2BHAA

E. coli aminopeptidase p in complex with substrate
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 155
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bhaA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bhaA02
2BWYA 2Q8KA 2GG9A 2DFIA 3D27A 3IL0A 1B6AA 5E2CA 1YW9A 3I7MA 4IKTA 5FCHA 3S6BA 4MATA 2GG2A 4FUKA 4IKUA 4U75A 4Z7MA 2MATA 2V3XA 3IG4A 4U1BA 3TAVA 1WKMA 4KM3A 1M35A 2ZSGA 2V3ZA 4S01A 5CIKA 2OKNA 4U6WA 1C27A 1XNZA 4U76A 1R5GA 1XGOA 4U70A 5E5BA 1XGSA 1W7VA 1WL6A 4OOKA 1C24A 3CB6A 2Q93A 2BWTA 4S2TP 5CDLA 1KQ0A 2OAZA 3PKCA 2BHAA 3OVKA 4S00A 1W2MA 2BWUA 1B59A 3CB5A 3IU8A 2GU7A 5CNXA 2BWXA 4PNCA 1Y1NA 2GG7A 4JUQA 1BN5A 2P98A 2GGBA 4U6JA 1A16A 3PKBA 4FKCA 4B28A 2BWSA 2IW2A 2NQ7A 3MR1A 5JHUA 4IKRA 4FLKA 5CDEA 3FM3A 4U6EA 3OOOA 4IKSA 1QXWA 4FLJA 1QXYA 4S2RP 3QOCA 1MATA 2Q92A 4IF7A 1YW7A 3PN9A 4RZYA 4ZWUA 3CTZA 5CLSA 1XGNA 2HOWA 3PEBA 4ZWPA 2BWVA 1PV9A 3PKAA 5D6EA 1C23A 2ADUA 4U6CA 3MATA 1R5HA 3PKEA 1JAWA 1C21A 3BIPA 3Q6DA 4RZZA 2G6PA 2GU5A 2BHCA 2Q95A 3MX6A 2Q94A 2EA2A 2V6CA 4IPAA 4U6ZA 2EVOA 3FMRA 5D6FA 1C22A 1BOAA 1QXZA 4IECA 3BIQA 2GG3A 1KQ9A 1YW8A 4ZWOA 1WLRA 2NQ6A 2BHBA 1XGMA 2GA2A 4U71A 3PKDA 3IU9A 4EGEA 2P99A 2BN7A 3L7GA 4R60A 2B3LA 4A6VA 3L24A 3IU7A 4PV4A 2GTXA 1CHMA 4QR8A 2GG8A 2B3HA 5JFRA 3BITA 3RORA 1YJ3A 4A6WA 3RVAA 2GG0A 4IU6A 5CE6A 1QZYA 4RGZ1 4U73A 2Q96A 4FLLA 5FCFA 2BB7A 2EA4A 5CDVA 2EVCA 5JI6A 1WBQA 3TB5A 2B3KA 2BHDA 1KP0A 2BWWA 2V3YA 1WL9A 4FO7A 2BH3A 1YVMA 2GG5A 4FO8A 1O0XA 1WY2A 3FMQA 1R58A 2GGCA 2EVMA 2GU4A 2GU6A 2GZ5A 1WN1A 3O5VA 2P9AA 4ZNGA 1N51A 4IDYA 4U69A 4HXXA 4FLIA
chains in the Genus database with same CATH superfamily
2BWYA 2Q8KA 2GG9A 2DFIA 3D27A 3IL0A 1B6AA 5E2CA 1YW9A 3I7MA 4IKTA 5FCHA 3S6BA 4MATA 2GG2A 4FUKA 4IKUA 4U75A 4Z7MA 2MATA 2V3XA 3IG4A 4U1BA 3TAVA 1WKMA 4KM3A 1M35A 2ZSGA 2V3ZA 4S01A 5CIKA 2OKNA 4U6WA 1C27A 1XNZA 4U76A 1R5GA 1XGOA 4U70A 5E5BA 1XGSA 1W7VA 1WL6A 4OOKA 1C24A 3CB6A 2Q93A 2BWTA 4S2TP 5CDLA 1KQ0A 2OAZA 3PKCA 2BHAA 3OVKA 4S00A 1W2MA 2BWUA 1B59A 3CB5A 3IU8A 2GU7A 5CNXA 2BWXA 4PNCA 1Y1NA 2GG7A 4JUQA 1BN5A 2P98A 2GGBA 4U6JA 1A16A 3PKBA 4FKCA 4B28A 2BWSA 2IW2A 2NQ7A 3MR1A 5JHUA 4IKRA 4FLKA 5CDEA 3FM3A 4U6EA 3OOOA 4IKSA 