2BH8A

Combinatorial protein 1b11
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
85
structure length
85
Chain Sequence
KMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAGSSGAAVRGNPQQGDRVEGKIKSITDFGIFIGLDGGIDGLVHLSDISWAQAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1B11
publication title A Segment of Cold Shock Protein Directs the Folding of a Combinatorial Protein
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 9
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2bh8A01
4JOIC 3CPWA 3ERSX 2OTLA 4HJ9A 1YJNA 1VS0A 2A19A 2YTXA 4X64Q 1SRUA 3HOVH 4KHPQ 5HGQA 3U50C 4BBRG 3G71A 2NVXH 3K7UC 4DV1L 1D8LA 1Y14B 2LSSA 3K80C 5GAEC 1IL2A 1WCMG 2JK8A 4GKKQ 2MO0A 4A3KH 5M5WH 1I5FA 3G48A 2R7DA 3HOYH 3K0XA 2EIFA 3GTLH 5IYDH 2GVAA 1HNZQ 4O2DA 1EIFA 2PI2E 1L1OB 2D0PA 4DV7L 1PH5A 1A8VA 5C3EH 5EAYA 1OXVA 5HY6A 4BBRH 4DV4Q 4AQYL 2UUBL 3H3VH 1HNWQ 4DKAC 4GOPC 2K5HA 3K8AA 3PV0A 4YHHQ 4BY1G 1S40A 1K73C 1YHAA 1V43A 4C3IH 4DV0L 4BY7G 4IJHA 2OWOA 5JJLA 2JA9A 1PA6A 2RF4A 1GO3E 2LXKA 4X66L 5IP9G 3H15A 4GNXC 1PFSA 1JMCA 3CC2A 3J81c 4DNIA 2R92H 2ZTEA 5M3FG 5E7NA 1NBWA 2E8GA 1TWCH 2N8NA 4HJ5A 1CKOA 1U5KA 3CCRA 1PVOA 1JJ2A 4JYAL 1IXRA 2ZTDA 3J81j 1VQIA 1W2BA 1N34L 1HZBA 4B3SL 1VQ6A 3OW2A 4UY8C 4OONA 4A3LH 4ME3A 3CCEA 5IP9H 3F2BA 2MQHA 1VQ7A 4NXML 1VQ5A 4KI0A 3CAMA 4LF8Q 1BBUA 1UE1A 4DV3L 4DK3C 1XPRA 2YU9H 4QL5A 4K0KQ 2QA4A 1EFWA 4B3TL 4JV5Q 3TEHB 3UDXA 1PH8A 1X6OA 1MJEA 2VL6A 2CQOA 2Z6KA 4BA2I 4UP9A 1YIJA 3NBHB 3H3VI 4QIWE 1X65A 1VQNA 3J7A5 3F2CA 4KHPL 1JJGA 1PH4A 3CPFA 3I56A 4ALPA 4NB3A 2KBNA 4LFAQ 4HJ8A 3L0OA 2MO1A 1IYJB 5BR8L 3K7AH 5GADC 1N9WA 2ID0A 1QZHA 4L5QA 4IJLA 4UP7A 3CF5A 1HNZL 4JBMA 1YEZA 4MZ9A 3KDFA 3AFPA 1EIYB 1OXTA 1JE5A 4NXNL 3I4MH 1K3RA 4DV1Q 4HIMA 3HFZB 1HNWL 1YZ6A 4OO1I 4JI4L 5C0XJ 5GQOA 1T9HA 1B8AA 2B29A 2ZM6Q 4HIOA 1X56A 4YHHL 5C4JH 1HZCA 2JQOA 2A8VA 4GLVB 3RZDH 3STBC 4DV7Q 1G291 3PGZA 5IE8A 3PIPA 2ES2A 4BXXG 4C3HH 1YITA 2I5HA 4AQYQ 3F1ZA 5C44G 2UUBQ 4GN3B 4IPHA 5FLMG 1KXLA 4KHZA 1L1OA 3F8TA 1VQKA 3HOZG 4LF4L 4A3CG 4DPGA 4DV0Q 1KHIA 3I4OA 2VQFL 2B63H 5IY0A 1PH2A 2F4VL 4X66Q 4YWKA 3HOWG 3PIOA 3JAMi 4Y7NH 1PH9A 3CCSA 1A63A 4POGA 2AHOB 2YYZA 3S24A 4DV6L 1XPOA 2R93H 1PYSB 2K5VA 4LNQA 3S17H 3UDIA 4JYAQ 2AWOA 1KRTA 2IX1A 2E2HH 4K0KL 4A3CH 4JV5L 1VQJA 1N34Q 3EN2A 2KHIA 2MNAA 4B3SQ 3GTKH 1HR0L 2AMCB 1Q81C 1HNXQ 3MEFA 4NXMQ 4A4IA 2AKWB 3HKZG 1CKNB 1FL0A 5FJ8H 2WFWA 3KF6A 4DV3Q 1G6PA 1BVSA 4JCVE 2K5NA 1TWAH 3CQZH 4P75A 4LUVA 4B3TQ 1VQDA 2C35B 3RLOA 2PQAB 3PUZA 1J5EL 2Q2UA 3HOYG 3A74A 2JA6G 1N33Q 3S1NH 2Q2HA 4IOAA 4DR2Q 5IYDG 2OQKA 1ASYA 4DR3L 2PMZE 3A0JA 1XPUA 3ULJA 3PO3H 3UE1A 5LMNW 1NJIC 4LWCA 2I5LX 2NVQH 3CCLA 5GROA 5C3EG 1QVFA 2R7ZH 1Q86C 3KJOA 4AYBG 1YVCA 3PUVA 4DK6C 1NMGA 2VS1A 4MNOA 4NPSA 5ELNA 1E3PA 2N3SA 4A3BH 4IFDJ 1AH9A 2ZM6L 4B3RL 3CCVA 2JA6H 5BR8Q 3CCJA 3UE0A 4A3FH 1Z47A 1SROA 2CFMA 4TVAB 3J80c 1QUQB 3H0GH 4JC0A 4P71A 1LUZA 1PYBA 4H02A 1CSQA 1I3QH 3RR5A 3HOUG 3ICEA 3M7NA 2R92G 3Q8DA 4X6AH 1DGSA 2HHHQ 4DAMA 4NXNQ 1L0WA 1N32L 1UEBA 1CKMA 4X65L 2ASBA 2UXCL 1BKBA 4O0AA 4JI4Q 4OX9Q 4HJ7A 2DGYA 3AFQA 2B3GA 1Q46A 2WAQG 1O7IA 3TS0A 1I94L 4L5TA 4JI6L 4A3DG 4OO1G 5IP7G 1MJCA 4A3LG 3T1HL 4HIDA 2R6GA 4GOPB 1JB7A 5DLQE 3JAMc 4AYBE 3HOUH 1HZ9A 2I5MX 1M90C 1ASZA 3AEVA 1Q1EA 2YV5A 4IPDA 4PZ7A 4GNXB 4IPCA 1NTGA 3KLWA 4UP8A 5IWAQ 3I2ZA 4LF4Q 5LMUQ 3M3YH 4R1JA 1C0AA 1E7ZA 2VQFQ 4A3DH 1KRSA 4PZ6A 5IP7H 4J15A 2UUCL 2F4VQ 3S1MH 1VQCA 1HNXL 1G51A 1SLJA 4JI7L 4DR6L 4DV6Q 1HZAA 1X3FA 1X54A 3PUYA 1JT8A 4R4OA 4AIMA 1VQHA 2MFIA 4JI3L 1LYLA 1IBLL 3GO5A 4JI1L 1D7QA 5ELOA 1HR0Q 1N33L 1TWFH 2K52A 2E2IH 1VQMA 4DR2L 2OCEA 3EIVA 5FLXc 2BH2A 1KAWA 3CC4A 4Y52H 4IOCA 4JI2Q 1I6HH 1NMFA 1OXUA 3NEMA 4OWWB 2Q2IA 2JA8G 1YBYA 3STBD 3NENA 3I4MG 3PUXA 1J5EQ 2UXBL 2PNHA 3PF4A 5JEAG 4R4QA 2JEBI 2OTJA 2JE6I 4JI0Q 1E24A 4DR3Q 3OTOL 3GTQH 3U4VA 3DLLA 2CKZB 2PQAA 5M3MG 1TWGH 2VUMG 4YWLA 2NZOA 1VQEA 1B70B 2HHHL 2JA8H 2KCMA 2F3IA 4JG2A 4DUYQ 1IZ6A 2QGQA 1E1TA 1N36Q 1XMOL 4GS3A 3M4QA 1VQBA 4P74A 4YY3Q 1RL2A 4LF7Q 2IT1A 4KLKA 2VQEQ 4JOIA 1SFOH 4B3RQ 3OYYA 1FJGL 2BA0A 2IHFA 5K36G 1IBML 5GAHC 3AQQA 4A3JG 4LFBQ 3BJUA 3KJPA 4YCWA 4A3IG 5M3MH 3TRZA 1AE2A 3G4SA 1EWIA 4A3EG 2VUMH 2R93G 1GKHA 3GTPH 3PO2G 4X65Q 1N32Q 3A5ZB 3HKSA 2UXCQ 2XTIA 5IT9c 4LUZA 4LUOA 5IWAL 3M4OH 1I94Q 4JI6Q 1VQLA 5LMUL 2WB1G 1RIPA 4LF5L 1HJPA 2HIVA 2QEXA 3M85A 1E22A 3T1HQ 1UWVA 1K83H 1K9MC 3F2DA 2JA5G 4A3JH 4IFDI 2NN6G 3CP0A 2HQLA 1VQ4A 5FJ8G 1WOCA 4A3IH 1B7YB 1PH3A 4QGUA 3DM3A 1A62A 4A3EH 3RLNA 4YWMA 3PO2H 3S1QH 1X3EA 2R7FA 4IO9A 4GOPA 3FKIG 4GLXA 1XNRQ 2JA7H 2Y0SG 2UU9Q 1K8GA 3GTMH 1W3SA 1TXYA 1J6QA 4GKJL 3M4PA 4A75A 1YHQA 2KHJA 2UUCQ 1VQFA 3BZCA 2JA5H 3PO3G 2F52A 2IHEA 3I4NG 4JI2L 4DR6Q 4JI7Q 2RCNA 3TQYA 4UPAA 2UXDL 1XJVA 2R7ZG 3RZOH 2WB1E 2Z6KC 3W1GA 3FKIH 4JI3Q 3J81i 1PHJA 1IBLQ 4OXPA 1Y1VH 4JI1Q 4A3BG 4QQBX 1VCIA 3S2HH 2HIXA 4A3FG 4JI0L 1HH2P 1NE3A 3H0GG 3PF5A 3W1BA 1VQAA 3CMAA 1MKHA 4C2MH 3PCOB 4PG3A 4R4IA 3I4NH 2EQSA 5M5YH 2Y0SE 1VQ9A 3KYHC 3CCUA 3WWVA 1PH6A 5C4XH 3L2PA 4DUYL 5LMNQ 1N36L 2UXBQ 4LF7L 4YY3L 2YTYA 5IYBG 2V1CC 3B6YA 2N49A 2VQEL 3BU2A 4DV2L 3I7FA 1QVCA 1VQGA 3HKZE 5JJKA 3J7ZC 3I55A 1FGUA 3OTOQ 2BH8A 1OXXK 4AH6A 4B3MQ 2DUDA 4LFBL 3G6EA 2VZAA 3JC66 3KDFB 3CC7A 3CCMA 4OX9L 4R4CA 3W5OA 2L15A 2YTVA 2B63G 4EX5A 4A3MG 1GD7A 2VNUD 1XMOQ 4JI5L 2D0OA 1C9OA 1YNXA 3CMEA 4LF6L 5IYBH 3S1RH 1EOVA 1KIXA 1FJGQ 1XMQQ 1S3OA 1X3GA 1WFQA 2NN6I 4BA1I 1IBMQ 1IBKL 4DR7Q 1Z9FA 5C0XI 4MTNA 5J3BA 4A76A 3S14H 4QY7A 1Y1WH 4DR1L 1L1OC 2IX0A 2ZTCA 4EQ5A 4DR5L 3D31A 1V9PA 2E2JH 1EUJA 3SGIA 3E0EA 2K4KA 4L5RC 1SMXA 4OWTB 1VQPA 3ULLA 3T1YL 1MIUA 4A3MH 1XNRL 1OTCA 2KCTA 2UU9L 5H1SE 4LF5Q 2D62A 2K50A 1KQSA 4JBJA 2GVBA 2E5LQ 2WP8J 2FXQA 5AJ3Q 4A93H 1WCMH 4DAYB 4POFA 3NELA 4YCVA 1X9NA 3RLFA 3GD7A 4IFDG 4XIGS 3RN2A 3LGJA 2WAQE 1EQQA 4QJFA 3CXCA 4LF9L 3VDYA 1Q82C 2NVTH 1K0RA 4JI8Q 3U4ZA 4GKJQ 3IRBA 2RHQB 1L2FA 4P73A 4DUZL 2ZJQA 1WI5A 2RHSB 2JEAI 3KF6B 1TWHH 2UXDQ 1SE8A 4BY1H 1XNQL 4BY7H 4DR4Q 1X55A 4LFAL 1NY4A 2N78A 3M9BA 1LM0A 5JJIA 4YCUA 4X62Q 5LMNL 1CKNA 5JEAJ 1PV4A 1BBWA 3FHWA 3L7ZC 5M3FH 4DV5L 1HR0W 4A3GG 4PMWA 4WJ4A 1S72A 4LFCQ 3EBEA 2K14A 3TREA 2K75A 1EYGA 4B3ML 1QVGA 1E1OA 1FVIA 3HOXG 3D0FA 2NVYH 2UUAQ 4OWXB 5GAGC 1P16A 1SN8A 1M1KC 3E9IA 1CSPA 1VQ8A 4X64L 4DV2Q 1PH1A 4A3GH 3GTOH 1XMQL 4DR7L 5IYCG 4C3JH 3A5UA 1YI2A 4P72A 4GKKL 4XTCS 1Q12A 3U58A 4GN5A 1UE7A 2VY3A 3KF8B 3HOXH 2Q2TA 2ALYB 1XTDA 1N8RC 4L5SA 2ZJRA 4GN4B 2JA7G 3S15H 1QUQA 4JI5Q 2CCZA 4LF6Q 2AWNA 2Z0SA 1CUKA 2OQ0A 3ULPA 1KL9A 3MXNB 4APVA 4HJAA 1IBKQ 2KENA 5IYCH 2E5LL 3GDEA 4DV4L 3CCQA 1C7YA 1VQOA 5AJ3L 4IPGA 2XGTA 4DR1Q 5C0XG 1Q1BA 1YJWA 1JJCB 4DR5Q 3UDFA 2HT1A 2PI2A 3KOJA 3K81C 1WJJA 4TQUS 1Q7YC 3T1YQ 3J80i 1P8LA 2ATWA 1AE3A 1K8AC 3S16H 4R4TA 4JI8L 1Y1VG 3S2DH 1WYDA 3GTGH 1U0LA 2H5XA 1YJ9A 2BA1A 4GNXA 1KD1C 1A0IA 3KFUA 1YHBA 2GN5A 1LTLA 2ZJPA 3TS2A 3PUWA 1UE5A 4HIKA 4LF9Q 2NZHA 2I0QA 4DR4L 4A93G 3CD6A 5C4XG 3E9HA 2LXJA 2JJQA 4X62L 3GTJH 3BZKA 1Q8KA 4GLAC 4BXXH 4BBSG 4LF8L 4DUZQ 5C44H 4LFCL 4JBWA 5FLMH 2CWAA 3AYHB 4RMFA 3HOZH 3UDGA 1SR3A 3ZJYC 5M5XH 4LW1A 1EQRA 1XNQQ 1GM5A 1GVPA 1OXSC 3RNUA 3RN5A 2UUAL 1I50H 4JBKA 2VW9A 2A1AA 3HOWH 4RG1A 1KC8C 3PSIA 4FDBA 3HOVG 4DV5Q 3CW2C 2CWPA 1PH7A 4BBSH 1UE6A 1QZGA 1V1QA 2IY5B 4PZ8A 2EXDA 3ER0A 4A3KG 1Y1WG 1R9TH 3FP9A 4WJ3M 1H95A
chains in the Genus database with same CATH superfamily
3ERSX 2OTLA 4HAEA 1YJNA 2L4NA 4CKBA 2A19A 4KHPQ 5FO8B 2NVXH 4FF3A 3HEJA 4DV1L 1YNJC 1D8LA 2LSSA 4GKKQ 1ET9A 2JK8A 1SBBB 4A3KH 1NUCA 1B2TA 3K59A 3K0XA 2Z9HA 2L12A 4NW2A 2ZXRA 2AQ1B 2EY6A 2PZUA 1SE4A 3QG1A 1H9MA 4DV7L 3C1FA 1PH5A 3IFTA 1GXDC 1MSHA 4ZLTF 5HY6A 4AYBB 3D6CA 1EWCA 4NKLA 2K5HA 4C3IB 4IFDJ 3ITPA 1UNSA 3M7GA 2OWOA 2JA9A 2PZWA 1STHA 1K8MA 1GO3E 4Q5VA 1JMCA 3H15A 4GNXC 1KAAA 1GUTA 2R92H 2ZTEA 5C5LA 4RKBA 1BBXC 1VF7A 2O5IC 2F0VA 3CHBD 3CCRA 2EYHA 1JJ2A 4JYAL 2EYMA 2ZTDA 4XYOA 4DK0A 1AZPA 5EPLA 4E6IA 1JQYD 1EL0A 4A3LH 4ME3A 2M00A 3CCEA 3GQBA 1TU2B 3F2BA 4KN7C 5I2XA 4JVZA 1DOLA 1SNCA 2JYOA 1FNUA 4G7ZC 1XPRA 2YU9H 1PTOD 4QL5A 5EQ0A 2QA4A 1Y69U 4JV5Q 4H7BA 4TSSA 2RVLA 1MJEA 2Z6KA 2JP1A 3FMCA 4JW0A 3NBHB 1VQNA 1JJGA 3FPPA 3TBIB 4RAUC 4NB3A 2MO1A 1IYJB 5BR8L 1QZHA 1N9WA 2ID0A 2JN4A 1F77A 1ILPA 3KDFA 1EIHA 3AFPA 2K32A 4K2KA 1Y8OB 4HIMA 1HNWL 1YZ6A 4JI4L 1PTOB 1I4QA 4DXGA 1HZCA 4ZAIA 1KDBA 3OOCA 3RZDH 3STBC 1G291 4ZCKA 1YITA 2UUBQ 3F1ZA 2A5HA 1EZ8A 4NP5A 5I4DA 2G9HD 1VQKA 3DWPA 4DV0Q 1JOQA 2B2YA 2MJ8A 3I3CA 3PO2B 2R93H 1B53A 2A69C 3S17H 3UDIA 4K0KL 3GTKB 2WB1B 2LS01 1MI2A 4B3SQ 2K5DA 2KHIA 2MNAA 2KEDA 3HKZG 1CKNB 5EKIA 4KY5A 3CQZB 4JCVE 3FKIB 2K1BA 4LUVA 5DNFA 1SXTA 4B3TQ 3HOYG 3IAYA 2Q2HA 3R8BA 3HKZB 3UE1A 2ENBA 1BCPD 1F2LA 1NJIC 2I5LX 3NBIA 4G57A 5CC4A 2R7ZB 5C3EG 1QVFA 1Q86C 4CDCC 1YVCA 4Q0FA 4MNOA 1AH9A 1E3PA 2KOLA 5ELBA 3N6RA 1D1IA 3UE0A 1SROA 3J80c 4P71A 1I3QH 3RR5A 1U4MA 4XXEA 2ASBA 4V0BA 1BKBA 4RHRA 4OX9Q 3AFQA 1QWYA 1MJCA 1RTOA 2CH4W 1ESFA 3S14B 3HOUH 4AYBE 1BCPB 1S5CD 1UAPA 3AEVA 1Q1EA 4IPDA 3D4DA 1XXGA 1GUSA 4ULLA 4R1JA 1EYCA 1KRSA 3HG9A 2F4VQ 5CV8A 3A8KE 3OHXC 4KY7A 4M8AA 1HZAA 2NYZD 3L3OC 1B44D 2FMMA 3WOEA 2BDNA 5ELOA 4ME5A 2K52A 2E2IH 1VQMA 4DR2L 3EIVA 4Y52H 3CC4A 4JI2Q 3NHHA 2A6ED 1NMFA 4OWWB 1MD2D 1YBYA 2BCOA 1VDZA 2UXBL 3P1HA 4R4QA 2JEBI 2JE6I 1PFMA 4DAPA 1QG7A 