2BGUA

Crystal structure of the dna modifying enzyme beta-glucosyltransferase in the presence and absence of the substrate uridine diphosphoglucose
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
351
structure length
328
Chain Sequence
MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-GLUCOSYLTRANSFERASE
publication title Crystal structure of the DNA modifying enzyme beta-glucosyltransferase in the presence and absence of the substrate uridine diphosphoglucose.
pubmed rcsb
source organism Enterobacteria phage t4
molecule tags Transferase (glycosyltransferase)
total genus 121
structure length 328
sequence length 351
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 1994-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2bguA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2bguA02
3T5TA 1XV5A 3D0RA 1LWOA 8GPBA 4EJ2A 1XL1A 3E3NA 3H4IA 3MTDA 1FU4A 3FROA 1WV1A 3CUVA 3OTHA 2VG8A 2VSNA 4LEIA 3EBPA 1NOJA 2F3QA 1VGVA 3ZCTA 4GYWA 3T3IA 3CV3A 4KQMA 1ABBA 4WACA 3G2JA 2XA9A 3DDWA 1C8KA 3S28A 3HBMA 2R4TA 3L01A 2G9UA 2QN2A 5TMEA 1E1YA 4F96A 2BFWA 4F9FA 3C48A 2F3UA 2GPAA 1Y8ZA 4REMA 4CTNA 2F3PA 2QN1A 2XMPA 3DD1A 2GJ4A 4RBNA 1M5RA 1A8IA 1O6CA 3VDNB 7GPBA 1GPYA 3T3GA 3BD8A 2OFFA 3DDSA 2FETA 3MT7A 4GZ6A 1UZUA 2GEKA 1GG8A 3SYRA 2AW3A 2Q6VA 4N3BA 4RIGA 2IV7A 3NCHA 1EM6A 2ASVA 1RZVA 2QN3A 2X6QA 2X0EA 3D1JA 3MTAA 4NESA 4RIFA 3C4VA 3CEMA 1Z8DA 3Q3HA 2PRIA 3OKPA 4RELA 1JG6A 1P2BA 2XCUA 3CUWA 2QLLA 2IYFA 3GPBA 3HBJA 4FKZA 2QN9A 4CTMA 2KS6A 3MRVA 4NEQA 3H4TA 2G9RA 3G2KA 2JZCA 3OKAA 1NVKA 2FFRA 4MHOA 3DZCA 5ENZA 1WUYA 3ZCUA 3E3LA 2QRMA 4AMGA 2IW1A 4NC9A 3HBFA 2VCHA 2C9ZA 4CDRA 3L7CA 3VDMA 3ZCPA 1F0KA 3S27A 9GPBA 4AN4A 1BX3A 4MI9A 5D00A 2SKEA 4F97A 2ACWA 1FA9A 3BCUA 4W6QA 1J39A 5JTTA 1QM5A 3NAZA 1YA6A 3UYKA 1E4OA 2PRJA 3ZCSA 3OTIA 2AV6A 2G9VA 2R4UA 3BD6A 3RSCA 2YJNA 4BQIA 5D01A 1HLFA 2QRGA 3MT8A 2WTXA 2IEGA 3NB0A 1IXYA 2JJMA 3COPA 2F9FA 3E3OA 2PQ6A 4XI9A 4M83A 1JEJA 3O3CA 1GPAA 2F3SA 3MS4A 3CUUA 4HWGA 4X7MA 5C1DA 3PE4A 4QLBA 3BD7A 4M7PA 5DXFA 5TMBA 1GFZA 1UQUA 1GPBA 4XIFA 5LQDA 2GPNA 3TOVA 1GGNA 4MRAA 3BDAA 1XOIA 5DU2A 2XCIA 4YUAA 3Q3EA 3OTGA 1UQTA 6GPBA 5JTUA 4AY6A 2H1HA 3IA7A 2QRHA 3MRXA 3QHPA 5I45A 1C8LA 1L5WA 1SXQA 1P4HA 2JLBA 4YI5A 2XGOA 4MICA 3MT9A 4N3CA 1XL0A 2P6PA 1FS4A 4FZRA 2IV3A 1F6DA 3MTBA 1L5RA 4CTOA 2H1FA 2BGUA 2QRQA 4GPBA 3BEOA 4X7PA 1C50A 3UYLA 2SKDA 1KTIA 1NZDA 1L5QA 1YGPA 3S0JA 3G2IA 4G2TA 2BGTA 1P4GA 2PYIA 3D0QA 2VSYA 1JIVA 3MQFA 1FTQA 4WHMA 1NOKA 5TMDA 3IAAA 1NLMA 3CEJA 3VUEA 2O6LA 3L79A 4EKEA 4X6LA 2QN8A 4MI6A 2BISA 3S2UA 2X0FA 3OKCA 4N3AA 4GZ5A 4MI3A 1Z6QA 3S29A 1FTYA 1PSWA 3ZCVA 3TAXA 2SKCA 2X6RA 1RZUA 4BQEA 4N39A 3OT5A 2C1XA 3T3EA 1FU7A 4BFCA 2ACVA 2C1ZA 4LDPA 4HLNA 4RIIA 3ZCQA 1NZFA 3WADA 3WC4A 1WW3A 4KQ1A 1RRVA 3NC4A 4RENA 4L22A 3WAGA 2GM9A 2ATIA 4AY5A 2IYAA 3BCSA 2X0DA 1EXVA 3SYMA 1L6IA 2QLNA 2XA1A 1XC7A 3RSZA 4EKYA 2QN7A 3CX4A 5IKOA 2AZDA 3MBOA 1IIRA 2R68A 3Q3IA 3TSAA 1PNVA 1L5VA 1Z62A 2R66A 4N9WA 1P4JA 3T3HA 5BNWA 3CUTA 4EL0A 3G2LA 3RHZA 2VCEA 2GPBA 3C4QA 3G2NA 1P29A 3OY2A 1K08A 2R60A 5HXAA 1GZ5A 3L7AA 2FF5A 4MHSA 1H5UA 2C4MA 3T7DA 4BQFA 3PE3A 2ECPA 1WUTA 1Z6PA 3OY7A 3T3DA 1P2DA 2XGSA 1NOIA 4RIHA 3RT1A 3QKWA 1FU8A 4EL5A 3MS7A 1QKJA 1B4DA 3NP9A 3BCRA 4Z5XA 5DLDA 2QLMA 3NPAA 1AHPA 1XKXA 1LWNA 3CUYA 1L7XA 3HBNA 2ZB2A 3MRTA 2GT1A 4YI3A 4GYYA 4PQGA 2G9QA 4GZ3A 1Y6GA 3GUHA 1JG7A 2QRPA 2IEIA 5GPBA 1Y6FA 3CEHA 4AMBA 1JIUA 3NP7A 5IKPA 3VUFA 1FC0A 1P2GA 3G2HA 2AMVA 2GEJA 3MS2A 5TVGA 2PYDA 2QNBA 4KQ2A 1WV0A 3ZCRA 1L5SA 1WW2A 1AXRA 2XGMA 1JIXA 2XA2A 1V4VA 3L7BA 4M60A 2IUYA 4RIEA 1PN3A 2HY7A 4X7RA 1SXPA 3L7DA 3AMVA 4WADA 1C3JA 1PYGA 3MSCA 2QZSA 1FTWA 3EBOA 1K06A
chains in the Genus database with same CATH superfamily
1E9RA 1MTOA 2CCGA 2Q62A 3OZWA 3T5TA 3CO5A 3IERA 4KN6A 2WJJA 1OC4A 3O1LA 4RA6A 2C0QA 2ECQA 1AG9A 3IILA 5A3VA 3I45A 3MMNA 4BNWA 4EJ2A 1KWGA 1P1HA 4DUGA 1C80A 2VNHA 1CVRA 1J56A 1RXUA 2AX3A 3PPIA 3UM9A 3OTHA 4DIMA 2ZJ5A 1QANA 1EK1A 3NWOA 2VG8A 3ILSA 3G02A 1T5IA 3LF1A 3RD5A 3TFOA 1Y4UA 2QV0A 3O8BA 3JASB 5M7EA 4LOJA 1AF4A 1G6Q1 2QUKA 1P60A 4FMDB 4HLDA 4EPWA 3KQLA 4NK5A 3MG9A 4FVTA 1PJSA 2X14A 4KOAA 1ZJ6A 2QP9X 2MSKA 3LLCA 4PYQA 4YUWA 1C4KA 4Y2PA 5E4YA 4RD3A 2QAGB 5K09A 5GP1A 4TS3A 2DMRA 1DAHA 2BKUA 2YWEA 1FTNA 3F5QA 3RS7A 4B6FA 5ALUA 4E13A 2K2QB 1S89A 2G40A 1D0VA 3WL6A 2V7QD 3ZJTA 2AOUA 1L7OA 4MOWA 4ZEXA 4MV4A 1ZAKA 3L01A 2G9UA 3T7IA 1A97A 1E1YA 4DC9A 3N07A 4UM9B 5K0NA 1TU3A 2YZ2A 5BV2P 2QTAA 3OD1A 1ENPA 1XTKA 4R84A 1NSFA 1NN1A 3KC2A 1EXDA 3TG8A 4G5OA 1G21E 1OBFO 4UBJA 5D2CA 3RKSA 4F71A 3HS3A 3L6BA 1XQWA 1COWD 1A9XB 5LXTF 2R8ZA 1M76A 3B3JA 4A4DA 2CJPA 1QRUA 2FEAA 2WF8A 4MK4A 3OOYA 1NG9A 4KAAA 1YZLA 4UE2A 4REMA 5BPHA 1EFKA 4U2KA 1SKYB 2Z2ZA 5KS2A 1UEIA 3T5CA 1C0PA 1DO0A 4CM6A 3UJCA 3VTAA 4A6PA 2RH5A 2DPXA 3A6KA 3BH6A 5EA2A 1DKNA 1A8IA 2JGJA 3VDNB 2FYTA 4RS4A 1P5FA 2BF7A 4C0WA 7GPBA 2PUGA 4D0GA 4RF2A 3TLCA 4DCSA 3QYFA 1NFFA 1LI7A 1R0KA 3HA2A 2OO3A 5EPEA 1EEXB 3L7OA 1EDOA 3ENVA 3TLAA 1I6LA 3VR5D 3L5OA 4XCQA 3EPJA 4HMQA 1Z3IX 4H3HB 3UK2A 5LQJA 1UZUA 