2BGUA

Crystal structure of the dna modifying enzyme beta-glucosyltransferase in the presence and absence of the substrate uridine diphosphoglucose
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
351
structure length
328
Chain Sequence
MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the DNA modifying enzyme beta-glucosyltransferase in the presence and absence of the substrate uridine diphosphoglucose.
pubmed rcsb
source organism Enterobacteria phage t4
molecule tags Transferase (glycosyltransferase)
molecule keywords BETA-GLUCOSYLTRANSFERASE
total genus 121
structure length 328
sequence length 351
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 1994-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2bguA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2bguA02
3OTIA 3T3HA 4XI9A 3CEHA 2IEIA 2ASVA 4AY5A 3T5TA 4YI3A 1WV0A 1Z8DA 3H4TA 3C4QA 1XC7A 4FZRA 3L79A 3BDAA 3OKAA 2ECPA 1WUYA 1Z62A 5TMEA 4MI6A 4RIGA 1K08A 4NEQA 2X6RA 4AMBA 2HY7A 2GPNA 4NC9A 1P4HA 1JIUA 4GPBA 2IW1A 1EM6A 3GUHA 3S29A 3NCHA 4REMA 2BGTA 3NPAA 3O3CA 3FROA 4GZ5A 4X7MA 2C4MA 3G2LA 1UQTA 3MSCA 3H4IA 3Q3IA 3T3IA 1A8IA 4YUAA 1FTWA 2QN7A 3AMVA 5ENZA 4BQEA 2QN2A 4RIIA 1L5VA 1E1YA 1PSWA 5TMDA 4KQMA 3S2UA 2QNBA 1AXRA 9GPBA 2XCIA 1FU8A 5DXFA 5TVGA 1GPBA 1NOIA 2XA2A 2X0DA 3TAXA 5JTUA 1EXVA 4FKZA 3G2KA 3CUYA 2GT1A 3HBJA 2XGMA 4M7PA 1PNVA 4W6QA 1M5RA 3SYMA 1H5UA 3WADA 4AN4A 1L5WA 3OY7A 2QN1A 2XA9A 4EKYA 2G9QA 1ABBA 2JJMA 3CUUA 4LEIA 1SXPA 3BEOA 1E4OA 1GPAA 3TOVA 1PN3A 3HBNA 4PQGA 3OTGA 3T3EA 2AZDA 1YA6A 4KQ2A 3IAAA 5IKOA 1C8LA 1QKJA 4CTMA 1XOIA 3BD6A 2ACWA 1FTYA 1Z6PA 4MI3A 3S0JA 2QN9A 4RIHA 2XGSA 3SYRA 2YJNA 1PYGA 4Z5XA 2QZSA 3OT5A 1P2DA 2IYFA 1JEJA 2PRJA 3L01A 1XL0A 3VDMA 1IXYA 3CUTA 2C1XA 2VCHA 5JTTA 1UQUA 1Y8ZA 4MICA 5GPBA 3DD1A 1L5SA 4MHOA 3G2JA 3CEJA 2R4UA 1JG6A 1XKXA 1FS4A 3RHZA 1Y6FA 2F3SA 4CDRA 3MRTA 2WTXA 2SKCA 3UYKA 3BCUA 4F97A 4BFCA 2C1ZA 3NB0A 2XA1A 4N9WA 2P6PA 3ZCPA 3L7AA 4RENA 1UZUA 1JG7A 3NP9A 3BCSA 1J39A 4HLNA 1GGNA 1F0KA 2QRMA 2FFRA 2G9RA 3RSCA 2VG8A 2PYDA 2R66A 3OKCA 3NAZA 2IYAA 2X6QA 4GYWA 3BCRA 3MRXA 3CUWA 1F6DA 2IUYA 2JLBA 1SXQA 2F3QA 4EKEA 1P2GA 3E3NA 1QM5A 3DZCA 4N39A 4F9FA 3WAGA 1K06A 3MTBA 4WHMA 1FU7A 1L7XA 3L7DA 3VDNB 5BNWA 4EL0A 3MS7A 3MTAA 2F3PA 3ZCQA 2AV6A 2QRPA 3L7CA 5IKPA 1GZ5A 3S28A 5I45A 1GPYA 1P2BA 4RELA 1NOKA 1JIVA 4L22A 4N3AA 4WACA 2R4TA 8GPBA 4EL5A 5LQDA 3D1JA 1IIRA 4RIEA 3C4VA 2GEKA 1NZFA 4GYYA 1C50A 4NESA 1V4VA 3MT8A 2F3UA 2VCEA 2IEGA 1RZUA 2ACVA 3MT9A 4AMGA 3D0RA 3G2HA 3CUVA 4G2TA 3T3GA 1GFZA 4BQIA 3G2NA 3MS4A 3COPA 4M83A 3CV3A 5TMBA 3Q3EA 2FETA 3DDSA 2VSYA 3QHPA 3QKWA 1Z6QA 2PYIA 5D00A 2GPAA 3T3DA 1FTQA 2XGOA 2VSNA 2JZCA 4CTNA 2Q6VA 3VUFA 1P29A 1JIXA 1LWOA 1L5RA 2GEJA 2G9VA 3HBMA 1FA9A 3ZCVA 2XMPA 3PE3A 4LDPA 3IA7A 2G9UA 3CEMA 3PE4A 3CX4A 3GPBA 4XIFA 2QRQA 4YI5A 1FU4A 5DU2A 2QN3A 3ZCUA 1WW3A 1KTIA 3BD8A 2R68A 3DDWA 3RT1A 1YGPA 5C1DA 1FC0A 2ZB2A 1B4DA 4KQ1A 6GPBA 2GJ4A 4CTOA 1AHPA 4GZ6A 1Y6GA 1HLFA 3MS2A 1L6IA 5DLDA 3S27A 4MRAA 2AW3A 2QRGA 3C48A 3T7DA 1BX3A 3ZCTA 1WV1A 2BGUA 1LWNA 1P4JA 3NC4A 3UYLA 2IV3A 1NLMA 3VUEA 7GPBA 4F96A 1WW2A 4RBNA 4AY6A 4X6LA 1RRVA 3MT7A 2QLLA 2SKDA 2GPBA 2QN8A 4X7RA 3L7BA 1L5QA 3MTDA 2QLNA 3BD7A 3EBOA 5HXAA 3TSAA 2H1FA 1XV5A 2BISA 3RSZA 1WUTA 3OKPA 3MBOA 2OFFA 3Q3HA 1O6CA 3NP7A 4BQFA 1NZDA 1NOJA 3HBFA 4HWGA 2PQ6A 1GG8A 2X0FA 3OTHA 2XCUA 1C8KA 2AMVA 2X0EA 1RZVA 2QRHA 4QLBA 3MRVA 4MHSA 2KS6A 3WC4A 2ATIA 1VGVA 4GZ3A 4M60A 3ZCSA 4N3CA 1NVKA 3OY2A 2O6LA 4N3BA 2FF5A 2H1HA 3E3LA 2F9FA 4X7PA 3D0QA 1P4GA 2PRIA 3EBPA 2IV7A 4EJ2A 5D01A 4MI9A 2R60A 1C3JA 2C9ZA 2GM9A 2BFWA 3MQFA 4WADA 3ZCRA 4RIFA 2QLMA 2SKEA 3G2IA 1XL1A 3E3OA
chains in the Genus database with same CATH superfamily
2AN1A 4QUIA 1J56A 2C3PA 3EEIA 3ESDA 5I5EA 1XDDA 1TK9A 2IYQA 4MUNA 2F8SA 1A50B 1E5XA 4IJVA 4JB3A 4Y2RA 1NUPA 3GZNA 1WMFA 4MITA 4X91A 1TU3A 3DYVA 4QBTA 4JT9A 1EK0A 3U4CA 3H2GA 5JYBA 3DBRB 4PYRA 1GGVA 1GTG1 1R6AA 5G1PA 4EYQA 1MAUA 2CYBA 5AHWA 2MU1A 3F4LA 1SCJA 4HXGA 5KX5A 4QPNA 1GFWA 1KI6B 1AXEA 1EVEA 4Z4QA 4ZMSA 1JQDA 3L6BA 3BN3A 3GLFB 1GLVA 3OQ6A 3TO5A 2PL1A 3KAPA 2KSQA 4GMXA 3BSFA 1E2KA 2AC7A 1I8TA 3BERA 1JQ3A 1RJ9B 4AJPA 5KVVA 1RBQA 4WNCA 5TRTA 4B76A 4EG3A 1AKWA 1CQIA 1L4MA 1B3RA 2XHZA 3AJ8A 5EOVA 3UXEA 4BMXA 5LMZA 3DBHB 4RTRA 3TW8B 1FZTA 3PGMA 3RSQA 8OHMA 1NMYA 2QE7D 3DULA 3KUKA 1QIKA 1H2BA 3PLAE 2RDMA 2YJ4A 4EB8A 1I14A 1KBOA 1DBWA 1QO0A 2WYIA 4HGYA 4AK9A 5JSQA 4U3JA 4AIIA 3TZ6A 2QN7A 2QVCA 3AMVA 4YUZA 2KBEA 1Q0TA 2Z8ZA 2RAUA 3ADDA 1SCIA 2Y66A 1T5DX 3N75A 2XQKA 4LZWA 2NZ8A 5LLDA 1E1YA 2XMCA 4KYUA 4MKIA 4MW7A 1FOEB 2WP0A 1WKBA 1WKVA 1H3FA 1R0WA 1TIKA 3FCYA 1QYVA 3GRCA 3LECA 3TL3A 5LLSA 3BPSA 2ZUWA 4K2HA 3UWDA 4CM1A 3DUFA 5CB4A 1S01A 2J5XA 2JLAA 3B3AA 1X7HA 5TV2A 5FWYA 3QLTA 5AI6A 2GYYA 2O2DA 3CEPB 3PC6A 5E8RA 5FWDA 3RUHA 3TUJC 4B87A 5A5FA 4N5LA 4RFVA 4FZ5A 1ZHHA 2RI0A 4OQXA 4NBVA 4X85A 4PZDA 1BDJA 4EW3A 2FDCA 2FA9A 3W2HA 3O8QA 3GUUA 5TVKA 4B3SB 5JMPA 3KQSA 3KAKA 3OLCX 4FWIB 3UWPA 3H4VA 3Q7TA 4B83A 2EZUA 3HB9A 2IELA 5DHUA 1NRXA 3PC7A 1QZTA 2QMYA 2IPMA 