4DR3Q 1E2VA 2CKZB 2PQAA 1NNXA 1DOMA 4PQXA 3TSSA 3H6MA 2EVBA 2F3IA 4JG2A 5T1IA 4LF7Q 1XMOL 1QE6A 4GS3A 4YY3Q 1EYDA 4B3RQ 2VQEQ 3GP7A 3OYYA 1HQRD 2IHFA 5JJZA 1KDCA 2RKSA 1U4LA 4RGNA 1AE2A 1ZEQX 4A3EG 1SNDA 4X65Q 2UXCQ 3M4OB 4LUZA 3NWTA 4MHEA 1D2BA 1HJPA 2HIVA 2QEXA 3M85A 3T1HQ 1CT1D 1K83H 5K36H 1BO0A 2FJ2A 2SOBA 4HEDA 3VYSA 1STNA 5FJ8G 1WOCA 4A3EB 1B7YB 1T5XD 1A62A 4I7AA 1A2TA 3S16B 2JA7B 1K8OA 3PO2H 3S1QH 3PIP3 2R7FA 4GLXA 3KUPA 1LTRD 4RH6A 1TXYA 1CA5A 2Q8IB 2KHJA 2UUCQ 2EJGC 3Q24A 3PO3G 3OW7A 5D3DA 2NTTA 1IYVA 1AN8A 2WB1E 3PIO3 1I4GA 1B3QA 3FKIH 1Y1VB 3J81i 3S2HB 1GUNA 2FMCA 3Q23A 4FXDA 1NE3A 3W1BA 2K5WA 5M5YB 1ILQA 3BVMA 1LV9A 4IUQA 1EEID 3WWVA 1PH6A 5C4XH 1LABA 2N49A 4DV2L 1QVCA 3HKZE 2K05A 2RDHA 4AH6A 3A7AB 3CC7A 2TMPA 2KJXA 1IW7D 2RBMA 1BOSA 3W5OA 2L15A 2YTVA 3SK4A 4EX5A 5J22A 2B63G 4RHSA 2IWHA 3S1RB 4LF6L 3CMEA 3PQIA 1X3GA 1IBMQ 1IBKL 1BNZA 3S14H 5KYLA 1Y1WH 2E2JB 5EKLA 4EQ5A 3GTLB 1V1PB 4H0LC 3E0EA 4HN7A 3E5SA 5L37A 3T1YL 4A3MH 1XNRL 1HPCA 1LTAD 4OELB 5H1SE 2EOTA 4JBJA 2GVBA 4A93B 2WP8J 1O78A 1KLGD 5EPKA 3NELA 1X9NA 3GD7A 4XIGS 3RN2A 2F0WA 1EQQA 2H1EA 3NQIA 2VB3X 3IRBA 2RHQB 2Z6BA 4DUZL 2JEAI 4KMUC 1TWHH 3J7YW 1ZYRD 4KTAA 4LMQD 4BY1H 4BY7H 4DR4Q 2UXDQ 1SYBA 1NY4A 2N78A 3OSOA 1CKNA 5M3FB 4WJ4A 1H9KA 4FNFA 1S72A 1SJHD 3TREA 2K75A 3A56A 1IHZA 4R9WA 1FVIA 2NVYB 3HOXG 3D0FA 2UUAQ 2EJMA 5GAGC 1Z6HA 3E9IA 3WOFA 1GHJA 1PH1A 4H13C 4C3JH 5FK9C 4P72A 4GKKL 5EJWA 3SK6A 3HOXB 2VY3A 3MEHA 3I8ZA 2ALYB 1XTDA 4L5SA 4RGOS 1V8QA 2AWNA 4WORA 4APVA 2JSOA 5CV4A 5IYCH 2E5LL 1VQOA 4QB4A 2XGTA 3NTHA 5C0XG 3UDFA 3ONAB 3K81C 1WJJA 3S16H 3GV3A 4XT1B 1K8AC 2F3VA 2QW7A 4CJ2C 4KHVA 5KYIA 1YJ9A 1SMYC 1HHVA 1B50A 1EQVA 2F0KA 2F0MA 2GN5A 3TS2A 2EXZA 4X3SA 1UE5A 4HIKA 3FDTA 5ELCA 2LXJA 3Q0AA 2NBFA 4GLAC 4KKSA 4BXXH 4BBSG 1LT3D 5C44H 3HOZB 5FLMH 2CWAA 1JCKB 2B2UA 1CTMA 4OHJA 3ZJYC 1GVPA 3TMEA 1K0SA 4EQOA 2A1AA 1X32A 1ML0D 4F88A 4FDBA 2ZXOA 1X3PA 5IT9L 3CW2C 4BBSB 1V1QA 3NUCA 4PZ8A 4A3KG 1H95A 3R93A 3FP9A 4NMZA 3CPWA 1NR2A 3BDCA 2BE5D 2YTXA 4C1NI 2NVXB 5HGQA 1EY4A 2FINB 1WTVA 2F0PA 5I2YA 3IFDA 3K7UC 5KNDA 1Y14B 4A3KB 2V4DA 1WCMG 1F9PA 5D3IB 5M5WH 2NZ1D 1EQTA 2OEOA 2J4XA 2C5CA 1ESRA 3GTLH 5CV7A 5IYDH 2GVAA 1EIFA 4HSPA 3LX0A 5C6AA 3KF8A 4PMBA 2SEBD 2UUBL 1WTXA 1HFNA 4GOPC 2XWBB 1WD1A 2B2TC 2F0GA 3PV0A 1S40A 4YHHQ 1K73C 4DV0L 2XRSD 3NWSA 3MXNA 4IJHA 2M9VA 1A3VA 2LFNA 1PFNA 3CC2A 2R92B 1J8IA 4HMJA 5E7NA 1NBWA 1TWCH 2N8NA 5T1GA 1CKOA 4QMGA 1VQIA 4KD3A 4DAVA 1W2BA 4B3SL 4OO1H 3OW2A 3VYRA 2PPBC 5IP9H 2F0QA 3A55A 2IL8A 5IODA 2B39A 2ICIA 1VQ5A 3N52A 4KI0A 4RGTA 3CAMA 4LF8Q 1BBUA 2YU9B 4DK3C 3KK7A 2CVRA 4B3TL 1EFWA 1RKNA 3JAML 1BF4A 1PH8A 4BA2I 2VL6A 1WTRA 4B08A 1EIGA 1YIJA 1IKLA 3J7A5 3F2CA 2A6HD 1PH4A 1FGBD 1EFID 5KNBA 5CV6A 2ICEC 2KBNA 3R2TA 4LFAQ 3L0OA 1S4ZA 3K7AH 1TS5A 2AUKA 1HNZL 3SXHA 1YEZA 3TP8A 1SDFA 3V2TA 3I4MH 3HFZB 1Y8PB 3BS1A 5FLXL 1STBA 2F4IA 5C0XJ 5GQOA 1T9HA 1B8AA 2ZM6Q 4HIOA 5I6YA 3T16A 2LMCB 3RZDB 1S5DD 2A8VA 4GLVB 3KBGA 2ES2A 4C3HH 4AQYQ 3V96A 5EBCA 3I4OA 3TZUA 5E3FA 1GOZA 2F4VL 4YWKA 3HOWG 1FNWA 1WTWA 2N55A 3J81E 1JE4A 2R93B 3S24A 2YYZA 1EY8A 3S17B 1PYSB 1PLFA 3R3OA 2E2HH 4XQNA 1VQJA 1YNJD 3EN2A 2R3ZA 5E4WC 1N34Q 1Q81C 1HNXQ 4MIUA 2F0EA 3KLRA 4J6HA 3IL8A 2XRQD 3LWUA 1Z7TA 1TWAH 1EZ6A 1SEBD 2Y0SB 2PQAB 3O13A 4FXGC 3A74A 4DNTB 1N33Q 5JVH3 1HUMA 1WD0A 3G6JB 4DR3L 3I4NB 2KA7A 1V1OA 1E0BA 2HUGA 2NVQH 3CCLA 4AYBG 3VR3A 2BOSA 5ELNA 2N3SA 4A3BH 4B3RL 3CCJA 4C3IG 4A3FH 1Z47A 2X6GA 4UHVA 2XN9C 3H0GH 1I3QB 1KDAA 1PYBA 1CSQA 5C4HA 3HOUG 2HHHQ 4NXNQ 1SNQA 1UEBA 1CKMA 4X65L 2UXCL 1DXMA 1U4RA 4HJ7A 2DGYA 2B3GA 1TVXA 2ZXPA 1AZQA 1KNAA 1IL8A 3T1HL 3KLSA 3HOUB 4WJWA 1QNKA 5DLQE 1HZ9A 4L8JA 1ASZA 4GNXB 1NTGA 1QB5D 1VMCA 1IYUA 5LMUQ 3A8JE 4ZYSA 5IP7H 4J15A 5JPMC 2UUCL 1F2MA 4KJOA 5I6WA 1SE3A 3K5MA 2L11A 1HFGA 2IPKD 4DV6Q 1X3FA 3T53B 1X54A 1EEFD 2XIWA 4R4OA 1VQHA 3K5NA 2MFIA 4K5VA 1D7QA 1HR0Q 2E2IB 3SK8A 1TWFH 3SK5A 1KAWA 1PTOF 3VR2A 1I6HH 3Q22A 5KRUA 4FVMA 1OXUA 4CDEC 2Q2IA 3STBD 1A2UA 3H91A 1PXUA 3PF4A 4IURA 1ENFA 3NQTA 3EA6A 4JI0Q 1QILA 5LHY1 1CQVA 3U4VA 3VA5A 5ELDA 4YWLA 2L9HA 1B70B 2PQEA 1JWSD 3M4QA 1VQBA 4KV6A 2IT1A 4KLKA 3GTOB 1SFOH 5K36G 1IBML 5GAHC 3AQQA 3KJPA 3TRZA 3I91A 5IGFA 3G4SA 1EWIA 2I07B 2A73B 3PO2G 3A5ZB 1ICFB 1M8AA 5IWAL 1I94Q 2Z4HA 2WB1G 2E2DC 4QCLA 1K83B 4H44C 1Y8NB 3K0YA 4A3JH 3MZ5A 4YWMA 3S1QB 2P5ZX 4GOPA 3KLSX 3FKIG 2UU9Q 1W3SA 1J6QA 3NTKA 3K5OA 3BG3A 3M4PA 4O1NA 3BZCA 3E3XA 3TQYA 4UPAA 4EVOA 2F03A 5ELFA 2UXDL 2R7ZG 2EZVA 1PMRA 4JI3Q 1VMPA 4OXPA 4QQBX 1SJED 1Q3LA 4XQJA 2B2VC 2AUJD 3PF5A 1MGSA 1ET6A 3NSWA 1MKHA 3I4NH 3PCOB 4PG3A 4R4IA 2EQSA 2Y0SE 4L63B 5C4XB 4PNYA 1G8ZD 3L2PA 4DUYL 4MTKA 1N36L 1BCPF 1TIID 1HXYD 3BU2A 5JJKA 3J7ZC 1H9SA 2BH8A 4LFBL 2DUDA 2VZAA 3T51B 3DHQA 2K6AA 3E0JA 1F9SA 1GD7A 3D8GA 1R4PB 4ZK9B 4WFN3 4A3MG 2VNUD 1EOVA 3ZYYX 1FJGQ 4BA1I 1WFQA 4DXFA 5J3BA 1Y1WB 1L1OC 5JAVA 3D31A 1CQFA 3H3VC 4OWTB 4A3MB 3ULLA 5NUCA 2SNMA 2KCTA 1TT2A 4LF5Q 2D62A 4CDDC 5D65A 1ONLA 5HURA 2A74C 1DOKA 3RLFA 1HCZA 3LGJA 1CZWA 1E2WA 4QJFA 3GV6A 3VDYA 1Q82C 2E75C 1HTPA 4GKJQ 1LTGD 5D14A 4IUVA 4P73A 1GJXA 2ZJQA 1WI5A 4QF4A 3J80L 1TWHB 2D2CC 1EY9A 4BY1B 4BY7B 2CH4A 3K57A 3M9BA 2WIIB 5JJIA 4X62Q 5LMNL 1BBWA 1TS4A 3EBEA 2K14A 1YNNC 4B3ML 1E1OA 1RF2D 1A3TA 1SN8A 3GTOH 1XMQL 3NP8A 3OIQA 4C3JB 5IYCG 4DR7L 1Q12A 4GN5A 2RDGA 3KF8B 1UUPA 1N8RC 3FRPB 1SYCA 2JA7G 4GN4B 3S15H 2LY7A 4XDXA 5F2DA 1AEXA 2Z0SA 1CUKA 2OQ0A 3K5LA 3MXNB 4HJAA 2KENA 3GDEA 1C7YA 5AJ3L 4DR1Q 4B9XA 1YJWA 1JJCB 2PI2A 3KOJA 4TQUS 2A6EC 2ATWA 2RDFA 4HSVA 4JI8L 1Y1VG 3R2IA 5A2QL 1WYDA 3GTGH 1U0LA 1L0XB 4GNXA 1LTBD 1A0IA 1LTLA 4I7ZC 2NZHA 2I0QA 1HA6A 4CGYB 4DU9A 2JJQA 4C1NK 4WRDA 5C44B 4RWSC 4LF8L 2MUYA 2F0FA 4LFCL 2QDBA 3I70A 4G7HC 1G6ZA 3AYHB 1JWUD 5EKKA 1SR3A 5CBAE 5M5XH 1XNQQ 3EFXD 1OXSC 3RN5A 4JBKA 2VW9A 1CFMA 3VR6A 4RG1A 1Q90A 4YIJA 4FF1A 3MHBA 2L55A 4DV5Q 1MHWC 1S5BD 2PMZB 1JB3A 1EU3A 5CMDA 1UE6A 5I9PA 2IY5B 1GUWA 4WJ3M 1R9TH 4LFAL 5EPJA 1D5ZC 2DNEA 1VF5C 4HJ9A 4K8IA 2Q8TA 1VS0A 4OL7A 4F87A 1JC7A 2HCCA 4A93G 5GAEC 5M5WB 4Z9CB 2MO0A 4U673 1I5FA 3G48A 3HOYH 2X69A 1D5XC 4O2DA 3MVVA 4DF7A 3QIAA 2D0PA 4KJNA 4OIJA 5C3EH 4BBRH 1OXVA 3H3VH 4AQYL 5IGGA 1HNWQ 4ZQ3A 5DM63 1EY6A 1I4PA 4DKAC 5FKAC 4IZ8A 1OO9B 2MP1A 2MHVA 1YHAA 1V43A 5JJLA 2F0JA 1WTPA 2HCIA 2MPMA 2LXKA 5IP9G 3J81c 4K6LA 5M3FG 5COYA 1TWCB 4IN3A 2QCPX 3QJYA 1U5KA 2WINB 2KECA 1PVOA 1QCBD 1IXRA 1A3UA 4B9WA 1N34L 1HZBA 3QB3A 2WV6D 4OONA 1EWHA 2MQHA 1G2TA 1E2ZA 4K0KQ 1W6KA 3TEHB 3FEWX 1LLRD 2CQOA 3J7AV 3HS0C 3OIPA 1MSGA 4TKOB 1X65A 1W6JA 4KHPL 2R61A 3I56A 3CRKC 4ALPA 4HJ8A 1SMYD 2EY5A 3K7AB 1RHPA 5GADC 2A68D 4UP7A 3CF5A 1TQOA 4JBMA 4RCNA 1EIYB 3I4MB 4C3HG 1OXTA 4X3TA 4NXNL 3MFGA 3DMUA 3MTSA 4OO1I 1D6EC 1STAA 2B29A 4KKTA 5KGUA 4KY6A 4CDFC 4DGZA 1ENCA 4FXKC 5IE8A 5HGTA 4C3HB 5G3LD 1MBYA 2I5HA 4JPBW 4IPHA 4BS9A 1EY7A 1G2SA 1L1OA 3HOZG 5G3LF 1KHIA 5FO9B 1PH2A 4X66Q 2M2LA 3JAMi 4Y7NH 3MXGA 2J0TD 1A63A 4POGA 2F0TA 2B8FA 3AB9A 4DV6L 2K5VA 3G7LA 3MXUA 2FHTA 2E2HB 2AWOA 2N88A 2IX1A 2QDLA 4HR7B 2EDGA 3HP3A 5BN4A 4A3CH 4K14A 4JV5L 1WTQA 1HR0L 2JA5B 3MEFA 1GHKA 4F8MA 4NXMQ 4A4IA 2AKWB 4IALA 5FJ8H 4P2CB 2LKVA 1TR5A 1TWAB 1BVSA 4DV3Q 2K5NA 2D9UA 1VQDA 2C35B 3RLOA 1NR4A 1IKMA 4HMIA 4DR2Q 1B1ZA 3MFYA 2PMZE 3ULJA 3PO3H 2KCNA 3MA2B 3VR4A 5LMNW 2NVQB 2C9OA 4ZKCB 2EYOA 2KEEA 3VYUA 3PUVA 4KKUA 4DK6C 2VS1A 4A3BB 1BQQT 2RSNA 4CBVA 4A3FB 2JA6H 3H0GB 1FNVA 4TVAB 5JPNC 1DONA 1QUQB 2E74C 3M7NA 1STYA 3ICEA 2R92G 3Q8DA 2RCFA 4DAMA 1JOKA 2FFKB 2IW3A 1NCVA 2G9DA 1PDQA 1I94L 1Q46A 1O7IA 4L5TA 5IP7G 4A3LG 3BDLA 4HIDA 2R6GA 4GOPB 4HCEA 4OGQC 3JAMc 3C1EA 1M90C 2KCCA 2NTSA 2B63H 1R4QB 4PZ7A 2B2YC 1PZKD 2O5JC 4LF4Q 5LL6S 5C4ZA 1E7ZA 1SAPA 2VQFQ 4A3DH 4L6TB 4PZ6A 2Z1CA 5TSSA 3S1MH 3D6WA 1KTKA 1VQCA 2XVSA 2Z8LA 1G51A 1SLJA 4J1MA 1SYGA 4CHTB 5I9OA 1JT8A 4M1UB 1XWEA 4JI3L 1TWFB 2OCEA 5FLXc 1I6HB 1KABA 1LACA 1S5FD 4QUFA 3NEMA 1O80A 1JR0D 1H9SB 5DM73 2F0NA 5K5PA 3DWQA 5EBDA 2PNHA 1J5EQ 4FO2A 2OTJA 1I4RA 2SNSA 1A6XA 1BR9A 1FYCA 5C5MA 3GTQH 3DLLA 4FYDA 1TWGH 2F0OA 3W2DA 1VQEA 1EY0A 2JA8H 1U4PA 2HDMA 2QGQA 4OX9L 4P74A 4K5WA 1SFOB 2K04A 4A3GB 5JEAH 3QR8A 5EGTA 3RUZA 2EY1A 1XX8A 5IOCA 1FJGL 1RD9D 4KN4C 1JORA 3VA7A 1D5MC 2B8GA 2F0IA 5JVG3 4A3JG 3BJUA 4YCWA 5M3MH 3S9WA 2VUMH 3OWEB 2R93G 1GKHA 3GTPH 1N32Q 3P7JA 1K28A 3HZXA 2QF7A 2QEJC 4JI6Q 4LF5L 3ND8A 4A3JB 3F2DA 4IFDI 3CP0A 1VQ4A 1LTID 4A3IH 1LT4D 4K5XA 1S5ED 2K33A 4CJ0B 4QGUA 3RLNA 1C48A 2JXMB 2F0HA 4ZRZA 1DCZA 3D4RA 3M4YA 2DJFC 1XNRQ 1CM9A 2Y0SG 1K8GA 1PRTC 3LWEA 4FF4A 4GKJL 4A75A 4XYQA 2JA5H 5FOBB 2NN6H 3I4NG 4JI2L 4DR6Q 5C0XH 2RCNA 1II3A 4JI7Q 1RJTA 3P20A 1XJVA 3X3MA 2D5DA 3NXWA 1XYIA 1IBLQ 4PMCA 4JI1Q 2ZT9C 1VCIA 3VYTA 4DFAA 1HH2P 4C2MH 1PFBA 3KYHC 1F9RA 2OXPA 4LF7L 4YY3L 3B6YA 2VQEL 5BN3A 5ELEA 3I55A 1FGUA 3OTOQ 4CJ1B 1SSOA 3G6EA 3JC66 1ZXTA 3SE0A 3CCMA 2KUMA 4K8JA 3C3LA 1A15A 4DNRB 4X3KA 3HOVB 2D0OA 1C9OA 2CW0C 5IYBH 1KIXA 1S3OA 4QY7A 4DR1L 1V9PA 2K4KA 1SMXA 1VQPA 4PV1C 1WVLA 4BWGB 1PZJD 3ERQA 5IT9E 1KQSA 2E5LQ 2FXQA 3PMFA 3IKJA 1WCMH 4DAYB 3D3RA 3CXCA 2NVTH 2G5DA 3U4ZA 2XNAC 2WKCA 2O2LD 1B4OA 1EYAA 3TP7A 1HRJA 3OWFA 3KF6B 4IFDH 1SE8A 4MN3A 1XNQL 1X55A 4ZUIA 4R8IA 4U68A 1PV4A 4DV5L 3AU7A 1HR0W 1X3QA 2PYKA 4QIWB 3TDQA 3NTIA 1WTOA 5E4XA 3DM1A 1ENAA 1H9RA 2EYLA 4K2LA 3LNNA 1P16A 