3A4TA 2IHUA 5A6SA 2DKOA 1K7FB 1YA4A 1SBQA 4RF4A 1FBNA 1HTBA 4JOBA 4PX2A 3ETJA 4AL4A 3F46A 2GEFA 4CDMA 1Z22A 3IUQA 4EAAA 1ZCZA 1E7QA 1V3VA 1W5SA 4OP2A 3L5KA 1XRMA 3V55A 2GS9A 2PFGA 3VAZA 3QLVA 2EV9A 2XUHA 3CEMA 1I2BA 3HCEA 4YJ2B 2V0GA 1O58A 3B5JA 4OQLA 1M0EA 2VF2A 4HNQA 5EP2A 3F7NA 3OQNA 1E2PA 3ZZ0A 3IH5A 3IUJA 3WL5A 4MVWA 3WJ2A 1IL0A 1CZNA 3JX9A 3M9LA 4OD0A 4Z9AA 4B9AA 1KSHA 2ZBUA 5E2AA 4R1LA 5EE9A 6AT1A 3LBAA 2D8AA 4N5DA 3CZQA 1P5HA 1Y98A 2QRKA 3F6CA 3NOVA 1U4NA 2DM6A 1O77A 4XSGA 4JLAA 1P5ZB 3G0CA 1HDEA 2GJ9A 1JLHA 5CJPA 4DNFA 4DMMA 1NIJA 1DFGA 4Y2YA 4D4IA 1VCIA 3SC4A 4JLUA 2WWYA 3ZV3A 1SULA 3NEAA 1CUAA 5AKLA 3CRNA 2PFSA 3GLHA 5ALMA 5HBRA 2WMYA 5CLIA 4OI1A 1M7GA 5EUCA 4U5QA 5JMPA 3RASA 2OO5A 2IUUA 3BMQA 2CHQA 3CO0S 4KMMA 3HKDA 5AHRA 2FFRA 3W05A 4DMKA 4ZK2A 1LW7A 2AN5A 4OB7A 1MMFB 2J7KA 2Q3BA 2F59A 1OIXA 4JHLA 4M8SA 4NYJQ 4TL9A 3T9CA 3W4JA 4R71A 3LXMA 1R12A 4G65A 4GIBA 3CB4A 4MRNA 4B3JA 1KO8A 4ID3A 1CJKC 2FQYA 3HMKA 4ZT3A 1AQUA 5IBQA 4CM9A 1TPYA 1WNTA 3MWDB 4DPLA 2X8AA 5BW4A 1RI1A 1D3AA 2AI2A 3O4VA 1NVAA 4QNNA 3SBOA 3O8NA 3WR5A 5IYZB 2WJGA 4ZAWA 1XDZA 4X71A 4C6TA 5C8ZA 2HMVA 1BX3A 1KFCB 4X93A 3EOBI 1KH3A 5ALKA 3E9CA 4I66A 2IHBA 4F2DA 3E2IA 4POOA 3QOXA 3OFVA 3ETEA 4W9NA 2I9KA 1L8QA 2HRBA 3X1JA 1F8UA 2FUCA 4HGPA 2VP3A 1QG0A 2QRZA 2X0RA 4N5MA 4V0RA 1U9JA 4XIJA 4ALIA 4Z2AA 2G76A 4GUDA 1O6FA 1JHPA 1F6WA 2YJZA 4HG2A 3RJ9A 3TINA 4ENTA 5C5IA 3NETA 2DQYA 5JI2E 1GDDA 3QXJA 4JQYA 1SHTX 1G6OA 2CHFA 3AQIA 1HSZA 1LK7A 1T25A 3EZXA 2GEUA 3JZAA 3U19A 3PUIA 2P9JA 1SB8A 1ZNXA 1KFKB 4J0KA 4TKVA 4A0SA 3HFRA 3EF1A 3R6LA 3ZNOA 4XQEA 5F1YA 5D01A 1PV2A 4K9NA 1Z5NA 3DE0X 1JF8A 4YAOA 4DSOA 1IXYA 3TZQA 4F1JA 4IS3A 3K6SA 2YHBA 1EEHA 6REQA 4YAEA 1XMOB 1YB4A 3AU9A 3RHFA 1HRKA 1L5ZA 3HVKA 4NZ9A 5KCMA 5HRCA 2DFDA 2YHUA 2JJ2D 3O3CA 4HKTA 3I6ZA 4JUFA 2C7VA 1PWXA 3FRIA 4ZVPA 2EL9A 2D7DA 4C06A 2Y99A 1NSYA 4UNPA 2OM6A 5FUBA 1JZSA 3M5CA 2B4RO 4LWZA 4QU5A 1TLFA 1FUUA 4DYVA 4MEAA 4E4RA 3PLNA 4YONB 5CFQA 4DYDA 5K8UA 4K9MA 4H0NA 3I01A 4GXRA 2ERXA 2PIDA 1Q50A 3BGSA 3OZSA 1MABA 5GONF 2W9XA 1MG5A 2XJ4A 2D06A 3B3GA 3QA9A 4AJ9A 2ID7A 4BEWA 4WPGA 2IHKA 4M87A 4MR8B 4U2EA 1OYYA 5FD8A 3FYUB 3HYCA 5KNLA 1PUJA 4KWEA 4MV0A 5IAOA 2ROQA 2XUOA 4NOKA 4FWBA 4FI3C 1E2FA 1SVNA 1M8JA 2VTDA 5AM5A 1MAHA 1RJDA 3FZGA 4OLHA 3VNUA 1GTL1 1N0HA 4UUQA 3Q3EA 4REQA 5BWCA 1Y5RA 3RVSA 2JL1A 1YU9A 4Z7OB 1SURA 2ID8A 1B93A 3NZEA 2HQBA 2OFXA 1JH9A 1A5BB 4Z8YA 1YRBA 2NACA 4K9KA 3BFKA 4GYJA 4AYTA 3GIWA 2C99A 3A6PC 3OEWA 5HIJA 3DZHA 3X3HA 2FJ0A 5HDBB 2OVFA 1SFRA 4UDNA 5AI5A 4EJFA 4EB0A 1M2HA 1HNXB 2JLBA 3CLRD 1QR2A 4I3HA 4ZJUA 3UCEA 1DUSA 1UDRA 2R1UA 4LZOA 1NF9A 1P19A 4R3NA 1F9EA 1YIOA 5SZIA 3U31A 4YRNA 5HW0A 3GVIA 5CDHA 1UT5A 4Z49A 4G37A 3SP1A 1FS6A 2WINI 3JYLA 3CH7A 4RHEA 1XN4A 5LMCA 4P4LA 4YMLA 2ZB3A 1D6MA 5BR4A 4BPRA 3NNDA 1YKSA 3PF8A 4TS4A 1EM8B 2GB4A 4GPBA 5CYFA 1J33A 2AL7A 3TMAA 1WDKA 4IDAA 3ITKA 5EIHA 3ZLVA 4AO8A 2GHTA 1W96A 4RV4A 2DFTA 1QNLA 4JEHA 3WZMA 1PK7A 3HKBB 3I9V6 4E6EA 2PLRA 4E2WA 4CMGA 2C4KA 1G8GA 2QMOA 3WXMA 3FVVA 3WAKA 5FKJA 1T0HB 4EY6A 5A3JA 1YB7A 4M38A 4NCIA 5HIKA 3G8YA 1DDIA 3FSRA 3SCZA 3VMMA 3WV4A 3QLEA 2NVUB 5CM2Z 3F3YA 2CB0A 3AP2A 4YMUA 1O6ZA 4MV5A 3CJTA 5AI4A 4ZVNA 1ACMA 2AEFA 2JGDA 4RPLA 1CS4C 2ECKA 4MQFB 3A6GA 3NBYC 1C0EA 2MR5A 4W7SA 2ZQYA 4QQRA 4YA6A 3RQSA 4LGVA 2OGTA 5DRYA 1DC6A 4IX1A 3LFTA 3CU5A 2WUWE 5GJBA 3OHMA 1T9DA 2WIDA 3PK0A 4CTJA 1K68A 2P40A 4PLZA 5HYVA 1A9TA 3SNKA 3A6ZA 2ONJA 4RANA 3QKUA 3FYHA 3SVTA 2JLQA 4DNOA 1EFRD 2I6XA 1N2OA 3FMVA 4QSHA 2VAPA 4AULA 1JALA 5DTRA 1ISFA 1U0HC 2JGNA 3OQHA 5LM3A 4FHDA 4H0CA 4YT2A 2XUFA 4S1WA 3A1WA 5AKIA 4G1UC 5BYAA 3DL2A 1HE8B 3AW9A 1LJ8A 1K7SN 4ZA2A 4PPQA 4D3DA 3TAXA 4LSWA 3DT6A 3QELA 1DCKA 2HNAA 2PVSA 4RK1A 4Q66C 3CT4A 1UC4B 4UFPA 5LJLA 2JCXA 3P9RA 1QVAA 4NG5A 4LHVA 5EC8A 4F72A 5KTNA 2BFEB 3UUEA 1RRPA 6Q21A 4M99A 5JOQA 4EHNA 3OIYA 4IHJB 4DCTA 4I5DA 3NANA 2NYAA 2H59A 3USZA 2YWFA 2JBAA 3D4IA 3O91A 3FBGA 4G5SA 3WFIA 5DYNA 3HUEA 4INZA 4LJRA 5D51S 1MU0A 3EDOA 2H31A 3ETGA 2YFHA 2Q46A 1MFZA 3EDCA 4KIFA 4N7BA 3EULA 1RW4A 4AF6A 1SOWA 5DMXA 2WE8A 3UJHA 4CDGA 3O3NB 4CR6A 5JYEA 4WERA 4I1YA 3M6UA 2CXTA 5CDUA 4CCYB 1V2HE 3KE9A 3D8UA 4I4TB 1G2OA 5ADWA 1Y7HA 1V5EA 2DY1A 3NDRA 1KVSA 3O8QB 4KITB 4JI3B 1Y7LA 4YDQA 1GL3A 3FZYA 3U1BA 1HZZC 4UTXA 2FZGA 4S0ZA 4QX6A 3F74A 1OD6A 3FPGA 3RAGA 3W2HA 5LP1A 1IZ8A 5JO9A 1L2TA 1LXCA 2O4UX 1E98A 4FEEA 3AERA 5I7HA 3T3MB 2C92A 1MORA 3FFWA 3TKAA 1C3XA 2EP7A 2ASEA 4FHEA 4RL6A 2Q2VA 821PA 2OSBA 2ENUA 4I8DA 5FV7A 1L5VA 3UAOA 4LZJA 2FB9A 3HG7A 3OM0A 4M98A 5F9FA 4DFDA 3SHFA 1D8TA 4UZEA 1EB9A 2ISSD 4JUAA 4WKCA 3PX7A 4QT4A 2QRJA 4FU0A 2NMVA 3TN7A 3FWNA 4M22A 3SLRA 1CUCA 4BP8A 4RF3A 1IUKA 4MZDA 4Q7KA 3H2IA 2D00A 3Q1KA 5EZYB 3RUIA 3GUUA 1X15A 2OC9A 1E92A 1X77A 4P5EA 4ESHA 2JLUA 4HDKA 4YJ2F 4PZZA 1EGVB 3CNNA 3REQA 4UNRA 4A2QA 1CUWA 1GCAA 2VJKA 2WWWA 3HCCA 3VR3D 2ADMA 3PBKA 2OXFA 4RSHA 1I30A 1SGWA 5D3ZA 3VAYA 4MWCA 1OOEA 1FNSA 2X4LA 3AVVA 5EKDA 4TWIA 1CRLA 1Y4SA 4KWHA 1NVBA 1OKKD 4K88A 2MSEB 1EFVB 3PYMA 5GONA 3S55A 2O5CA 4KXQA 2WAAA 5T6BA 4MHSA 3AINA 1DLJA 1GV0A 