3PLRA 1JHMA 3GWGA 3HCAA 3X44A 4EI2A 2EJTA 4EZIA 1ZONA 2YY5A 3BXGA 4QT0A 3WGMA 3GH3A 3OQBA 5AJTA 3ZY2A 1XLWA 3O90A 3TIXB 5EWJA 4YAWA 2HO4A 2BEVB 2JNWA 5FB3A 3VVCA 5D7NA 1CNEA 1QYXA 1KR5A 2QLJA 1MB2A 2Y0CA 4EQZA 1ZSYA 3U56A 4LV6A 3DOHA 4I8DA 5G0WA 3BRQA 5CA1A 1A9ZA 1RYYA 1FFYA 1K8QA 3U9LA 1SXPA 4YR7A 3JARB 5BSEA 1YKSA 2VAWA 4TX1A 2ZIWB 2CGEA 2Z3VA 3VNVA 4RVOA 1OXXK 4G1EB 4H15A 4V0RA 5BR4A 2VYVA 1IZ7A 4HEA6 5BVGB 4H7EA 4URFA 5DSXA 2MHCA 3I73A 2VZ9A 3VDNB 1UJ6A 4GMDA 4MS1B 5B3JA 3WGUA 4DUYB 1TJ3A 4KCGA 1I30A 4D45A 3LUCA 1WCWA 3D7LA 3RU7A 4EO4A 4AMYA 1SHLA 5EJEA 4I66A 4Q9HA 3GGOA 2JGKA 3HWX1 3KYBA 5EUMA 1T6YA 1SHJA 4PZAA 2Q4BA 2V6BA 4YVFA 1IAQA 1Z2CA 5LYJA 2ZYRA 5A1TA 5E38A 1COZA 1DINA 1EFHA 1KPIA 3T9CA 1H69A 5I7EA 3F9RA 5DNVA 2VI5A 1GLNA 3ZKAA 3DLAA 3L49A 3H9JA 5FD8A 5JWHA 2C9BA 2GCOA 2P2CA 1KOLA 3WO0A 1VJGA 3LBFA 2H16A 3MPOA 2ZSEA 4ZN6A 2V5VA 5E3JA 4QUEA 4JOQA 2R0QC 4KE7A 2WTBA 3UMRA 1DE0A 4QDZA 3C0KA 4PG5A 3PHBE 4RY8A 1GD1O 3UGJA 4ZAXA 4Q4JB 2OV2A 3ISJA 1RWVA 1J0DA 3IERA 1F14A 2XB6A 4TGLA 1PO7A 3CO0S 3WZMA 4EEXA 2Q7XA 3CVWA 3G6KA 1P4AA 1DV1A 1QYDA 2PRJA 2EFDB 2YQZA 1Q15A 3TOXA 2AZTA 4HS9A 4E6EA 1LXCA 3D0KA 2ZJ3A 3L1VA 2GNAA 4L5JA 3DD1A 1SBIA 4QSHA 2RE8A 3W78A 4AP5A 1M2WA 4BP9A 4B48A 5KI6A 3MJSA 1E89A 4NCNA 2ZREA 2IZ1A 2IXFA 5HS4A 2GQ0A 3GJSA 3A4IA 4GP7A 1T0JB 3UPDA 1K9SA 3V8VA 1JFSA 4KR3A 4BX8A 1ZITA 1CUZA 1TA0A 1ZH8A 3RIGA 5TS3A 1QCYA 1QK5A 3P9RA 1KDOA 3DMFA 3IVAA 3NHSA 3FA2A 3BAFA 4D46A 5B2ZA 4KMRA 3H18A 1S02A 1KMHA 1XZPA 6NULA 2HJHA 4GI1A 2AR0A 3ZV6A 2QR2A 1YMQA 4C0XA 1QP0A 4FMPA 1WB4A 2XA1A 4MRRA 3WWYA 2J41A 4K9KA 2XKKA 1S4QA 2A9OA 3M7IA 2RC5A 5KOHB 3GHYA 1PGJA 3NP9A 1YFKA 3MB8A 4BQRA 3GNSA 4PO1A 4F0JA 1O97D 3DYBA 5CBKA 3LQ1A 2V0GA 1Z5PA 2PT9A 2H1VA 2D7JA 3ZDEA 1EVKA 3PTZA 5H4GA 4RDIA 2GVDC 4JJIA 2YVKA 2KI5A 1RI3A 4X65B 1L7PA 1ZUWA 2GXUA 3R8CA 4Q1EA 1P80A 2YXPX 5DNYB 2RGGA 3G13A 3WRYA 5IULC 1N3IA 2DTXA 4X71A 2J5RA 1GGJA 1KHHA 1UP7A 3KXKA 4N18A 5KYKA 3TLXA 4OKIA 1E96A 3O1HB 2V7TA 3PRYA 1CQZA 4Q0MA 1ZR4A 2Q3FA 3UUWA 4Z51A 2GWHA 3E6AA 3P2IA 3N76A 3KCNA 3ZGVA 2FJPA 4GUDA 4QLOA 1AA6A 4YJ3B 4Z1MD 1FZQA 1EP9A 2QEQA 1LK5A 2VNIA 3HO8A 5L6MB 2V59A 3PXEA 4RORA 1ARZA 1MOSA 1TF5A 4WKOA 4IHQA 5TE9A 3VC7A 2ZWMA 1W1UA 4LE2A 3ZXSA 5LYYA 4D8UA 4E5NA 3GQBB 3P2OA 5EJ9A 1LS6A 2AR7A 2Q3LA 2ZPAA 3EFOB 1DAHA 3GG9A 3WKAA 1C0IA 2YKGA 4R3UC 4OYLA 1VKRA 4QPPA 5AWFC 3D8RA 2ORWA 4Y6GB 1LLCA 4CM9D 3FZNA 3DH0A 1HQDA 4TRNA 1H05A 5SYNA 2NVBA 3BCHA 3L7DA 5GONF 4JP1A 1I3MA 1EFVB 4XWOA 3K70D 4Z7OB 4RPCA 1MW9X 3AR5A 4U7GA 1J6UA 4Q82A 2V9CA 3DOOA 3ZCQA 2VPWA 2JIZA 4C07A 4EUHA 3NDPA 3ST7A 1PV4A 5JFTA 2ZAGA 2XZOA 3VV2A 2F3RA 4S2UA 1FVXA 1GPYA 1N5RA 1V4BA 5K0BA 3CZ9A 1D2HA 1DELA 1ZIOA 3JQDA 4D0SA 3WG9A 5LJIA 2UXDB 3CLVA 3WIOA 2QGFA 3ZXIA 2XE7A 2AOXA 3DE7X 3H1TA 4KWCA 3FVWA 1PJAA 2AFHB 2WFZA 4H0FA 5ETJA 5J58A 4DSOA 3TB4A 4A8JC 2ADOA 4D44A 4F2GA 821PA 2FWMX 5HM8A 2W7TA 2Z3ZA 4GWKA 2Q3BA 4DG9A 1KMMA 1OR8A 1PLLA 2VRWA 1WZEA 1PJBA 1E2PA 1QLWA 1W1WA 2Y1WA 3CE9A 3FNFA 5BN1A 2C2MA 4RZHA 5T8KA 5KNLA 2HA0A 1XMQB 2O59A 1ZGCA 3E8MA 3HNPA 1RRKA 1D1QA 2PUCA 4RUKA 4ARVA 4Z53A 6Q21A 2HUNA 4NONA 4IV8A 2WTMA 3DLIA 2GYWA 3EZFA 4HFRA 4DCCA 2X1MA 1V8DA 3HA2A 1BE6A 4LE0A 4IDDA 3T3GA 1YI8A 1ENPA 2C2YA 4CM8B 3D4IA 2LBPA 3QPCA 4QRIA 4WNIA 1T1RA 2PFSA 1D6SA 3BOSA 2Q2WA 4Y0AA 1Z0IA 1IJKA 1SD2A 4ZANA 4MS3A 1MQAA 2MJLA 3CO5A 3EQ2A 1NW3A 1UAAA 1J2JA 1U3DA 2JIDA 3K0FA 1G21B 4JUDX 4UFOA 2VSYA 2WFLA 4NCKA 3LKBA 5D3MB 5IJWA 2YCLA 3L02A 1SUCA 3PNOA 4GLFA 3T9DA 3WOHA 4BE4A 2OQ2A 4BNNA 3HVHA 5C32A 4CTNA 2BT4A 1A27A 4HWSA 2PJUA 3DR5A 4RK5A 1U6JA 2OZLA 5F33A 3LQ2A 3QITA 4XX0A 4GYJA 4BLQA 3I0NA 4WZBA 2JGEA 4LFBB 1R0CA 3IUYA 5MN5A 1X1TA 3CW2A 3EQ9A 1Y6ZA 5CVTA 5AW7A 2AC2A 2BH2A 1R6VA 4MQ6A 3PPWA 4LDPA 2GCNA 1MB0A 5I3ZA 3GVPA 3WP0A 1CYDA 3VFDA 3M6VA 2LDXA 3E9QA 1OLSB 1THMA 5K9ZA 4F6CA 1G41A 4GRDA 2PWPA 3CVVA 5EKTA 4K9NA 2B2NA 3GGSA 4FGWA 4DNQA 2XDWA 1YL7A 2AX4A 3F6YA 2C3UA 2NAPA 2GBIA 4LGCA 3UB2A 1AUOA 3CH7A 4G1CA 4K86A 4PLTA 2RHBA 4DJJA 4EGJA 2DUNA 2RGRA 3LCJA 4PFQA 1NYQA 2IHZA 2WWIA 3CUSA 2JANA 3R3JA 4P92A 3U3RA 1ZNWA 2RCYA 2C57A 3EDOA 5JROA 2H0RA 1YGPA 4DILA 3ICQB 5K3OA 1ZVMA 2VS1A 1DTEA 3E70C 3BG5A 3JPYA 3WGQA 1XRLA 4R83A 4RVSA 1HDZA 2HF7A 2ZWIA 1DC7A 1K1EA 1T3HA 1S2NA 1Q1AA 2MINA 2D2XA 4I4TF 4R1PA 2YIMA 5EMJA 3Q8XB 2UVQA 4UM9D 3ASYA 3D5EA 2R47A 3IE2A 3NIGB 4YCDA 1SIUA 4JXKA 1A5BB 1GHTA 3FSRA 4DDUA 5A04A 5JVDF 2VJKA 1Q1ZA 5J2UF 2ZKIA 2P27A 1A8UA 1E9BA 5AQEA 3PB3A 4IDOA 3UZUA 1UBLS 3K0KA 1PD0A 3RIHA 4JLPA 1U0NA 3AGQA 4AZTA 4JI8B 2BCEA 1QVWA 1EP2B 1OBCA 1YVEI 2B82A 2HMYB 2OBNA 3ADPA 1H5NA 4MUAA 2PG3A 3L8HA 3SBDA 3URKA 2WQ7A 4U7HA 3B1FA 4P3YA 3RTEA 1OX6A 2QJTA 2GBLC 4AU1A 1UPCA 3B5IA 1CDZA 5TNXA 3PHHA 1Z3CA 2RHLA 1YU6A 1UM9B 3BUSA 1WHSA 2EEPA 3AC0A 3PHGA 3EVAA 4JU8A 4WCDA 4I5FA 5THKA 4FC6A 4ASUD 4YV2A 3TVDA 2B20A 4E13A 2HEGA 2GPBA 1LPSA 4EHFA 4ZCRA 1KY4A 3F5SA 2EJBA 4G3XA 3DE3X 4MUGA 4WH0A 1Q7RA 3GROA 4XLTA 2F8LA 1XFDA 2KYRA 5EP3A 1EP3B 2I1LA 4BMVA 1SELA 4BEJA 1BHJA 1ML3A 1QAQA 1TMKA 1YZFA 4HZGA 3NV9A 1DI0A 4JJEA 3FRHA 2C4HA 1NYTA 1Y1PA 