1VQ8A 2A69D 1SNOA 4A3GH 1CZGA 3CRLC 1YI2A 4XTCS 2F0LA 1GUGA 1UE7A 2Q2TA 3S15B 2ZJRA 1QUQA 4JI5Q 1H9JA 1PTOC 1KL9A 1DM0B 1T5EA 2J7ZA 2F0UA 3MXPA 3CCQA 4IPGA 4DR5Q 5C4JB 3JAME 1PZID 2Q8RE 3J80i 1LO5D 2IX3A 2B2TA 4HTHA 4R4TA 2K01A 3S2DH 5KIXA 3GTGB 2H5XA 3L9AX 2EPBA 1YHBA 3QWNA 3PUWA 4DR4L 4IQZA 4LF9Q 4X3UA 5C4XG 4G7OC 2F3WA 3GTJH 3BZKA 3T4AC 2B2WC 2L1BA 5FLXE 2PW7A 4JBWA 1TS2A 4CKCA 4RMFA 5M5XB 3TP6A 4LJZC 4LW1A 1EQRA 4HCSA 1GM5A 2AQ3B 2UUAL 1I50H 3BVZA 1BUVT 3HOWH 1HA5A 3HRZC 1KC8C 3SR1A 1PH7A 2XWJB 2L5TA 1QJOA 1R9TB 2EXDA 3ER0A 1XTCD 1Y1WG 3S1NB 4UAIA 1EY5A 4JOIC 4DK1A 1F2ZA 2VB2X 4X64Q 1SRUA 3HOVH 2CHBD 1JOOA 1Q8IA 3T13A 2DY8A 3U50C 4BBRG 3G71A 2X6LA 2PCFB 2HQEA 3K80C 1QOHA 4N9PA 1IL2A 1HTLD 3HOYB 1HQMC 2R7DA 1AW7A 1EU4A 2EIFA 2BDOA 1LT6D 1HNZQ 2PI2E 1L1OB 1UEAB 5C3EB 4BBRB 1A8VA 1LTTD 5EAYA 4DV4Q 2RSOA 4EQNA 1DZ1A 2PO4A 3K8AA 1SNMA 4BY1G 4BY7G 1YNND 4C3IH 1BCPC 5CR3A 2RF4A 1PA6A 1WTHA 4X66L 1STEA 1PFSA 1J9OA 4DNIA 1CHPD 1B3AA 2E8GA 4HJ5A 4S3SA 1F2YA 3M3YB 3J81j 1VQ6A 4UY8C 1VQ7A 4NXML 1O7YA 2K28A 3ND9A 2B2UC 1UE1A 4DV3L 1K3BC 4C3JG 1LT5D 3MC0B 3EROA 3UDXA 1X6OA 3A8IE 4UP9A 3H3VI 4QIWE 1KNEA 1PYWD 3CPFA 4IUNA 4C56C 1O7ZA 4DN4M 3NK9A 5IGBA 4L5QA 4IJLA 2EJFC 2I46A 1TS3A 4NDXA 4MZ9A 3DEOA 1JE5A 1K3RA 4DV1Q 4IUUA 1FR3A 4V190 1DJRD 3NPPA 5CV5A 1PTOH 3C46A 1X56A 2HDLA 5C4JH 4YHHL 2JQOA 1CI3M 4DV7Q 3PGZA 3PIPA 3A54A 4BXXG 2MGSA 5C44G 4GN3B 5FLMG 4KHZA 3F8TA 4LF4L 3RMHA 4A3CG 1B9MA 4DPGA 5KNCA 3D4WA 3DUZA 2VQFL 2PW5A 1I4XA 5IY0A 4GZYC 4Y7NB 1C8CA 2WACA 3PIOA 4DAYA 1PH9A 3CCSA 2AHOB 1XPOA 4LNQA 3GTMB 4JYAQ 1KRTA 5DEHA 4I65A 3GTKH 3CKIB 1D1KA 2AMCB 1I4HA 1FL0A 2WFWA 3H09A 3KF6A 5CORA 2NB0A 3RZOB 1G6PA 2SDFA 3CQZH 4P75A 1QNUA 2HD3A 3PUZA 2VXWA 4RCOA 1J5EL 2Q2UA 2JA6G 3BZDB 3MWYW 3S1NH 2XSCA 4IOAA 5IYDG 5IIFA 3X3NA 2OQKA 5M9OA 1ASYA 3UI2A 3A0JA 3W3AA 5C3WA 1XPUA 3PO3B 4J8QA 4LWCA 5GROA 2R7ZH 2EYFA 3KJOA 3DEPA 2F0DA 1NMGA 4NPSA 3SEBA 3NBHA 2JA6B 5J1ZA 2ZM6L 3TZDA 1NAPA 3KBXA 5BR8Q 3CCVA 2CFMA 1O7LA 3A7LA 4JC0A 1LUZA 4H02A 4X6AH 3TN2A 1DGSA 1CK1A 1L0WA 1N32L 3AMUA 2NUCA 2EYJA 4O0AA 4JI4Q 4OIKA 3TS0A 4JI6L 2WAQG 4A3DG 4OO1G 4F7XA 4IUTA 1TY2A 1JB7A 3U9OA 2K03A 5A35A 2I5MX 2B63B 2YV5A 4IPCA 4UP8A 3KLWA 5IWAQ 3I2ZA 2WAQB 4A3DB 3M3YH 1B9NA 3OMGA 1C0AA 3S1MB 3OPOA 1HNXL 5CBEE 1IW7C 4DA2A 1GUOA 4DR6L 2EY2A 4JI7L 3BVGA 3PUYA 4AIMA 3CU7A 3NE5B 3TP5A 1LYLA 1IBLL 3GO5A 4N8X1 4JI1L 5LL6X 1N33L 5BN5A 3BYYB 1SYEA 2BH2A 5CGKA 4IOCA 3FVQA 5JOBA 2JA8G 2B2VA 2B2WA 3I4MG 3NENA 2RA4A 2DJGC 3PUXA 1TKWB 3F2UA 2OT2A 1JICA 5JEAG 1ZKOA 4ODGA 1E24A 3GTQB 3OTOL 2F0SA 1TWGB 3EVQA 5M3MG 3BDOA 3SHLA 3QOLA 1I6VC 3HGBA 2NZOA 3J81L 1JWMD 2VUMG 2JA8B 2HHHL 2KCMA 4DUYQ 1IZ6A 1N36Q 1E1TA 1RL2A 3K58A 4JOIA 3K6OA 2BA0A 4QUCA 4FF2A 1RTNA 1ZYRC 4LFBQ 3J80E 5M3MB 4A3IG 2VUMB 2QKIC 3GTPB 4G4KA 3HKSA 2XTIA 4ZKBB 5IT9c 4LUOA 2Z4IA 2NWGA 3M4OH 1VQLA 5LMUL 1RIPA 2KHSA 1E22A 1UWVA 1K9MC 2JA5G 2NN6G 4A3IB 2HQLA 2IJ0A 1PH3A 3DM3A 4O42A 4A3EH 2RQXA 1DYQA 4LK1C 3EJIA 1X3EA 4IO9A 2JA7H 2H4OA 1NSNS 3E6ZX 3C2PA 4RFBA 4ZUJA 1SYFA 3GTMH 5ISRA 3H94A 1YHQA 1VQFA 4KD4A 2DN8A 2F52A 2IHEA 2A68C 3I73A 2OF1A 3BYTB 3RZOH 3J7AF 2Z6KC 3W1GA 1PHJA 1Y1VH 4A3BG 3S2HH 2HIXA 4KK7A 3DWAA 4A3FG 1C4QA 4JI0L 5IGEA 1M4VA 3H0GG 1VQAA 4C2MB 3CMAA 1DD2A 4XT3B 1SNPA 5M5YH 3I90A 4UDUC 1VQ9A 1RCVD 2DNCA 3CCUA 3DXJC 4ABNA 2EYPA 3U9SA 1F9QA 5LMNQ 2UXBQ 2YTYA 5IYBG 2V1CC 5A2QE 3I7FA 1VQGA 3I4LA 5C3XA 2GA4B 1OXXK 1TY0A 4B3MQ 3KDFB 4TRDA 4R4CA 2PZTA 4R8NA 1XMOQ 4JI5L 1YNXA 3I72A 3S1RH 1XMQQ 4DR7Q 2DY7A 2NN6I 1Z9FA 5C0XI 4MTNA 4A76A 1HUNA 1STGA 2IX0A 2ZTCA 2E2JH 4DR5L 1EUJA 2E76C 3SGIA 1ICWA 4L5RC 4XQQA 1MIUA 4IUPA 3T56B 4OEMB 1OTCA 2UU9L 2K50A 5AFWA 2QILA 5AJ3Q 1WCMB 4A93H 1FD7D 4POFA 4YCVA 4IFDG 2L0CA 2BE5C 2WAQE 4LF9L 2NVTB 1K0RA 1U9RA 4JI8Q 4FP5D 1L0YB 1AP0A 3EQLC 1L2FA 2RHSB 3URYA 5DAUA 2KQ3A 3VR5A 1LM0A 4YCUA 1BDOA 4ILWA 3FHWA 3L7ZC 5JEAJ 5M3FH 4A3GG 4PMWA 2CQAA 4LFCQ 1EYGA 4K6DA 1QVGA 1RDPD 2NVYH 4OWXB 2PNRC 1M1KC 1CSPA 2EE1A 4N8FA 4X64L 4DV2Q 3SDZA 1EOTA 1PRTD 3A5UA 5CV9A 3U58A 3HOXH 4CKEA 1PRTF 2CCZA 4LF6Q 3ULPA 5CYUA 3RD4A 5E1FA 1IBKQ 4RGMA 2AQ2B 4DV4L 2O4XA 3SVMA 5KEEA 5IGDA 1Q1BA 2HT1A 2K7VA 1Q7YC 3T1YQ 1P8LA 1CHQD 1AE3A 1G91A 3S2DB 2A6HC 3P75A 4EGVA 1LTSD 1V1PA 4JK1C 5IGCA 3QOJA 4LAAA 2BA1A 1KD1C 1PRTB 3KFUA 5J39A 2ZJPA 2F1MA 1AFPA 3CD6A 4RA8A 3E9HA 3V05A 3OMCA 3GTJB 4ID6A 4X62L 1RODA 5FO7B 1Q8KA 1CA6A 4RKLA 2CW0D 4DUZQ 3FPUB 1KLUD 3MAQA 3HOZH 3UDGA 2TSSA 1I50B 3RNUA 3HOWB 3WDNA 3PSIA 3HOVG 1SE2A 2CWPA 3QO2A 1QZGA 4BBSH 3Q6SA 1SYDA 2WKDA 2K5QA 2KVMA 4N9TA 1BXTA 1KXLA 4EQPA
chains in the Genus database with same CATH topology
4JOIC 3CPWA 3ERSX 2OTLA 4HJ9A 1YJNA 1VS0A 2A19A 2YTXA 4X64Q 1SRUA 3HOVH 4KHPQ 5HGQA 3U50C 4BBRG 3G71A 2NVXH 3K7UC 4DV1L 1D8LA 1Y14B 2LSSA 3K80C 5GAEC 1IL2A 1WCMG 2JK8A 4GKKQ 2MO0A 4A3KH 5M5WH 1I5FA 3G48A 2R7DA 3HOYH 3K0XA 2EIFA 3GTLH 5IYDH 2GVAA 1HNZQ 4O2DA 1EIFA 2PI2E 1L1OB 2D0PA 4DV7L 1PH5A 1A8VA 5C3EH 5EAYA 1OXVA 5HY6A 4BBRH 4DV4Q 4AQYL 2UUBL 3H3VH 1HNWQ 4DKAC 4GOPC 2K5HA 3K8AA 3PV0A 4YHHQ 4BY1G 1S40A 1K73C 1YHAA 1V43A 4C3IH 4DV0L 4BY7G 4IJHA 2OWOA 5JJLA 2JA9A 1PA6A 2RF4A 1GO3E 2LXKA 4X66L 5IP9G 3H15A 4GNXC 1PFSA 1JMCA 3CC2A 3J81c 4DNIA 2R92H 2ZTEA 5M3FG 5E7NA 1NBWA 2E8GA 1TWCH 2N8NA 4HJ5A 1CKOA 1U5KA 3CCRA 1PVOA 1JJ2A 4JYAL 1IXRA 2ZTDA 3J81j 1VQIA 1W2BA 1N34L 1HZBA 4B3SL 1VQ6A 3OW2A 4UY8C 4OONA 4A3LH 4ME3A 3CCEA 5IP9H 3F2BA 2MQHA 1VQ7A 4NXML 1VQ5A 4KI0A 3CAMA 4LF8Q 1BBUA 1UE1A 4DV3L 4DK3C 1XPRA 2YU9H 4QL5A 4K0KQ 2QA4A 1EFWA 4B3TL 4JV5Q 3TEHB 3UDXA 1PH8A 1X6OA 1MJEA 2VL6A 2CQOA 2Z6KA 4BA2I 4UP9A 1YIJA 3NBHB 3H3VI 4QIWE 1X65A 1VQNA 3J7A5 3F2CA 4KHPL 1JJGA 1PH4A 3CPFA 3I56A 4ALPA 4NB3A 2KBNA 4LFAQ 4HJ8A 3L0OA 2MO1A 1IYJB 5BR8L 3K7AH 5GADC 1N9WA 2ID0A 1QZHA 4L5QA 4IJLA 4UP7A 3CF5A 1HNZL 4JBMA 1YEZA 4MZ9A 3KDFA 3AFPA 1EIYB 1OXTA 1JE5A 4NXNL 3I4MH 1K3RA 4DV1Q 4HIMA 3HFZB 1HNWL 1YZ6A 4OO1I 4JI4L 5C0XJ 5GQOA 1T9HA 1B8AA 2B29A 2ZM6Q 4HIOA 1X56A 4YHHL 5C4JH 1HZCA 2JQOA 2A8VA 4GLVB 3RZDH 3STBC 4DV7Q 1G291 3PGZA 5IE8A 3PIPA 2ES2A 4BXXG 4C3HH 1YITA 2I5HA 4AQYQ 3F1ZA 5C44G 2UUBQ 4GN3B 4IPHA 5FLMG 1KXLA 4KHZA 1L1OA 3F8TA 1VQKA 3HOZG 4LF4L 4A3CG 4DPGA 4DV0Q 1KHIA 3I4OA 2VQFL 2B63H 5IY0A 1PH2A 2F4VL 4X66Q 4YWKA 3HOWG 3PIOA 3JAMi 4Y7NH 1PH9A 3CCSA 1A63A 4POGA 2AHOB 2YYZA 3S24A 4DV6L 1XPOA 2R93H 1PYSB 2K5VA 4LNQA 3S17H 3UDIA 4JYAQ 2AWOA 1KRTA 2IX1A 2E2HH 4K0KL 4A3CH 4JV5L 1VQJA 1N34Q 3EN2A 2KHIA 2MNAA 4B3SQ 3GTKH 1HR0L 2AMCB 1Q81C 1HNXQ 3MEFA 4NXMQ 4A4IA 2AKWB 3HKZG 1CKNB 1FL0A 5FJ8H 2WFWA 3KF6A 4DV3Q 1G6PA 1BVSA 4JCVE 2K5NA 1TWAH 3CQZH 4P75A 4LUVA 4B3TQ 1VQDA 2C35B 3RLOA 2PQAB 3PUZA 1J5EL 2Q2UA 3HOYG 3A74A 2JA6G 1N33Q 3S1NH 2Q2HA 4IOAA 4DR2Q 5IYDG 2OQKA 1ASYA 4DR3L 2PMZE 3A0JA 1XPUA 3ULJA 3PO3H 3UE1A 5LMNW 1NJIC 4LWCA 2I5LX 2NVQH 3CCLA 5GROA 5C3EG 1QVFA 2R7ZH 1Q86C 3KJOA 4AYBG 1YVCA 3PUVA 4DK6C 1NMGA 2VS1A 4MNOA 4NPSA 5ELNA 1E3PA 2N3SA 4A3BH 4IFDJ 1AH9A 2ZM6L 4B3RL 3CCVA 2JA6H 5BR8Q 3CCJA 3UE0A 4A3FH 1Z47A 1SROA 2CFMA 4TVAB 3J80c 1QUQB 3H0GH 4JC0A 4P71A 1LUZA 1PYBA 4H02A 1CSQA 1I3QH 3RR5A 3HOUG 3ICEA 3M7NA 2R92G 3Q8DA 4X6AH 1DGSA 2HHHQ 4DAMA 4NXNQ 1L0WA 1N32L 1UEBA 1CKMA 4X65L 2ASBA 2UXCL 1BKBA 4O0AA 4JI4Q 4OX9Q 4HJ7A 2DGYA 3AFQA 2B3GA 1Q46A 2WAQG 1O7IA 3TS0A 1I94L 4L5TA 4JI6L 4A3DG 4OO1G 5IP7G 1MJCA 4A3LG 3T1HL 4HIDA 2R6GA 4GOPB 1JB7A 5DLQE 3JAMc 4AYBE 3HOUH 1HZ9A 2I5MX 1M90C 1ASZA 3AEVA 1Q1EA 2YV5A 4IPDA 4PZ7A 4GNXB 4IPCA 1NTGA 3KLWA 4UP8A 5IWAQ 3I2ZA 4LF4Q 5LMUQ 3M3YH 4R1JA 1C0AA 1E7ZA 2VQFQ 4A3DH 1KRSA 4PZ6A 5IP7H 4J15A 2UUCL 2F4VQ 3S1MH 1VQCA 1HNXL 1G51A 1SLJA 4JI7L 4DR6L 4DV6Q 1HZAA 1X3FA 1X54A 3PUYA 1JT8A 4R4OA 4AIMA 1VQHA 2MFIA 4JI3L 1LYLA 1IBLL 3GO5A 4JI1L 1D7QA 5ELOA 1HR0Q 1N33L 1TWFH 2K52A 2E2IH 1VQMA 4DR2L 2OCEA 3EIVA 5FLXc 2BH2A 1KAWA 3CC4A 4Y52H 4IOCA 4JI2Q 1I6HH 1NMFA 1OXUA 3NEMA 4OWWB 2Q2IA 2JA8G 1YBYA 3STBD 3NENA 3I4MG 3PUXA 1J5EQ 2UXBL 2PNHA 3PF4A 5JEAG 4R4QA 2JEBI 2OTJA 2JE6I 4JI0Q 1E24A 4DR3Q 3OTOL 3GTQH 3U4VA 3DLLA 2CKZB 2PQAA 5M3MG 1TWGH 2VUMG 4YWLA 2NZOA 1VQEA 1B70B 2HHHL 2JA8H 2KCMA 2F3IA 4JG2A 4DUYQ 1IZ6A 2QGQA 1E1TA 1N36Q 1XMOL 4GS3A 3M4QA 1VQBA 4P74A 4YY3Q 1RL2A 4LF7Q 2IT1A 4KLKA 2VQEQ 4JOIA 1SFOH 4B3RQ 3OYYA 1FJGL 2BA0A 2IHFA 5K36G 1IBML 5GAHC 3AQQA 4A3JG 4LFBQ 3BJUA 3KJPA 4YCWA 4A3IG 5M3MH 3TRZA 1AE2A 3G4SA 1EWIA 4A3EG 2VUMH 2R93G 1GKHA 3GTPH 3PO2G 4X65Q 1N32Q 3A5ZB 3HKSA 2UXCQ 2XTIA 5IT9c 4LUZA 4LUOA 5IWAL 3M4OH 1I94Q 4JI6Q 1VQLA 5LMUL 2WB1G 1RIPA 4LF5L 1HJPA 2HIVA 2QEXA 3M85A 1E22A 3T1HQ 1UWVA 1K83H 1K9MC 3F2DA 2JA5G 4A3JH 4IFDI 2NN6G 3CP0A 2HQLA 1VQ4A 5FJ8G 1WOCA 4A3IH 1B7YB 1PH3A 4QGUA 3DM3A 1A62A 4A3EH 3RLNA 4YWMA 3PO2H 3S1QH 1X3EA 2R7FA 4IO9A 4GOPA 3FKIG 4GLXA 1XNRQ 2JA7H 2Y0SG 2UU9Q 1K8GA 3GTMH 1W3SA 1TXYA 1J6QA 4GKJL 3M4PA 4A75A 1YHQA 2KHJA 2UUCQ 1VQFA 3BZCA 2JA5H 3PO3G 2F52A 2IHEA 3I4NG 4JI2L 4DR6Q 4JI7Q 2RCNA 3TQYA 4UPAA 2UXDL 1XJVA 2R7ZG 3RZOH 2WB1E 2Z6KC 3W1GA 3FKIH 4JI3Q 3J81i 1PHJA 1IBLQ 4OXPA 1Y1VH 4JI1Q 4A3BG 4QQBX 1VCIA 3S2HH 2HIXA 4A3FG 4JI0L 1HH2P 1NE3A 3H0GG 3PF5A 3W1BA 1VQAA 3CMAA 1MKHA 4C2MH 3PCOB 4PG3A 4R4IA 3I4NH 2EQSA 5M5YH 2Y0SE 1VQ9A 3KYHC 3CCUA 3WWVA 1PH6A 5C4XH 3L2PA 4DUYL 5LMNQ 1N36L 2UXBQ 4LF7L 4YY3L 2YTYA 5IYBG 2V1CC 3B6YA 2N49A 2VQEL 3BU2A 4DV2L 3I7FA 1QVCA 1VQGA 3HKZE 5JJKA 3J7ZC 3I55A 