1ZRMA 1G41A 4HGOA 4X1KB 1OLXA 3SDZA 4D8XA 1BA2A 3H6HA 3BK2A 1Q7BA 2V03A 4QUIA 3NTOA 1PFYA 1TEXA 3ZCXA 4HRYA 4Z4GA 1ZVJA 3H04A 2AEEA 2Z9DA 3K94A 4GHWA 1TK3A 3COJA 4DR3B 2GSWA 2MINA 3T7AA 2H3HA 3VM6A 2RMKA 1RAAA 1V4BA 2HLNA 3HDGA 4WXEA 5L3ZA 4RQTA 3TQHA 3WSWA 1W36C 4C2UA 2E4VA 3GLTA 4K9LA 4Q9HA 2VK1A 4M0KA 4WT7A 2Q3DA 1P18A 1GZ3A 1JDNA 1PWZA 4NS4A 1NBHA 4GM1A 1BYIA 3AETB 2JGFA 4RVCA 4Z86A 5JROA 1RWMA 3I2GA 1XNRB 2H65A 2FR8A 2NLOA 5GIOE 2G63A 3KSRA 2PWYA 3GROA 3R5SA 4WESA 4DQLA 3W04A 5IYZF 3V1KA 1B41A 3AIIA 1PRYA 4CF7A 3W3ZB 4ZDJA 3OM1A 1S3IA 4D3XA 2LWIA 1QTIA 1OI7A 2PX6A 4KQIA 3D8NA 4P3NA 4JQOA 4NJEB 4A8JC 1QRDA 3E23A 1NVFA 1ISHA 4PZYA 4GYYA 2ZR9A 3H83A 3K0SA 4P4UA 3VHRA 3P9SA 1L7EA 1JG7A 1GOTA 1Z2EA 2OLEA 2XDYA 5F1OA 4B4VA 5LMUB 1SRQA 2X9LA 3DCNA 3ND8A 4GPD1 4N7MA 3BJZA 3WI7A 3SIWA 4E7OA 2B5OA 2ETXA 4TLBA 3ZNQA 4HLCA 4J1TA 1FP2A 2P9HA 2YC4C 4LDQA 4MLPA 4Y6OA 5FNVA 3W3AH 5J3JA 3GVPA 1Z0SA 3AQ4A 1Q21A 5JFTA 2CE2X 4JEUA 1EIZA 2WIJA 3REOA 1IOLA 4Y2QA 2Z8YA 2W11A 5HZMA 1WV0A 3W78A 1UMDA 4R1SA 3EIFA 1JLKA 1V45E 1E9DA 1N6KA 3O90A 5DYYA 1QB7A 5A4MS 1IVYA 2FZ4A 3UFXA 4W7HA 5BMVF 2BCGY 3QNWA 3RU9A 3OJFA 4L5AA 3RU2A 1QTRA 1T6NA 1PNQA 1ZISA 1H23A 4AECA 5IF3A 2DT8A 1FFWA 2GCNA 1EX7A 5ALXA 3OM8A 3DZKA 2QZSA 5K4GA 3OKFA 3BWMA 4HO1X 3C7CB 5KYVA 5K0TA 2RGXA 3H8WA 4QASA 8GPBA 3ANMA 3P1JA 1SOVA 1KVQA 4KNVA 4NFSA 3MTDA 3PPVA 1GQYA 3DZFA 3DAYA 4Q4DA 5CLGA 3HDQA 1D2RA 1ORIA 2Q21A 1T0UA 3AR4A 3JASA 2JVJA 2HIHA 3FCXA 3NDIA 5DT9A 3R7SA 1G9TA 4L4RA 3NUGA 1H2EA 3VKWA 1LD3A 1TCUA 3EEBA 2OFWA 2YOHA 4ZOLA 4BJ6A 1W5EA 5IC4A 2QAGA 2YS6A 1QIEA 1WZIA 1HORA 1T1SA 2J67A 3P32A 4GYWA 4XTCS 5CVJA 5DB4A 3C1AA 2MDTA 1ZS9A 2Y0EA 3VR0A 1ABBA 1PEKE 1NV9A 2UDPA 1XQ1A 3QSGA 3TNDA 2FRDC 4NBUA 4BLUA 1ZONA 1STOA 1B7GO 5KJ6A 3I01M 1RNLA 2Q1SA 4FYJA 4NYMR 1WDMA 2MR6A 2PX5A 4QJ5A 3VDXA 1SIBE 4G6ZA 3TLZA 1L7BA 5ALWA 4R6WA 2XI4A 5CXUA 3SXJA 3WRYA 3MMSA 4TLAA 1A9XA 5F73A 3D6AA 1Y6ZA 4OCZA 4PNEA 4YAKA 1V1RA 3T9FA 1L4MA 2I3AA 4BMOB 1Q1EA 3BXZA 1G66A 3J7AC 3VKUA 4IL5A 2GESA 2W6ZA 2ZR0A 3GXOA 3L02A 1ZHOA 5I8ZA 3DDZX 4YFYA 1PW5A 4N5LA 1BCRB 5K3CA 2ATCA 4C05A 1QMPA 2WKSA 5IPFA 5FOVA 1W36B 1V5WA 3RGGA 3MPOA 2CDCA 3HSKA 2ZIVB 3OQVA 1H1TA 2HMSA 2RGGA 3TUZC 3PB3A 1R8JA 2NU6A 3ZE1B 1DOZA 4KXFB 3IVAA 1N2BA 4HXYA 1LPPA 2GRJA 2VR1A 4CQJA 1P4SA 3KU1A 1MCZA 1SXJC 3VHXB 5DWQA 2AR7A 4H1HA 1L5NA 1ZGAA 1T3GA 1I32A 3UGQA 1AOXA 3L4BA 3ZQ6A 1AS2A 3CTMA 1PTJC 4PHCA 1YB5A 1QIGA 1TCBA 3STYA 3EFBA 7REQB 4FCTA 3LXXA 1JXMA 2A4KA 2A3NA 4ZVRA 1E9VA 2C04A 4DLUA 4JFRA 4Q15A 2YNMC 4RYLA 4TTQA 1L5GB 3WVNA 2C4TA 1DO8A 3ROTA 3IQFA 3MCTA 2VDLB 3BILA 3SYRA 3JAMA 3SR3A 4PPYA 1EKXA 4TL6A 1FYXA 5JT1A 3G88A 4QYIA 2OORC 3W2GA 2X3UA 5K0SA 3NO4A 5DOZA 1PFUA 3ID6C 1OLUA 3MWYW 3KZCA 4J2OA 3IRVA 2CGEA 4BJ5A 4DIBA 2FKNA 4W5TA 2CNWA 1GP2A 1Z8DA 4M9QA 1SUDA 3UPDA 1O9HA 1Z0AA 3FUWA 2FZVA 1C4OA 4KFCA 3O0DA 2QPOA 1L1QA 1R88A 3EGOA 5ERXA 2PJRA 5CFPA 2O2DA 1X1SA 4WVLA 1TQ2A 4ZCSA 4BHTA 3KKKA 2B9EA 3AY3A 4B6JA 1W8DA 1PD0A 2NZJA 3LLVA 4RHXA 2P3SA 3FNBA 5BWNA 2GBCA 4NJOA 3RYFA 2WNHA 4CUZA 4P35A 4NMWA 3FJOA 4O4LB 2JH3A 4P7JA 4UHHA 4IHJF 1NR5A 4RACA 5BT9A 1XALA 1P7YA 4YCNA 4QM7A 4OP3A 5KNCA 4MIOA 5CNMA 2MCFA 1J70A 2EBWA 1UMBA 1U7WA 3R4VA 4RU1A 1Y37A 1N2SA 3SQWA 3H4TA 3ZLJA 4J03A 5HUQA 1KAGA 1XTBA 2OECA 3MTQA 1ADYA 2WRZA 4KBGA 3NHUA 4QEKA 3V4SA 1YT5A 3ZCUA 1TJNA 5AUQA 2QRMA 1V39A 4F4UA 1N5JA 3TXAA 2I71A 1MW8X 2O14A 3B48A 2GZDA 2ZAYA 1BTOA 2ONYA 2VPIA 4I4TF 1EQAA 1AKYA 4KVGA 5CXXA 2VNSA 4UU8A 4YVFA 1NW8A 3QYAA 5E9JA 4RNDB 3W5VA 3AVXA 2IDJA 1R1DA 1M2KA 1W76A 1YS1X 5EI5A 3MMPA 4AWXA 3T99A 1ZUIA 4N0MA 2Y8EA 3V80A 1Q2UA 4AJ4A 2ZXEA 2DHCA 3FBWA 2IXGA 2P5TB 5ERGB 1KQNA 3D02A 2PEZA 2WJIA 4LRUA 3KZNA 1E9EA 4MGZR 5AHXA 1XO1A 1RYZA 3SIPA 5KQLA 5CEEA 1H9BA 1G4UR 4TYWA 3OF2A 2QGZA 2IOYA 1WZUA 1U7ZA 3HEAA 3W8NA 4B6EA 3W8EA 3RW9A 2HHHB 2EKDA 3CX8A 1QOPB 3HRIA 4FILA 1TEZA 4NP6A 1I4OA 1JAHA 2JANA 2ZVQX 4CMEA 4CIXA 1YQUA 1MX1A 1YR9A 4HEA1 2O8DB 2X0KA 5EZYF 1UF9A 2BI7A 4R9NA 3X1WA 5F1PA 3ZY5A 2NTNA 1O8CA 1ZGBA 2WIBA 3NOXA 4ANFA 1T6ZA 5CIYA 5BMVA 3ISTA 3WYEA 4B3XA 4FINA 2F9FA 3UXYA 1YJAA 2PR7A 1Z3CA 2QR2A 3BM5A 4NONA 4YCSA 1LGYA 2YV4A 4YTEA 1QP0A 1SCQA 3GEEA 4M83A 4GBGA 3ZUGA 4EUKA 3STTA 1P2VA 2BT4A 1BGWA 2F3SA 2ODPA 2NUAB 3F3SA 4RAOA 1A9RA 4E2ZA 3EQ2A 4HGZA 1RYHA 4M8LA 4DNXA 2ACEA 3QJGA 3V42A 5IANA 4M9ZA 5LKAA 2FHSA 4JKIA 3TSOA 1NYTA 3N6RA 4ERNA 4EZEA 1O95A 3CR3C 3IBFA 5DTEA 1YQTA 5LQMA 5AKEA 2VRBA 1VL1A 4KN9S 4ILKA 1CXZA 5FLKA 2ZU6A 2XT0A 4GC5A 4NF2A 4OHRA 1VPEA 1GFZA 4HH3C 1UM9B 1SIWA 4QE3A 3ZJVA 3HNRA 2OV4A 2GYYA 3FYSA 3TOVA 1T2EA 1U2DA 2I2BA 4MYDA 5K3SA 4R2XA 5K2MA 4RXTA 2OHIA 3I9JA 3N7TA 4GR9A 5ALDA 4JX9A 2CF5A 1ZCJA 1SU6A 1I94B 1FXWF 2IDKA 1W29A 4FGSA 2YQ5A 4CZ2A 4QYTA 2XB6A 3C7KA 2HTEA 2QL5A 1E9SA 3Q12A 3HYTA 3NEPX 1NP7A 4GR4A 4RK7A 5CNJA 1N7GA 4I5IA 1XD8A 2Y1GA 3IA7A 4FNGA 4GX2A 4JR1A 5CTJA 2I67A 1XLVA 4KXWA 1M1ZA 1QFYA 2V7EA 3MOSA 4C07A 3RIYA 1GLVA 4AXXA 1IRXA 3RIHA 1ENYA 3IHKA 1VPLA 3W5BA 2PUCA 4H3SA 3LHKA 5LB4A 1F20A 3H65A 3LPLA 3SM9A 1ECJA 5HZHA 3IIJA 4CMCA 3MT9A 2BFBB 2WICA 3AXSA 