2FH5B 2QVBA 1OA0A 2W8BA 3GUCA 3PIRA 5TQJA 3TLGB 3WKEA 3PITA 5JVDA 3SQNA 1RIIA 3B6ZA 2ES4A 1X1SA 2FFBA 4X8LA 4JI3B 2DY1A 1XGKA 2XITA 1LSUA 1JMKC 4NL4H 2DU8A 4B7AA 1TEHA 3QXJA 3BGSA 4R0MA 3PICA 4IYJA 4IXDA 1M9NA 4R2HA 3QFFA 3TLEA 3ULKA 3VVMA 3FG9A 2ZIVB 3KWLA 3QVXA 3T3MB 4PX9A 5CM8B 1P9WA 3V2HA 1WWKA 4OCZA 4ABYA 4LY0A 3FPSA 2AVNA 4NJMB 1MXFA 3GJ8A 3RBAA 4DUGD 4EJSA 1TZMA 1FNDA 1UP4A 4QUDA 1M6VB 3I42A 2XCUA 4I50F 4LC9A 4R5HA 3SSNA 4E33A 1C8KA 5AQ1A 3NEJA 4D4LA 5IJAA 3L1IA 1TQ2A 4ERXA 1AKVA 2WKRA 3KUCA 4RE6A 4MYTA 4XGKA 3ZDAA 3PNPA 4D8XA 3PX7A 1UZMA 3VNQA 5FHQA 1WD7A 4HR7A 2V3VA 4RD6A 2IYPA 2VK2A 1TJNA 4MVJI 2JJ8A 4N3CA 4DQLA 4KFUA 3CRVA 3FR8A 4FLMA 3OY2A 2X8AA 1F2VA 2W6NA 3E1GA 3QWHA 4B9EA 4QASA 3IJEB 1HETA 1ZCJA 5HBRA 1K98A 1NY5A 4O3MA 4N3BA 3HYLA 3E3LA 1Y98A 4MQUA 3EF0A 3A4LA 1QIIA 3TQHA 1ZGJA 4NOJA 3CZ5A 4P31A 2O2JA 3EBPA 3CX8A 1KAHA 2M32A 3GYBA 2VYQA 4X20B 3SM3A 4K1LA 1SCDA 4K3VA 4H6PA 1PFKA 2C9ZA 2AZMA 3G6WA 4OD0A 2G71A 3GAMA 4LY9A 5FQNA 3OM9A 1E8MA 3OMXA 1ZWKA 4PSCA 4Q18A 1EE2A 1BQ4A 2NT3A 3QFCA 4NATA 5SY4A 3O9ZA 1L1FA 3UG7A 5F5XA 2C82A 5E4JA 4WK2B 2WU4A 1OBOA 2RKBA 4BCCA 2HCJB 2Y68A 5CFMA 1GQOA 1P6XA 4IF6A 4R69A 1ZVQA 5J2UA 1QHHB 3HM2A 3KCQA 3A6KA 2Z5GA 4QODA 5JAOA 2ONZA 2OBBA 4ND1A 3Q41A 1UJNA 2WFMA 4INPA 1NXXA 3DHWC 3JQ8A 4M21A 1LTKA 1JTFA 3H84A 2CVOA 1Z8DA 3KSMA 1M73E 1N1MA 2OB1A 3OX3A 4O4JF 1I7SB 1XTVA 3X3HA 3BDAA 1A1VA 2CXPA 2W8BB 4O4LA 3K0FB 4NCHA 3LDFA 3Q87B 4MINA 4QRDA 4BNIA 4DV3B 4M7RA 4GOKA 1KJ8A 2E87A 4UEJA 4IIHA 3HU1A 5TF4A 3ZS8A 2PUVA 3LHDA 1GCOA 2WAAA 3ZK9A 3HB5X 1HL7A 1YXMA 3EMDA 4RJIA 3EZLA 1H2EA 1MDBA 3Q85A 2VDUE 221PA 2GPNA 2PRSA 3INTA 2CLHB 3NWPA 4FX2A 5FORA 2AJDA 3D3WA 2E7ZA 5IVKA 4EG4A 2RH5A 4NBTA 2QD5A 4UW9A 4NU8X 3I0MA 3KE8A 4HX9A 4X0EA 1KJNA 4KOEC 3NASA 5KMGB 4S1VA 2IU0A 3KT0A 1NXSA 4OI0A 4P0PB 1DXYA 4PHCA 4EHIA 2QL9A 1S9DA 4F9GA 1GPWB 1T34A 3MD9A 2AA3A 1SXJC 1ZI6A 2WAOA 2NPOA 3H1AA 4L85A 4S0ZA 4YMTA 5LBUA 4PNZA 5KNBH 3EVNA 5B64A 1WAMA 1IWPB 1OZFA 3GRKA 5I8ZA 1AUVA 4MROA 3EIEA 3ED5A 4Q21A 2XYHA 4RWZA 2IODA 4WK4B 1A1SA 1VA4A 2JFGA 1MVLA 3M1YA 4YUAA 1FTWA 5AW6A 3UJ3X 2P6NA 5B55A 3JQ6A 1ZIYA 4RVNA 2YY6A 2C7VA 1BD4A 1LDMA 3D1LA 5F64A 3W7VA 1XTQA 2OK8A 5CNMA 2QMEA 3VJLA 1WUKS 1IEQA 4MYCA 3M6XA 3S2UA 1RM5A 2JJ1D 3F98A 5SV2A 4CIDA 1AXRA 2AOWA 4AVYA 1TKCA 5FA8A 3ENNA 3RTAA 4DGSA 1PTJC 3K31A 4U5QA 3CVJA 4D9BA 4FOLA 1I4TD 2H57A 1GQQA 1IQPA 2VHUA 4M0UA 3USZA 1OXSC 1TKAA 3GO4A 4EX7A 4HNRA 1TJYA 4FE3A 2OV1A 1IN8A 1B6GA 5EZ5A 3TB6A 3V9AA 4EUEA 3EY9A 4CEHB 3ZWXA 3E18A 3G1UA 5LZ7A 4TZ0A 5J43A 3S2FA 1ZYUA 2X86A 3AG5A 1ZZGA 1LDGA 3QI7A 4QNRA 2IDZA 4J43A 3AEUB 3KKZA 4JJ4A 4WVLA 3FLEA 5E8JA 1PIWA 5I7HA 1E2GA 1RLIA 1TLFA 3B52X 3DAPA 3R75A 4FEAA 4RTQA 2QD1A 3IV6A 5B1YA 3X0DA 1X80B 2PZFA 4IMRA 4OGKA 4QM7A 2DH5A 2GR9A 1WSWA 4MTLA 2JK1A 3PUIA 1U3GA 1MG5A 3NJ8A 3UA3A 2W5UA 2WWWA 3DMYA 2XRYA 3ML1A 1BKDR 2ZI3A 5CXQA 3HWSA 1J06A 4D99A 3GPIA 4DMHA 1X2BA 2W8ZA 5JCXA 4RD4A 2CCGA 2JBWA 1NX6A 3EZXA 1GN9A 2B9EA 5BXQC 1X94A 3KYCA 1Z8HA 1H93A 1W59A 4TVBA 5DM70 3QOYA 3NG1A 4HNVA 3T12A 3JQRA 2GEFA 3ZNNA 1O9BA 1FFEA 2GWRA 3NHKA 3KKOA 2RJNA 1JEYA 1VFNA 2CBXA 4EG0A 3Q3CA 4YJHB 4AS2A 1H0RA 3TDKA 1MRZA 1ODKA 2DKFA 3MGGA 1W2WB 1MJFA 3UOGA 2PKXA 4IJQA 4WXPA 4LXYA 3PTAA 2DT5A 3BB4A 1K7CA 3SJCA 2NMVA 3PG5A 4XB2A 3ELUA 1P5FA 2QUKA 4MV4A 2OLKA 3KB1A 1R64A 2ENWA 5C3UA 4OF4A 2FRDC 3TTXA 2C2ZA 3OHPA 2QR5A 3LNCA 4DREA 5ILGA 1V5WA 2CCKA 3GT7A 3WHLA 4BMOB 2CT8A 1T8UA 4EVQA 1UC5B 1OYVA 1RWBA 3GCDA 2VAPA 5JPDA 2YMQA 3H1EA 1BMQA 2ANCA 2AOVA 2I2XB 3CZRA 3EXIB 5G4KA 4ZXFA 5BOVA 1LQ2A 3VXKA 4ZHQA 1VMDA 3QHQA 3BK7A 2VKTA 2BP7A 3D6AA 3OLQA 1GQRA 1AB6A 2BKXA 3MOIA 2IYFA 4J29A 4IJ6A 3U16A 1RQGA 2IEAA 1KZ1A 3DAHA 2QW8A 5HZGA 3VSEA 2UUCB 5CLHA 2H7VA 3DZIA 1KDYA 4EMBA 2RB5A 3EDYA 2Q4DA 3OD5A 2I2CA 2FG5A 2H52A 3GDGA 4KVAA 1B1AA 1F8GA 1NR7A 1RJEA 4QO7A 1ORTA 3AIKA 2ZK7A 3EXHC 4RA9B 2XNKA 3HP4A 2ZBEA 3BE4A 4QDXA 1QMPA 1GA1A 1XCMA 4Y8VA 2J3LA 1ZJZA 1AH2A 3KVOA 2HCFA 2YJZA 3CEJA 4L0DA 5BW5A 3E23A 2V97A 1HY3A 1CUDA 1J97A 3M4XA 5L3RA 2PZAA 3L9WA 2FSVA 2OVFA 3WB0A 1O8BA 2NO1A 3HCEA 4WCFA 5J5VA 4V1CI 1PR5A 1VSQA 4C29A 4Y1RB 3IKJA 3R9KA 3CLTD 2VDRB 1BGVA 3AOEA 2FUEA 4ENTA 4YTEA 5ALNA 3T1OA 3BCUA 1HH4A 1KY5A 1XG5A 1D8AA 4UAJA 5EEGA 3F5DA 4IILA 4PC7A 2XJ4A 3K1YA 1OFUA 3SEFA 1CQWA 4J9UE 2RGNC 3WGLA 3QEBZ 3KWFA 5IN4A 1TD9A 3LU1A 1SIWA 3PIDA 2C4TA 1YS7A 3PNYA 1GGNA 4I6GA 4MS4A 1W48A 2E4YA 4OHFA 4PNHA 1Y8QB 4BJ3A 4C21A 4CQNA 3LBIA 1C7QA 2R66A 3R7LA 2C2OA 3AH8A 1ZM2A 4I1VA 4MV6A 3UICA 4LI3X 1KC3A 2N1MA 4FR0A 4LDZA 4FS3A 3W2EA 3AEYA 1IUPA 1PRYA 1Z4MA 2FWPA 2H1SA 4NMHA 5KYGA 1UK6A 2HJ9A 3FX2A 1GNTA 3UMGA 1X74A 3RI3A 3VKUA 3ICWA 4BTVA 4JKIA 1NA5A 1HRDA 2VHWA 4CCSA 1D0SA 1OIXA 3CSDA 3VPDA 1H9AA 3OIGA 4L4UA 3OF2A 4FB4A 1J0AA 4UTZA 2QTLA 3UHAA 3WZLA 4Z9YA 1INLA 1XEXB 4PBSA 1MV5A 3DHYA 1F6BA 5CVJA 3ABQB 1MJHA 2FMFA 2PMDA 2OXIA 3K0CC 3K0AA 1TTTA 4CKCA 3C74A 4HH4A 4PGFA 1HA3A 4EG5A 4H1HA 4G8DA 2DERA 2XZDA 3RJZA 1UWCA 3CH4B 1STOA 2ZRPA 2XUJA 2Z56A 1F17A 3BE6A 2A9PA 4HO1X 3SF0A 2B1QA 2WMOB 1EHYA 1ZNZA 4Q16A 4DLRA 1K66A 2R8ZA 