1FGUA 3OTOQ 2BH8A 1OXXK 4AH6A 4B3MQ 2DUDA 4LFBL 3G6EA 2VZAA 3JC66 3KDFB 3CC7A 3CCMA 4OX9L 4R4CA 3W5OA 2L15A 2YTVA 2B63G 4EX5A 4A3MG 1GD7A 2VNUD 1XMOQ 4JI5L 2D0OA 1C9OA 1YNXA 3CMEA 4LF6L 5IYBH 3S1RH 1EOVA 1KIXA 1FJGQ 1XMQQ 1S3OA 1X3GA 1WFQA 2NN6I 4BA1I 1IBMQ 1IBKL 4DR7Q 1Z9FA 5C0XI 4MTNA 5J3BA 4A76A 3S14H 4QY7A 1Y1WH 4DR1L 1L1OC 2IX0A 2ZTCA 4EQ5A 4DR5L 3D31A 1V9PA 2E2JH 1EUJA 3SGIA 3E0EA 2K4KA 4L5RC 1SMXA 4OWTB 1VQPA 3ULLA 3T1YL 1MIUA 4A3MH 1XNRL 1OTCA 2KCTA 2UU9L 5H1SE 4LF5Q 2D62A 2K50A 1KQSA 4JBJA 2GVBA 2E5LQ 2WP8J 2FXQA 5AJ3Q 4A93H 1WCMH 4DAYB 4POFA 3NELA 4YCVA 1X9NA 3RLFA 3GD7A 4IFDG 4XIGS 3RN2A 3LGJA 2WAQE 1EQQA 4QJFA 3CXCA 4LF9L 3VDYA 1Q82C 2NVTH 1K0RA 4JI8Q 3U4ZA 4GKJQ 3IRBA 2RHQB 1L2FA 4P73A 4DUZL 2ZJQA 1WI5A 2RHSB 2JEAI 3KF6B 1TWHH 2UXDQ 1SE8A 4BY1H 1XNQL 4BY7H 4DR4Q 1X55A 4LFAL 1NY4A 2N78A 3M9BA 1LM0A 5JJIA 4YCUA 4X62Q 5LMNL 1CKNA 5JEAJ 1PV4A 1BBWA 3FHWA 3L7ZC 5M3FH 4DV5L 1HR0W 4A3GG 4PMWA 4WJ4A 1S72A 4LFCQ 3EBEA 2K14A 3TREA 2K75A 1EYGA 4B3ML 1QVGA 1E1OA 1FVIA 3HOXG 3D0FA 2NVYH 2UUAQ 4OWXB 5GAGC 1P16A 1SN8A 1M1KC 3E9IA 1CSPA 1VQ8A 4X64L 4DV2Q 1PH1A 4A3GH 3GTOH 1XMQL 4DR7L 5IYCG 4C3JH 3A5UA 1YI2A 4P72A 4GKKL 4XTCS 1Q12A 3U58A 4GN5A 1UE7A 2VY3A 3KF8B 3HOXH 2Q2TA 2ALYB 1XTDA 1N8RC 4L5SA 2ZJRA 4GN4B 2JA7G 3S15H 1QUQA 4JI5Q 2CCZA 4LF6Q 2AWNA 2Z0SA 1CUKA 2OQ0A 3ULPA 1KL9A 3MXNB 4APVA 4HJAA 1IBKQ 2KENA 5IYCH 2E5LL 3GDEA 4DV4L 3CCQA 1C7YA 1VQOA 5AJ3L 4IPGA 2XGTA 4DR1Q 5C0XG 1Q1BA 1YJWA 1JJCB 4DR5Q 3UDFA 2HT1A 2PI2A 3KOJA 3K81C 1WJJA 4TQUS 1Q7YC 3T1YQ 3J80i 1P8LA 2ATWA 1AE3A 1K8AC 3S16H 4R4TA 4JI8L 1Y1VG 3S2DH 1WYDA 3GTGH 1U0LA 2H5XA 1YJ9A 2BA1A 4GNXA 1KD1C 1A0IA 3KFUA 1YHBA 2GN5A 1LTLA 2ZJPA 3TS2A 3PUWA 1UE5A 4HIKA 4LF9Q 2NZHA 2I0QA 4DR4L 4A93G 3CD6A 5C4XG 3E9HA 2LXJA 2JJQA 4X62L 3GTJH 3BZKA 1Q8KA 4GLAC 4BXXH 4BBSG 4LF8L 4DUZQ 5C44H 4LFCL 4JBWA 5FLMH 2CWAA 3AYHB 4RMFA 3HOZH 3UDGA 1SR3A 3ZJYC 5M5XH 4LW1A 1EQRA 1XNQQ 1GM5A 1GVPA 1OXSC 3RNUA 3RN5A 2UUAL 1I50H 4JBKA 2VW9A 2A1AA 3HOWH 4RG1A 1KC8C 3PSIA 4FDBA 3HOVG 4DV5Q 3CW2C 2CWPA 1PH7A 4BBSH 1UE6A 1QZGA 1V1QA 2IY5B 4PZ8A 2EXDA 3ER0A 4A3KG 1Y1WG 1R9TH 3FP9A 4WJ3M 1H95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JOI C;  3CPW A;  3ERS X;  2OTL A;  4HJ9 A;  1YJN A;  1VS0 A;  2A19 A;  2YTX A;  4X64 Q;  1SRU A;  3HOV H;  4KHP Q;  5HGQ A;  3U50 C;  4BBR G;  3G71 A;  2NVX H;  3K7U C;  4DV1 L;  1D8L A;  1Y14 B;  2LSS A;  3K80 C;  5GAE C;  1IL2 A;  1WCM G;  2JK8 A;  4GKK Q;  2MO0 A;  4A3K H;  5M5W H;  1I5F A;  3G48 A;  2R7D A;  3HOY H;  3K0X A;  2EIF A;  3GTL H;  5IYD H;  2GVA A;  1HNZ Q;  4O2D A;  1EIF A;  2PI2 E;  1L1O B;  2D0P A;  4DV7 L;  1PH5 A;  1A8V A;  5C3E H;  5EAY A;  1OXV A;  5HY6 A;  4BBR H;  4DV4 Q;  4AQY L;  2UUB L;  3H3V H;  1HNW Q;  4DKA C;  4GOP C;  2K5H A;  3K8A A;  3PV0 A;  4YHH Q;  4BY1 G;  1S40 A;  1K73 C;  1YHA A;  1V43 A;  4C3I H;  4DV0 L;  4BY7 G;  4IJH A;  2OWO A;  5JJL A;  2JA9 A;  1PA6 A;  2RF4 A;  1GO3 E;  2LXK A;  4X66 L;  5IP9 G;  3H15 A;  4GNX C;  1PFS A;  1JMC A;  3CC2 A;  3J81 c;  4DNI A;  2R92 H;  2ZTE A;  5M3F G;  5E7N A;  1NBW A;  2E8G A;  1TWC H;  2N8N A;  4HJ5 A;  1CKO A;  1U5K A;  3CCR A;  1PVO A;  1JJ2 A;  4JYA L;  1IXR A;  2ZTD A;  3J81 j;  1VQI A;  1W2B A;  1N34 L;  1HZB A;  4B3S L;  1VQ6 A;  3OW2 A;  4UY8 C;  4OON A;  4A3L H;  4ME3 A;  3CCE A;  5IP9 H;  3F2B A;  2MQH A;  1VQ7 A;  4NXM L;  1VQ5 A;  4KI0 A;  3CAM A;  4LF8 Q;  1BBU A;  1UE1 A;  4DV3 L;  4DK3 C;  1XPR A;  2YU9 H;  4QL5 A;  4K0K Q;  2QA4 A;  1EFW A;  4B3T L;  4JV5 Q;  3TEH B;  3UDX A;  1PH8 A;  1X6O A;  1MJE A;  2VL6 A;  2CQO A;  2Z6K A;  4BA2 I;  4UP9 A;  1YIJ A;  3NBH B;  3H3V I;  4QIW E;  1X65 A;  1VQN A;  3J7A 5;  3F2C A;  4KHP L;  1JJG A;  1PH4 A;  3CPF A;  3I56 A;  4ALP A;  4NB3 A;  2KBN A;  4LFA Q;  4HJ8 A;  3L0O A;  2MO1 A;  1IYJ B;  5BR8 L;  3K7A H;  5GAD C;  1N9W A;  2ID0 A;  1QZH A;  4L5Q A;  4IJL A;  4UP7 A;  3CF5 A;  1HNZ L;  4JBM A;  1YEZ A;  4MZ9 A;  3KDF A;  3AFP A;  1EIY B;  1OXT A;  1JE5 A;  4NXN L;  3I4M H;  1K3R A;  4DV1 Q;  4HIM A;  3HFZ B;  1HNW L;  1YZ6 A;  4OO1 I;  4JI4 L;  5C0X J;  5GQO A;  1T9H A;  1B8A A;  2B29 A;  2ZM6 Q;  4HIO A;  1X56 A;  4YHH L;  5C4J H;  1HZC A;  2JQO A;  2A8V A;  4GLV B;  3RZD H;  3STB C;  4DV7 Q;  1G29 1;  3PGZ A;  5IE8 A;  3PIP A;  2ES2 A;  4BXX G;  4C3H H;  1YIT A;  2I5H A;  4AQY Q;  3F1Z A;  5C44 G;  2UUB Q;  4GN3 B;  4IPH A;  5FLM G;  1KXL A;  4KHZ A;  1L1O A;  3F8T A;  1VQK A;  3HOZ G;  4LF4 L;  4A3C G;  4DPG A;  4DV0 Q;  1KHI A;  3I4O A;  2VQF L;  2B63 H;  5IY0 A;  1PH2 A;  2F4V L;  4X66 Q;  4YWK A;  3HOW G;  3PIO A;  3JAM i;  4Y7N H;  1PH9 A;  3CCS A;  1A63 A;  4POG A;  2AHO B;  2YYZ A;  3S24 A;  4DV6 L;  1XPO A;  2R93 H;  1PYS B;  2K5V A;  4LNQ A;  3S17 H;  3UDI A;  4JYA Q;  2AWO A;  1KRT A;  2IX1 A;  2E2H H;  4K0K L;  4A3C H;  4JV5 L;  1VQJ A;  1N34 Q;  3EN2 A;  2KHI A;  2MNA A;  4B3S Q;  3GTK H;  1HR0 L;  2AMC B;  1Q81 C;  1HNX Q;  3MEF A;  4NXM Q;  4A4I A;  2AKW B;  3HKZ G;  1CKN B;  1FL0 A;  5FJ8 H;  2WFW A;  3KF6 A;  4DV3 Q;  1G6P A;  1BVS A;  4JCV E;  2K5N A;  1TWA H;  3CQZ H;  4P75 A;  4LUV A;  4B3T Q;  1VQD A;  2C35 B;  3RLO A;  2PQA B;  3PUZ A;  1J5E L;  2Q2U A;  3HOY G;  3A74 A;  2JA6 G;  1N33 Q;  3S1N H;  2Q2H A;  4IOA A;  4DR2 Q;  5IYD G;  2OQK A;  1ASY A;  4DR3 L;  2PMZ E;  3A0J A;  1XPU A;  3ULJ A;  3PO3 H;  3UE1 A;  5LMN W;  1NJI C;  4LWC A;  2I5L X;  2NVQ H;  3CCL A;  5GRO A;  5C3E G;  1QVF A;  2R7Z H;  1Q86 C;  3KJO A;  4AYB G;  1YVC A;  3PUV A;  4DK6 C;  1NMG A;  2VS1 A;  4MNO A;  4NPS A;  5ELN A;  1E3P A;  2N3S A;  4A3B H;  4IFD J;  1AH9 A;  2ZM6 L;  4B3R L;  3CCV A;  2JA6 H;  5BR8 Q;  3CCJ A;  3UE0 A;  4A3F H;  1Z47 A;  1SRO A;  2CFM A;  4TVA B;  3J80 c;  1QUQ B;  3H0G H;  4JC0 A;  4P71 A;  1LUZ A;  1PYB A;  4H02 A;  1CSQ A;  1I3Q H;  3RR5 A;  3HOU G;  3ICE A;  3M7N A;  2R92 G;  3Q8D A;  4X6A H;  1DGS A;  2HHH Q;  4DAM A;  4NXN Q;  1L0W A;  1N32 L;  1UEB A;  1CKM A;  4X65 L;  2ASB A;  2UXC L;  1BKB A;  4O0A A;  4JI4 Q;  4OX9 Q;  4HJ7 A;  2DGY A;  3AFQ A;  2B3G A;  1Q46 A;  2WAQ G;  1O7I A;  3TS0 A;  1I94 L;  4L5T A;  4JI6 L;  4A3D G;  4OO1 G;  5IP7 G;  1MJC A;  4A3L G;  3T1H L;  4HID A;  2R6G A;  4GOP B;  1JB7 A;  5DLQ E;  3JAM c;  4AYB E;  3HOU H;  1HZ9 A;  2I5M X;  1M90 C;  1ASZ A;  3AEV A;  1Q1E A;  2YV5 A;  4IPD A;  4PZ7 A;  4GNX B;  4IPC A;  1NTG A;  3KLW A;  4UP8 A;  5IWA Q;  3I2Z A;  4LF4 Q;  5LMU Q;  3M3Y H;  4R1J A;  1C0A A;  1E7Z A;  2VQF Q;  4A3D H;  1KRS A;  4PZ6 A;  5IP7 H;  4J15 A;  2UUC L;  2F4V Q;  3S1M H;  1VQC A;  1HNX L;  1G51 A;  1SLJ A;  4JI7 L;  4DR6 L;  4DV6 Q;  1HZA A;  1X3F A;  1X54 A;  3PUY A;  1JT8 A;  4R4O A;  4AIM A;  1VQH A;  2MFI A;  4JI3 L;  1LYL A;  1IBL L;  3GO5 A;  4JI1 L;  1D7Q A;  5ELO A;  1HR0 Q;  1N33 L;  1TWF H;  2K52 A;  2E2I H;  1VQM A;  4DR2 L;  2OCE A;  3EIV A;  5FLX c;  2BH2 A;  1KAW A;  3CC4 A;  4Y52 H;  4IOC A;  4JI2 Q;  1I6H H;  1NMF A;  1OXU A;  3NEM A;  4OWW B;  2Q2I A;  2JA8 G;  1YBY A;  3STB D;  3NEN A;  3I4M G;  3PUX A;  1J5E Q;  2UXB L;  2PNH A;  3PF4 A;  5JEA G;  4R4Q A;  2JEB I;  2OTJ A;  2JE6 I;  4JI0 Q;  1E24 A;  4DR3 Q;  3OTO L;  3GTQ H;  3U4V A;  3DLL A;  2CKZ B;  2PQA A;  5M3M G;  1TWG H;  2VUM G;  4YWL A;  2NZO A;  1VQE A;  1B70 B;  2HHH L;  2JA8 H;  2KCM A;  2F3I A;  4JG2 A;  4DUY Q;  1IZ6 A;  2QGQ A;  1E1T A;  1N36 Q;  1XMO L;  4GS3 A;  3M4Q A;  1VQB A;  4P74 A;  4YY3 Q;  1RL2 A;  4LF7 Q;  2IT1 A;  4KLK A;  2VQE Q;  4JOI A;  1SFO H;  4B3R Q;  3OYY A;  1FJG L;  2BA0 A;  2IHF A;  5K36 G;  1IBM L;  5GAH C;  3AQQ A;  4A3J G;  4LFB Q;  3BJU A;  3KJP A;  4YCW A;  4A3I G;  5M3M H;  3TRZ A;  1AE2 A;  3G4S A;  1EWI A;  4A3E G;  2VUM H;  2R93 G;  1GKH A;  3GTP H;  3PO2 G;  4X65 Q;  1N32 Q;  3A5Z B;  3HKS A;  2UXC Q;  2XTI A;  5IT9 c;  4LUZ A;  4LUO A;  5IWA L;  3M4O H;  1I94 Q;  4JI6 Q;  1VQL A;  5LMU L;  2WB1 G;  1RIP A;  4LF5 L;  1HJP A;  2HIV A;  2QEX A;  3M85 A;  1E22 A;  3T1H Q;  1UWV A;  1K83 H;  1K9M C;  3F2D A;  2JA5 G;  4A3J H;  4IFD I;  2NN6 G;  3CP0 A;  2HQL A;  1VQ4 A;  5FJ8 G;  1WOC A;  4A3I H;  1B7Y B;  1PH3 A;  4QGU A;  3DM3 A;  1A62 A;  4A3E H;  3RLN A;  4YWM A;  3PO2 H;  3S1Q H;  1X3E A;  2R7F A;  4IO9 A;  4GOP A;  3FKI G;  4GLX A;  1XNR Q;  2JA7 H;  2Y0S G;  2UU9 Q;  1K8G A;  3GTM H;  1W3S A;  1TXY A;  1J6Q A;  4GKJ L;  3M4P A;  4A75 A;  1YHQ A;  2KHJ A;  2UUC Q;  1VQF A;  3BZC A;  2JA5 H;  3PO3 G;  2F52 A;  2IHE A;  3I4N G;  4JI2 L;  4DR6 Q;  4JI7 Q;  2RCN A;  3TQY A;  4UPA A;  2UXD L;  1XJV A;  2R7Z G;  3RZO H;  2WB1 E;  2Z6K C;  3W1G A;  3FKI H;  4JI3 Q;  3J81 i;  1PHJ A;  1IBL Q;  4OXP A;  1Y1V H;  4JI1 Q;  4A3B G;  4QQB X;  1VCI A;  3S2H H;  2HIX A;  4A3F G;  4JI0 L;  1HH2 P;  1NE3 A;  3H0G G;  3PF5 A;  3W1B A;  1VQA A;  3CMA A;  1MKH A;  4C2M H;  3PCO B;  4PG3 A;  4R4I A;  3I4N H;  2EQS A;  5M5Y H;  2Y0S E;  1VQ9 A;  3KYH C;  3CCU A;  3WWV A;  1PH6 A;  5C4X H;  3L2P A;  4DUY L;  5LMN Q;  1N36 L;  2UXB Q;  4LF7 L;  4YY3 L;  2YTY A;  5IYB G;  2V1C C;  3B6Y A;  2N49 A;  2VQE L;  3BU2 A;  4DV2 L;  3I7F A;  1QVC A;  1VQG A;  3HKZ E;  5JJK A;  3J7Z C;  3I55 A;  1FGU A;  3OTO Q;  2BH8 A;  1OXX K;  4AH6 A;  4B3M Q;  2DUD A;  4LFB L;  3G6E A;  2VZA A;  3JC6 6;  3KDF B;  