4FEGA 3K4QA 2UZ1B 4JUIA 1DC7A 1SKBA 3EMBA 3MTBA 3PC2A 2CNNA 4JASB 1T8UA 2P35A 5EAIA 2VOJA 1NBMA 1EWYA 1GUBA 1IWOA 5KYXA 2FW9A 4A16A 1UBEA 4GOND 3E1GA 3WLOA 2OQVA 1ISGA 2FK8A 3FCSB 1A82A 3UJ6A 1CZKA 3KPYA 3ZJUA 3DVAA 4BMPB 2ZUVA 1T2DA 3UJ9A 3DM5A 5EKTA 3VPCA 3BJRA 4X92A 4U9UA 3IPRA 4BX8A 3E5MA 1T34A 5D85A 2V9ZA 1E1LA 3GLFE 4PPFA 1JQAA 3ECSA 1OMOA 1WMDA 3BYZA 4MQFA 1UM8A 4D8VA 4G4JA 5CBKA 4V0LA 3AR7A 2FG7C 3DXZA 4NENB 5CLHA 4HFNA 3ELWA 2V5VA 2A59A 3F7TA 3Q8XB 2W37A 4H6WA 2VQEB 4KDRA 2AGVA 3GN2A 1WKVA 3DWEX 1MOSA 5U4XA 1TIPA 2PX8A 3IAAA 1XRLA 4EGJA 3DMYA 5BOSB 4OMFG 3PDWA 5HCUA 4GE3A 4R2LA 1VCNA 3GVCA 3WB0A 3JCZA 4RZQA 2LNDA 3L79A 3NALA 4OMUA 1X70A 3MQ2A 4OHCA 4EG6A 2K7ZA 4QHYA 3KP1A 4G1BA 2NTEA 1QPGA 2I7CA 4LWPA 2O23A 3S40A 4HQ6A 1JLSA 2QN8A 3H2KA 4BP3A 4DTCA 5JU6A 4E3ZA 5IK2D 4ZCRA 3Q8WA 4UDYX 2Z95A 5EFZA 1PZFA 1MVOA 2Z8YM 1V8OA 3LW8A 4AMUA 4TZTA 1JJBA 4Y2UA 2PCLA 1XIVA 4L27A 3T35A 4MKXA 4EHIA 2HF2A 2YR0A 4J3FA 1DQNA 2EC5A 3QEAZ 4CKBB 3A2NA 5JRDS 4CKZA 5JZSA 3UTCA 1MV8A 2BFEA 2X6RA 1E2HA 1MJGA 3CC8A 4FFLA 4IHJA 1QR6A 1ND6A 1WCIA 3KDSE 4DLBA 2WAOA 4RH0A 2DXIA 1YGYA 2BUAA 3VU0A 5DNUA 3DVRX 5ITZA 2OXRA 1Z25A 4EY7A 2I1LA 1B1CA 2RH9B 1EGMB 1OASA 2BDTA 1K9VF 4ABTA 3JZDA 4KCGA 1MN6A 4PPNA 5H3LA 5BRNA 4UARA 4IIJB 3TIGA 2B98A 2RGEA 3O2QB 5CG1A 4YB8A 4GKAA 3IUBA 3K4HA 1G42A 2X3YA 3O4HA 3EAGA 4RENA 3F4BA 4GMHA 4TRNA 4YRLA 1GGEA 3UOGA 4GX0A 4UTOA 4I4TA 1OPXA 2UAGA 3O8QA 4DAEA 1NKVA 4JL6A 3ZD7A 1BWRA 5E6SB 1JPUA 1C3VA 4W9NC 1FNDA 1GZ4A 4DLPA 3S4YA 5K99A 1OYVA 1NT2A 4G0XA 2VFAA 1H2AS 4IG9A 4YP7A 3V4PB 2EX0A 3NATA 4CQMA 4KREA 4K8OA 1QU3A 4WY8A 4HMPA 4XUEA 5KUTA 3DAGA 1GGJA 1F2TB 1NVDA 1TJ5A 2J33A 3LX6A 3URMA 2YHAA 4FFWA 1OHHA 1SXIA 2AN1A 4UHDA 4X5OA 2CZCA 2Y2UA 4RLQA 4QXQA 2V0NA 2YC2C 4Y1GA 2XMQA 1FSZA 2I4MA 3RAFC 1NVTA 2OE2A 1BOFA 2YVUA 2ZREA 2ZIXB 2TS1A 1A9SA 1KQ3A 5ADVA 3A6LA 4GOOD 4KPUB 4JEIA 1I4EB 1RQNA 2C4WA 2ZETA 3LZDA 3ORYA 5LZ5A 1AU9A 2BZ1A 2C1EA 3GGGA 4FOLA 3IBTA 4D9IA 3SQXA 3KWMA 4F1WA 4F7WA 2FZ5A 2J3DA 3CZAA 3E7WA 2HADA 2JJ1A 3KHUA 3NHWA 5EMHA 4QDTA 1N5DA 5CK5A 1GVNB 1IXKA 1G1MA 2YMQA 2IEAA 2PL5A 4MDHA 5LZ7A 4ZVOA 5TIIA 1MHTA 4W8OA 5BXYA 1Q1GA 3HXPA 3H9QA 1TTPB 3VU1A 2XNDD 4LXHA 3VH3A 1LX7A 3UF0A 1XELA 4WUTA 2YVAA 3ADPA 1TO2E 1H1LB 2AJTA 4X1KA 2QZJA 2MSLA 3QYPA 3QFCA 4YAFA 4EVSA 3H5NA 4MAAA 5IZCA 1KOGA 1MC8A 3LPMA 3LVFO 3OLQA 3V1MA 3KJHA 3FYTA 2MTBA 1BS9A 1V43A 2HIAA 3GJ8A 3WIEA 1RJ9B 1RHQA 4W5OA 2V45A 4GM0A 1YR2A 3FTEA 2IYTA 5ADUS 5DHRA 1FRQA 1M54A 2VSXA 4UW9A 4I55A 1CIPA 1QHEA 2ATEA 1LPOA 2X8JA 4OK6A 1WUTA 2VDPB 3IQZA 2FKAA 3OY7A 2ZJFA 1KK3A 3O2NA 4J3JA 3EQ9A 4E46A 1CZLA 1XCLA 1FXWA 2Y9PB 3R3WA 4I5EA 2GZRA 3YASA 3WO1A 2BD0A 3H9JA 2F48A 2Q49A 3WNVA 1QHNA 3ZW7A 3NAQA 3LX4A 1QPBA 2HEIA 3AUYA 3OAAD 4IO0A 1T8YA 2NPOA 3D6MA 4QU0A 4U7PB 3K9WA 4JYBA 4BO4A 1V3UA 1QYRA 3OLCX 1Q7TA 4LQ4A 4UEKA 5A0VA 1C9DB 3HJUA 1JTVA 4WMLA 2WTBA 4CM7A 2QTZA 4FHFA 4N5IX 3H1BA 1R16A 4BLPA 5HVNA 2Q3FA 4NJEA 1E1KA 1OFTA 4HWKA 2VAMA 4BN4A 3QTBA 3MA0A 2GZMA 1AHPA 1V6SA 2O5VA 4DJAA 2PJZA 3EWIA 4J1SA 3A2KA 4G36A 4DR5B 3A3KA 4O33A 3P94A 4ACAA 1PI3A 3QUCA 3HBNA 1I0LA 2OM2A 5DNVA 3LFHA 2YUIA 4BFXA 1ZZEA 4QT0A 5EERA 4ZKDA 1YCGA 2P2DA 1KMIY 5BSVA 1MXFA 4RTNA 2HXYA 1U8AA 1Q20A 1RM3A 2HJRA 3V8MA 4BU0A 4LX0A 3SC2B 3WRXA 5CA0B 5LQRA 1D6JA 5FPPA 3HLYA 2FNAA 5B37A 3V2UA 2AVDA 3PHLA 1RLIA 4A7PA 2F64A 5G1NA 3SICE 1V5FA 4F86A 3C3XA 4B7XA 3PHIA 3KKQA 1H2XA 3NYIA 1A95A 1P2GA 5CDSA 1KEPA 1R10A 1LC3A 1SAYA 3B9QA 5EIWA 1UBTS 3K8ZA 3TTWA 3U0BA 4QQ8A 5BQXA 5TSDA 3D4OA 7YASA 1DRWA 2XYPA 1DKUA 5FTMA 4BEJA 4OFXA 5E4JA 4CI0B 4F4FA 4MKGA 5AQ1A 1VXRA 5JBIA 4ALLA 2BL4A 4ZYXA 1LSOA 2ZUUA 3OZXA 2PZFA 4W1PA 4LYGA 4C4SA 1U2QA 3DHYA 4FE7A 1HTWA 4UHCA 4ZQEA 2PJUA 1YO6A 1ZICA 2RGNC 3BKXA 2YFYA 1RRFA 4OJYA 1TJ3A 3HMQA 3KTDA 3MELA 4Q3AA 2WA1A 1PVOA 4JITA 1I3KA 3LLUA 3V3KA 5J47A 3KAKA 4XXHA 1N2GA 1C7QA 4X3CA 3WO0A 1BDHA 1VHJA 2C4VA 3KOWA 1W1WA 5J2TB 4W1SA 2FQXA 2YY5A 3ZVLA 1V26A 2IEZA 2QN6A 2CXNA 4D1YA 5A06A 3R7FA 3LDGA 1C8BA 4NYIR 1N5LA 3U16A 2EQAA 4R7TA 3H5AA 3FR7A 4OMDA 4QUKA 3QY0A 3ZGLA 2VSQA 5KWSA 1U3UA 4B0OA 3GLIA 2K5UA 1NN0A 3ZXSA 1UXJA 3C3BA 4P7FA 2AIRA 3GD5A 1DBPA 3K35A 4TSFA 4X8HA 1R3DA 2IPOA 5B1DA 4ZT5A 5A3RA 2OBFA 5EWJA 3DMRA 4L9SA 1GSHA 4UJ3A 3VYVA 1H9AA 5HTKA 3DHEA 2PSJA 4LZAA 2TMGA 3A4NA 3DWGA 1IY8A 2EW2A 2ZE8A 3IVGA 3AR8A 4PSCA 4PZLA 4QWWA 5AHWA 1GDTA 1XF9A 3DO5A 1KY4A 4LXGA 4QUDA 4KX5A 1XU4A 3TMYA 1W4RA 4BO3A 4BVJA 1UXOA 3FVRA 5I7SA 1GPWB 1VSTA 2CK3A 1JMYA 3DJFA 5TC4A 3EK2A 5SYNA 2BBWA 1YZGA 2PYZA 1JHRA 4R1QA 4DLTA 3AEUB 1SUEA 3HBAA 4B6SA 4TWZA 3BS4A 5L9AA 1ZRSA 5F76A 3CG4A 1MVLA 1UK8A 2CNDA 2NU9B 4FBMA 7MDHA 5LPNA 4B31A 9LDBA 1XA0A 2G0AA 1DIAA 3FG9A 2B2NA 2F00A 1PL6A 2P2NA 2YW9A 2EIXA 3FWPA 1QHYA 2G06A 4G01B 4KRXA 2PUEA 2Q3CA 2XUAA 4Q3NA 2W42A 2G1KA 5HOEA 2DR3A 1IXSB 1I8TA 2VQ6A 4LZWA 1WCYA 4MPTA 2FPGB 5LLSA 3R7LA 2UUAB 1M2JA 3HY3A 1JBQA 2A9JA 2WJZB 3A1TA 4HQLA 2C42A 4MIYA 3CIFA 5FI1B 2GJAA 3F47A 3CPSA 4HL6A 4N0EA 1GA4A 1H85A 5DRTA 1S1MA 1WBJB 1ZESA 2QMZA 2UUCB 4C7MA 1SU4A 4KQEA 2X2OA 3H97A 2QNIA 3HU5A 1OAOA 1DMSA 