1A9YA 4H3KB 1JDTA 1I7NA 2MOKA 4U6SA 3MMZA 3MTAA 4OJYA 1JHPA 2YJ6A 2ZBFA 4PRLA 4PZPA 1JB1A 4U2FA 5ALQA 4HF7A 4ZZ0A 5K6TA 5K09A 5K0EA 3NHLA 5CUQA 2AYZA 2IHVA 1EJ6A 4NYIR 1G6Q1 5DGTA 4GE3A 1V45E 3NT2A 3K71B 3P1JA 2ZJ4A 2RBEA 4A0GA 5FOWA 1NC1A 3OZDA 4NXNB 1C29B 3L0YA 3H5NA 3X2EA 1VLLA 5IAGA 3N6RA 5TR9A 1WEKA 1Q95A 3QUCA 4LSZA 4TTPA 3FCEA 3W2TA 1ND5A 3LQ4A 1KWKA 3HXOA 1WZ2A 2BZ1A 2YQ5A 1G42A 4F8EA 3TQCA 1WETA 3BB1A 4N6GA 4AURA 2R44A 3BSYA 3MG9A 4GYYA 4MGZR 1ESMA 4OI2A 5JXIA 2I71A 2QRJA 1C9YA 4HDRB 4WUTA 5AKHA 4TZ6A 3CCBA 2BFFB 2JFYA 1RZUA 3OFVA 5F5NA 1CRZA 4OU4A 3TQIA 5ILQA 4X8MA 2IVFA 4Z0HO 1DC8A 3OEHA 3SZGA 2XBUA 7MDHA 2OCKA 3IDZA 1OXTA 2H4YA 3QJGA 2BEUB 4G09A 4O2AA 1GFZA 2F55A 1XIVA 4HXEB 1KSFX 2OD9A 3HADA 2Q5IA 3BMOB 2NU6A 3PEUA 4W1QA 3LX8A 4G0VA 4WASA 1HSOA 3ORHA 2W6ZA 4DLBA 4ZMBA 4EPTA 1V11A 1NSFA 4ZT6A 1EXNA 3DE6X 4DV7B 1V5IA 4N3NA 4OKNA 1JFRA 1JQBA 3GVXA 5FLEX 3AUTA 1JE0A 3DMRA 2R7AA 2CXNA 4O59O 2ZRGA 4ER6A 4M98A 3GW8A 5A6SB 1QF6A 3GJRA 4FYYA 4KQKA 1PNRA 4G0ZA 3PA8A 4I50A 2P2DA 3RAPR 1FDOA 3CRW1 1K4KA 1RVDA 3WYCA 3SNKA 5LP6F 3ISVA 4MIOA 3G7UA 4MJLA 2CWDA 3ZJ5A 1XMPA 1ZMOA 3ZCVA 5WRFA 4ZYTA 3D31A 4A0QA 3MCZA 2NZ2A 1ISRA 3GHHA 3NT5A 4U7FA 3ESBA 5DCYA 2BL4A 1OKKD 3S29A 2KWIA 4KYIB 3TG8A 4GUAA 2UYCA 5KNDA 4RCYA 2CK3A 2IHYA 3GNLA 1PL8A 5MN6A 4EMUA 3DV9A 3BWDD 3V1KA 2D7CA 4YJDA 4PSAA 2C5FA 5DHAA 2FP4B 3EDCA 1AQ6A 1ZL0A 3NQ41 1Q1NA 1CPYA 3I58A 1T4MA 4J6EA 4PLYA 1R9NA 4W5HA 3T41A 3ZCUA 2ZRJA 2XT6A 3CPSA 5DE3A 4ZZ3A 3IBFA 1KTIA 4PO9A 5D3KA 2CMDA 3S8MA 1DXOA 1NXWA 4JEHA 4QDUA 3RIXA 4ZHQF 2NU9A 4KZPA 1IXKA 3ZZMA 1L1EA 5A0FA 1E3WB 3BE5A 4I8IA 4IJ5A 3LLMA 4XFJA 2B8WA 4YC7A 5F4ZA 4R31A 1B4DA 3CRZA 5ECWA 1CP2A 2OUIA 2Q50A 2X1VA 3LC7O 1MV8A 4LA4A 4JBGA 4Z3OA 1JEYB 4B4VA 3C6MA 4JX9A 2C61A 4K28A 3K0BA 1EYZA 4DV1B 1FDUA 2EJUA 2IYTA 1GQSA 5GGXA 1NVUQ 3F8WA 5PNTA 2VWGA 5A5EA 3C41J 4OA8A 4R5MA 10MHA 1ZKMA 2XVMA 4BB6A 1R5BA 4OXRA 1V48A 5CVEA 3DE4X 3A3KA 1JHXA 5LD2B 1QIEA 2QRGA 2B4AA 4ML3A 2VOEA 2IS2A 4B3FX 1NM5C 2B3TA 4YN3A 4DC9A 5BN4A 4I9GA 1LBEA 1TCUA 3FFTA 3TQFA 1CW2B 3HU3A 5DK6A 4DZTA 4EJ6A 2GYUA 3GDHA 4Y98A 5C5DA 4JLMA 1M1YB 1KIFA 4LTDA 4BKOA 3COZA 2F64A 4X90A 3VNRA 4HNUA 5DI3B 3WB2A 3MMSA 2RFLA 1U11A 2FPMA 3NC4A 4KBGA 3L06A 3SXUB 2W42A 1UFVA 2W0SA 3H3XA 3V8EA 1GVNB 5DGIA 1II0A 2PQ0A 1A9PA 3KOZA 2JEZA 3TKLA 3LA6A 4AS3A 3GUZA 1KY3A 1CC1S 2MSNA 1SQGA 2PX0A 3NGMA 5D3ZA 3KYDA 1TW3A 5F7XA 5IYZA 2XVAA 3PFNA 4QVKA 1GT6A 4DCSA 1GG5A 1GUFA 3QBEA 5CJJA 1AGRA 1LH0A 5H4HA 3LXMA 4PN3A 5KYNA 2VP9A 4UBLA 4Y2QA 1MTZA 4EDFA 1F7VA 3S99A 2Q1WA 1PL6A 1Q3HA 4HZUB 5L95A 1QRUA 3FZQA 1JKJA 4OLJA 1B23P 1WSDA 3I30X 4MUYA 2P1ZA 2YZNA 3KZXA 2J33A 2C2WA 4N49A 1QO0D 3D6NB 2GF9A 4X94A 4YBZA 1DQNA 3EJWA 4FTWA 2JEOA 1E2EA 3EXG2 2OFWA 4KN6A 5JASA 4WKPA 4EEZA 1IBSA 1ZISA 2EQAA 4I14A 3OUUA 3O47A 5M3BA 1U1GA 1WF6A 2Q9UA 3K8ZA 3M5DA 2A0XA 1M2OA 3AKDA 1NN0A 3QOFA 1ZOOA 4JH0A 1USWA 1NF9A 3DZ8A 3DEKA 3DOUA 3UJDA 3BMCB 1KO7A 1F4PA 3B6KA 3LX5A 1U0TA 4HDSA 1KJZA 1T9DA 2A1UB 3BH6A 3FPKA 3KNZA 2ZBRA 5GOTA 4RA6A 3TH5A 3W6ZA 1ZMBA 2EV9A 1SU4A 5FI1B 3EEFA 4D9FA 4CKWA 1EUDA 1WDKA 5EPEA 3F7TA 1OFVA 2QT0A 4BTEA 1ZK4A 4HTFA 4WVFA 1F2TB 3PT5A 4XAQA 1HKUA 2XXJA 1QG4A 2YOFA 4TV9F 2OZLB 2B4YA 3S8EA 2QRHA 2W43A 2XUFA 3AR3A 2OD2A 3B2NA 3MRVA 1LSOA 3OCJA 4DLXA 2QW0X 2EIXA 2BUAA 2P2NA 1ECJA 2Z0MA 4HLCA 2KQUA 4GZ3A 2YZ2A 5I7OA 4TMKA 4MDEA 1R0ZA 5FAKA 1S8OA 2C8LA 5JYDA 1ZVJA 4IIJA 1YT5A 3FN4A 2C59A 1VMKA 1N5MA 1NASA 1NQUA 2W6JA 4GMFA 2IHTA 5IAEA 4BNYA 2M1ZA 4R41A 1YASA 5J4KA 3WA7A 1RSZA 2QR3A 3K9WA 5K4HA 3ENVA 1U2RA 1V3UA 3HO6A 4KQ9A 3SJBA 3WMWA 3ZWVA 3FNQA 2CE7A 1EFKA 4ZP1A 3B82A 4DHEA 2NUTB 4HGPA 1XXLA 3GRFA 1ZGAA 3ETJA 2C92A 4DWJA 2V96A 4ON9A 1D3AA 5J2UB 1X3LA 4AT1A 4PR0A 3DAFA 3MMNA 4CI0B 2XWJI 1TRKA 1XZNA 1Y48E 4DYDA 1I3KA 1SEPA 3CKMA 4IJWA 1CZRA 5KHAA 4LOAA 1OMOA 3QVGA 1QRDA 3EFBA 4LISA 1Y5NA 1M67A 3L77A 2E21A 3H19A 3IXMA 3MINA 4F6RB 5KSOA 4D96A 2AYYA 2XUQA 3QZUA 4O25A 2B3DA 3IQIX 2B5VA 2W93A 2DWPA 3MAJA 5F21A 1KEEA 1MTOA 2H18A 4HNSA 2ANBA 5JR3A 4GMKA 4NS4A 2ZM6B 5IUJC 3D7KA 1QIMA 3HKDA 1UIMA 3B78A 3LLVA 4I5GA 8ADHA 3ZWYA 4YI3A 2CVPA 1T9KA 1U7PA 2I8CA 2FVXA 4GXTA 2BGLA 4DE5A 4IUCS 3M5WA 3E8XA 2EC5A 5BNZA 3I2JA 3ADBA 4UCXA 1KFCB 2ZG6A 1SG9A 3TGLA 1NQWA 1OH6A 2L19A 2OCAA 4PSVA 4TLEA 4YMLA 1QFSA 1R6XA 2DOKA 3T0GA 4BVFA 1MEEA 2XTMA 4OJQA 3I04M 4XCQA 2Q6OA 4IHJF 1OI4A 3L4BA 4ZGWA 1YFJA 1E3WA 1X1DA 2ZRBA 4FZVA 4U4AA 3PPVA 4BNTA 5JSZA 5GIPE 5F98A 3HXLA 2O8BB 1VJ1A 2AMLA 3UH1A 4MK4A 1EM6A 1G4HA 3OO1A 1NQXA 1CQXA 2WIAA 5GVRA 2HJVA 2RGCA 3O3CA 1YRAA 1QHIA 4F91B 3OA2A 1X80A 3QE3A 1W46A 4X44A 2JGMA 2IHKA 2VHTA 3OH8A 3QE2A 3DXFA 4RPLA 1HFJA 1WTAA 2PXCA 5E4YA 3A14A 5EESA 5HEKA 4CR7A 5TGDA 5LQNA 2V7VA 3H4IA 4NZZA 4GQIA 1FP2A 1A69A 1Y3DE 3BDVA 1KJ9A 4GPIB 4LWPA 1S8NA 2VXOA 1W34A 1QBKC 3KDPA 4C04A 4R1MA 5DIZA 3SC6A 2G5TA 2OXRA 1U0HC 3HZZA 4HSEA 1IK6A 1R8QA 1Y63A 2P69A 3P2JA 2FK8A 1A88A 1MEJA 2IXBA 3S1LA 1UR5A 1ISJA 2QNBA 5LCXA 2BPOA 1UZNA 2OBXA 4RDHA 1F4LA 3COVA 4BX9A 2ABWA 2YTZA 2ODAA 3RK1A 4CL0A 4YT4A 2YHUA 1U0BB 2R25B 4X20A 4R6XA 5CNIA 