3CC7 A;  3CCM A;  4OX9 L;  4R4C A;  3W5O A;  2L15 A;  2YTV A;  2B63 G;  4EX5 A;  4A3M G;  1GD7 A;  2VNU D;  1XMO Q;  4JI5 L;  2D0O A;  1C9O A;  1YNX A;  3CME A;  4LF6 L;  5IYB H;  3S1R H;  1EOV A;  1KIX A;  1FJG Q;  1XMQ Q;  1S3O A;  1X3G A;  1WFQ A;  2NN6 I;  4BA1 I;  1IBM Q;  1IBK L;  4DR7 Q;  1Z9F A;  5C0X I;  4MTN A;  5J3B A;  4A76 A;  3S14 H;  4QY7 A;  1Y1W H;  4DR1 L;  1L1O C;  2IX0 A;  2ZTC A;  4EQ5 A;  4DR5 L;  3D31 A;  1V9P A;  2E2J H;  1EUJ A;  3SGI A;  3E0E A;  2K4K A;  4L5R C;  1SMX A;  4OWT B;  1VQP A;  3ULL A;  3T1Y L;  1MIU A;  4A3M H;  1XNR L;  1OTC A;  2KCT A;  2UU9 L;  5H1S E;  4LF5 Q;  2D62 A;  2K50 A;  1KQS A;  4JBJ A;  2GVB A;  2E5L Q;  2WP8 J;  2FXQ A;  5AJ3 Q;  4A93 H;  1WCM H;  4DAY B;  4POF A;  3NEL A;  4YCV A;  1X9N A;  3RLF A;  3GD7 A;  4IFD G;  4XIG S;  3RN2 A;  3LGJ A;  2WAQ E;  1EQQ A;  4QJF A;  3CXC A;  4LF9 L;  3VDY A;  1Q82 C;  2NVT H;  1K0R A;  4JI8 Q;  3U4Z A;  4GKJ Q;  3IRB A;  2RHQ B;  1L2F A;  4P73 A;  4DUZ L;  2ZJQ A;  1WI5 A;  2RHS B;  2JEA I;  3KF6 B;  1TWH H;  2UXD Q;  1SE8 A;  4BY1 H;  1XNQ L;  4BY7 H;  4DR4 Q;  1X55 A;  4LFA L;  1NY4 A;  2N78 A;  3M9B A;  1LM0 A;  5JJI A;  4YCU A;  4X62 Q;  5LMN L;  1CKN A;  5JEA J;  1PV4 A;  1BBW A;  3FHW A;  3L7Z C;  5M3F H;  4DV5 L;  1HR0 W;  4A3G G;  4PMW A;  4WJ4 A;  1S72 A;  4LFC Q;  3EBE A;  2K14 A;  3TRE A;  2K75 A;  1EYG A;  4B3M L;  1QVG A;  1E1O A;  1FVI A;  3HOX G;  3D0F A;  2NVY H;  2UUA Q;  4OWX B;  5GAG C;  1P16 A;  1SN8 A;  1M1K C;  3E9I A;  1CSP A;  1VQ8 A;  4X64 L;  4DV2 Q;  1PH1 A;  4A3G H;  3GTO H;  1XMQ L;  4DR7 L;  5IYC G;  4C3J H;  3A5U A;  1YI2 A;  4P72 A;  4GKK L;  4XTC S;  1Q12 A;  3U58 A;  4GN5 A;  1UE7 A;  2VY3 A;  3KF8 B;  3HOX H;  2Q2T A;  2ALY B;  1XTD A;  1N8R C;  4L5S A;  2ZJR A;  4GN4 B;  2JA7 G;  3S15 H;  1QUQ A;  4JI5 Q;  2CCZ A;  4LF6 Q;  2AWN A;  2Z0S A;  1CUK A;  2OQ0 A;  3ULP A;  1KL9 A;  3MXN B;  4APV A;  4HJA A;  1IBK Q;  2KEN A;  5IYC H;  2E5L L;  3GDE A;  4DV4 L;  3CCQ A;  1C7Y A;  1VQO A;  5AJ3 L;  4IPG A;  2XGT A;  4DR1 Q;  5C0X G;  1Q1B A;  1YJW A;  1JJC B;  4DR5 Q;  3UDF A;  2HT1 A;  2PI2 A;  3KOJ A;  3K81 C;  1WJJ A;  4TQU S;  1Q7Y C;  3T1Y Q;  3J80 i;  1P8L A;  2ATW A;  1AE3 A;  1K8A C;  3S16 H;  4R4T A;  4JI8 L;  1Y1V G;  3S2D H;  1WYD A;  3GTG H;  1U0L A;  2H5X A;  1YJ9 A;  2BA1 A;  4GNX A;  1KD1 C;  1A0I A;  3KFU A;  1YHB A;  2GN5 A;  1LTL A;  2ZJP A;  3TS2 A;  3PUW A;  1UE5 A;  4HIK A;  4LF9 Q;  2NZH A;  2I0Q A;  4DR4 L;  4A93 G;  3CD6 A;  5C4X G;  3E9H A;  2LXJ A;  2JJQ A;  4X62 L;  3GTJ H;  3BZK A;  1Q8K A;  4GLA C;  4BXX H;  4BBS G;  4LF8 L;  4DUZ Q;  5C44 H;  4LFC L;  4JBW A;  5FLM H;  2CWA A;  3AYH B;  4RMF A;  3HOZ H;  3UDG A;  1SR3 A;  3ZJY C;  5M5X H;  4LW1 A;  1EQR A;  1XNQ Q;  1GM5 A;  1GVP A;  1OXS C;  3RNU A;  3RN5 A;  2UUA L;  1I50 H;  4JBK A;  2VW9 A;  2A1A A;  3HOW H;  4RG1 A;  1KC8 C;  3PSI A;  4FDB A;  3HOV G;  4DV5 Q;  3CW2 C;  2CWP A;  1PH7 A;  4BBS H;  1UE6 A;  1QZG A;  1V1Q A;  2IY5 B;  4PZ8 A;  2EXD A;  3ER0 A;  4A3K G;  1Y1W G;  1R9T H;  3FP9 A;  4WJ3 M;  1H95 A; 
#chains in the Genus database with same CATH topology
 3ERS X;  2OTL A;  4HAE A;  1YJN A;  2L4N A;  4CKB A;  2A19 A;  4KHP Q;  5FO8 B;  2NVX H;  4FF3 A;  3HEJ A;  4DV1 L;  1YNJ C;  1D8L A;  2LSS A;  4GKK Q;  1ET9 A;  2JK8 A;  1SBB B;  4A3K H;  1NUC A;  1B2T A;  3K59 A;  3K0X A;  2Z9H A;  2L12 A;  4NW2 A;  2ZXR A;  2AQ1 B;  2EY6 A;  2PZU A;  1SE4 A;  3QG1 A;  1H9M A;  4DV7 L;  3C1F A;  1PH5 A;  3IFT A;  1GXD C;  1MSH A;  4ZLT F;  5HY6 A;  4AYB B;  3D6C A;  1EWC A;  4NKL A;  2K5H A;  4C3I B;  4IFD J;  3ITP A;  1UNS A;  3M7G A;  2OWO A;  2JA9 A;  2PZW A;  1STH A;  1K8M A;  1GO3 E;  4Q5V A;  1JMC A;  3H15 A;  4GNX C;  1KAA A;  1GUT A;  2R92 H;  2ZTE A;  5C5L A;  4RKB A;  1BBX C;  1VF7 A;  2O5I C;  2F0V A;  3CHB D;  3CCR A;  2EYH A;  1JJ2 A;  4JYA L;  2EYM A;  2ZTD A;  4XYO A;  4DK0 A;  1AZP A;  5EPL A;  4E6I A;  1JQY D;  1EL0 A;  4A3L H;  4ME3 A;  2M00 A;  3CCE A;  3GQB A;  1TU2 B;  3F2B A;  4KN7 C;  5I2X A;  4JVZ A;  1DOL A;  1SNC A;  2JYO A;  1FNU A;  4G7Z C;  1XPR A;  2YU9 H;  1PTO D;  4QL5 A;  5EQ0 A;  2QA4 A;  1Y69 U;  4JV5 Q;  4H7B A;  4TSS A;  2RVL A;  1MJE A;  2Z6K A;  2JP1 A;  3FMC A;  4JW0 A;  3NBH B;  1VQN A;  1JJG A;  3FPP A;  3TBI B;  4RAU C;  4NB3 A;  2MO1 A;  1IYJ B;  5BR8 L;  1QZH A;  1N9W A;  2ID0 A;  2JN4 A;  1F77 A;  1ILP A;  3KDF A;  1EIH A;  3AFP A;  2K32 A;  4K2K A;  1Y8O B;  4HIM A;  1HNW L;  1YZ6 A;  4JI4 L;  1PTO B;  1I4Q A;  4DXG A;  1HZC A;  4ZAI A;  1KDB A;  3OOC A;  3RZD H;  3STB C;  1G29 1;  4ZCK A;  1YIT A;  2UUB Q;  3F1Z A;  2A5H A;  1EZ8 A;  4NP5 A;  5I4D A;  2G9H D;  1VQK A;  3DWP A;  4DV0 Q;  1JOQ A;  2B2Y A;  2MJ8 A;  3I3C A;  3PO2 B;  2R93 H;  1B53 A;  2A69 C;  3S17 H;  3UDI A;  4K0K L;  3GTK B;  2WB1 B;  2LS0 1;  1MI2 A;  4B3S Q;  2K5D A;  2KHI A;  2MNA A;  2KED A;  3HKZ G;  1CKN B;  5EKI A;  4KY5 A;  3CQZ B;  4JCV E;  3FKI B;  2K1B A;  4LUV A;  5DNF A;  1SXT A;  4B3T Q;  3HOY G;  3IAY A;  2Q2H A;  3R8B A;  3HKZ B;  3UE1 A;  2ENB A;  1BCP D;  1F2L A;  1NJI C;  2I5L X;  3NBI A;  4G57 A;  5CC4 A;  2R7Z B;  5C3E G;  1QVF A;  1Q86 C;  4CDC C;  1YVC A;  4Q0F A;  4MNO A;  1AH9 A;  1E3P A;  2KOL A;  5ELB A;  3N6R A;  1D1I A;  3UE0 A;  1SRO A;  3J80 c;  4P71 A;  1I3Q H;  3RR5 A;  1U4M A;  4XXE A;  2ASB A;  4V0B A;  1BKB A;  4RHR A;  4OX9 Q;  3AFQ A;  1QWY A;  1MJC A;  1RTO A;  2CH4 W;  1ESF A;  3S14 B;  3HOU H;  4AYB E;  1BCP B;  1S5C D;  1UAP A;  3AEV A;  1Q1E A;  4IPD A;  3D4D A;  1XXG A;  1GUS A;  4ULL A;  4R1J A;  1EYC A;  1KRS A;  3HG9 A;  2F4V Q;  5CV8 A;  3A8K E;  3OHX C;  4KY7 A;  4M8A A;  1HZA A;  2NYZ D;  3L3O C;  1B44 D;  2FMM A;  3WOE A;  2BDN A;  5ELO A;  4ME5 A;  2K52 A;  2E2I H;  1VQM A;  4DR2 L;  3EIV A;  4Y52 H;  3CC4 A;  4JI2 Q;  3NHH A;  2A6E D;  1NMF A;  4OWW B;  1MD2 D;  1YBY A;  2BCO A;  1VDZ A;  2UXB L;  3P1H A;  4R4Q A;  2JEB I;  2JE6 I;  1PFM A;  4DAP A;  1QG7 A;  4DR3 Q;  1E2V A;  2CKZ B;  2PQA A;  1NNX A;  1DOM A;  4PQX A;  3TSS A;  3H6M A;  2EVB A;  2F3I A;  4JG2 A;  5T1I A;  4LF7 Q;  1XMO L;  1QE6 A;  4GS3 A;  4YY3 Q;  1EYD A;  4B3R Q;  2VQE Q;  3GP7 A;  3OYY A;  1HQR D;  2IHF A;  5JJZ A;  1KDC A;  2RKS A;  1U4L A;  4RGN A;  1AE2 A;  1ZEQ X;  4A3E G;  1SND A;  4X65 Q;  2UXC Q;  3M4O B;  4LUZ A;  3NWT A;  4MHE A;  1D2B A;  1HJP A;  2HIV A;  2QEX A;  3M85 A;  3T1H Q;  1CT1 D;  1K83 H;  5K36 H;  1BO0 A;  2FJ2 A;  2SOB A;  4HED A;  3VYS A;  1STN A;  5FJ8 G;  1WOC A;  4A3E B;  1B7Y B;  1T5X D;  1A62 A;  4I7A A;  1A2T A;  3S16 B;  2JA7 B;  1K8O A;  3PO2 H;  3S1Q H;  3PIP 3;  2R7F A;  4GLX A;  3KUP A;  1LTR D;  4RH6 A;  1TXY A;  1CA5 A;  2Q8I B;  2KHJ A;  2UUC Q;  2EJG C;  3Q24 A;  3PO3 G;  3OW7 A;  5D3D A;  2NTT A;  1IYV A;  1AN8 A;  2WB1 E;  3PIO 3;  1I4G A;  1B3Q A;  3FKI H;  1Y1V B;  3J81 i;  3S2H B;  1GUN A;  2FMC A;  3Q23 A;  4FXD A;  1NE3 A;  3W1B A;  2K5W A;  5M5Y B;  1ILQ A;  3BVM A;  1LV9 A;  4IUQ A;  1EEI D;  3WWV A;  1PH6 A;  5C4X H;  1LAB A;  2N49 A;  4DV2 L;  1QVC A;  3HKZ E;  2K05 A;  2RDH A;  4AH6 A;  3A7A B;  3CC7 A;  2TMP A;  2KJX A;  1IW7 D;  2RBM A;  1BOS A;  3W5O A;  2L15 A;  2YTV A;  3SK4 A;  4EX5 A;  5J22 A;  2B63 G;  4RHS A;  2IWH A;  3S1R B;  4LF6 L;  3CME A;  3PQI A;  1X3G A;  1IBM Q;  1IBK L;  1BNZ A;  3S14 H;  5KYL A;  1Y1W H;  2E2J B;  5EKL A;  4EQ5 A;  3GTL B;  1V1P B;  4H0L C;  3E0E A;  4HN7 A;  3E5S A;  5L37 A;  3T1Y L;  4A3M H;  1XNR L;  1HPC A;  1LTA D;  4OEL B;  5H1S E;  2EOT A;  4JBJ A;  2GVB A;  4A93 B;  2WP8 J;  1O78 A;  1KLG D;  5EPK A;  3NEL A;  1X9N A;  3GD7 A;  4XIG S;  3RN2 A;  2F0W A;  1EQQ A;  2H1E A;  3NQI A;  2VB3 X;  3IRB A;  2RHQ B;  2Z6B A;  4DUZ L;  2JEA I;  4KMU C;  1TWH H;  3J7Y W;  1ZYR D;  4KTA A;  4LMQ D;  4BY1 H;  4BY7 H;  4DR4 Q;  2UXD Q;  1SYB A;  1NY4 A;  2N78 A;  3OSO A;  1CKN A;  5M3F B;  4WJ4 A;  1H9K A;  4FNF A;  1S72 A;  1SJH D;  3TRE A;  2K75 A;  3A56 A;  1IHZ A;  4R9W A;  1FVI A;  2NVY B;  3HOX G;  3D0F A;  2UUA Q;  2EJM A;  5GAG C;  1Z6H A;  3E9I A;  3WOF A;  1GHJ A;  1PH1 A;  4H13 C;  4C3J H;  5FK9 C;  4P72 A;  4GKK L;  5EJW A;  3SK6 A;  3HOX B;  2VY3 A;  3MEH A;  3I8Z A;  2ALY B;  1XTD A;  4L5S A;  4RGO S;  1V8Q A;  2AWN A;  4WOR A;  4APV A;  2JSO A;  5CV4 A;  5IYC H;  2E5L L;  1VQO A;  4QB4 A;  2XGT A;  3NTH A;  5C0X G;  3UDF A;  3ONA B;  3K81 C;  1WJJ A;  3S16 H;  3GV3 A;  4XT1 B;  1K8A C;  2F3V A;  2QW7 A;  4CJ2 C;  4KHV A;  5KYI A;  1YJ9 A;  1SMY C;  1HHV A;  1B50 A;  1EQV A;  2F0K A;  2F0M A;  2GN5 A;  3TS2 A;  2EXZ A;  4X3S A;  1UE5 A;  4HIK A;  3FDT A;  5ELC A;  2LXJ A;  3Q0A A;  2NBF A;  4GLA C;  4KKS A;  4BXX H;  4BBS G;  1LT3 D;  5C44 H;  3HOZ B;  5FLM H;  2CWA A;  1JCK B;  2B2U A;  1CTM A;  4OHJ A;  3ZJY C;  1GVP A;  3TME A;  1K0S A;  4EQO A;  2A1A A;  1X32 A;  1ML0 D;  4F88 A;  4FDB A;  2ZXO A;  1X3P A;  5IT9 L;  3CW2 C;  4BBS B;  1V1Q A;  3NUC A;  4PZ8 A;  4A3K G;  1H95 A;  3R93 A;  3FP9 A;  4NMZ A;  3CPW A;  1NR2 A;  3BDC A;  2BE5 D;  2YTX A;  4C1N I;  2NVX B;  5HGQ A;  1EY4 A;  2FIN B;  1WTV A;  2F0P A;  5I2Y A;  3IFD A;  3K7U C;  5KND A;  1Y14 B;  4A3K B;  2V4D A;  1WCM G;  1F9P A;  5D3I B;  5M5W H;  2NZ1 D;  1EQT A;  2OEO