA 1ZY9A 1XIGA 2ISDA 3K13A 3IANA 2PDJA 1P0BA 3MVIA 5CJNA 4DF1A 2WLZA 3BJTA 1N7KA 1QASA 3O0KA 4NNBA 1DE6A 5DCDA 4MJ4A 1X6LA 4H8UA 3WD3A 3TN3A 2O9OA 5M2FX 4D2JA 2OO6A 3AU6A 5MKGB 3ABOA 1XD0A 2IXVA 3ECQA 5CBJA 3BJSA 1EJTC 1PVNA 2YCLB 2HBVA 4ALDA 4S38A 4W89A 1K77A 3FXGA 1NDZA 5CAHA 3W26A 2DGAA 3W1AA 1OG6A 6REQB 2ZRWA 3ZS4A 1W9VA 1QATA 3SUVA 1JZ2A 3W82A 2WMJA 1UW9A 4LBSA 2IPJA 4I5XA 3W07A 2O4QA 3SUTA 2Q6ZA 1EB3A 4JL2A 1UIOA 1W9BM 1KCKA 3FVMA 3VIKA 3WEMA 1CXIA 3B8TA 1TWWA 3UJ2A 3NSMA 5AYYA 3VE9A 4QJ5B 4PRWA 1KRBC 1AMYA 3H23A 3VOCA 5EFFA 3GK0A 2YBUA 2RUSA 4O1BA 4QP0A 1PS9A 2F38A 2L5HA 3T2QA 4QNWA 5C54A 2ZX8A 1UPPA 1QHPA 2Y61A 1CNVA 3FA4A 4TV5A 4F2UA 3LN3A 1F74A 2WNQA 2VGBA 2QGYA 1OFBA 1ADDA 1O66A 3PWIA 3AO0A 4QX4A 5FJRA 1GJPA 2FPTA 1N82A 5LXEA 4RDZA 2BY0A 1OEPA 2BV9A 4P2VA 1PTDA 1TV2A 4D6IA 5HUPA 1W3TA 2BSLA 1EHAA 3HGOA 1REQA 2DY3A 2VRQA 2Y4SA 4WQ6A 1V03A 4JN6A 1P7TB 3IAQA 1K6AA 2VMFA 1QMLA 1FWWA 1SJBA 3VPLA 4JTCA 1OT2A 4URIA 4Z42C 4GUIA 2NQHA 2WSQA 1CXKA 3EB4A 3LGDA 3EWWA 3G1SA 1PYMA 5AOUA 1BSLA 1PHWA 4QNEA 1DJWA 3ZO9A 1QR7A 3B8IA 1GEQA 2MNRA 3FHQA 4QJ4B 4IUOA 1BXBA 5H2ZA 3MO7A 5A5WA 4B91A 4YTSA 1VFHA 4GINA 1KCLA 4N0RA 4UCFA 3CLWA 2AKMA 3TOPA 1QWGA 3MWAA 2HNEA 2OU4A 1TA3A 1VEMA 2C1GA 4J5NA 4PEKA 4ICNA 3CLMA 3R7MA 1DXFA 1V6WA 2C0AA 4PL1A 3UD6A 3ALGA 4MWAD 2E0PA 3NOEA 4JN7A 3H21A 2YFOA 3H54A 1ZAHA 1LUCB 3VKJA 3W83A 3O6DA 2A21A 1F8MA 4RV3A 1GYMA 1RV8A 3VIMA 3RR1A 5CPNA 3O1NA 4MDOA 2Y5SA 2DZWA 4RUBA 2GK1A 2CKSA 1FH9A 5G5IA 3QH2A 4PTWA 1W5OA 3FFSA 4JTIA 3BH4A 5C7VA 2NUXA 3AMKA 4DUWA 4PCNA 3EX3A 3C8NA 2ZUVA 1QI3A 2ZUNA 3GIYA 1GKQA 3GUWA 3L4VA 2I9UA 1EO7A 1ZGDA 1L2UA 4UIOA 4HPHA 3MC5A 2EKGA 4X60A 3SRKA 3L9CA 2WPBA 2DQXA 2BY1A 4DUXA 4N9DA 3ISIX 2UY3A 1EJRC 3A5VA 3A3WA 2BGQA 2EKCA 3WLMA 4QRNA 2QUUA 1TB3A 2PTDA 1DQWA 5G4HC 2YA2A 5AFDA 4J3ZA 1B3XA 1DHPA 1SU5A 3N19B 1XRFA 3NPXA 1BWLA 2POTA 4M7SA 2BOGX 2DUZA 4JL1A 3FEQA 2H8XA 5F4XA 5F7UA 1N8WA 3C2VA 2R1MA 2DSUA 4GA8A 3H4XA 3RJXA 3XINA 1YTDA 2Z6JA 3UEQA 4R88A 4D6FA 3TIMA 3IIXA 5KINA 5IFPA 3W22A 1AODA 2DT1A 2XIBA 1U2YA 5HK4A 3ZR5A 4A29A 3QEZA 3LXCA 1HJWA 4JCLA 3TYUA 4LCRA 4O1EA 1SZGA 1W1IE 3AFBA 3VMPA 4L1XA 5I07A 1EX1A 3E38A 1VYRA 3NQCA 2PDPA 2BXYA 1SO5A 3PN8A 3G3MA 3QPZA 3O05A 3EPNA 3G6LA 1C3FA 3R5EA 3Q37A 2V81A 1JVNA 3WMSA 2GQ9A 3HQPA 3PBVA 5AHIA 4GXPA 5C9UA 2OWXA 1GUVA 1UG6A 4JQ3A 2NQZA 1NOWA 4WJ8A 1XRVA 2W27A 2FKPA 1JCXA 3ZMRA 4B3KA 3E2QA 3JVAA 3ZWSA 1NDYA 1OFOA 3IACA 5FSEC 3UYIA 4QLJA 1W1B1 2ODOA 5C6MA 4WDXA 4ICMA 2JK2A 4I3GA 3SN1A 5LA0A 4KRUA 3PF3A 4F9DA 4UWMA 3H2OA 2PD5A 3MCNA 1JCLA 1DKWA 5CJ5A 1CLKA 3CNYA 3DX5A 2PCQA 3FJNA 4MTVA 3UQNA 1T99A 4DO5A 1XBYA 2PS2A 3TTYA 1Q6GA 5H6HA 3B0YA 5BXTA 1V08A 3DEQA 3AIVA 2GGHA 4HOWA 4GVGA 3SCWA 2J24A 4P7QA 4AISA 2XGZA 4NJHA 3UPWA 1FRBA 2JF6A 4Q6JA 1DE5A 1PX3A 1YNYA 1RBLA 1XCFA 3GBDA 2PWEA 4JYDA 1NOUA 4IJBA 1RP9