2ZCVA 2GEUA 3A1EA 3GR6A 3HJBA 3ZHXA 3RC8A 4WERA 1FY2A 3LC2O 3WMGA 3M0EA 4Y2YA 4M53A 1QNLA 3TG2A 1J1IA 4L9WA 3CNEA 5DCUA 5E6RB 3ZUPA 5H83A 1YK1A 1VOTA 2WSYB 2FPUA 2EHJA 4IDQA 3AJDA 3Q72A 1JIJA 1HDOA 4L8YA 5LMCA 1KYVA 1AQYA 2C77A 3LXXA 2ZR0A 1KAQA 3PDWA 4RDCA 2PD3A 1VG0B 4CMAA 3G17A 2IX3A 1T4CA 2FPRA 2O1WA 1FP7A 4QHTA 4V0NA 2DQKA 2WJHA 1DO0A 4PFKA 4RYLA 4XR4A 5BQPA 4C06A 4ZCMA 3D4OA 5HR5A 1L5WA 2FR1A 3QOXA 1QVZA 1UJCA 1UC4B 1EFDN 1Q0RA 1IHPA 1Q14A 1RAGA 3IPLA 4LDRA 4QYWA 1DEOA 5A06A 3F71A 3O7WA 1G5PA 2OESA 2B34A 1I4OA 3H6GA 3EXHA 2O8CA 1XTRA 2B6HA 1E4OA 1EEHA 1PBTA 1O6FA 2QTVB 3DW1X 4LUCA 1UXJA 2W6IA 3TXXA 2C5EA 5DFAA 2JLUA 3RVDA 2VQEB 4FGUA 1IOWA 1RVV1 1Y3CE 2MDTA 3B13B 3I9V6 4OHVA 1BS2A 2HBYA 1IOVA 1UMKA 1HOTA 1RAFA 3LVQE 4PG8A 1RHKA 2E6KA 5HM6A 2ZT6A 3HNOA 4J7AA 4DSUA 3M6MD 1PWXA 3O74A 3VSAA 5IKOA 3VR4H 3THWB 2PO7A 2VJNA 4AZ3A 2K2QB 4WXMA 3DT8A 2DWCA 4JGBA 5EE1A 3ZE0B 1PGQA 1O96B 1F38A 1MAVA 2J8ZA 3MFQA 3MYRA 2VJAA 4JC8A 4PZEA 4TL8A 3SSMA 1BCRB 1JZSA 5LPNA 5JCOC 4JDUA 3RQIA 3OAAA 3NDRA 3WLJA 5KKNB 1Z73A 2ZUVA 3NLLA 2JZNA 4WOJA 3JVVA 1BRTA 3L46A 3F6CA 3PUVA 5IEBA 4ZYLA 2G3YA 3KQVA 2ATXA 4G5FA 2BMEA 4B82A 4CKWB 4JP2A 4DSAA 1UH5A 1O0CA 2PTHA 1DG1G 3ZXYA 3FSJX 1LFDB 3MAGA 4IL5A 2DTDA 3ZGXA 3MUEA 3S6JA 1TKBA 4KQGA 4EFKA 3UMSA 2XJ9A 1J0BA 1RTKA 2A4KA 3D7NA 4NS1A 4DLLA 2YS7A 5TF0A 1NU6A 2JRCA 3H17A 2ZJZA 3CSUA 4L28A 1Y8ZA 2VF7A 2RHRA 5GPBA 3OA0A 4TT8A 3E82A 2QG9A 4YQEA 1L4EA 4P0TA 3G2JA 4U63A 3BGVA 5ANRB 4PHGA 1U7OA 3NH6A 3MIZA 1T5LA 3KTFA 3NZEA 5G41A 1NXPA 5AKLA 4XLLA 1E5QA 2EBUA 2MMCA 1PP4A 8ATCA 2YFQA 4N5DA 1V16A 2EL9A 1G8PA 3VZCA 2MSDB 2PV7A 5CFZA 4F8YA 4Z8YA 2WD7B 5EYPB 4EHBA 1ZUD1 2ZSHA 1E2DA 1HTTA 2YY7A 4WZBB 2W98A 3AXTA 1NW9B 1W0KD 2F00A 1ADFA 1KJQA 1NTOA 2WWHA 4L8GA 3U60B 1H94A 2JFQA 1TADA 1DJQA 1M1UA 1ZMTA 2CYCA 4Y1FA 2QRUA 1B43A 1XTJA 1TW2A 2NXWA 4PC1A 4MB6A 5GZ6A 1WTCA 4D82A 4QGHA 4O1IA 5CTAA 3SIRA 1WUJS 2WIFA 4KVFA 5KYYA 1C7ZA 1HYQA 5DKFA 3WMXA 2WWYA 4B8ZA 3N59A 2IXGA 4ONEA 3NBKA 4IZHA 2JGJA 3KEGA 3M70A 1Y3AA 2FKNA 3KLMX 4OGGA 3LOUA 5DP2A 4B2LA 1T2AA 5ENVA 5JT1A 3PHCA 1Z2OX 1XZBA 1KMQA 3E1KA 4CL8A 5KYUB 5L9AA 5LP6C 4ZAWA 5F7JA 1EGQA 2CJWA 3AV0B 4GBED 1DV2A 3BXOA 1GPDG 3NNDA 3D43A 3IPYA 4US1R 5C35A 4LZJA 1KP3A 4CG2A 5F9HA 2HWWA 4P3XA 1UC8A 1I6MA 2R62A 2J4DA 4YJGA 1NV9A 2L82A 3GNTA 2FQ1A 3OUZA 4KLZA 4GBGA 7ADHA 3VJKA 2WSIA 3B89A 5JBQA 4YRCA 4ACAA 4F9FA 4UUQA 1VHJA 3FCCA 2ZZKA 1CJKC 3ZPXA 3PGJA 1NW4A 2VNSA 3SR3A 2FRVA 4L3VA 1CQPA 1GAXA 3EPRA 4P8RA 1AS2A 4M9RA 2I66A 3KOXA 5EIWA 2H1WA 5L3ZA 5CM2Z 2DVMA 3ZN2A 3P2YA 4Q4LA 4D4IA 1XTKA 4UE2A 2DFNA 3E0XA 3AUKA 3R6TA 2QTNA 3CNNA 1ECCA 4FBLA 3G5AA 2HA7A 4TSFA 5LP6B 1QC5A 1Z12A 4B7XA 4QM6A 1NUTA 1Q5PA 2CZGA 1UFOA 2Q2VA 1GILA 2OYSA 2X14A 3UFBA 3K70B 1JSZA 1K6XA 4RA9A 4RNCA 3D6UA 2O2XA 1RYHA 1FUUA 5K4AA 4DIUA 3IVGA 1G8JA 4GSLA 2J0UA 4L22A 1JZTA 1T1GA 4YEDA 2NQ2C 4BXOB 3RASA 1R4NB 1VL1A 3FOWA 3C43A 4KI7A 2J3JA 3IJPA 4AULA 1W85A 2IUSA 3OLYA 3PPIA 3FYUB 2NIPA 1NFQA 1ZL2A 1IRXA 4YHHB 3QK7A 2GSDA 1OYOA 4NMXB 4JI7B 1B8PA 2HX1A 1YBAA 2FQYA 2X5KO 4Q01A 4YCAA 2OC9A 4LQCA 4A7PA 1V25A 5K01A 3MT9A 4M9UA 1FFBA 2H2HA 3D0RA 2PH3A 5HFAA 1DKOA 1OFUX 4ENQA 1JUDA 1QP8A 4CF7A 4NCIA 5IW8A 1G16A 1N1GA 4GEKA 5ECDA 4DMGA 5H9VA 2QPAA 1NBWB 3STYA 3FGZA 2WT8A 4RZXA 2HBRA 5C53B 1BVRA 1NMQA 4PYKA 2JGDA 1PZFA 3GYGA 1D6JA 5BV0A 1NW7A 2Z30A 3HJRA 1W4BA 1VHQA 2Z2IA 1PEAA 2A3NA 4QATA 3RIMA 2PO5A 3S5JA 3IRUA 1AHHA 1GNSA 3GRPA 4Y2XA 3QVGB 5EERA 5FPYA 4R6WA 2A5LA 1O5IA 3FWZA 2DFDA 1YO6A 2Q6VA 2XKAA 2JFWA 3H5VA 2C4NA 1M7GA 5AT1A 1L5RA 1I0ZA 1XD8A 3WAKA 4CMBA 4F4FA 4AQDA 1C80A 1YDWA 4KH1A 5CYPA 4J0FA 1M2HA 3B2EA 1VL5A 1SZJG 4O8CA 2XMSA 2G6TA 2HK7A 3GFQA 4YYEA 5BP7A 3E81A 4FSDA 1O08A 3UJ6A 3VBCA 1A72A 4JL5A 5K0ZA 3FFAA 3OU7A 1SURA 2ZI5A 2QNIA 1GAJA 4S1PA 1F4VA 4C20A 2WJYA 1TK3A 3DMHA 2I54A 3PDHA 1O97C 5ALXA 2FOXA 4C03A 1VJDA 2QD2A 4WX2B 3DO6A 5IVDA 5JHHB 1I33A 2HNKA 2ZYHA 3NYIA 2VDWB 5ALOA 1HDRA 1I7PA 1V43A 4IJMA 3UJBA 4H2DA 2JFZA 3KQPA 3QNUA 3OQNA 1E7WA 4IDCA 1FE8A 4PC6A 2XZTA 3JQCA 1FDRA 2ZZNA 4JL6A 4P84A 3CX3A 4HRAA 4EG7A 4YO7A 1I0IA 4MW6A 1FQKA 2XE8A 4C7KA 1LLFA 2BKLA 4DA9A 5EKDA 4LSWA 1EWYA 4IS2A 4BFLA 2WICA 5KAMA 3C8UA 2Y6UA 2ZJAA 3H2YA 4BLSA 3WOVA 2M2IA 1XDSA 3WICA 1FFCA 2JARA 1NVEA 4I81A 4E94A 3UAWA 3S27A 3IAFA 2X13A 4TLDA 3OZEA 4D56A 5KNDD 3GXOA 1AS0A 2BJHA 1REQA 3AUFA 4CV2A 1QKIA 4HBGA 3RV4A 5U1PA 2EIHA 2XSZD 1NSYA 5GAJA 1FFHA 2QRVB 5ALRA 3VH3A 5KKAA 3FE2A 4UOQA 4F96A 2P3QA 2G7MC 1W29A 2QDKA 2WZCA 5ALIA 1AKRA 2EQ5A 4J1QA 5FYDA 4KN9S 4PF1A 1YQXA 1FP4B 5LZ2A 1ODTC 2A2ZA 4Y2GA 3ZIAD 4U7JA 4OSPA 2VT6A 3DFIA 3MF4A 1PEYA 2JCXA 1KP2A 5JNTA 5DV9A 3ZJ4A 4YJFB 5AW0A 2ZT5A 3CURA 1P3DA 4FFRA 2A57A 2XWBF 4N03A 2HPVA 3S4YA 2J59A 5IM4F 4PG6A 4QOJA 4A6XA 1K6IA 1LDNA 3ZJTA 3C8DA 4JELA 3TOCA 2CLSA 3ACDA 2PXHA 3JS5A 3ETHA 3MGCA 4ZRNA 2C00A 2H2DA 4FHZA 4TKUA 2NUAB 3RBZA 4B74A 1T2VA 3KJXA 4PWZA 4RESA 3OF5A 4ZOLA 5JFOA 4L15A 1H2XA 3DL4A 2I6TA 1R9MA 4OJMX 3X2FA 1HK7A 3G8CA 5ALWA 4EUKA 3M33A 1DLIA 1KF0A 1SU6A 4TWIA 4EGCB 3E8SA 4V2UA 2G9NA 1HURA 1VCMA 2PJZA 3HPRA 4FI3C 