A;  2J4X A;  2C5C A;  1ESR A;  3GTL H;  5CV7 A;  5IYD H;  2GVA A;  1EIF A;  4HSP A;  3LX0 A;  5C6A A;  3KF8 A;  4PMB A;  2SEB D;  2UUB L;  1WTX A;  1HFN A;  4GOP C;  2XWB B;  1WD1 A;  2B2T C;  2F0G A;  3PV0 A;  1S40 A;  4YHH Q;  1K73 C;  4DV0 L;  2XRS D;  3NWS A;  3MXN A;  4IJH A;  2M9V A;  1A3V A;  2LFN A;  1PFN A;  3CC2 A;  2R92 B;  1J8I A;  4HMJ A;  5E7N A;  1NBW A;  1TWC H;  2N8N A;  5T1G A;  1CKO A;  4QMG A;  1VQI A;  4KD3 A;  4DAV A;  1W2B A;  4B3S L;  4OO1 H;  3OW2 A;  3VYR A;  2PPB C;  5IP9 H;  2F0Q A;  3A55 A;  2IL8 A;  5IOD A;  2B39 A;  2ICI A;  1VQ5 A;  3N52 A;  4KI0 A;  4RGT A;  3CAM A;  4LF8 Q;  1BBU A;  2YU9 B;  4DK3 C;  3KK7 A;  2CVR A;  4B3T L;  1EFW A;  1RKN A;  3JAM L;  1BF4 A;  1PH8 A;  4BA2 I;  2VL6 A;  1WTR A;  4B08 A;  1EIG A;  1YIJ A;  1IKL A;  3J7A 5;  3F2C A;  2A6H D;  1PH4 A;  1FGB D;  1EFI D;  5KNB A;  5CV6 A;  2ICE C;  2KBN A;  3R2T A;  4LFA Q;  3L0O A;  1S4Z A;  3K7A H;  1TS5 A;  2AUK A;  1HNZ L;  3SXH A;  1YEZ A;  3TP8 A;  1SDF A;  3V2T A;  3I4M H;  3HFZ B;  1Y8P B;  3BS1 A;  5FLX L;  1STB A;  2F4I A;  5C0X J;  5GQO A;  1T9H A;  1B8A A;  2ZM6 Q;  4HIO A;  5I6Y A;  3T16 A;  2LMC B;  3RZD B;  1S5D D;  2A8V A;  4GLV B;  3KBG A;  2ES2 A;  4C3H H;  4AQY Q;  3V96 A;  5EBC A;  3I4O A;  3TZU A;  5E3F A;  1GOZ A;  2F4V L;  4YWK A;  3HOW G;  1FNW A;  1WTW A;  2N55 A;  3J81 E;  1JE4 A;  2R93 B;  3S24 A;  2YYZ A;  1EY8 A;  3S17 B;  1PYS B;  1PLF A;  3R3O A;  2E2H H;  4XQN A;  1VQJ A;  1YNJ D;  3EN2 A;  2R3Z A;  5E4W C;  1N34 Q;  1Q81 C;  1HNX Q;  4MIU A;  2F0E A;  3KLR A;  4J6H A;  3IL8 A;  2XRQ D;  3LWU A;  1Z7T A;  1TWA H;  1EZ6 A;  1SEB D;  2Y0S B;  2PQA B;  3O13 A;  4FXG C;  3A74 A;  4DNT B;  1N33 Q;  5JVH 3;  1HUM A;  1WD0 A;  3G6J B;  4DR3 L;  3I4N B;  2KA7 A;  1V1O A;  1E0B A;  2HUG A;  2NVQ H;  3CCL A;  4AYB G;  3VR3 A;  2BOS A;  5ELN A;  2N3S A;  4A3B H;  4B3R L;  3CCJ A;  4C3I G;  4A3F H;  1Z47 A;  2X6G A;  4UHV A;  2XN9 C;  3H0G H;  1I3Q B;  1KDA A;  1PYB A;  1CSQ A;  5C4H A;  3HOU G;  2HHH Q;  4NXN Q;  1SNQ A;  1UEB A;  1CKM A;  4X65 L;  2UXC L;  1DXM A;  1U4R A;  4HJ7 A;  2DGY A;  2B3G A;  1TVX A;  2ZXP A;  1AZQ A;  1KNA A;  1IL8 A;  3T1H L;  3KLS A;  3HOU B;  4WJW A;  1QNK A;  5DLQ E;  1HZ9 A;  4L8J A;  1ASZ A;  4GNX B;  1NTG A;  1QB5 D;  1VMC A;  1IYU A;  5LMU Q;  3A8J E;  4ZYS A;  5IP7 H;  4J15 A;  5JPM C;  2UUC L;  1F2M A;  4KJO A;  5I6W A;  1SE3 A;  3K5M A;  2L11 A;  1HFG A;  2IPK D;  4DV6 Q;  1X3F A;  3T53 B;  1X54 A;  1EEF D;  2XIW A;  4R4O A;  1VQH A;  3K5N A;  2MFI A;  4K5V A;  1D7Q A;  1HR0 Q;  2E2I B;  3SK8 A;  1TWF H;  3SK5 A;  1KAW A;  1PTO F;  3VR2 A;  1I6H H;  3Q22 A;  5KRU A;  4FVM A;  1OXU A;  4CDE C;  2Q2I A;  3STB D;  1A2U A;  3H91 A;  1PXU A;  3PF4 A;  4IUR A;  1ENF A;  3NQT A;  3EA6 A;  4JI0 Q;  1QIL A;  5LHY 1;  1CQV A;  3U4V A;  3VA5 A;  5ELD A;  4YWL A;  2L9H A;  1B70 B;  2PQE A;  1JWS D;  3M4Q A;  1VQB A;  4KV6 A;  2IT1 A;  4KLK A;  3GTO B;  1SFO H;  5K36 G;  1IBM L;  5GAH C;  3AQQ A;  3KJP A;  3TRZ A;  3I91 A;  5IGF A;  3G4S A;  1EWI A;  2I07 B;  2A73 B;  3PO2 G;  3A5Z B;  1ICF B;  1M8A A;  5IWA L;  1I94 Q;  2Z4H A;  2WB1 G;  2E2D C;  4QCL A;  1K83 B;  4H44 C;  1Y8N B;  3K0Y A;  4A3J H;  3MZ5 A;  4YWM A;  3S1Q B;  2P5Z X;  4GOP A;  3KLS X;  3FKI G;  2UU9 Q;  1W3S A;  1J6Q A;  3NTK A;  3K5O A;  3BG3 A;  3M4P A;  4O1N A;  3BZC A;  3E3X A;  3TQY A;  4UPA A;  4EVO A;  2F03 A;  5ELF A;  2UXD L;  2R7Z G;  2EZV A;  1PMR A;  4JI3 Q;  1VMP A;  4OXP A;  4QQB X;  1SJE D;  1Q3L A;  4XQJ A;  2B2V C;  2AUJ D;  3PF5 A;  1MGS A;  1ET6 A;  3NSW A;  1MKH A;  3I4N H;  3PCO B;  4PG3 A;  4R4I A;  2EQS A;  2Y0S E;  4L63 B;  5C4X B;  4PNY A;  1G8Z D;  3L2P A;  4DUY L;  4MTK A;  1N36 L;  1BCP F;  1TII D;  1HXY D;  3BU2 A;  5JJK A;  3J7Z C;  1H9S A;  2BH8 A;  4LFB L;  2DUD A;  2VZA A;  3T51 B;  3DHQ A;  2K6A A;  3E0J A;  1F9S A;  1GD7 A;  3D8G A;  1R4P B;  4ZK9 B;  4WFN 3;  4A3M G;  2VNU D;  1EOV A;  3ZYY X;  1FJG Q;  4BA1 I;  1WFQ A;  4DXF A;  5J3B A;  1Y1W B;  1L1O C;  5JAV A;  3D31 A;  1CQF A;  3H3V C;  4OWT B;  4A3M B;  3ULL A;  5NUC A;  2SNM A;  2KCT A;  1TT2 A;  4LF5 Q;  2D62 A;  4CDD C;  5D65 A;  1ONL A;  5HUR A;  2A74 C;  1DOK A;  3RLF A;  1HCZ A;  3LGJ A;  1CZW A;  1E2W A;  4QJF A;  3GV6 A;  3VDY A;  1Q82 C;  2E75 C;  1HTP A;  4GKJ Q;  1LTG D;  5D14 A;  4IUV A;  4P73 A;  1GJX A;  2ZJQ A;  1WI5 A;  4QF4 A;  3J80 L;  1TWH B;  2D2C C;  1EY9 A;  4BY1 B;  4BY7 B;  2CH4 A;  3K57 A;  3M9B A;  2WII B;  5JJI A;  4X62 Q;  5LMN L;  1BBW A;  1TS4 A;  3EBE A;  2K14 A;  1YNN C;  4B3M L;  1E1O A;  1RF2 D;  1A3T A;  1SN8 A;  3GTO H;  1XMQ L;  3NP8 A;  3OIQ A;  4C3J B;  5IYC G;  4DR7 L;  1Q12 A;  4GN5 A;  2RDG A;  3KF8 B;  1UUP A;  1N8R C;  3FRP B;  1SYC A;  2JA7 G;  4GN4 B;  3S15 H;  2LY7 A;  4XDX A;  5F2D A;  1AEX A;  2Z0S A;  1CUK A;  2OQ0 A;  3K5L A;  3MXN B;  4HJA A;  2KEN A;  3GDE A;  1C7Y A;  5AJ3 L;  4DR1 Q;  4B9X A;  1YJW A;  1JJC B;  2PI2 A;  3KOJ A;  4TQU S;  2A6E C;  2ATW A;  2RDF A;  4HSV A;  4JI8 L;  1Y1V G;  3R2I A;  5A2Q L;  1WYD A;  3GTG H;  1U0L A;  1L0X B;  4GNX A;  1LTB D;  1A0I A;  1LTL A;  4I7Z C;  2NZH A;  2I0Q A;  1HA6 A;  4CGY B;  4DU9 A;  2JJQ A;  4C1N K;  4WRD A;  5C44 B;  4RWS C;  4LF8 L;  2MUY A;  2F0F A;  4LFC L;  2QDB A;  3I70 A;  4G7H C;  1G6Z A;  3AYH B;  1JWU D;  5EKK A;  1SR3 A;  5CBA E;  5M5X H;  1XNQ Q;  3EFX D;  1OXS C;  3RN5 A;  4JBK A;  2VW9 A;  1CFM A;  3VR6 A;  4RG1 A;  1Q90 A;  4YIJ A;  4FF1 A;  3MHB A;  2L55 A;  4DV5 Q;  1MHW C;  1S5B D;  2PMZ B;  1JB3 A;  1EU3 A;  5CMD A;  1UE6 A;  5I9P A;  2IY5 B;  1GUW A;  4WJ3 M;  1R9T H;  4LFA L;  5EPJ A;  1D5Z C;  2DNE A;  1VF5 C;  4HJ9 A;  4K8I A;  2Q8T A;  1VS0 A;  4OL7 A;  4F87 A;  1JC7 A;  2HCC A;  4A93 G;  5GAE C;  5M5W B;  4Z9C B;  2MO0 A;  4U67 3;  1I5F A;  3G48 A;  3HOY H;  2X69 A;  1D5X C;  4O2D A;  3MVV A;  4DF7 A;  3QIA A;  2D0P A;  4KJN A;  4OIJ A;  5C3E H;  4BBR H;  1OXV A;  3H3V H;  4AQY L;  5IGG A;  1HNW Q;  4ZQ3 A;  5DM6 3;  1EY6 A;  1I4P A;  4DKA C;  5FKA C;  4IZ8 A;  1OO9 B;  2MP1 A;  2MHV A;  1YHA A;  1V43 A;  5JJL A;  2F0J A;  1WTP A;  2HCI A;  2MPM A;  2LXK A;  5IP9 G;  3J81 c;  4K6L A;  5M3F G;  5COY A;  1TWC B;  4IN3 A;  2QCP X;  3QJY A;  1U5K A;  2WIN B;  2KEC A;  1PVO A;  1QCB D;  1IXR A;  1A3U A;  4B9W A;  1N34 L;  1HZB A;  3QB3 A;  2WV6 D;  4OON A;  1EWH A;  2MQH A;  1G2T A;  1E2Z A;  4K0K Q;  1W6K A;  3TEH B;  3FEW X;  1LLR D;  2CQO A;  3J7A V;  3HS0 C;  3OIP A;  1MSG A;  4TKO B;  1X65 A;  1W6J A;  4KHP L;  2R61 A;  3I56 A;  3CRK C;  4ALP A;  4HJ8 A;  1SMY D;  2EY5 A;  3K7A B;  1RHP A;  5GAD C;  2A68 D;  4UP7 A;  3CF5 A;  1TQO A;  4JBM A;  4RCN A;  1EIY B;  3I4M B;  4C3H G;  1OXT A;  4X3T A;  4NXN L;  3MFG A;  3DMU A;  3MTS A;  4OO1 I;  1D6E C;  1STA A;  2B29 A;  4KKT A;  5KGU A;  4KY6 A;  4CDF C;  4DGZ A;  1ENC A;  4FXK C;  5IE8 A;  5HGT A;  4C3H B;  5G3L D;  1MBY A;  2I5H A;  4JPB W;  4IPH A;  4BS9 A;  1EY7 A;  1G2S A;  1L1O A;  3HOZ G;  5G3L F;  1KHI A;  5FO9 B;  1PH2 A;  4X66 Q;  2M2L A;  3JAM i;  4Y7N H;  3MXG A;  2J0T D;  1A63 A;  4POG A;  2F0T A;  2B8F A;  3AB9 A;  4DV6 L;  2K5V A;  3G7L A;  3MXU A;  2FHT A;  2E2H B;  2AWO A;  2N88 A;  2IX1 A;  2QDL A;  4HR7 B;  2EDG A;  3HP3 A;  5BN4 A;  4A3C H;  4K14 A;  4JV5 L;  1WTQ A;  1HR0 L;  2JA5 B;  3MEF A;  1GHK A;  4F8M A;  4NXM Q;  4A4I A;  2AKW B;  4IAL A;  5FJ8 H;  4P2C B;  2LKV A;  1TR5 A;  1TWA B;  1BVS A;  4DV3 Q;  2K5N A;  2D9U A;  1VQD A;  2C35 B;  3RLO A;  1NR4 A;  1IKM A;  4HMI A;  4DR2 Q;  1B1Z A;  3MFY A;  2PMZ E;  3ULJ A;  3PO3 H;  2KCN A;  3MA2 B;  3VR4 A;  5LMN W;  2NVQ B;  2C9O A;  4ZKC B;  2EYO A;  2KEE A;  3VYU A;  3PUV A;  4KKU A;  4DK6 C;  2VS1 A;  4A3B B;  1BQQ T;  2RSN A;  4CBV A;  4A3F B;  2JA6 H;  3H0G B;  1FNV A;  4TVA B;  5JPN C;  1DON A;  1QUQ B;  2E74 C;  3M7N A;  1STY A;  3ICE A;  2R92 G;  3Q8D A;  2RCF A;  4DAM A;  1JOK A;  2FFK B;  2IW3 A;  1NCV A;  2G9D A;  1PDQ A;  1I94 L;  1Q46 A;  1O7I A;  4L5T A;  5IP7 G;  4A3L G;  3BDL A;  4HID A;  2R6G A;  4GOP B;  4HCE A;  4OGQ C;  3JAM c;  3C1E A;  1M90 C;  2KCC A;  2NTS A;  2B63 H;  1R4Q B;  4PZ7 A;  2B2Y C;  1PZK D;  2O5J C;  4LF4 Q;  5LL6 S;  5C4Z A;  1E7Z A;  1SAP A;  2VQF Q;  4A3D H;  4L6T B;  4PZ6 A;  2Z1C A;  5TSS A;  3S1M H;  3D6W A;  1KTK A;  1VQC A;  2XVS A;  2Z8L A;  1G51 A;  1SLJ A;  4J1M A;  1SYG A;  4CHT B;  5I9O A;  1JT8 A;  4M1U B;  1XWE A;  4JI3 L;  1TWF B;  2OCE A;  5FLX c;  1I6H B;  1KAB A;  1LAC A;  1S5F D;  4QUF A;  3NEM A;  1O80 A;  1JR0 D;  1H9S B;  5DM7 3;  2F0N A;  5K5P A;  3DWQ A;  5EBD A;  2PNH A;  1J5E Q;  4FO2 A;  2OTJ A;  1I4R A;  2SNS A;  1A6X A;  1BR9 A;  1FYC A;  5C5M A;  3GTQ H;  3DLL A;  4FYD A;  1TWG H;  2F0O A;  3W2D A;  1VQE A;  1EY0 A;  2JA8 H;  1U4P A;  2HDM A;  2QGQ A;  4OX9 L;  4P74 A;  4K5W A;  1SFO B;  2K04 A;  4A3G B;  5JEA H;  3QR8 A;  5EGT A;  3RUZ A;  2EY1 A;  1XX8 A;  5IOC A;  1FJG L;  1RD9 D;  4KN4 C;  1JOR A;  3VA7 A;  1D5M C;  2B8G A;  2F0I A;  5JVG 3;  4A3J G;  3BJU A;  4YCW A;  5M3M H;  3S9W A;  2VUM H;  3OWE B;  2R93 G;  1GKH A;  3GTP H;  1N32 Q;  3P7J A;  1K28 A;  3HZX A;  2QF7 A;  2QEJ C;  4JI6 Q;  4LF5 L;  3ND8 A;  4A3J B;  3F2D A;  4IFD I;  3CP0 A;  1VQ4 