1WMFA 5MN4A 3KVVA 3LLSA 2GPSA 4P54A 3CX7A 1JEQB 3N2EA 2VYFA 5KCZA 1JEYB 3T94A 4YJFB 2O7QA 3DOFA 4CCSA 2LVBA 4WTOA 5KKNB 3RADC 4IKOA 1EUQA 1ZC4A 4R1PA 1OFGA 3BORA 2B7LA 2C3MA 3VO2A 3H2SA 3OZ7A 4BNFA 4CGZA 2GCGA 1R64A 4Z3KA 3CWZA 2C8JA 1E69A 2EEZA 3P8ZA 3ES9A 3OZFA 4EI2A 4YCLA 5TQVA 1PT9A 3GY0A 2FV8A 3NCHA 3U9TA 3RG8A 3ZWPA 2WDZA 2JIMA 3FCOA 2X0EA 5INTA 1MX9A 1Q0LA 5T4EA 4NMLA 3QFSA 1E99A 4NESA 4Y6RA 4DCNA 1IE3A 5BN3B 2Z5FA 4HLQB 2D2EA 2HBZA 1GXSB 4KO2S 2OFOA 3OKPA 2PZLA 2W8BB 1OLOA 2VLBA 2F1RA 3BERA 1AZSC 2FLWA 1KDOA 2AYXA 1NXQA 4JT2A 4D6XA 4CV3A 3ZWKA 4FS8A 3TRIA 3EC2A 4GLOA 5ALIA 1OWPA 2J3HA 2OEPA 2QP3A 1WB4A 3D8BA 3CUWA 4RSRA 1SQGA 1CLUA 3K30A 3NFRA 1RAGA 3NRCA 4TKUA 1KMHB 4JJGA 2P8JA 4MTLA 4UKDA 4M0MA 1K4YA 3ONVA 3PG5A 4R3WA 1V41E 1ZWKA 2GRUA 3TTYA 1ADJA 2IXAA 1K3UB 4H1UA 3AVPA 4QPPA 1G6KA 1KKUA 2O57A 4BNKA 4Q5IA 2PZJA 3MRVA 1TKRA 4RLFA 4IIJF 5DK4A 4GU5A 3SHOA 1BU5A 5KI6A 3P2JA 5CR9A 4DS3A 3J81A 2L42A 3PUXA 4F6RB 1AH2A 3BFJA 3ZLUA 1RRKA 2G9RA 2OA0A 3I6IA 3WOVA 4KXVA 1J2RA 1P72A 3N3BC 5CB4B 4PAMA 2VUTA 4GXNA 5FWDA 2FTKE 1E18A 1FDSA 3IXLA 4O2BF 3RVRA 4B48A 5BVHB 1F2UB 5GOTA 3GLGE 2H8KA 4OUKX 1L8LA 3RSOA 4RHTA 5G0SA 1J09A 1TC2A 1G21B 3L7CA 2QJTA 3UT5B 4RH3A 1YVPA 1MJGM 5A9RA 2ID9A 3D3EA 1O4VA 2CUKA 3FPLA 3SF8B 1F0KA 1SA0B 2Q50A 3JWIA 4EYGA 2FF7A 5DJ5A 1NR7A 4H77A 1J20A 2FEKA 2ZBRA 3HN2A 3AI2A 1D09A 3ENZA 1MJ5A 3HRHA 1U7XA 4JT9A 1SPXA 3L4KA 2G1PA 2SKEA 4HNUA 4WZZA 4YHHB 3AGQA 2JPDA 3P19A 1JHQA 1IEXA 3EEYA 3EWSA 1LF0A 1BDJA 1PZXA 3PD1A 2M6RA 4NU6A 2NP7A 1V9SA 4HAUA 1OBOA 3DP9A 2PRJA 3VZDA 2XT9A 3W2TA 4AKTA 1K6IA 3KTFA 1V4NA 3MWFA 3TZLA 2ECFA 4FPXA 4ZALA 1JIKA 2GARA 1CUHA 1YVDA 4TVBA 3L8YA 2Y77A 3MAAC 3DLPX 4K03A 2NZ2A 1SKUA 4NU0A 4OP1A 3MAGA 1Q1ZA 2AI3A 2ID4A 2JLVA 1J24A 4UAVA 3D6VA 3KXDA 2HSWA 2GN2A 3V2IA 3GRRA 3UAYA 4IWYA 2BGLA 4GKVA 2AT1A 4EPYA 1MAAA 2V7TA 1ISSA 1C4WA 4K3VA 4K6KA 4BASA 4DMHA 3DONA 4JBIA 4WLEA 4D2IA 5TMPA 1KZ4A 3EF0A 5EZQA 4UEOA 4GBMA 1W9MA 1COWA 1H22A 2W6NA 1S8OA 4F5EA 1MZPA 1YSCA 1ESMA 1AV6A 1KETA 4BTVA 4XDZA 1K1EA 1XVIA 4ALNA 2C31A 3HADA 4ENVA 3X1ZA 2Z4RA 2CC2A 1ECLA 1UFRA 4PGFA 3BD7A 3SR4A 3GG2A 4MS3A 2F1HA 4EJ0A 1RXVA 2IYLD 3GRKA 3MINA 3KDAA 5EVCA 1ZFNA 3O75A 2QQ0A 4KOEC 2P9BA 4TYPA 2TYSB 3NH6A 4U7DA 1EWQA 3R0XA 1WZNA 2N9UA 4MRAA 3Q9NA 3FMIA 2RKBA 5KO2A 1SCIA 3KKOA 1IJFA 5FBQB 4F11A 3ZHBA 1AA6A 3JD2A 1RCUA 2LUOA 3QW4B 4I3GA 5AOVA 4G9EA 2XZPA 4EDHA 1HK7A 4URWR 1HGXA 5DWVA 5GM1A 4RORA 3SSMA 1FDUA 2J0EA 3VR5A 4U1RA 3VR5H 3D5TA 2G04A 4GWKA 4OLJA 3KYCA 4G1VA 4BBPA 4KFUA 3ZWVA 5A4FS 5MHTA 5EE5B 2PSSA 2NVWA 4RK0A 4ZAZA 1EESA 1TPZA 4I08A 2UZ1A 4CVNA 4JLOA 4RFLA 1PS9A 3RTEA 3VC3A 5A5GA 1BHSA 4NE7A 4CQNA 4JXKA 4IJWA 2ZDQA 3C1UA 1CSEE 3RBVA 3FDZA 5B3JC 3QVXA 2J0VA 2G25A 3B7GA 2YDXA 2CLMB 1Y9AA 2G08A 1V8BA 1I5EA 4PFSA 3OZCA 3P9QA 1L5RA 5CA0F 1GU0A 3KQKA 3RAJA 2Y6VA 3LPCA 5JWHA 4EFLA 4R5MA 2IYVA 1WY5A 1FXUA 4N3NA 1FVXA 2ZIFA 3KHSA 1M8PA 2J32A 2QRQA 2YV5A 3ME5A 4INOA 4TLLB 4YQFA 5FBZA 1WBBA 2QYTA 3AY6A 1C2TA 1GCGA 1PFQA 4PVCA 3O2JA 3UIEA 2RG7A 2OP1A 1FNNA 4A26A 1GQFA 1NLFA 2RKOA 2WHPB 4LG1A 3KS9A 1X19A 4CIAA 5JBQA 1UOOA 2F90A 1JSZA 3C3JA 1TA0A 4LCJA 3QWFA 1G8HA 1KZHA 4D45A 4DM3A 2IZ5A 3S1AB 3NHZA 1S2IA 1UINA 3INGA 4DMGA 1E0DA 4YGXB 4WASA 1CRZA 3QVUA 1DZ3A 5IM5A 4RADA 5H4GA 2VH1A 3P4UA 1X7XA 2RGUA 3C5VA 2E4XA 4XGKA 1J5EB 2LR0A 4XJVA 4DHEA 2X6TA 2QKYA 1TO1E 5TVKA 3OEED 3OLYA 4MW0A 1T9ZA 3L7LA 4Z51A 4RSMA 1OB2A 4ZOBA 4DGSA 3K0FB 3BWDD 2Q99A 2COKA 5J2TF 1PNRA 5FL3A 1BXRA 2X0JA 3BIWA 4OK3A 3OPYA 1FFXA 3PT5A 1NASA 3BAZA 2R6CA 1XCPA 2BISA 2GVNA 2QL6A 2ZRQA 2HBRA 2QX6A 4MJ7A 5KJ1A 5KNDD 3EGVA 1ESEA 2EHDA 1FYWA 4YJ3B 1KHHA 1OX6A 2BGRA 3LBIA 2VTVA 4FTWA 1NWHA 5F2KA 4N3AA 1GQRA 3W2FA 2WJAA 3GLUA 3IBGA 2FSVA 3BK1A 4G1MB 4RQBA 1QYVA 1EZZA 2P5YA 3C5EA 3O4FA 2GQ0A 2AN9A 4J6EA 4Q9AA 1FTYA 2W6JD 3CW2A 1SUCA 2G3YA 2VCYA 3PDCA 2ZAMA 3MGGA 4IS2A 1R5NA 4AZSA 4WKGA 3A10A 1WWKA 3LCRA 1MLDA 2QR5A 3NBZC 4ZCPA 4E4TA 1PJAA 5HZKA 4DR4B 1RZUA 5JHGB 2EHJA 4LBZA 4AB1A 2WJ3A 4HDMB 3OIFA 1MQSA 2XE6A 5C3MA 3WYNA 2EJBA 2OENG 4XRRA 4M36A 2ZIUB 1YNSA 4YRAA 1Z9BA 4KHPB 3VU8A 1TZCA 4KPGA 3EASA 3ESAA 4RIIA 4Q7JB 5AVWA 1FCJA 1QKIA 2HPZA 4MVJE 1JLMA 3N8IA 4LCBA 4WDQA 3BQNB 4I1UA 1ODCA 5KWJA 5JJCA 1HTTA 1QUFA 3PFHA 5E6SA 4BV9A 2P2YA 1CDZA 2JJ2A 4O2BA 4RDIA 4EYQA 4M1EA 4PC2A 2CE7A 1WABA 3L84A 4WWHA 5KYUB 2NUPB 4MCHA 3LDAA 3S7ZA 1IDOA 4CLRB 3D3WB 4IQ8A 3ZGNA 5IDVA 3CLHA 5HE9A 3D6HA 2BUCA 3SVZA 4YT5A 3I3OA 1AUOA 1VBMA 1CEQA 2C2OA 2Q07A 3IJRA 5EG5A 5B7QA 4FYWA 3LUGA 1W5FA 4K1XA 1PZGA 1M2VB 4BKMA 2CWDA 1F2TA 5M29A 2V54A 3LRTA 3GC6A 1W85B 3C85A 4JYAB 2H1RA 1MBZA 2Z3ZA 3UMGA 1UWLA 2W2LD 4COKA 2UZ0A 5ELXA 1Q1AA 4FYPA 1BXGB 3L1JA 1Q6YA 1W0CA 4HN2A 3VSCA 1A1VA 4P31A 3HR4A 2FW7A 1DS6A 2YCLA 3HZRA 1R0XA 1RJEA 3I6MA 4WBSA 3EY4A 5CITA 1CF4A 4XTRA 4KBFA 1GIAA 3D2CA 1ZH4A 4Z0NA 4EW3A 3HJFA 1X1RA 2W48A 3B53X 2FPUA 5CNKA 2XXAB 5CIQA 3GV0A 1RLMA 4LGYA 5I8PA 2H1WA 4KDEA 1QAOA 3L9XA 3UMFA 3ITEA 1DXHA 4EQ6A 1T9GR 4PQFA 4B44A 2XZTA 3P2OA 4OU4A 1T3TA 1B16A 2ZYGA 1H1LA 1RFGE 3A1SA 1L7VC 1M34A 2ODNA 3OE5A 3GEBA 4YJDA 