3UXYA 4GXNA 1B8UA 3GELA 3HACA 4HWGA 4BCDA 1TZJA 3R9WA 1X7WA 3SJUA 2W4IA 1LPNA 2QU7A 1V2GA 4YLYA 2C8KA 1JHUA 1XNGA 1HT3A 3E3MA 1YR9A 3PQ5A 5HRUA 4IIYA 3ZU5A 2PAFA 5TSDA 1ODSA 3DKRA 4XW2A 4HFNA 4J49A 1X7GA 2BBSA 2BY4A 1MORA 2QRVA 2RHDA 4DM7A 3K5PA 1NRJB 1T5BA 4ETNA 2VF2A 1VL0A 1WJGA 4W8GA 2BEKA 3M5CA 3T61A 3RHFA 3EGIA 2OCXA 1PWHA 1E64A 1NFFA 2HRBA 1ZD9A 1G20B 1IHUA 2FG7C 1JHOA 1G5IA 2PPVA 1QZXA 1VIDA 3WWPA 2O2ZA 1F20A 2FZ4A 2WKSA 3IXLA 2WAXA 4KI0A 4ZK2A 2GESA 2PT7A 2V6IA 4MIYA 3TLGA 4B4WA 4YDSA 4D4JA 4BQSA 3MJVA 1YDHA 2YNMD 2X8JA 2B99A 3NEYA 3THXB 3AWDA 3NTXA 4ZKEA 3W5AA 2ZGVA 3QLUC 4MO9A 3WMRA 1AV6A 2IPOA 5BSKA 3IOYA 2HYIC 3LY7A 1ZN2A 3D0OA 3JCZA 3GJ3A 3L93A 4MHTA 3D4LA 4EHLA 4ZI7A 4CLHA 3TVTA 4KRFA 5B53A 4EBFA 3ZW8A 4LJ5A 4Y6PA 2EKDA 3UCFA 3U7EB 2QVXX 1ESZA 1CWUA 2NZUG 1DAEA 1GR0A 2B61A 2QLMA 3HJCA 3RLFA 1G20E 5HPYB 1VIMA 1H2WA 2A9KA 3Q7PA 1IOLA 4RM3A 3KSDO 4KN8A 3ETCA 4P80A 1GU1A 1U5BA 3A10A 5B6PA 1P9LA 4U2KA 4CM9A 3T5TA 5J4LA 3QY0A 3N2LA 1PKEA 4FYJA 1Y7TA 3R1IA 2GJ8A 3O21A 2P9CA 4RD1A 5HMLA 5ARCA 5AUOB 5IH7A 1T8SA 1LFAA 1A0OA 4B9AA 1T6BY 1YSCA 4FBGA 2BM1A 1WUYA 2BFEA 4C6TA 4E2FA 2PEYA 4HH1A 2D0OB 5GM1A 1KQNA 4BO1A 4WOPA 1YAJA 5CFOA 1MJGM 1FYFA 3DDZX 2WPDA 3KKNA 1FNCA 2HJRA 3F5FA 1KY2A 3WBFA 4BBPA 4BU1A 4LI0A 4YAEA 2X6RA 3K7EA 1KXZA 1N9GA 3QSGA 5HE8A 3VOBA 1V5FA 3BT7A 4GXQA 1WQ3A 2PWZA 2RHMA 2AXEA 4XTRA 3B70A 5GONA 5K3DA 4M0PA 1EU1A 2AG0A 3RLIA 3VZPA 2IHUA 4LSMA 5ITZB 5JEEA 1Z4OA 1WXXA 2DH6A 3OCZA 2JBAB 5E1MA 2QOEA 5ALJA 1ISFA 5H3LA 2NXJA 5G3YA 4ZAFA 4GI3A 4MEAA 4MX8A 4REMA 2B8NA 3R3WA 1AN9A 3OCVA 3PQ3A 1N33B 1A4UA 1J49A 2HXYA 4G23A 4GZ5A 4MDHA 1UZLA 2M98A 3ZBTA 4BEBA 2VNAA 3PNKA 3V1UA 3ZZ1A 1IB6A 1BX1A 3N8IA 1YB1A 3TKAA 4BQNA 2Q99A 1TIBA 1N77A 2HNAA 4CLRB 1SUEA 1RLOA 1GZSA 1Y6RA 1CKEA 1FTNA 1XQ6A 2B30A 2J7PD 3G8BA 1Y42X 3H04A 3JQAA 3R4CA 4DXDA 1SVOA 2YMMA 4I2NA 4UPDA 2IQIA 1XROA 1I3CA 1II8A 2Y4OA 5FX2A 4DKXA 5HUJA 2QN2A 3BORA 4A6EA 4AY2A 2WV9A 3B48A 3H5RA 4LVOA 1E1KA 1ULTA 2PYZA 2FN7A 4O2LA 3UQZA 1RACA 2J9RA 1K5DA 4Q3CA 4F5WA 2JG3A 1LI4A 3OBBA 2J9ZB 3AEKB 1JU3A 1G3MA 3CA8A 3IOEA 1KZ7B 3C7TA 4MCJA 3RUPA 1TLTA 2BYTA 3F78A 4LQ4A 3T15A 5ALEA 2VCYA 2DT8A 1QCCA 1OI3A 3AETA 4JCCA 2ZJ2A 1ONBA 2LV8A 1U5CA 3C1OA 4L74A 2BGGA 3KJEA 5I7SA 1G7RA 5JTUA 2BRUC 1E3QA 3G5TA 3ZY5A 3P32A 2HR1A 2GUWA 2PZEA 3L5KA 3OVMA 1W75A 2GAOA 1BQEA 2PGDA 4BEWA 5FBVB 3GEBA 1AUPA 3VKVA 1T9GR 2EERA 3WKBA 1KWGA 4URUR 2FPGB 1UBSB 2IA5A 1M76A 2I78A 3JQGB 3N7UA 3S2IA 1S89A 4NCBA 1FFDA 2WHPA 3A4TA 3ORQA 3VSDA 3W2IA 4YCCA 1E6CA 2FSIA 1E59A 2ZAMA 5BSMA 3BQNB 5ALMA 4A8JB 2EW2A 1E3JA 3FXAA 3C7CB 4L27A 4ITUA 2RHGB 3O82A 4ZCPA 3IIEA 3IEKA 4M1ZA 1DBIA 3JWIA 4QQKA 2W2LA 3FIJA 1M10A 2VBIA 4YRBA 2IGTA 1I2DA 1XNJA 2B5OA 3HBNA 3Q3JB 2Y1CA 4RS3A 4ESOA 3L82B 1L8AA 4V0KA 5JAZA 1W8IA 2XBLA 1M8PA 4RK0A 4IEEA 4J2HA 1T9GS 4RH3A 1E63A 3T3PB 3MMXA 4MS3B 4BWYA 5FPKA 3K5IA 3W4JA 2I4MA 3B12A 5BWNA 1KIAA 2HDNB 3MGKA 1ZGZA 3K8YA 1AXGA 4JBXA 3K9QO 1ZO8A 1FNMA 3LVBA 3UKOA 4E2ZA 2WJ6A 3DE1X 4IOJA 2BD0A 1OZ0A 3LD9A 3CW8X 1RYMA 1ZBDA 3GN1A 1LBSA 4EY7A 4ZVVA 2PWYA 2G88A 5EQTA 1JDPA 3SHTA 3PCRB 2PBFA 3WL4A 2HA4A 1KIMA 2XGSA 2H11A 4FQ7A 3O8QB 5DLEA 1OPRA 1WMSA 2VHEA 1Z25A 4UDXX 4L1KA 2ZYUX 2J0QA 4WAUA 2X8JB 4O4LF 1XLVA 3WR5A 1S2DA 4J75A 5JZMA 1LC0A 3SE0A 4AZ0B 4ZT4A 1II9A 1MUUA 5IPFA 2CLLB 4KOAA 3U19A 2MTBA 4I36A 4N7JA 3LPAA 1DQZA 1EBUA 2AN5A 4R81A 3ZHQA 3EXIA 1GKIA 3W2FA 1PJ2A 2XMDA 3BFVA 1KBZA 4EBBA 2W2OA 1FQWA 1WMAA 4KXUA 1OZAA 3SBEA 1NJFA 4UCQA 3I53A 2QD4A 1PWYE 4H27A 1QGAA 5KIAA 2IH2A 4BC1A 2C7RA 2H5LA 3KPJA 2B5WA 4Z0PA 4DQDA 5KTSA 1IFXA 3GQVA 3WLQA 4WZ6A 4ZJUA 2VDLB 4PPQA 1P1JA 4IIFA 2H2GA 3ZYCA 4F4JA 1N6OA 2B1RA 1GZUA 3L0IB 1U1DA 1UBRS 1RYDA 1ZNQO 1MD9A 2IL1A 2VSQA 3GZTB 3H8VA 4MRNA 4YO8A 3KSZO 3UYKA 3K6SA 4JI4B 4RD3A 2PUGA 5G02A 1AKNA 4XVRA 4GLBA 4N9WA 4ITVA 3UPUA 1ECFA 2VK4A 3HVJA 2LKCA 3OF3A 4RENA 2WB4A 3V7YA 4R9VA 4JYMA 4B33A 2AG6A 1D0IA 1M0SA 2CDCA 4E5KA 1ODCA 4ED9A 4HKTA 3LC0A 1B2LA 2GCOB 1H2ZA 1CUBA 1FVHA 1NONA 2BGRA 2G9RA 4J76A 3OZRA 4A91A 3G7SA 4C89A 3WV5A 2BEJA 1MT0A 4UU1A 1QP7A 4N7BA 4RHCA 4XWKA 1CERA 1HT0A 3ES9A 4US0R 5L3VA 3BCRA 1PR9A 3T1QA 2FW6A 3LY9A 5KJEA 5TPZA 3VTZA 1Y1QA 3MILA 5C9ZA 2P2YA 3CWQA 1NAHA 4O2BB 1TKRA 1HMYA 4C3ZA 3QFHA 1L7VC 4A1FA 1E8DA 4GKAA 4XWAA 3VOSA 2DSNA 2WUEA 1Q1EA 5I7RA 3TGWA 3F7MA 1A8PA 3QEMB 4RJJA 1N78A 5EXPA 1SQSA 4KAJA 4WSOA 5EMHA 3RVSA 5CBPB 2RONA 3CWCA 4EG1A 1DTSA 2FPIA 4NRDA 3R7FA 1QH8A 2GFIA 3SPXA 1R16A 3CZPA 2FP3A 2XZPA 4AXBA 1B3BA 1JLKA 1Z07A 5CGQB 3B1WA 3RYIB 3SC2A 4R2MA 4N39A 2BI7A 1GRRA 3D3EA 4J9VA 5JLAA 2EP8A 1M74A 1S8AA 1RPTA 1E1CA 3SK0A 1NZJA 3CNLA 3C3CA 3NU1A 2G7ZA 3GDFA 2WTNA 1RD4A 4ZOLB 5HA5A 4MDFA 1RQPA 4KREA 5J5CA 4JP3A 2CJPA 2I2DA 4LCJA 1PF7E 4KGZA 1JS1X 1M8JA 1RADA 4GR5A 4QYIA 4RPHA 2RGWA 4KAAA 3WYFA 3ZD8A 5M7EA 1HR0B 5C80A 3DVAA 4LDNA 4QUJA 4DV4B 3IEPA 5BT8A 1RZRA 4RLQA 1EAYA 3TZLA 4M0LA 3MWJA 2REOA 3A7EA 2ZWAA 4URZR 5IT5A 1JR3D 1QH1B 4GQBA 5IXSA 1IAVA 1H66A 5I45A 1RHQA 4O0MA 1P91A 4KQ6A 5HKKA 4NE7A 4EOGA 5IABA 5LMUB 2ETXA 4YXWD 1J7JA 3RANA 3UV3A 1N9GB 4ENWA 1IZ8A 