A;  1LTI D;  4A3I H;  1LT4 D;  4K5X A;  1S5E D;  2K33 A;  4CJ0 B;  4QGU A;  3RLN A;  1C48 A;  2JXM B;  2F0H A;  4ZRZ A;  1DCZ A;  3D4R A;  3M4Y A;  2DJF C;  1XNR Q;  1CM9 A;  2Y0S G;  1K8G A;  1PRT C;  3LWE A;  4FF4 A;  4GKJ L;  4A75 A;  4XYQ A;  2JA5 H;  5FOB B;  2NN6 H;  3I4N G;  4JI2 L;  4DR6 Q;  5C0X H;  2RCN A;  1II3 A;  4JI7 Q;  1RJT A;  3P20 A;  1XJV A;  3X3M A;  2D5D A;  3NXW A;  1XYI A;  1IBL Q;  4PMC A;  4JI1 Q;  2ZT9 C;  1VCI A;  3VYT A;  4DFA A;  1HH2 P;  4C2M H;  1PFB A;  3KYH C;  1F9R A;  2OXP A;  4LF7 L;  4YY3 L;  3B6Y A;  2VQE L;  5BN3 A;  5ELE A;  3I55 A;  1FGU A;  3OTO Q;  4CJ1 B;  1SSO A;  3G6E A;  3JC6 6;  1ZXT A;  3SE0 A;  3CCM A;  2KUM A;  4K8J A;  3C3L A;  1A15 A;  4DNR B;  4X3K A;  3HOV B;  2D0O A;  1C9O A;  2CW0 C;  5IYB H;  1KIX A;  1S3O A;  4QY7 A;  4DR1 L;  1V9P A;  2K4K A;  1SMX A;  1VQP A;  4PV1 C;  1WVL A;  4BWG B;  1PZJ D;  3ERQ A;  5IT9 E;  1KQS A;  2E5L Q;  2FXQ A;  3PMF A;  3IKJ A;  1WCM H;  4DAY B;  3D3R A;  3CXC A;  2NVT H;  2G5D A;  3U4Z A;  2XNA C;  2WKC A;  2O2L D;  1B4O A;  1EYA A;  3TP7 A;  1HRJ A;  3OWF A;  3KF6 B;  4IFD H;  1SE8 A;  4MN3 A;  1XNQ L;  1X55 A;  4ZUI A;  4R8I A;  4U68 A;  1PV4 A;  4DV5 L;  3AU7 A;  1HR0 W;  1X3Q A;  2PYK A;  4QIW B;  3TDQ A;  3NTI A;  1WTO A;  5E4X A;  3DM1 A;  1ENA A;  1H9R A;  2EYL A;  4K2L A;  3LNN A;  1P16 A;  1VQ8 A;  2A69 D;  1SNO A;  4A3G H;  1CZG A;  3CRL C;  1YI2 A;  4XTC S;  2F0L A;  1GUG A;  1UE7 A;  2Q2T A;  3S15 B;  2ZJR A;  1QUQ A;  4JI5 Q;  1H9J A;  1PTO C;  1KL9 A;  1DM0 B;  1T5E A;  2J7Z A;  2F0U A;  3MXP A;  3CCQ A;  4IPG A;  4DR5 Q;  5C4J B;  3JAM E;  1PZI D;  2Q8R E;  3J80 i;  1LO5 D;  2IX3 A;  2B2T A;  4HTH A;  4R4T A;  2K01 A;  3S2D H;  5KIX A;  3GTG B;  2H5X A;  3L9A X;  2EPB A;  1YHB A;  3QWN A;  3PUW A;  4DR4 L;  4IQZ A;  4LF9 Q;  4X3U A;  5C4X G;  4G7O C;  2F3W A;  3GTJ H;  3BZK A;  3T4A C;  2B2W C;  2L1B A;  5FLX E;  2PW7 A;  4JBW A;  1TS2 A;  4CKC A;  4RMF A;  5M5X B;  3TP6 A;  4LJZ C;  4LW1 A;  1EQR A;  4HCS A;  1GM5 A;  2AQ3 B;  2UUA L;  1I50 H;  3BVZ A;  1BUV T;  3HOW H;  1HA5 A;  3HRZ C;  1KC8 C;  3SR1 A;  1PH7 A;  2XWJ B;  2L5T A;  1QJO A;  1R9T B;  2EXD A;  3ER0 A;  1XTC D;  1Y1W G;  3S1N B;  4UAI A;  1EY5 A;  4JOI C;  4DK1 A;  1F2Z A;  2VB2 X;  4X64 Q;  1SRU A;  3HOV H;  2CHB D;  1JOO A;  1Q8I A;  3T13 A;  2DY8 A;  3U50 C;  4BBR G;  3G71 A;  2X6L A;  2PCF B;  2HQE A;  3K80 C;  1QOH A;  4N9P A;  1IL2 A;  1HTL D;  3HOY B;  1HQM C;  2R7D A;  1AW7 A;  1EU4 A;  2EIF A;  2BDO A;  1LT6 D;  1HNZ Q;  2PI2 E;  1L1O B;  1UEA B;  5C3E B;  4BBR B;  1A8V A;  1LTT D;  5EAY A;  4DV4 Q;  2RSO A;  4EQN A;  1DZ1 A;  2PO4 A;  3K8A A;  1SNM A;  4BY1 G;  4BY7 G;  1YNN D;  4C3I H;  1BCP C;  5CR3 A;  2RF4 A;  1PA6 A;  1WTH A;  4X66 L;  1STE A;  1PFS A;  1J9O A;  4DNI A;  1CHP D;  1B3A A;  2E8G A;  4HJ5 A;  4S3S A;  1F2Y A;  3M3Y B;  3J81 j;  1VQ6 A;  4UY8 C;  1VQ7 A;  4NXM L;  1O7Y A;  2K28 A;  3ND9 A;  2B2U C;  1UE1 A;  4DV3 L;  1K3B C;  4C3J G;  1LT5 D;  3MC0 B;  3ERO A;  3UDX A;  1X6O A;  3A8I E;  4UP9 A;  3H3V I;  4QIW E;  1KNE A;  1PYW D;  3CPF A;  4IUN A;  4C56 C;  1O7Z A;  4DN4 M;  3NK9 A;  5IGB A;  4L5Q A;  4IJL A;  2EJF C;  2I46 A;  1TS3 A;  4NDX A;  4MZ9 A;  3DEO A;  1JE5 A;  1K3R A;  4DV1 Q;  4IUU A;  1FR3 A;  4V19 0;  1DJR D;  3NPP A;  5CV5 A;  1PTO H;  3C46 A;  1X56 A;  2HDL A;  5C4J H;  4YHH L;  2JQO A;  1CI3 M;  4DV7 Q;  3PGZ A;  3PIP A;  3A54 A;  4BXX G;  2MGS A;  5C44 G;  4GN3 B;  5FLM G;  4KHZ A;  3F8T A;  4LF4 L;  3RMH A;  4A3C G;  1B9M A;  4DPG A;  5KNC A;  3D4W A;  3DUZ A;  2VQF L;  2PW5 A;  1I4X A;  5IY0 A;  4GZY C;  4Y7N B;  1C8C A;  2WAC A;  3PIO A;  4DAY A;  1PH9 A;  3CCS A;  2AHO B;  1XPO A;  4LNQ A;  3GTM B;  4JYA Q;  1KRT A;  5DEH A;  4I65 A;  3GTK H;  3CKI B;  1D1K A;  2AMC B;  1I4H A;  1FL0 A;  2WFW A;  3H09 A;  3KF6 A;  5COR A;  2NB0 A;  3RZO B;  1G6P A;  2SDF A;  3CQZ H;  4P75 A;  1QNU A;  2HD3 A;  3PUZ A;  2VXW A;  4RCO A;  1J5E L;  2Q2U A;  2JA6 G;  3BZD B;  3MWY W;  3S1N H;  2XSC A;  4IOA A;  5IYD G;  5IIF A;  3X3N A;  2OQK A;  5M9O A;  1ASY A;  3UI2 A;  3A0J A;  3W3A A;  5C3W A;  1XPU A;  3PO3 B;  4J8Q A;  4LWC A;  5GRO A;  2R7Z H;  2EYF A;  3KJO A;  3DEP A;  2F0D A;  1NMG A;  4NPS A;  3SEB A;  3NBH A;  2JA6 B;  5J1Z A;  2ZM6 L;  3TZD A;  1NAP A;  3KBX A;  5BR8 Q;  3CCV A;  2CFM A;  1O7L A;  3A7L A;  4JC0 A;  1LUZ A;  4H02 A;  4X6A H;  3TN2 A;  1DGS A;  1CK1 A;  1L0W A;  1N32 L;  3AMU A;  2NUC A;  2EYJ A;  4O0A A;  4JI4 Q;  4OIK A;  3TS0 A;  4JI6 L;  2WAQ G;  4A3D G;  4OO1 G;  4F7X A;  4IUT A;  1TY2 A;  1JB7 A;  3U9O A;  2K03 A;  5A35 A;  2I5M X;  2B63 B;  2YV5 A;  4IPC A;  4UP8 A;  3KLW A;  5IWA Q;  3I2Z A;  2WAQ B;  4A3D B;  3M3Y H;  1B9N A;  3OMG A;  1C0A A;  3S1M B;  3OPO A;  1HNX L;  5CBE E;  1IW7 C;  4DA2 A;  1GUO A;  4DR6 L;  2EY2 A;  4JI7 L;  3BVG A;  3PUY A;  4AIM A;  3CU7 A;  3NE5 B;  3TP5 A;  1LYL A;  1IBL L;  3GO5 A;  4N8X 1;  4JI1 L;  5LL6 X;  1N33 L;  5BN5 A;  3BYY B;  1SYE A;  2BH2 A;  5CGK A;  4IOC A;  3FVQ A;  5JOB A;  2JA8 G;  2B2V A;  2B2W A;  3I4M G;  3NEN A;  2RA4 A;  2DJG C;  3PUX A;  1TKW B;  3F2U A;  2OT2 A;  1JIC A;  5JEA G;  1ZKO A;  4ODG A;  1E24 A;  3GTQ B;  3OTO L;  2F0S A;  1TWG B;  3EVQ A;  5M3M G;  3BDO A;  3SHL A;  3QOL A;  1I6V C;  3HGB A;  2NZO A;  3J81 L;  1JWM D;  2VUM G;  2JA8 B;  2HHH L;  2KCM A;  4DUY Q;  1IZ6 A;  1N36 Q;  1E1T A;  1RL2 A;  3K58 A;  4JOI A;  3K6O A;  2BA0 A;  4QUC A;  4FF2 A;  1RTN A;  1ZYR C;  4LFB Q;  3J80 E;  5M3M B;  4A3I G;  2VUM B;  2QKI C;  3GTP B;  4G4K A;  3HKS A;  2XTI A;  4ZKB B;  5IT9 c;  4LUO A;  2Z4I A;  2NWG A;  3M4O H;  1VQL A;  5LMU L;  1RIP A;  2KHS A;  1E22 A;  1UWV A;  1K9M C;  2JA5 G;  2NN6 G;  4A3I B;  2HQL A;  2IJ0 A;  1PH3 A;  3DM3 A;  4O42 A;  4A3E H;  2RQX A;  1DYQ A;  4LK1 C;  3EJI A;  1X3E A;  4IO9 A;  2JA7 H;  2H4O A;  1NSN S;  3E6Z X;  3C2P A;  4RFB A;  4ZUJ A;  1SYF A;  3GTM H;  5ISR A;  3H94 A;  1YHQ A;  1VQF A;  4KD4 A;  2DN8 A;  2F52 A;  2IHE A;  2A68 C;  3I73 A;  2OF1 A;  3BYT B;  3RZO H;  3J7A F;  2Z6K C;  3W1G A;  1PHJ A;  1Y1V H;  4A3B G;  3S2H H;  2HIX A;  4KK7 A;  3DWA A;  4A3F G;  1C4Q A;  4JI0 L;  5IGE A;  1M4V A;  3H0G G;  1VQA A;  4C2M B;  3CMA A;  1DD2 A;  4XT3 B;  1SNP A;  5M5Y H;  3I90 A;  4UDU C;  1VQ9 A;  1RCV D;  2DNC A;  3CCU A;  3DXJ C;  4ABN A;  2EYP A;  3U9S A;  1F9Q A;  5LMN Q;  2UXB Q;  2YTY A;  5IYB G;  2V1C C;  5A2Q E;  3I7F A;  1VQG A;  3I4L A;  5C3X A;  2GA4 B;  1OXX K;  1TY0 A;  4B3M Q;  3KDF B;  4TRD A;  4R4C A;  2PZT A;  4R8N A;  1XMO Q;  4JI5 L;  1YNX A;  3I72 A;  3S1R H;  1XMQ Q;  4DR7 Q;  2DY7 A;  2NN6 I;  1Z9F A;  5C0X I;  4MTN A;  4A76 A;  1HUN A;  1STG A;  2IX0 A;  2ZTC A;  2E2J H;  4DR5 L;  1EUJ A;  2E76 C;  3SGI A;  1ICW A;  4L5R C;  4XQQ A;  1MIU A;  4IUP A;  3T56 B;  4OEM B;  1OTC A;  2UU9 L;  2K50 A;  5AFW A;  2QIL A;  5AJ3 Q;  1WCM B;  4A93 H;  1FD7 D;  4POF A;  4YCV A;  4IFD G;  2L0C A;  2BE5 C;  2WAQ E;  4LF9 L;  2NVT B;  1K0R A;  1U9R A;  4JI8 Q;  4FP5 D;  1L0Y B;  1AP0 A;  3EQL C;  1L2F A;  2RHS B;  3URY A;  5DAU A;  2KQ3 A;  3VR5 A;  1LM0 A;  4YCU A;  1BDO A;  4ILW A;  3FHW A;  3L7Z C;  5JEA J;  5M3F H;  4A3G G;  4PMW A;  2CQA A;  4LFC Q;  1EYG A;  4K6D A;  1QVG A;  1RDP D;  2NVY H;  4OWX B;  2PNR C;  1M1K C;  1CSP A;  2EE1 A;  4N8F A;  4X64 L;  4DV2 Q;  3SDZ A;  1EOT A;  1PRT D;  3A5U A;  5CV9 A;  3U58 A;  3HOX H;  4CKE A;  1PRT F;  2CCZ A;  4LF6 Q;  3ULP A;  5CYU A;  3RD4 A;  5E1F A;  1IBK Q;  4RGM A;  2AQ2 B;  4DV4 L;  2O4X A;  3SVM A;  5KEE A;  5IGD A;  1Q1B A;  2HT1 A;  2K7V A;  1Q7Y C;  3T1Y Q;  1P8L A;  1CHQ D;  1AE3 A;  1G91 A;  3S2D B;  2A6H C;  3P75 A;  4EGV A;  1LTS D;  1V1P A;  4JK1 C;  5IGC A;  3QOJ A;  4LAA A;  2BA1 A;  1KD1 C;  1PRT B;  3KFU A;  5J39 A;  2ZJP A;  2F1M A;  1AFP A;  3CD6 A;  4RA8 A;  3E9H A;  3V05 A;  3OMC A;  3GTJ B;  4ID6 A;  4X62 L;  1ROD A;  5FO7 B;  1Q8K A;  1CA6 A;  4RKL A;  2CW0 D;  4DUZ Q;  3FPU B;  1KLU D;  3MAQ A;  3HOZ H;  3UDG A;  2TSS A;  1I50 B;  3RNU A;  3HOW B;  3WDN A;  3PSI A;  3HOV G;  1SE2 A;  2CWP A;  3QO2 A;  1QZG A;  4BBS H;  3Q6S A;  1SYD A;  2WKD A;  2K5Q A;  2KVM A;  4N9T A;  1BXT A;  1KXL A;  4EQP A; 
#chains in the Genus database with same CATH homology