4E11A 2BTQB 3TYXA 2W83A 2YMPA 2QM8A 2ZGVA 3EXEB 3FPJA 5JXJA 2IV2X 1G18A 3WHPA 2BF4A 5HCNA 3KRTA 3O74A 2C3UA 3ISJA 1RJ9A 3GHHA 2PXAA 4HNGA 5BYJA 1I2MA 1JVSA 3M4JA 4RHFA 1KFEB 1HX7A 3P26A 4PZUA 5E9AA 3OFND 5JEEA 4OX9B 1BW9B 5MN6A 5LR6A 4BB0A 4X20B 2NZXA 2QXYA 3DBVO 4L28A 1SNYA 1GUZA 3C6YA 5IXJA 5A1JA 4ENWA 2RH4A 4GVLA 3I3SR 2DFVA 4LNUA 1QVWA 5LYJA 1N4AA 1KSFX 5HILA 1Z6PA 1ISJA 1BEUB 2GLXA 3ICPA 2Q6LA 3WKAA 1LDGA 1P2DA 2Z1MA 3Q5DA 3IB3A 5IX8A 1TOAA 2JKZA 2FDCA 1Z8FA 2EGUA 3I52A 4KVAA 1XPJA 4BJHB 3LBNA 1Z6AA 1TZJA 2DULA 4KRGA 3T1TA 1OH6A 1VJRA 4PX3A 3WGQA 3I09A 1E64A 2GKGA 2P78A 3BFXA 1RCTE 2BH9A 2VHEA 3C39A 3HN7A 4OF4A 3THOA 2DQSA 3GLVA 4C9BA 3PCTA 1CETA 1UPBA 3OETA 3NHBA 3I04A 3PZRA 4LXTA 4OJNA 4FDUA 3HXTA 4PC1A 3O8CA 3LC7O 3CE9A 3F1KA 4IV5A 3KZXA 2FN9A 1GQQA 3TQTA 3DMTA 4KEAA 1PZEA 3VNSA 4KUEA 2ZKIA 3OPXA 4OAQA 1BKYA 4OQXA 3WHLA 4NH4A 4PO1A 1EFRA 2OKGA 3CUYA 4Q3DA 5CA0A 3SC2A 4ZI5A 1AKWA 2B8WA 2IA5A 1OZGA 3UTDA 3WWZA 1C41A 2IYSA 1NJ6A 4NZNA 3TOSA 2I6SA 5DDIP 2FPSA 4PQGA 3NX4A 5DM4A 2MYUA 1KY2A 1AY0A 3IEUA 3DHNA 3W5AA 4RX1A 1OZ0A 3L0PA 4C7JA 1QQ5A 1H4TA 4J0QA 3RSSA 1WU8A 3TD6A 2A2ZA 3FE2A 3MJTA 3NP7A 3PGA1 3PQ2A 4ZQBA 3G8CA 3G2HA 5FA5A 5BN4B 1XGKA 3GH1A 3LQ1A 2VL7A 3T9AA 4FT4A 3JD3A 1UDWA 2NQTA 4BB6A 1DWUA 1BCSB 1N1DA 3DC7A 4RGYA 5FWXB 1P0CA 1AUQA 1WS6A 2JCYA 3TEJA 2BDUA 4MPRA 1BROA 1Z2CA 1V4VA 1SWWA 1WQ3A 1WPGA 3L7BA 3UEOA 3HH8A 3WGHA 4DV4B 2IZ7A 3L49A 4HWOA 3ZY6A 2FSSA 1J07A 2D5CA 2DWOA 3GBPA 1NJ1A 5GJVC 1IQRA 4RULA 3L7DA 3AMVA 2ZYSA 4WADA 4E2YA 4JAVC 5J2TA 3GU3A 2XADA 4IIYA 2GN1A 2VO1A 1CK4A 4HS9A 2VF7A 3K8YA 5E7JA 3FWHA 4DCGA 1CULC 3VJRA 3HCNA 1B42A 2CLCX 4QOEA 3V4LA 4BATA 5LQUA 4U63A 1NE7A 2WU4A 1XQ6A 2G5GX 3DFFA 4MVJH 3H4IA 1FU4A 5KYYB 3EPKA 1E7YA 3C3AA 4HRVA 3Q7EA 4DMCA 1WR8A 2IKQA 1IQ0A 2PU5A 1Z0DA 4NXNB 2PRZA 4JVOA 3R7BA 4WDRA 2H2GA 3K9GA 1GPUA 1RP7A 4WFKA 4HFJA 4IDPA 2VVTA 4LHXA 1RZ3A 4G8DA 2B1RA 1L4KA 4L8FA 2VHXA 3W5CA 4ZAFA 1RBQA 1Y48E 3H84A 3K9CA 4C14A 2VP5A 2P4QA 5DN6D 3HWWA 1SOUA 3ASUA 3D6UA 1YI8A 4TS9A 1PJQA 2CUTA 2XHEA 4LISA 1XZLA 2NU9A 2B36A 4Y2GA 4E33A 1HKUA 3ESZA 1JILA 3VJLA 1TF2A 3L77A 2FUG1 1TUBB 3CRVA 4QDOA 1DXQA 1KMCA 1NYRA 2YIVX 1TJ4A 4HQFA 2H5LA 2L0XA 3PI7A 3O73A 3ROXA 1CT9A 4YIKA 1KI9A 1ZJYA 2IZ0A 3V4RA 2PT5A 4HDCA 3DKKA 1A4RA 2DFPA 3ZHTA 3KJEA 1J0EA 3JQRA 5I9LA 1OKKA 1G16A 1KQPA 1S9HA 3FOFC 3PQ8A 5JC1A 2Z6AA 1QTNA 3KZKA 4XIYA 5HR5A 4MQLA 2ZT8A 1HR0B 3E03A 3K5WA 1YI1A 4IJUA 3TQCA 4OBBA 3W1EA 3QEBZ 4V0KA 1UOEA 3CW8X 3IPYA 3JD0A 3M4ZA 4V2UA 2JZNA 2AJ8A 3OUUA 3QWHA 1E6LA 1KYZA 4WBXC 1JG3A 3QKSA 3PUYA 1ZIYA 1WD7A 4YJFA 1GU1A 3GMIA 1VSBA 4D4LA 1V2GA 1TJPB 2EFDB 3MOGA 3Q4GA 1SQSA 4L8VA 4OL9A 4QEZA 4RJ2A 4RCZA 4BRWA 3BD8A 3GELA 4UTRA 2HJHA 3F6SA 2IPMA 4M1WA 1PJRA 1HZJA 2Z56A 5B3KA 4E4YA 4PN7A 3H2HA 3IAHA 3K9LA 3H18A 4ENPA 1XJCA 4PHFA 4Y2SA 1UP6A 1QGZA 1U94A 5BN3A 5KYWA 1GN8A 3HFSA 4RIGA 5KU7A 3O26A 4LDNA 3UJ8A 4CCAA 2W8BA 1LI5A 2NW6A 2PD3A 1JUDA 2QN3A 3C43A 3DR3A 3GUCA 3WYGA 2VUIB 1TT5A 1Z7BA 4FYHA 1Z4OA 3H9BA 4JWTA 2QR3A 5L53A 4YJ3F 1R3UA 1HYHA 2O8EB 1JDZA 3NWEA 4PR0A 1ZN7A 4RELA 2LRHA 2QE7D 1Z4NA 1ORRA 2XD4A 4E5YA 1KMHA 2M6LA 1FB5A 2P9CA 1P2BA 1JGTA 4PHGA 3ZWQA 5H16A 1N5IA 3CINA 3JZIA 3DUFB 1ZKMA 3AVQA 4WH0A 3ZVKA 1X80B 4IDQA 4YJHB 5AI9A 3FHCB 4AX8A 3FPHA 3Q8LA 3OBIA 2ZJ4A 5FOUA 5TGDA 1ODLA 2H17A 3LGXA 1Q57A 3D0OA 3O9MA 3R44A 4LJYA 5AXBA 3UWKA 4WBNB 3LX8A 4OEHA 4PG5A 4PQRA 2A1UB 4Y9TA 1IWPB 1C7IA 3MHPA 1U0LA 1MVNA 3DBHB 3OQ1A 4TMWA 1B0UA 5DYIA 1EXNA 3MIIA 4G1CA 5CCBA 1K8XB 2PLFA 4FHCA 3D6TB 5DPMA 5FTLA 1NQTA 4MQMA 3ZHZA 2P2SA 2OWDA 2GO1A 1OGJA 2Q2NA 3ITNA 1YRHA 2VIIA 3FFBA 3NV7A 1G21A 3H9CA 3KL2A 4ZV9A 3HXLA 3LCMA 4YQEA 3UT5A 2R1TB 3DMFA 5HQ3B 4JVLA 1TM5E 5F35A 3SF8A 1ICEA 4FONA 3OZRA 4D4JA 3R09A 3UBMA 1WLSA 3JWEA 1E2BA 2XITA 3ZHCA 5KVSA 3WRXC 3DT9A 3UV6A 1M67A 5JHHB 1HQYE 1KRXA 5BSEA 4GT1A 4QBIA 2NNLD 9GPBA 5K6TA 1JJVA 1MC5A 1XRRA 2G0NA 1Q84A 3HWRA 4DBLC 5CFMA 3PQDA 1OVGA 1XVUA 3GL9A 3VOAA 3P0JA 3FTNA 1U6IA 3L40A 5T3YA 3B1KA 1U4OA 3AM5A 3HCFA 3L41A 4ZODA 5LIPA 2QU7A 4M89A 4TPKA 1CE8B 3HCBA 1GITA 4M0EA 4NBVA 5DTJA 4GMFA 3RSLA 4G8CA 3PQ5A 5DE3A 4U02A 1J23A 1HG1A 2DH6A 2P9TA 1C1XB 5JD5A 3SSAA 3DGFC 1LW6E 4L7QA 5FL7D 2ZSDA 3RK1A 3SSNA 4CHTA 2CLLB 2CXQA 3G1TA 5D8DA 3QX9A 2WU0A 5HRAA 2A78A 1B0PA 1KJ8A 2GXQA 2ZI4A 3C0KA 4I8IA 5ER6A 3UWPA 1MO4A 1OC2A 3GQBB 4QBFA 4KTTE 2QMUA 4N76A 1C1DB 1QE5A 4F85A 1H0KA 4BVKA 2J0UA 4LNAA 2TMKA 4Q34A 1V16A 2Y1FA 4CL8A 1CVIA 4J0HA 5JCOA 3MJRA 3RODA 4V39A 2WQ7A 3KSUA 3IQWA 4QLBA 2QBYA 2JIRA 5FOWA 4M9UA 3RS3A 4YRBA 2IIPA 2VSOA 3WLQA 4EAQA 5TPWA 4HAIA 1EP1B 1NLUA 1SU7A 1M1NB 1A3CA 1ORHA 2PNFA 3FGOA 3IDOA 1V11B 3KUUA 2O2HA 3GMDA 2HPHA 2Y1CA 2C8VA 3D7MA 1XDGA 3VSBA 1FPQA 1KJQA 5EIAA 4FYMA 1KEVA 4EGCB 3PGKA 3R3ZA 1G3IA 2P3LA 3T3NA 4NYMQ 2IEDA 4HX2A 1T26A 1IWBB 3QI7A 4YUAA 4ER0A 1LDYA 4XA8A 3CSDA 4J0IA 3HNPA 5F5LA 5JLAA 3FHTA 3TLBA 1YJ5A 1HYBA 1T4BA 1U2GC 2HT6A 3GJXC 5I45A 3U7HB 4EB8A 1JI0A 2PKYX 5FYQA 1Y6QA 2NT3A 2B8JA 2AG1A 1U5BB 2AFHB 3IPXA 3L93A 5DW3A 5E4TA 5KDDA 3RAEC 5D87A 3OQIA 4CETA 2KBFA 3I76A 2DWUA 1NY6A 1XCGB 