1EM8A 5SZHB 4DKJA 2GB4A 2CNNA 1MIOB 2NO9A 3HXQA 1SVIA 2R3SA 4DLSA 1EX7A 4BE7B 4EPWA 2AF3C 4EY3A 2H4XA 1J23A 3HP7A 3IOMA 4G5XA 3EIFA 4K5QA 3GVCA 5IDVA 2QG6A 5D51S 1V16B 3JWGA 5C0OE 3G82C 1CXZA 3OZXA 4HUQB 3UMYA 5FPSA 3ZBQA 1QZZA 1X87A 2VTBB 5AKIA 3TNYA 3UCEA 1WR8A 2ACVA 2BGKA 2D2IA 2ENUA 3BFPA 4IDBA 4KACA 4AY3A 1TAQA 1FMCA 4P93A 4Y1EA 2LKDA 1H8HD 1CRPA 2X0KA 3WSTA 5AIBA 2Q5HA 4WTOA 2YUTA 4TLMB 1I24A 1AB5A 1DWPA 1RJWA 1ZOLA 2RK6A 3OQVA 4M49A 5GJCA 3RSFA 4Q9DA 4L5BA 2HPHA 2FETA 4KDFA 2W70A 1TC2A 4ICIA 3A9UA 4FFBB 4BB0A 5GVSA 2BTOA 3MA0A 1R2QA 4BAUA 1AZSC 2PYIA 5A4DA 4S2EA 1JQLB 4M9CA 4LGYA 4WN9B 3EYWA 4WNAB 3VAAA 1NBEA 4PYLA 4FYVA 2ZB3A 3TZCA 1EFRD 4B2PA 4NCAA 2RI6A 2P4SA 2E9SA 2QTMA 3E03A 3IQZA 4P1ZA 3ODPA 2XIJA 1ZOPA 2XD9A 4QPDA 2GN2A 4PE5B 2QBYB 1G6HA 5CU7A 4RKFA 1VKNA 3BA6A 1J4AA 1JIXA 4RYDA 3TEFA 3VC2A 2HF8A 2GEJA 2A67A 2G9VA 2QZJA 4IDNA 3THYB 4X66B 3LIPA 5DGXA 3IBGA 3KBBA 1H65A 1GM5A 1DCTA 5IJ0B 4JQYA 1U0JA 4JLWA 5FJIA 2OE2A 4BO7A 3L0PA 2FJ0A 1SCBA 3A3NA 3U40A 4BIIA 4BNDB 3EZNA 3M82A 4IFTA 4Z1MA 1AKUA 2BLNA 3BAZA 3FBWA 3HFJA 3MJEA 4KDCA 4C5AA 4KWIA 3IRVA 3QENA 1I1NA 1WE2A 4FFSA 3WB9A 3IV9A 3EFHA 3LUDA 4GYKA 3SFTA 4CQMA 3G02A 3G9UA 4HDOB 2GETA 3L6OO 2R68A 3X2SA 4RHXA 4P3KA 5DP1A 4AZWA 2QVZX 1N34B 1ZN9A 4XGIA 3CXRA 4B5LA 1J21A 1E1RA 3IC5A 1UBMS 4R8MA 1R10A 3BWXA 3C1TA 3KHUA 3T1TA 4J94A 1RHMA 1OKKA 4PS0A 3UAYA 3V1NA 1WU7A 4TXHA 1HEUA 2PXAA 1Z83A 4GOND 3MXTA 4RK7A 3Q5GA 5D6OA 4N6OA 2QE6A 3T7JA 5I8WA 5L40A 2XNHA 5HTOA 1GQYA 5H7XA 2AD5A 1T4BA 4RMNA 2AW3A 1A2QA 3WK8A 3BM5A 2H3HA 3FRJA 2I2FA 3IT3A 4F5EA 2H31A 3OOSA 3NC0C 3QUSA 1HXHA 2VJOA 5BSWA 2VXCA 4IIUA 3RC3A 4DRYA 3KFXA 1PX0A 2NXNA 3N8HA 5EC8A 3EZ7A 5A4FS 1OBHA 5DM2A 3AVUA 1P4JA 1K88A 2I4NA 2H54A 1UQRA 2QXUA 4XYLA 3VUEA 5JLJA 3E5NA 3VNSA 5U9CA 5EP4A 1OH5A 4FHEA 4RBNA 4BVEA 4JWKA 1XPUA 3D3NA 4DUPA 2P9HA 4NNOA 4RXTA 5ALZA 1N57A 4AY6A 1VFPA 4ZOBA 4ZARA 4INZA 2O8DA 5HZKA 1Q83A 4PX5A 3VOTA 3TUIC 4QG3A 1RXCA 3NXSA 3E53A 3O8OA 1VYUA 1SBTA 1B8VA 4X7RA 4CV0A 1L4BA 3LWZA 1JPJA 4PAWA 2BELA 1XEWY 1ZNXA 2UZ3A 4AJOA 5A62A 1LRLA 3V7NA 5JZVA 2W83A 1XNRB 4QGGA 1FUIA 1VE5A 4ZODA 4KO1S 2QMUA 4RGBA 4WXYB 2WNSA 3ZR4B 3WGJA 2K4MA 1IRIA 1YZUA 2ODEA 4FHFA 2C58A 4HGOA 4HRYA 4S1OA 3THYA 2Z08A 3FYSA 4JEUA 3GEPA 1XDBA 1JR3E 1U7TA 4IIBA 1O0SA 2NOAA 3GBSA 1BS9A 1FMJA 1GZ4A 1VE3A 3EMVA 4TXNA 4BFZA 2R85A 2XF2A 4UZSA 2CNKA 3DOCA 4A16A 2GHRA 1TM1E 1VPTA 2ZCUA 1IXYA 2D2FA 1CY0A 2PS0A 2ZJOA 1Y7IA 2C2HA 3RG2A 1RHRA 1NOJA 1NT2A 3DEZA 3KYCB 2O4UX 4Q1CA 2A33A 3SC3A 1WZUA 2JI7A 2X76A 4JOCA 1ENOA 4Z99A 4S05A 1RHJA 3U3DA 4E07A 4I6EA 4QGFA 5LQJA 3MOGA 4JQZA 2FZGA 3PRHA 1JB9A 2IUEA 1DKPA 1XF9A 2GBLA 2FMIA 1EWRA 3N74A 4IKPA 4QU9A 4JV5B 2Q5OA 4QLBA 1HV8A 1JIIA 3PNLA 1E92A 1NJ1A 1CBUA 3F3SA 3TXYA 3L4JA 1JX6A 4X1YB 2Z43A 2IIQA 3EPHA 4Q03A 2QM8A 3K15A 1ZMXA 4CEIB 1ESDA 1YUNA 2NUBA 3LMKA 4Q19A 4MPJA 1UINA 1Z5GA 1VPEA 4PXSA 3WDKA 4EQ6A 1S3FA 2I0FA 5CPBA 4HUQA 3ZZUA 5BV1A 3Q2KA 4DLTA 1ORVA 3EOBI 3L8CA 1Q2XA 2R6FA 4RVHA 3N2KA 3ZJUA 5B12A 3AM5A 5AHRA 5A2QA 1CEXA 2GPSA 1RYEA 3N5KA 4KQJA 4UXJA 5EMKA 1XVIA 2A6PA 1CY1A 4YRPA 4WFKA 5FBKA 4L73A 2ID8A 2CWWA 3B51X 3L07A 3FDFA 1FQOA 1GA6A 1E7SA 4X95A 4MR8B 3ABZA 4YAUA 4ZU6X 4RC9A 5EN4A 3A06A 1E0AA 5CLJA 4MARA 2WRZA 3AJAA 1WS6A 4LWOA 3WGKA 4N5HX 2A5YB 3L0OA 2ZXUA 1N0HA 3DS8A 2OEPA 4TMWA 2QPOA 1C1HA 1RBZA 3IUMA 3AVYA 3E7FA 3TK1A 2BJVA 3EE6A 4G1FA 5AKGA 4YWHA 4C08A 4YRKA 1PW5A 2GXSA 2ZTVA 5D84A 3WDMA 1CR2A 3QMMA 3TCXB 2P6MA 5ESWA 3OM8A 2SKEA 5E7JA 4OSEA 4WWHA 4UHKA 1A95A 4O4HB 1WG8A 1WLSA 4KAXA 4LSGA 3EB9A 3LT0A 1YCGA 4QBHA 1EBBA 3FAKA 5IC6A 4AP9A 2O7NA 3LCMA 3H9CA 2YIDA 4CM8A 3B7WA 4F72A 2ZI7A 4KO8A 3BMQB 2R6ZA 1BWPA 1BW9A 1XC7A 1ZH6A 2OP1A 5GONB 1CDEA 4KFSA 8ABPA 1T2DA 2FMHA 2O52A 4F2HA 3H2HA 4OU5A 2C0QA 2PZLA 2NZYA 3LV8A 1QH0A 2BGJA 1DJPA 1AS3A 2IRWA 1NJ6A 3QU7A 4ADSG 3AY7A 3AZQA 4HGRA 4TKMA 4R8RA 4AUNA 4CUKA 4KK3A 2HY7A 4JBLA 3VO2A 1SFRA 4HI0E 4OLAA 2OG1A 2WJGA 2X0NA 1RWXA 5FV4A 3SQXA 5C34B 1PFUA 3HCOA 3KKEA 3IALA 5I51A 3ABIA 4E5VA 3VR2D 5D85A 3H2JA 1JG3A 5KEIA 1XELA 3MLAA 3ZIUA 2O07A 4DXAA 2OGSA 4X7MA 1FMFA 1KDTA 3TLBA 3TAHA 2B2CA 2GZHA 4KG7A 1JU4A 4G0WA 3F7OA 4V24A 3LWDA 1ZUHA 3FKJA 4C30A 3N2NA 4D57A 4DF3A 1QYIA 1A8IA 5G3ZA 1U7DA 4UE3S 3O4HA 4Q9NA 1LUAA 4P4NA 3EX7C 3K5HA 1F0YA 3GUYA 3Q40A 5JJBA 2P2LA 4A23A 1L5VA 3RS8A 3ZJVA 3QH4A 3RSHA 1HTBA 2FEOA 3OC0A 5KHOC 1GUAA 4Q24A 2ZRCA 3GZ4A 1LD3A 4MAFA 3GMTA 1PW7A 1FB5A 1ZXXA 2XSZA 2AG1A 2QI9C 1JG1A 3PHIA 2VJDA 1K8ZB 1GR1A 3H86A 1QRTA 3ZH2A 3RRYA 4Q3OA 2XLCA 4Q93A 1WPGA 9LDBA 1MZPA 1RKVA 3USES 2F1HA 2XA2A 3EPPA 5JALA 1JHQA 2YFKA 3V4SA 1EXVA 5JQGF 2I9KA 2AL7A 1Y5LA 5KWSA 3CUYA 4L6AA 4TVSA 4G37A 4RHEA 5TJHA 2VAMA 3ORYA 4IXMA 1MH9A 4YRDA 1FRZA 4M7PA 2DPYA 2HHJA 4QO8A 4AG3A 5JISA 1YIAA 5EPOA 2MSCB 3L1HA 3IDAA 1BRMA 3T4PA 3V3TA 5HQ3A 2NP7A 3GC6A 5HF9A 1GTMA 5ED4A 4C78A 4EHNA 4YUXA 2IWRA 4NHEA 1Z8NA 4PGGA 1RMYA 1BMFA 2UV8A 4NP6A 3P52A 4C76A 4C4XA 4TPKA 2XBMA 3M9LA 1HYEA 4CMHA 4EKIA 3C3WA 4GOJA 1Z74A 2EJWA 2W6OA 4S24A 3H9GA 2NYUA 3A37A 1T4CB 3M3HA 2H4JA 3R5XA 4I5DA 1PN3A 1QCZA 1FYWA 