 4JOI C;  3CPW A;  3ERS X;  2OTL A;  4HJ9 A;  1YJN A;  1VS0 A;  2A19 A;  2YTX A;  4X64 Q;  1SRU A;  3HOV H;  4KHP Q;  5HGQ A;  3U50 C;  4BBR G;  3G71 A;  2NVX H;  3K7U C;  4DV1 L;  1D8L A;  1Y14 B;  2LSS A;  3K80 C;  5GAE C;  1IL2 A;  1WCM G;  2JK8 A;  4GKK Q;  2MO0 A;  4A3K H;  5M5W H;  1I5F A;  3G48 A;  2R7D A;  3HOY H;  3K0X A;  2EIF A;  3GTL H;  5IYD H;  2GVA A;  1HNZ Q;  4O2D A;  1EIF A;  2PI2 E;  1L1O B;  2D0P A;  4DV7 L;  1PH5 A;  1A8V A;  5C3E H;  5EAY A;  1OXV A;  5HY6 A;  4BBR H;  4DV4 Q;  4AQY L;  2UUB L;  3H3V H;  1HNW Q;  4DKA C;  4GOP C;  2K5H A;  3K8A A;  3PV0 A;  4YHH Q;  4BY1 G;  1S40 A;  1K73 C;  1YHA A;  1V43 A;  4C3I H;  4DV0 L;  4BY7 G;  4IJH A;  2OWO A;  5JJL A;  2JA9 A;  1PA6 A;  2RF4 A;  1GO3 E;  2LXK A;  4X66 L;  5IP9 G;  3H15 A;  4GNX C;  1PFS A;  1JMC A;  3CC2 A;  3J81 c;  4DNI A;  2R92 H;  2ZTE A;  5M3F G;  5E7N A;  1NBW A;  2E8G A;  1TWC H;  2N8N A;  4HJ5 A;  1CKO A;  1U5K A;  3CCR A;  1PVO A;  1JJ2 A;  4JYA L;  1IXR A;  2ZTD A;  3J81 j;  1VQI A;  1W2B A;  1N34 L;  1HZB A;  4B3S L;  1VQ6 A;  3OW2 A;  4UY8 C;  4OON A;  4A3L H;  4ME3 A;  3CCE A;  5IP9 H;  3F2B A;  2MQH A;  1VQ7 A;  4NXM L;  1VQ5 A;  4KI0 A;  3CAM A;  4LF8 Q;  1BBU A;  1UE1 A;  4DV3 L;  4DK3 C;  1XPR A;  2YU9 H;  4QL5 A;  4K0K Q;  2QA4 A;  1EFW A;  4B3T L;  4JV5 Q;  3TEH B;  3UDX A;  1PH8 A;  1X6O A;  1MJE A;  2VL6 A;  2CQO A;  2Z6K A;  4BA2 I;  4UP9 A;  1YIJ A;  3NBH B;  3H3V I;  4QIW E;  1X65 A;  1VQN A;  3J7A 5;  3F2C A;  4KHP L;  1JJG A;  1PH4 A;  3CPF A;  3I56 A;  4ALP A;  4NB3 A;  2KBN A;  4LFA Q;  4HJ8 A;  3L0O A;  2MO1 A;  1IYJ B;  5BR8 L;  3K7A H;  5GAD C;  1N9W A;  2ID0 A;  1QZH A;  4L5Q A;  4IJL A;  4UP7 A;  3CF5 A;  1HNZ L;  4JBM A;  1YEZ A;  4MZ9 A;  3KDF A;  3AFP A;  1EIY B;  1OXT A;  1JE5 A;  4NXN L;  3I4M H;  1K3R A;  4DV1 Q;  4HIM A;  3HFZ B;  1HNW L;  1YZ6 A;  4OO1 I;  4JI4 L;  5C0X J;  5GQO A;  1T9H A;  1B8A A;  2B29 A;  2ZM6 Q;  4HIO A;  1X56 A;  4YHH L;  5C4J H;  1HZC A;  2JQO A;  2A8V A;  4GLV B;  3RZD H;  3STB C;  4DV7 Q;  1G29 1;  3PGZ A;  5IE8 A;  3PIP A;  2ES2 A;  4BXX G;  4C3H H;  1YIT A;  2I5H A;  4AQY Q;  3F1Z A;  5C44 G;  2UUB Q;  4GN3 B;  4IPH A;  5FLM G;  1KXL A;  4KHZ A;  1L1O A;  3F8T A;  1VQK A;  3HOZ G;  4LF4 L;  4A3C G;  4DPG A;  4DV0 Q;  1KHI A;  3I4O A;  2VQF L;  2B63 H;  5IY0 A;  1PH2 A;  2F4V L;  4X66 Q;  4YWK A;  3HOW G;  3PIO A;  3JAM i;  4Y7N H;  1PH9 A;  3CCS A;  1A63 A;  4POG A;  2AHO B;  2YYZ A;  3S24 A;  4DV6 L;  1XPO A;  2R93 H;  1PYS B;  2K5V A;  4LNQ A;  3S17 H;  3UDI A;  4JYA Q;  2AWO A;  1KRT A;  2IX1 A;  2E2H H;  4K0K L;  4A3C H;  4JV5 L;  1VQJ A;  1N34 Q;  3EN2 A;  2KHI A;  2MNA A;  4B3S Q;  3GTK H;  1HR0 L;  2AMC B;  1Q81 C;  1HNX Q;  3MEF A;  4NXM Q;  4A4I A;  2AKW B;  3HKZ G;  1CKN B;  1FL0 A;  5FJ8 H;  2WFW A;  3KF6 A;  4DV3 Q;  1G6P A;  1BVS A;  4JCV E;  2K5N A;  1TWA H;  3CQZ H;  4P75 A;  4LUV A;  4B3T Q;  1VQD A;  2C35 B;  3RLO A;  2PQA B;  3PUZ A;  1J5E L;  2Q2U A;  3HOY G;  3A74 A;  2JA6 G;  1N33 Q;  3S1N H;  2Q2H A;  4IOA A;  4DR2 Q;  5IYD G;  2OQK A;  1ASY A;  4DR3 L;  2PMZ E;  3A0J A;  1XPU A;  3ULJ A;  3PO3 H;  3UE1 A;  5LMN W;  1NJI C;  4LWC A;  2I5L X;  2NVQ H;  3CCL A;  5GRO A;  5C3E G;  1QVF A;  2R7Z H;  1Q86 C;  3KJO A;  4AYB G;  1YVC A;  3PUV A;  4DK6 C;  1NMG A;  2VS1 A;  4MNO A;  4NPS A;  5ELN A;  1E3P A;  2N3S A;  4A3B H;  4IFD J;  1AH9 A;  2ZM6 L;  4B3R L;  3CCV A;  2JA6 H;  5BR8 Q;  3CCJ A;  3UE0 A;  4A3F H;  1Z47 A;  1SRO A;  2CFM A;  4TVA B;  3J80 c;  1QUQ B;  3H0G H;  4JC0 A;  4P71 A;  1LUZ A;  1PYB A;  4H02 A;  1CSQ A;  1I3Q H;  3RR5 A;  3HOU G;  3ICE A;  3M7N A;  2R92 G;  3Q8D A;  4X6A H;  1DGS A;  2HHH Q;  4DAM A;  4NXN Q;  1L0W A;  1N32 L;  1UEB A;  1CKM A;  4X65 L;  2ASB A;  2UXC L;  1BKB A;  4O0A A;  4JI4 Q;  4OX9 Q;  4HJ7 A;  2DGY A;  3AFQ A;  2B3G A;  1Q46 A;  2WAQ G;  1O7I A;  3TS0 A;  1I94 L;  4L5T A;  4JI6 L;  4A3D G;  4OO1 G;  5IP7 G;  1MJC A;  4A3L G;  3T1H L;  4HID A;  2R6G A;  4GOP B;  1JB7 A;  5DLQ E;  3JAM c;  4AYB E;  3HOU H;  1HZ9 A;  2I5M X;  1M90 C;  1ASZ A;  3AEV A;  1Q1E A;  2YV5 A;  4IPD A;  4PZ7 A;  4GNX B;  4IPC A;  1NTG A;  3KLW A;  4UP8 A;  5IWA Q;  3I2Z A;  4LF4 Q;  5LMU Q;  3M3Y H;  4R1J A;  1C0A A;  1E7Z A;  2VQF Q;  4A3D H;  1KRS A;  4PZ6 A;  5IP7 H;  4J15 A;  2UUC L;  2F4V Q;  3S1M H;  1VQC A;  1HNX L;  1G51 A;  1SLJ A;  4JI7 L;  4DR6 L;  4DV6 Q;  1HZA A;  1X3F A;  1X54 A;  3PUY A;  1JT8 A;  4R4O A;  4AIM A;  1VQH A;  2MFI A;  4JI3 L;  1LYL A;  1IBL L;  3GO5 A;  4JI1 L;  1D7Q A;  5ELO A;  1HR0 Q;  1N33 L;  1TWF H;  2K52 A;  2E2I H;  1VQM A;  4DR2 L;  2OCE A;  3EIV A;  5FLX c;  2BH2 A;  1KAW A;  3CC4 A;  4Y52 H;  4IOC A;  4JI2 Q;  1I6H H;  1NMF A;  1OXU A;  3NEM A;  4OWW B;  2Q2I A;  2JA8 G;  1YBY A;  3STB D;  3NEN A;  3I4M G;  3PUX A;  1J5E Q;  2UXB L;  2PNH A;  3PF4 A;  5JEA G;  4R4Q A;  2JEB I;  2OTJ A;  2JE6 I;  4JI0 Q;  1E24 A;  4DR3 Q;  3OTO L;  3GTQ H;  3U4V A;  3DLL A;  2CKZ B;  2PQA A;  5M3M G;  1TWG H;  2VUM G;  4YWL A;  2NZO A;  1VQE A;  1B70 B;  2HHH L;  2JA8 H;  2KCM A;  2F3I A;  4JG2 A;  4DUY Q;  1IZ6 A;  2QGQ A;  1E1T A;  1N36 Q;  1XMO L;  4GS3 A;  3M4Q A;  1VQB A;  4P74 A;  4YY3 Q;  1RL2 A;  4LF7 Q;  2IT1 A;  4KLK A;  2VQE Q;  4JOI A;  1SFO H;  4B3R Q;  3OYY A;  1FJG L;  2BA0 A;  2IHF A;  5K36 G;  1IBM L;  5GAH C;  3AQQ A;  4A3J G;  4LFB Q;  3BJU A;  3KJP A;  4YCW A;  4A3I G;  5M3M H;  3TRZ A;  1AE2 A;  3G4S A;  1EWI A;  4A3E G;  2VUM H;  2R93 G;  1GKH A;  3GTP H;  3PO2 G;  4X65 Q;  1N32 Q;  3A5Z B;  3HKS A;  2UXC Q;  2XTI A;  5IT9 c;  4LUZ A;  4LUO A;  5IWA L;  3M4O H;  1I94 Q;  4JI6 Q;  1VQL A;  5LMU L;  2WB1 G;  1RIP A;  4LF5 L;  1HJP A;  2HIV A;  2QEX A;  3M85 A;  1E22 A;  3T1H Q;  1UWV A;  1K83 H;  1K9M C;  3F2D A;  2JA5 G;  4A3J H;  4IFD I;  2NN6 G;  3CP0 A;  2HQL A;  1VQ4 A;  5FJ8 G;  1WOC A;  4A3I H;  1B7Y B;  1PH3 A;  4QGU A;  3DM3 A;  1A62 A;  4A3E H;  3RLN A;  4YWM A;  3PO2 H;  3S1Q H;  1X3E A;  2R7F A;  4IO9 A;  4GOP A;  3FKI G;  4GLX A;  1XNR Q;  2JA7 H;  2Y0S G;  2UU9 Q;  1K8G A;  3GTM H;  1W3S A;  1TXY A;  1J6Q A;  4GKJ L;  3M4P A;  4A75 A;  1YHQ A;  2KHJ A;  2UUC Q;  1VQF A;  3BZC A;  2JA5 H;  3PO3 G;  2F52 A;  2IHE A;  3I4N G;  4JI2 L;  4DR6 Q;  4JI7 Q;  2RCN A;  3TQY A;  4UPA A;  2UXD L;  1XJV A;  2R7Z G;  3RZO H;  2WB1 E;  2Z6K C;  3W1G A;  3FKI H;  4JI3 Q;  3J81 i;  1PHJ A;  1IBL Q;  4OXP A;  1Y1V H;  4JI1 Q;  4A3B G;  4QQB X;  1VCI A;  3S2H H;  2HIX A;  4A3F G;  4JI0 L;  1HH2 P;  1NE3 A;  3H0G G;  3PF5 A;  3W1B A;  1VQA A;  3CMA A;  1MKH A;  4C2M H;  3PCO B;  4PG3 A;  4R4I A;  3I4N H;  2EQS A;  5M5Y H;  2Y0S E;  1VQ9 A;  3KYH C;  3CCU A;  3WWV A;  1PH6 A;  5C4X H;  3L2P A;  4DUY L;  5LMN Q;  1N36 L;  2UXB Q;  4LF7 L;  4YY3 L;  2YTY A;  5IYB G;  2V1C C;  3B6Y A;  2N49 A;  2VQE L;  3BU2 A;  4DV2 L;  3I7F A;  1QVC A;  1VQG A;  3HKZ E;  5JJK A;  3J7Z C;  3I55 A;  1FGU A;  3OTO Q;  2BH8 A;  1OXX K;  4AH6 A;  4B3M Q;  2DUD A;  4LFB L;  3G6E A;  2VZA A;  3JC6 6;  3KDF B;  3CC7 A;  3CCM A;  4OX9 L;  4R4C A;  3W5O A;  2L15 A;  2YTV A;  2B63 G;  4EX5 A;  4A3M G;  1GD7 A;  2VNU D;  1XMO Q;  4JI5 L;  2D0O A;  1C9O A;  1YNX A;  3CME A;  4LF6 L;  5IYB H;  3S1R H;  1EOV A;  1KIX A;  1FJG Q;  1XMQ Q;  1S3O A;  1X3G A;  1WFQ A;  2NN6 I;  4BA1 I;  1IBM Q;  1IBK L;  4DR7 Q;  1Z9F A;  5C0X I;  4MTN A;  5J3B A;  4A76 A;  3S14 H;  4QY7 A;  1Y1W H;  4DR1 L;  1L1O C;  2IX0 A;  2ZTC A;  4EQ5 A;  4DR5 L;  3D31 A;  1V9P A;  2E2J H;  1EUJ A;  3SGI A;  3E0E A;  2K4K A;  4L5R C;  1SMX A;  4OWT B;  1VQP A;  3ULL A;  3T1Y L;  1MIU A;  4A3M H;  1XNR L;  1OTC A;  2KCT A;  2UU9 L;  5H1S E;  4LF5 Q;  2D62 A;  2K50 A;  1KQS A;  4JBJ A;  2GVB A;  2E5L Q;  2WP8 J;  2FXQ A;  5AJ3 Q;  4A93 H;  1WCM H;  4DAY B;  4POF A;  3NEL A;  4YCV A;  1X9N A;  3RLF A;  3GD7 A;  4IFD G;  4XIG S;  3RN2 A;  3LGJ A;  2WAQ E;  1EQQ A;  4QJF A;  3CXC A;  4LF9 L;  3VDY A;  1Q82 C;  2NVT H;  1K0R A;  4JI8 Q;  3U4Z A;  4GKJ Q;  3IRB A;  2RHQ B;  1L2F A;  4P73 A;  4DUZ L;  2ZJQ A;  1WI5 A;  2RHS B;  2JEA I;  3KF6 B;  1TWH H;  2UXD Q;  1SE8 A;  4BY1 H;  1XNQ L;  4BY7 H;  4DR4 Q;  1X55 A;  4LFA L;  1NY4 A;  2N78 A;  3M9B A;  1LM0 A;  5JJI A;  4YCU A;  4X62 Q;  5LMN L;  1CKN A;  5JEA J;  1PV4 A;  1BBW A;  3FHW A;  3L7Z C;  5M3F H;  4DV5 L;  1HR0 W;  4A3G G;  4PMW A;  4WJ4 A;  1S72 A;  4LFC Q;  3EBE A;  2K14 A;  3TRE A;  2K75 A;  1EYG A;  4B3M L;  1QVG A;  1E1O A;  1FVI A;  3HOX G;  3D0F A;  2NVY H;  2UUA Q;  4OWX B;  5GAG C;  1P16 A;  1SN8 A;  1M1K C;  3E9I A;  1CSP A;  1VQ8 A;  4X64 L;  4DV2 Q;  1PH1 A;  4A3G H;  3GTO H;  1XMQ L;  4DR7 L;  5IYC G;  4C3J H;  3A5U A;  1YI2 A;  4P72 A;  4GKK L;  4XTC S;  1Q12 A;  3U58 A;  4GN5 A;  1UE7 A;  2VY3 A;  3KF8 B;  3HOX H;  2Q2T A;  2ALY B;  1XTD A;  1N8R C;  4L5S A;  2ZJR A;  4GN4 B;  2JA7 G;  3S15 H;  1QUQ A;  4JI5 Q;  2CCZ A;  4LF6 Q;  2AWN A;  2Z0S A;  1CUK A;  2OQ0 A;  3ULP A;  1KL9 A;  3MXN B;  4APV A;  4HJA A;  1IBK Q;  2KEN A;  5IYC H;  2E5L L;  3GDE A;  4DV4 L;  3CCQ A;  1C7Y A;  1VQO A;  5AJ3 L;  4IPG A;  2XGT A;  4DR1 Q;  5C0X G;  1Q1B A;  1YJW A;  1JJC B;  4DR5 Q;  3UDF A;  2HT1 A;  2PI2 A;  3KOJ A;  3K81 C;  1WJJ A;  4TQU S;  1Q7Y C;  3T1Y Q;  3J80 i;  1P8L A;  2ATW A;  1AE3 A;  1K8A C;  3S16 H;  4R4T A;  4JI8 L;  1Y1V G;  3S2D H;  1WYD A;  3GTG H;  1U0L A;  2H5X A;  1YJ9 A;  2BA1 A;  4GNX A;  1KD1 C;  1A0I A;  3KFU A;  1YHB A;  2GN5 A;  1LTL A;  2ZJP A;  3TS2 A;  3PUW A;  1UE5 A;  4HIK A;  4LF9 Q;  2NZH A;  2I0Q A;  4DR4 L;  4A93 G;  3CD6 A;  5C4X G;  3E9H A;  2LXJ A;  2JJQ A;  4X62 L;  3GTJ H;  3BZK A;  1Q8K A;  4GLA C;  4BXX H;  4BBS G;  4LF8 L;  4DUZ Q;  5C44 H;  4LFC L;  4JBW A;  5FLM H;  2CWA A;  3AYH B;  4RMF A;  3HOZ H;  3UDG A;  1SR3 A;  3ZJY C;  5M5X H;  4LW1 A;  1EQR A;  1XNQ Q;  1GM5 A;  1GVP A;  1OXS C;  3RNU A;  3RN5 A;  2UUA L;  1I50 H;  4JBK A;  2VW9 A;  2A1A A;  3HOW H;  4RG1 A;  1KC8 C;  3PSI A;  4FDB A;  3HOV G;  4DV5 Q;  3CW2 C;  2CWP A;  1PH7 A;  4BBS H;  1UE6 A;  1QZG A;  1V1Q A;  2IY5 B;  4PZ8 A;  2EXD A;  3ER0 A;  4A3K G;  1Y1W G;  1R9T H;  3FP9 A;  4WJ3 M;  1H95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...