5AM0A 3SDSA 3EC7A 2DLCX 3E70C 2GYUA 1ZH2A 1CUGA 3FUXA 4I50B 4E7PA 4IJMA 1H8ED 1YFKA 1BKDR 4LRQA 1PGQA 2DSNA 1OIWA 4NBRA 3WGJA 2YV2A 1TU4A 3IQGX 1SMKA 2GVDC 2BGUA 1G8MA 3CWCA 3FYDA 1OAOC 4I1VA 4IJKA 3O47A 4YALA 3ZD8A 2N42A 3DLTA 1U0SY 4WE3A 5EKSA 2B82A 1TKBA 3IIKA 3UNXA 3UYLA 3WMRA 4HR7A 3T3OA 5CJJA 3S1AA 1D4FA 1GEGA 4AQDA 1KTIA 4GS5A 1YD7A 3I04M 4LYYA 3PEVA 1DBIA 1KJIA 3ONWA 4M9CA 4LY9A 5KQGA 5U1PA 1HQCA 4JOCA 4TZKA 1O97D 2AS0A 2Q3EA 3FVWA 1SUFA 5HIMA 1JIVA 3QMMA 3VH1A 4XFJA 3D7NA 3F97A 1PT7A 2DWPA 1MDBA 2RAVA 3D8SA 1K3FA 1I2CA 3D2AA 3IT2A 3P97A 5LOVB 1X8KA 1NP3A 2DLDA 2DUUA 3O4IA 4DOMA 3L7IA 3GA0A 4D46A 4ER5A 1TAUA 3NKLA 2LTAA 3QVLA 1E1DA 2NYRA 2QTVB 3EIQA 3OFKA 4G0PA 3ZE2B 1E5VA 4G0ZA 5ICSA 1JMVA 1S2GA 2R62A 3Q3JB 1CRWG 1UKEA 3N28A 4L0QA 3NHMA 4C0BA 5HNKA 2ZUDA 1T24A 1F2VA 1CX9B 1H1DA 2FE1A 3MJHA 2W0SA 5BVGB 3KTAB 1HM5A 1PNTA 5KYTA 2QG9A 3I1JA 1Z13A 1SUWA 3JVVA 2XXJA 3LO5A 3QVMA 4XDHA 5THQA 5I5GA 4DBVO 4EVRA 2J7PD 2FPLA 2I1WA 2LCIA 3FRJA 4JROA 1G2IA 4M0FA 4KYTA 3ZU6A 4B4UA 4DILA 2VJAA 5BWMA 1NMEA 4MA5A 1SD2A 5IAJA 5BSFA 1EPUA 2XOXA 4Q00A 4LXYA 2XMGA 1RQRA 1QONA 2IYWA 4GBJA 1JIJA 2EW1A 2FVYA 1O4WA 3NXKA 4C0XA 4BYMA 3ERCA 1DEAA 1Z2DA 1H2FA 1FS5A 3IKMB 4IFIA 1JSCA 1U65A 2POQX 2GCOA 3MCAA 1KDRA 4HNRA 1PWYE 3RSGA 1FU7A 3IAM1 2LZ0A 1Y3IA 3FB4A 1E2LA 2Q1WA 2ZSJA 4J1QA 1A0OA 4Q3BA 3R7WA 5B3AA 4DSUA 2REOA 2EFGA 2NM0A 4LMPA 3MSXA 5KYUA 3RJZA 2NUPA 3K0AB 1R18A 3L7JA 4IO1A 1UAYA 2AOXA 4QBKA 3D3WA 3U48A 2OHJA 3FHOA 4GGMX 2AOVA 3FWZA 1L5HA 3TTVA 1OREA 1NXPA 4ISBA 2GK6A 3M4XA 4JB0A 4IH4A 4U2FA 3V1NA 4JBXA 3EGWA 2VH2A 4I9FA 1VG8A 1ZK2A 4DJTA 5EJ4A 1KI1A 2YVQA 3ON5A 4PYNA 4TTRA 2RBEA 3UBTA 2C78A 4C6HA 2P3OA 3B78A 1E2IA 1ZD8A 1W4LA 4WGFA 1E5LA 4TTJA 2I3DA 2PZBA 2QTHA 1ZA2A 1Q14A 1ZJZA 1U3TA 4HJRA 2DECA 1L5LA 3L43A 2HTFA 2MSCB 1JBKA 4IDBA 3WQBA 5AW4A 3GLFB 2XF8A 2XECA 1ZD5A 5FWYA 3PEEA 1P80A 2Y92A 3N0WA 3NBUA 3EQ8A 1TLLA 4DEYA 4ZVMA 1L3BA 1A8UA 2EGGA 4URXR 1RWKA 2R85A 1EVEA 2AWNA 3IEMA 3LBFA 1R4MB 4NS1A 1JKMA 1GL7A 2PIAA 1RI3A 3NAGA 3U49A 4AG3A 5KTPA 1QK4A 1XU9A 2XNKA 3M82A 4QJBA 5JUWA 5ALQA 3EXEA 4HDNA 3P5BA 2IPLA 4PAOA 2ZUBA 3H1GA 3V00A 4MUIA 2C98A 3JVIA 421PA 2G88A 3KQMA 2DE0X 3MBIA 2EDAA 2EWVA 2I6TA 4RMJA 1X1EA 4QEDA 4PFKA 3CNOA 3T1QA 3S2ZA 1UPAA 1U1DA 2AFIA 1KI6A 2PL9A 2R60A 4XUDA 3CONA 1KPGA 3IEIA 3OIUA 3UAVA 4ARZB 2DX7A 4EUEA 1U8YA 2FP4B 1TMYA 4FR2A 4NMXB 4G5QA 2J3JA 3I62A 1H5UA 1LBTA 3K05A 3IOYA 3H8VA 4GLLA 4BBAA 4Z4HA 5DTQA 5JMOA 2AOTA 4AI6A 3G9ZA 4W7IA 2Q6TA 5C7LO 1XWIA 5DHFA 5IABA 1C4XA 3EDMA 2C61A 3HB1A 4FCVA 4V0QA 1K8ZB 4MWEA 3FSGD 1JFRA 1LSJA 2OBMA 3HBLA 5DHTA 2XGSA 4F8EA 4B3RB 4XW2A 4HTFB 1VDZA 3AWIA 2E18A 3VZPA 2UYQA 3RFTA 1G5QA 1U9IA 2PSEA 1MTZA 1BFKA 3GJSA 5FYDA 1IUPA 2FDRA 3EHEA 4K9RA 5GZ6A 3MWKA 4MP6A 4TWJA 4B6OA 1EVZA 1VG1A 2C9DA 1A2BA 4J8PA 5EUQB 1XJQA 4C1BA 3HSYA 1M8KA 3BJEA 2BMJA 2XR1A 4CLHA 4EDFA 4G26A 5KTKA 1T9GS 4DDMA 1K63A 1G5IA 2ISQA 2QLMA 1RWBA 2R5NA 3EAQA 3KOZA 5T41A 1TM3E 3DEJA 3NPAA 4KXXA 1XDBA 2WF9A 4UMVA 3KT3A 1W9HA 4YC7A 3DOJA 2HREA 4W99A 3KZVA 5I4BA 4E5UA 2GN4A 4KQFA 3V7UA 2XCQA 3G68A 4A3SA 1UPUA 3TX2A 4MWGA 2ZUEA 5EYPA 1SU8A 3EXAA 3DE4X 4RTJA 4FK8A 2ZB2A 5BN5A 3E5NA 3LJKA 1V1MA 2WIKA 3D6NB 2FPOA 3R9WA 1PQWA 3ZH9B 2HU8A 4H16A 1KJWA 4B71A 3ZHUA 5BN4A 2C9OA 1VKZA 2X7HA 4L76A 2RI6A 5AM3A 5IKPA 1BCSA 5FWXA 2CFTA 2XUIA 3ZDYB 3QWIA 4H31A 4M1TA 2R0QC 1RDFA 5IXYA 3RE1A 2G07A 4HQ0A 4TUYF 5G3ZA 3B2NA 2HFJA 2ZR8A 3K0CA 5I7VA 4M6WB 2CYAA 3EPHA 2ZXUA 1UIMA 2J3LA 5ICEA 2P5UA 3SXPA 3A6EA 2XA2A 3CVOA 3DF9A 4NECA 4OBWA 5EHGA 1R8YA 2G8NA 4XGRA 5LQKA 4DG8A 2XJ9A 2H4YA 1YWGO 3PSAA 2ZBPA 4F38A 4C6RA 3DTNA 2FW6A 5EEGA 1RLOA 1R8XA 3QQ5A 4LFBB 3NWBA 3IEKA 2BFFB 3C3WA 3RUPA 3UT0A 1FJGB 4NULA 1RJWA 2X1LA 5AUNB 5JDIC 4MLZA 2CHEA 3S8EA 2DPGA 3CLUD 1AURA 3DL4A 3AJ9A 2R1ZA 5HTOA 5AM4A 3OPQA 1O87A 3WGNA 5BWLA 2VDWA 1VE1A 4QULA 4W5RA 5JSHA 3CF2A 1U1FA 2ZBVA 4OAPA 1QAMA 4ZXFA 3R2JA 4J07A 4CFYA 5AESA 1UBHS 1A76A 1SXGA 2LBPA 4K7JA 1HPLA 2H18A 2HZ7A 2O2ZA 2Q5LA 4NZOA 1KH1A 2GN9A 1VE3A 1CRQA 3IB6A 3NRBA 5H7XA 4N8EA 3S70A 4ZJPA 5H82A 4QC2A 2YL2A 2PSHA 3EZ9A 3N8GA 1F2DA 3IKJA 4G1FA 1LPAB 2GBLA 2HLDA 3OEYA 4IGIA 1YBVA 1Q1NA 1ZI9A 2X41A 3NVMB 5EJMA 4OHZA 5BMOA 1LV7A 1PGOA 5L3QA 3I1IA 3L0YA 4XWGA 3O8OA 2GM5A 5ALNA 2JGLA 5CTAA 3BBPA 3RVDA 3TM5A 4PZ9A 2X7XA 2FW1A 3MWEB 3ORHA 3RNLA 3HBMA 4OQDA 1Z2AA 2FX2A 1X9HA 3BPSA 1IC6A 2BFWA 4I50F 2JD2A 4F1KA 2FEOA 2J30A 1Z2NX 2XWJI 2XNDA 2V3VA 4FIZA 2C7PA 4GI1A 1CY4A 2QZZA 4XB1A 4BAUA 5IAEA 1A69A 2X40A 4EBFA 1AGYA 1JS1X 1D0IA 1PZMA 1VLVA 4R2KA 5KYNA 1K5HA 1NQOA 3E7DA 3K0HA 4FHGA 1J0DA 1YUNA 5HKKD 1XZMA 3NHRA 4ZU3A 2PGDA 3T7CA 3GDHA 4FS3A 3QJYA 1LPBB 4AP6A 2BFCB 3L7NA 2HW8A 2RGYA 3C2QA 1ZD2P 2BI4A 5AIBA 2OCLA 2EAUA 5T4FA 4ILEA 4WEOA 2JS7A 3RRZA 3U56A 2HZBA 2JFFA 3I8XA 2X19A 2F4NA 2OT3B 1I3OA 3H6GA 1F14A 3PDIB 2VH5R 2EERA 3EZFA 4LYFA 4RBNA 4MUJA 2EFJA 4LBYA 4Q4HA 5B7PA 5LOVF 1GZHB 2RIPA 4HWRA 2X77A 3OAAA 1DJLA 4BCDA 2YFQA 1GPDG 3GJ5A 4YUVA 1UEJA 3TNFA 1ITZA 3C98A 2CMDA 3OT4A 1U2TA 1IK4A 2COEA 2GEKA 3MOIA 1GG8A 2J07A 2YWDA 4TTTS 4OKSA 1E0AA 2JEZA 1PT6A 