3DZFA 3G88A 4I4NA 1M7BA 5F7OA 2HU7A 1DX4A 3TCKA 2IPAB 3H0CA 3GJ7A 3W5HA 2FEMA 1YBMA 3KR9A 4Q4HA 3TIFA 2P6UA 5JBIA 1TQ4A 2YZGA 1ACLA 4EKDA 1RPNA 3V1LA 1JHDA 1GPKA 1DP4A 3K3PA 4L5CA 1GL6A 4JC4A 1O9GA 1NY6A 3EVGA 4TYNA 3HDVA 2DAPA 4QICA 2ZVJA 1VCHA 4ZWNA 3FWNA 1CK4A 4A8TA 4JYZA 1AD2A 1GPUA 3BD9A 3HDGA 4Z4CA 4XX1A 3O93A 4HAVA 3TSYA 2PVPA 3MC1A 4I1UA 4YXWA 1FTYA 3OIDA 3ONFA 3KEFA 4OTZA 4UD2A 3OPMA 3PBKA 5EIOA 4AZSA 1D5WA 4F84A 3RS3A 5A5GA 1QSGA 2RGUA 4LMRA 3W5IA 5BWOA 4RIHA 5JNLA 2HHAA 4EENA 4ZV4A 1GPLA 4OHCA 5K0GA 3T5PA 3Q8WA 4X8HA 3WJ7A 3MJFA 4I5IA 4I9FA 2DQYA 3KXLA 4JYCA 4IIVA 4RFSB 1YI0A 3ADOA 1NE2A 1WHTB 2Q5JA 3LUFA 3SWWA 3QU9A 4JKYA 3NKFA 5EVCA 3ZV3A 5JXGA 3ZVKA 1G1AA 1JPUA 2HRDA 1Y4UA 4RV5A 5J3JA 2Y0BA 1AMOA 1QIJA 1YJ8A 1FUEA 4BOYA 4FM9A 4LHXA 3UG6A 1IUNA 3Q7RA 4INJA 2YOGA 2W58A 3GEGA 4WKBA 1L7RA 1P4SA 3MFYA 2CF6A 3WGYA 4UDOA 1FFAA 1VSBA 1Z16A 3BIWA 4AIRA 4M8NE 3WIEA 4DCGA 1SRRA 4BGEA 1NP6A 4FGZA 5C1PA 1L4UA 1Y9ZA 5IASA 2AR9A 2ZYIA 3NOXA 4N8EA 3NDIA 4XJSA 2P62A 3LK7A 3OZBA 4NDAA 4CXMA 3T5CA 2O23A 5IEJA 2J3QA 1UT5A 1XQVA 4GR4A 4CM7A 3FRIA 2D0DA 1I9CA 2YDXA 2RCNA 2PZMA 2J0VA 5LQSA 1KORA 4W99A 2PGNA 4NULA 3RAEC 3WGGA 1YI1A 3JQ7B 2YFYA 1C0LA 1JDUA 3UCXA 5FXMA 2EFCB 2JI8A 4IVRA 5FNVB 3UUEA 4ZJYA 3R0IA 3DMNA 3U09A 4RPIA 1W5AA 4RU1A 2J7KA 3QUBA 2XUPA 4ZQCB 1QIGA 2BEUA 1SUBA 1M5TA 2HMTA 4JLKA 4JSYA 3A3PA 3U17A 4POOA 1R4AA 1CUYA 1ZOIA 3GLKA 1R4ZA 3H3JA 2ZI6A 4EPXA 2FFRA 1MO5A 4JYBA 1YTUA 3NAZA 3OFKA 5GINE 4QOGA 1RWMA 2ECQA 4HMOA 3QKTA 2B21A 4V03A 5HKAA 4CF5A 1K0UA 1NLUA 4GW3A 1FRNA 2IV2X 2Q3HA 1KRHA 3G5UA 4LC0A 1EDZA 4FONA 1YDGA 4Y6QA 2EGUA 5KTMA 3PF8A 1UBTS 5JPIA 1XCLA 4G1BA 3T5GA 1CJMA 5TDHA 4X5OA 4KPEC 2BFCB 4C6HA 1OT5A 3LBAA 1PNQA 1Z6ZA 2ORVA 3O95A 1TEXA 5CVCA 5DXJA 1ISHA 3L8FA 4I4CA 3U6KA 2UXCB 4BUCA 1X8JA 2WJAA 3LP6A 3DMGA 4HQKA 4ESEA 1UXHA 1L5MA 1S6YA 2CXOA 2VT7A 3LT5A 2WB2A 1SH7A 3AEQA 3LPLA 4JVSB 1VLMA 3X1ZA 5C7IO 5AVVA 2W6ID 1F3LA 2FMTA 3I92A 2EWMA 5FUVA 4AYWA 1H0KA 4EDHA 1GDHA 1W25A 3GIWA 3Q3GE 5B2EA 4W9MC 3DVRX 2H5JA 5IKXA 4PPNA 2A0UA 1DS6A 2BFOA 4DR6B 1RE0A 4HXYA 3WYDA 4EL0A 1IQRA 1W5FA 5FNVA 1CR4A 2ZSUA 1X6VA 1R8YA 3WHIA 1D6MA 3PXXA 1XQWA 2R5WA 2AV6A 2XE4A 1XTUA 3F8SA 4GBJA 4IUBS 4AG6A 4TYYA 3GIDA 1V8OA 1HLGA 1CUAA 1AO0A 3WB1A 3DOFA 2Q6LA 1G3UA 4L4ZA 3HK2A 4D0LB 1UBHS 2Y0EA 3DLBA 3GJ0A 1DU4A 3BSSA 3O03A 4PM4A 1DNPA 5G0VA 4Z4HA 2I4IA 3OFSA 3S2ZA 3PWTA 4K9PA 5IWCA 5JH7F 1J07A 2BDUA 1MHTA 1GSOA 4K40A 4W1RA 3C4VA 1LGYA 1NF8A 3GDWA 4R1QA 1E3EA 1I1HA 3IPRA 5JJ5A 1ZCZA 2UYOA 3NIFB 4M86A 2QGZA 3ZQJA 4I4LA 4KV9A 4JI0B 4OHMA 3JR3A 2PSEA 3V55A 2F1KA 3ZTTA 2UDPA 1M6WA 4RTMA 4IINA 1LZLA 4KL8S 1J2TA 4HB2A 3VH4A 1P2SA 1UEIA 5B1DA 3B2QA 3CUVA 4W5TA 4XCXA 3BZWA 3QYJA 2HLDA 4EUNA 3MOSA 1T1SA 1O95C 4AF7A 4BQIA 5EP1A 1XQ9A 2D7DA 1QO7A 3EUEA 4LBWA 1OI2A 4UNSA 1IY1A 3WNZA 4E11A 3R5TA 2QBYA 4IBOA 2HV8A 4TM7A 2LDBA 4OM8A 3VI3B 4EA7A 4XPIB 4WIAA 1DBQA 4DTCA 4PZ0A 1T91A 4EB0A 2CDNA 2WYUA 2RBKA 3OT1B 1ZX1A 4TL9A 3T4UA 3GVHA 4GT1A 4REOA 5AESA 2VSNA 7MHTA 2OGTA 2JZCA 2O06A 4I4TB 3W3AH 1YULA 3PRJA 1DTWA 4RCZA 3FYDA 3L4BC 1NJGA 2G1PA 4MCHA 4YMVA 3Q88A 2VRBA 1W36C 1R00A 2ZJYA 1P29A 2LZ0A 1IHDA 2HWUA 2P9YA 2FYTA 3JVDA 3UJCA 4S1WA 3J81A 2Q41A 3VTKA 3K30A 2CB9A 1ISMA 1E5TA 3I32A 2OHVA 5H82A 5D7BA 3O6VA 1KKMA 5ESRA 4QUAA 4R8KA 4QWWA 2J5BA 1G2IA 5M04A 2I6GA 1H9BA 1P9OA 2BGIA 4FDAA 2HKIA 5G0SA 1O54A 3NONA 4FCTA 3CN9A 4FVTA 1QF7A 3SDZA 3WRXC 5BR7A 4DBZA 3QY9A 4FMDF 4I3GA 3P5SA 1L7NA 1P19A 4XE5A 3ZOKA 3G79A 1N0VC 1DC3A 3DYIA 3E7XA 2HRZA 4LTMA 5KVCA 4GH5A 5KTPA 4AYXA 1RC1A 2JFOA 4NU6A 3QLVA 1G8MA 2Q2NA 3U4HA 4E09A 3K2EA 1JHZA 3HKEB 1C8BA 1YU9A 4MTCA 4LHVA 4QPJC 2ICAA 1ABEA 1VJTA 2HRQA 2W2TA 3W04A 4CL3A 3DEFA 3CF4A 3GI1A 5BWLA 2REQA 3D3JA 5C2JB 2UUOA 4MVJF 1CZHA 2QL6A 2QKYA 1RLTA 3VX3A 1FX1A 1IBCA 1ESNA 4RANA 3GD7A 3REFA 5REQB 2Q0QA 1Y5MA 3FHLA 5CLLA 3UB4A 4UQLA 2M6RA 1QTIA 2Z1MA 1YQEA 3KQMA 1SHTX 4BZXA 1FP1D 1M66A 1BG6A 2XTNA 3BGDA 3ZGZA 4K1XA 3PQEA 4KC0A 3ND8A 5K8IA 1L5NA 2GM5A 3UYLA 1QLJA 4B84A 2QM0A 2DGDA 2P5UA 3I2FA 1RXYA 3UQYS 1WW2A 2V8BA 2LD4A 4MKZA 3FSGA 3VPFA 4P3PA 1XD9A 1DPFA 1K75A 3U7FB 3LK6A 3W4IA 3KQNA 1T35A 4FNAA 1HE8B 2TMGA 1T5SA 4J4BA 1J1ZA 3HMQA 1Z26A 4W5NA 2D1RA 2YV3A 2A1TS 4WV3A 1E8NA 3UK1A 4A73A 4BMYA 2V74B 3C3BA 2D62A 5ELMA 4B3MB 2QN8A 2G8NA 2RG7A 3OEYA 2KE5A 4LYHA 4WPGA 3VA7A 4BO6A 2WU1A 3B3QA 3NJRA 5CEJA 2VLIA 3U44B 1QE5A 2C97A 3HU2A 1ZQ9A 2W90A 2X9NA 1EINA 5CX1B 3BMXA 1JHVA 3ZEAA 4R2IA 4MRMB 1QF9A 3TJMA 2AEJA 3DNMA 3JALA 4R0NA 2CZQA 5IJXA 1MRSA 1SXJE 3KALA 3NEPX 4PQRA 3DL2A 1BMTA 4C4PA 2JRLA 4JVOA 4R98A 3V46A 2QXYA 3P96A 4KBYA 3ABSB 1ATIA 1I5EA 2HSGA 2NO7A 4Y9SA 3PUXA 1DBVO 1V6AA 2P9GA 3V8BA 2QQ5A 1LX7A 2F9LA 2J5KA 3GVIA 4GSKA 4M0EA 1OTXA 1ZJ6A 4BQFA 1ID8A 1GPH1 3NVDA 3RHTA 3GLFA 2O8CB 1VLZA 4HDKB 1SXGA 1BJRE 5KBYA 3FCXA 2IOFK 2Q6KA 4G1UC 2CHVA 1MQ9A 5AOBA 4DIEA 3KZVA 1VPLA 3R7SA 2XWQA 1JAYA 2ZTMA 3SYNA 1WMDA 2MMGA 4UUNA 3TI7A 5JARA 4PYIA 1M34A 4ZO7A 1KH1A 1R27A 3INNA 4ZCIA 1D2GA 1XRSB 1QIDA 4MWTA 4OO3A 4CKBB 3G9QA 1RYZA 1NR1A 1R88A 5C1IA 3T4EA 3AL2A 5BN3B 4F1KA 1U1CA