3PA6A 2O8EA 4LJSA 4ZDWA 4HNVA 1YCHA 2OGSA 3H4MA 4XR4A 1BD3A 1DNPA 1UP4A 3QE0A 4ZYTA 1P39A 1TK9A 3C8ZA 4S12A 2HPAA 1UCFA 3DL0A 4Z99A 5IM4F 3BXHA 4G0WA 1H2WA 2VWPA 1WZCA 1GR0A 5LP6A 3RKUA 2YINC 2Z08A 1X80A 3M8KA 4GG1A 4JS0A 4GPTA 1UXHA 1FFGA 3V8NA 3VU9B 3EQZA 2A9VA 2PL3A 2PUVA 1Q6ZA 2A0FA 3GFRA 2YOFA 4KX3A 4RLSA 3UW3A 2BKAA 3GT4A 1O1YA 4X9XA 3OCWA 5KC9A 4Z53A 2WWFA 3A11A 3OX3A 4O4IF 3DBHA 4K9OA 3VOBA 2KM1A 4NOJA 2XE8A 3R8CA 4QYWA 3V6MA 5JWRA 1ECFA 5KMGB 1VL6A 2VXCA 4ZVQA 5DX0A 3A4MA 1PSZA 1WPXA 5HX7A 2XRFA 4HHEA 4P2BA 4EMBA 2XBLA 4NARA 2FY8A 4M0CA 5LLTA 3PJDA 4KJZA 4YV0A 4DKJA 1RZRD 3B85A 2WPDD 4JK3A 3ZDFA 1RWPA 4MHOA 1TQ4A 1UJCA 4IM7A 1GNSA 4ND2A 1JP7A 1WXDA 5JALA 3OJEA 4RHCA 3U44A 3BSFA 1X0VA 3F8TA 2IITA 4GF5A 2FSPA 5KNBA 2CVOA 4O25A 3QI2A 4BP9A 1K6EA 2PE5A 4AJHA 5F7ZA 2P8SA 3MK31 3SX0A 4BFSA 2C5SA 3EDYA 1E4YA 5AJZA 5A7GA 2V4MA 3A9WA 2H1VA 2NU7A 5CFZA 4BMYA 2B20A 2WKWA 1EP2B 1VL2A 1AS3A 1ULAA 2OV8A 4FKBA 1M1YA 3JQAD 1E3EA 4MYTA 3WQSB 1VTKA 3IKTA 5J63A 2XYGA 2PA0A 3FNRA 3QWAA 3BN3A 4PS0A 4BV3A 1DJPA 1J8VA 1MO2A 1OU0A 3DBOB 3OQBA 4YEDA 2IS4A 1Y8QB 4BXOB 1E3DA 1IY9A 1RRCA 4ZO9A 2O7RA 2Q5QA 2JLAA 2OGWA 1YA6A 3DBRB 4ZIRA 2JHFA 2D5IA 2DKFA 3IKVA 1ZXXA 1KE2A 4A6DA 1ZWLA 3JYNA 1TFRA 4QDJA 4TUYA 2EOAA 2YIMA 3VOTA 4NTZA 2W43A 3PNKA 3K09C 2XWPA 4TQGA 3B1ZA 3ESCA 1KOFA 5U4QA 2JFWA 2ZU0C 4QQKA 2H2IA 3GQBA 5AUOB 3AIKA 3UH0A 1DKLA 2VBFA 3LGAA 3NVKI 4LYHA 4OL0A 4XLZA 3SQMA 1A04A 4OJQA 4QA9A 3UJNA 4RY0A 5EJFA 3OCVA 4BNHA 4UPEA 1RTTA 1C7FA 4D9EA 3E3OA 2VDJA 5MGNA 2PQ6A 4UQOA 2V59A 2FP3A 3UWMA 2YICA 1WTCA 4CM1A 1BDIA 4GKKB 1I14A 2P9YA 1FX0A 3I2KA 1ZXBA 4JI7B 3I42A 4LECA 1RYBA 2B6HA 1DOAA 3EUFA 3KVNA 1DCFA 3L0DA 4NYIQ 4Y67A 1U8ZA 5J43A 5M2QA 1QH1B 3K2IA 4MIKA 5IJ0B 1OH5A 1QYXA 1V11A 3QV1A 1KOLA 5ABPA 3SMQA 1MW9X 3FXAA 1NLYA 4D3YA 4RLHA 1IZ7A 2NTYC 1OXVA 2EYQA 4BYGA 1I4WA 2Z09A 4BKPA 4C7OA 2WZQA 4ZCLA 2LCFA 3UANA 4EMUA 5GV7A 2H1CA 5BSTA 4C20A 5LQDA 2RHMA 2X0NA 2Y3IA 3AC0A 4MUEA 5FHRA 4RAQA 5BW8A 2I91A 1DTSA 1D6SA 2JAHA 1G8YA 4PWYA 4XIIA 5JH7F 3ICQB 4FN5A 4DPMA 1CUIA 4OVKA 4PLHA 3CSSA 3ZJ4A 3IBSA 3U7QB 5DP1A 3P9ZA 1G8JA 1Z6XA 2UYYA 3DB1A 3DR5A 3MNFA 1F1JA 4IXNA 3IQIX 2N75A 5E6RA 4BWYA 1XTUA 2PWPA 4IJ6A 1U5BA 2AFHA 3P45A 3KJIA 5REQB 2PRKA 2O7VA 2VHZA 4OIMA 1JDPA 2FWAA 2J3MA 2C9MA 1CEYA 1HE3A 1R00A 2XEDA 1BFUA 1H2HA 1P4HA 4F4CA 2HSGA 3M0EA 4I50A 5I47A 3GLGB 3JWJA 5HMMA 4GYKA 3UAZA 3THWA 1EE1A 3PNYA 2LXNA 1FPMA 1M8FA 4WZBA 4ZANA 2FI1A 3X1KA 4BB9A 2Q27A 1XG5A 3OA2A 3UN1A 5BOVA 4HDSB 1PK9A 2IEBA 4JY7A 1ZG3A 5HF8A 2C5HA 3VC2A 1UJ4A 3LT2A 4ETWA 4Z4CA 5JAZA 5TF4A 1UC5B 3PQFA 3WV5A 3Q7SA 1PLKA 4X61A 2ZWAA 3SC3A 3HA3A 3RDPA 3C7TA 2NZWA 1HT1E 1CR1A 1HO3A 3KVYA 4RXMA 1VB3A 1X42A 2IBMA 4RDHA 2C82A 5HUJA 1W46A 4KE8A 4V02A 2YKGA 4YXWD 1NZDA 4KRFA 2HPVA 3WYFA 1IM2A 2YQ4A 2PGLA 4NFLA 4TV8B 3EEOA 3L9WA 3IDQA 2XB9A 4G2TA 2XYQA 4IZHA 1ESCA 4UD2A 3VTZA 4A0QA 4DR6B 5F4ZA 3THYB 4P4SB 2H7CA 5F5NA 1JT2A 2VQ3A 4Y6QA 4PNPA 3O1JC 1NBIA 4WSOA 3DXYA 1IZ0A 4QAJA 5G4KB 5IWCA 7MHTA 5IU6A 3AP3A 3KZOA 3P9YA 3ZDAA 1L7PA 1ZL2A 4OBXA 2C5AA 2QE6A 4DCCA 1IEQA 1SKAA 3ZNPA 5BVGA 3IR6A 3PC7A 1H9CA 5I9IA 3B1JA 1T5OA 1OSNA 1BC5A 1IULA 5IM4A 4NZYA 1ESZA 4W6ZA 4PV7A 3LUPA 4AF7A 2E3JA 3DZGA 1JDBB 1T6YA 3LY8A 3UATA 2XW6A 1HFJA 1KFBB 2Y1WA 2JFGA 3AIOA 3NUZA 3TEMA 4D26A 2E5WA 3R6TA 2NQ8A 4IXDA 3RTGA 1XZIA 4I36A 4ZQFA 3PX2A 4UZFA 4ZTUB 3G23A 3ZWCA 2I78A 3GD7A 5K3AA 3TLGB 4O4IA 1E6EA 2B30A 2FFBA 5FTKA 4P8RA 1GUDA 1KVUA 4DLLA 1SCBA 2Q4EA 1AQIA 4RPGA 3Q98A 4X45A 2CUNA 3DEAA 3PCRB 1I10A 3IHWA 1Q15A 2VF8A 3COYA 4J0FA 5CGZA 3J81k 2IH5A 4FZ5A 1GU7A 1NF3A 4M0LA 4B81A 2IS6A 1X7ZB 2CJWB 1ZPDA 4MS4A 4MROA 1C30B 3LPDA 5FUVA 2OB1A 5AXAA 3SBXA 2C2MA 4HX5A 5CVTA 2VYCA 1F8YA 1XZ8A 4OI0A 1VA4A 2PV0A 3NIBA 2FLKA 4JI6B 4DLVA 5COQA 1QFJA 2RJOA 2JA1A 1E59A 4OHUA 3ZDXB 4MJLA 4MB0A 1PVDA 1Y1LA 3KSBC 1IG0A 4MW9A 3ZLBA 1LX6A 2F17A 4Q1CA 1G59A 2QTBA 4Q6BA 4ZICA 4OXQA 1ISMA 4NWIA 2GVZC 2WVAA 3M6WA 3B6MA 5CYGA 1Q44A 3GFPA 2BTOA 4G8BA 4X1IA 3WQRA 1X6VA 4AUKA 2D3WA 2CBGA 4DEXA 3TIVA 1XC7A 4KQHA 4AKHA 3D4LA 4EQZA 3GLFA 1D2NA 4CN8A 2ZKLA 3QX8A 3Q9SA 1TM7E 3TIIA 3WZLA 1FP7A 3C6ZA 3ZYZA 4OSPA 1L7RA 3RRFA 4MAMA 4YUZA 1H0HA 1G8KA 3CJQA 3A1FA 3D4PA 1Q0QA 3ROEA 1R4MA 5ARBA 2OCYC 1SUIA 3HR8A 1UXGA 1RQ7A 3FTPA 3MLAA 4X63A 4KPYA 4QPJC 4WY2A 1TI7A 3B1YA 2V6FA 3NC1C 1AN0A 5AKZA 3K5HA 1VPDA 3D64A 1S3SA 1W8IA 1YTLA 2OK8A 3OPVA 3HNOA 1G5PA 2D3TA 4K46A 1K5PA 3WL4A 1TTTA 4DSTA 2WYHA 2VJOA 1CR6A 3RIGA 3CUTA 2A58A 3CLKA 2ZTUA 1KK2A 5BV8A 5C5EA 3GCXA 3I5XA 3OOHA 5CG2A 1QH8A 1GPNA 2BGMA 4KXLA 2J41A 2GPBA 4WXHA 1A50B 3SJUA 1GYQA 4R5HA 3VH2A 4AM8A 4KMOA 4ARUA 4A15A 1NVMB 1TCVA 1P29A 2FP4A 4F7DA 3OQOA 4C7BA 1OXKB 5A9SA 3PTLA 3BC1A 5C37A 2VHVA 1Z6YA 2WZCA 3TO5A 1GZ5A 4NFYA 2XTMA 3L7AA 4ND5A 3WDKA 4ZU1X 5SZJA 2RG1A 2OZKA 3VISA 1IHYA 3WYAA 3T7DA 1UT8A 9LDTA 3OO0A 4GUAA 4ND8A 5FUMA 1FUKA 1ZITA 1I3LA 1T4CB 2QRLA 2V6MA 3GRAA 3M81A 1N2XA 3PFKA 4NJMA 4Y6GB 4CFSA 4EJSB 3SXUA 5JH7A 4N41A 3FNEA 4BRZA 5EWLB 4QECA 4Q4AA 4QPDA 1HFEL 1QNFA 3AEQB 4AUMA 4D74A 1MA0A 3V8BA 4EF6A 5IXSA 3EAFA 1S8NA 4NI5A