1QXWA 4FLJA 1QXYA 4S2RP 3QOCA 1MATA 2Q92A 4IF7A 1YW7A 3PN9A 4RZYA 4ZWUA 3CTZA 5CLSA 1XGNA 2HOWA 3PEBA 4ZWPA 2BWVA 1PV9A 3PKAA 5D6EA 1C23A 2ADUA 4U6CA 3MATA 1R5HA 3PKEA 1JAWA 1C21A 3BIPA 3Q6DA 4RZZA 2G6PA 2GU5A 2BHCA 2Q95A 3MX6A 2Q94A 2EA2A 2V6CA 4IPAA 4U6ZA 2EVOA 3FMRA 5D6FA 1C22A 1BOAA 1QXZA 4IECA 3BIQA 2GG3A 1KQ9A 1YW8A 4ZWOA 1WLRA 2NQ6A 2BHBA 1XGMA 2GA2A 4U71A 3PKDA 3IU9A 4EGEA 2P99A 2BN7A 3L7GA 4R60A 2B3LA 4A6VA 3L24A 3IU7A 4PV4A 2GTXA 1CHMA 4QR8A 2GG8A 2B3HA 5JFRA 3BITA 3RORA 1YJ3A 4A6WA 3RVAA 2GG0A 4IU6A 5CE6A 1QZYA 4RGZ1 4U73A 2Q96A 4FLLA 5FCFA 2BB7A 2EA4A 5CDVA 2EVCA 5JI6A 1WBQA 3TB5A 2B3KA 2BHDA 1KP0A 2BWWA 2V3YA 1WL9A 4FO7A 2BH3A 1YVMA 2GG5A 4FO8A 1O0XA 1WY2A 3FMQA 1R58A 2GGCA 2EVMA 2GU4A 2GU6A 2GZ5A 1WN1A 3O5VA 2P9AA 4ZNGA 1N51A 4IDYA 4U69A 4HXXA 4FLIA
chains in the Genus database with same CATH topology
2BWYA 2Q8KA 2GG9A 2DFIA 3D27A 3IL0A 1B6AA 5E2CA 1YW9A 3I7MA 4IKTA 5FCHA 3S6BA 4MATA 2GG2A 4FUKA 4IKUA 4U75A 4Z7MA 2MATA 2V3XA 3IG4A 4U1BA 3TAVA 1WKMA 4KM3A 1M35A 2ZSGA 2V3ZA 4S01A 5CIKA 2OKNA 4U6WA 1C27A 1XNZA 4U76A 1R5GA 1XGOA 4U70A 5E5BA 1XGSA 1W7VA 1WL6A 4OOKA 1C24A 3CB6A 2Q93A 2BWTA 4S2TP 5CDLA 1KQ0A 2OAZA 3PKCA 2BHAA 3OVKA 4S00A 1W2MA 2BWUA 1B59A 3CB5A 3IU8A 2GU7A 5CNXA 2BWXA 4PNCA 1Y1NA 2GG7A 4JUQA 1BN5A 2P98A 2GGBA 4U6JA 1A16A 3PKBA 4FKCA 4B28A 2BWSA 2IW2A 2NQ7A 3MR1A 5JHUA 4IKRA 4FLKA 5CDEA 3FM3A 4U6EA 3OOOA 4IKSA 1QXWA 4FLJA 1QXYA 4S2RP 3QOCA 1MATA 2Q92A 4IF7A 1YW7A 3PN9A 4RZYA 4ZWUA 3CTZA 5CLSA 1XGNA 2HOWA 3PEBA 4ZWPA 2BWVA 1PV9A 3PKAA 5D6EA 1C23A 2ADUA 4U6CA 3MATA 1R5HA 3PKEA 1JAWA 1C21A 3BIPA 3Q6DA 4RZZA 2G6PA 2GU5A 2BHCA 2Q95A 3MX6A 2Q94A 2EA2A 2V6CA 4IPAA 4U6ZA 2EVOA 3FMRA 5D6FA 1C22A 1BOAA 1QXZA 4IECA 3BIQA 2GG3A 1KQ9A 1YW8A 4ZWOA 1WLRA 2NQ6A 2BHBA 1XGMA 2GA2A 4U71A 3PKDA 3IU9A 4EGEA 2P99A 2BN7A 3L7GA 4R60A 2B3LA 4A6VA 3L24A 3IU7A 4PV4A 2GTXA 1CHMA 4QR8A 2GG8A 2B3HA 5JFRA 3BITA 3RORA 1YJ3A 4A6WA 3RVAA 2GG0A 4IU6A 5CE6A 1QZYA 4RGZ1 4U73A 2Q96A 4FLLA 5FCFA 2BB7A 2EA4A 5CDVA 2EVCA 5JI6A 1WBQA 3TB5A 2B3KA 2BHDA 1KP0A 2BWWA 2V3YA 1WL9A 4FO7A 2BH3A 1YVMA 2GG5A 4FO8A 1O0XA 1WY2A 3FMQA 1R58A 2GGCA 2EVMA 2GU4A 2GU6A 2GZ5A 1WN1A 3O5VA 2P9AA 4ZNGA 1N51A 4IDYA 4U69A 4HXXA 4FLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWY A;  2Q8K A;  2GG9 A;  2DFI A;  3D27 A;  3IL0 A;  1B6A A;  5E2C A;  1YW9 A;  3I7M A;  4IKT A;  5FCH A;  3S6B A;  4MAT A;  2GG2 A;  4FUK A;  4IKU A;  4U75 A;  4Z7M A;  2MAT A;  2V3X A;  3IG4 A;  4U1B A;  3TAV A;  1WKM A;  4KM3 A;  1M35 A;  2ZSG A;  2V3Z A;  4S01 A;  5CIK A;  2OKN A;  4U6W A;  1C27 A;  1XNZ A;  4U76 A;  1R5G A;  1XGO A;  4U70 A;  5E5B A;  1XGS A;  1W7V A;  1WL6 A;  4OOK A;  1C24 A;  3CB6 A;  2Q93 A;  2BWT A;  4S2T P;  5CDL A;  1KQ0 A;  2OAZ A;  3PKC A;  2BHA A;  3OVK A;  4S00 A;  1W2M A;  2BWU A;  1B59 A;  3CB5 A;  3IU8 A;  2GU7 A;  5CNX A;  2BWX A;  4PNC A;  1Y1N A;  2GG7 A;  4JUQ A;  1BN5 A;  2P98 A;  2GGB A;  4U6J A;  1A16 A;  3PKB A;  4FKC A;  4B28 A;  2BWS A;  2IW2 A;  2NQ7 A;  3MR1 A;  5JHU A;  4IKR A;  4FLK A;  5CDE A;  3FM3 A;  4U6E A;  3OOO A;  4IKS A;  1QXW A;  4FLJ A;  1QXY A;  4S2R P;  3QOC A;  1MAT A;  2Q92 A;  4IF7 A;  1YW7 A;  3PN9 A;  4RZY A;  4ZWU A;  3CTZ A;  5CLS A;  1XGN A;  2HOW A;  3PEB A;  4ZWP A;  2BWV A;  1PV9 A;  3PKA A;  5D6E A;  1C23 A;  2ADU A;  4U6C A;  3MAT A;  1R5H A;  3PKE A;  1JAW A;  1C21 A;  3BIP A;  3Q6D A;  4RZZ A;  2G6P A;  2GU5 A;  2BHC A;  2Q95 A;  3MX6 A;  2Q94 A;  2EA2 A;  2V6C A;  4IPA A;  4U6Z A;  2EVO A;  3FMR A;  5D6F A;  1C22 A;  1BOA A;  1QXZ A;  4IEC A;  3BIQ A;  2GG3 A;  1KQ9 A;  1YW8 A;  4ZWO A;  1WLR A;  2NQ6 A;  2BHB A;  1XGM A;  2GA2 A;  4U71 A;  3PKD A;  3IU9 A;  4EGE A;  2P99 A;  2BN7 A;  3L7G A;  4R60 A;  2B3L A;  4A6V A;  3L24 A;  3IU7 A;  4PV4 A;  2GTX A;  1CHM A;  4QR8 A;  2GG8 A;  2B3H A;  5JFR A;  3BIT A;  3ROR A;  1YJ3 A;  4A6W A;  3RVA A;  2GG0 A;  4IU6 A;  5CE6 A;  1QZY A;  4RGZ 1;  4U73 A;  2Q96 A;  4FLL A;  5FCF A;  2BB7 A;  2EA4 A;  5CDV A;  2EVC A;  5JI6 A;  1WBQ A;  3TB5 A;  2B3K A;  2BHD A;  1KP0 A;  2BWW A;  2V3Y A;  1WL9 A;  4FO7 A;  2BH3 A;  1YVM A;  2GG5 A;  4FO8 A;  1O0X A;  1WY2 A;  3FMQ A;  1R58 A;  2GGC A;  2EVM A;  2GU4 A;  2GU6 A;  2GZ5 A;  1WN1 A;  3O5V A;  2P9A A;  4ZNG A;  1N51 A;  4IDY A;  4U69 A;  4HXX A;  4FLI A; 
#chains in the Genus database with same CATH topology
 2BWY A;  2Q8K A;  2GG9 A;  2DFI A;  3D27 A;  3IL0 A;  1B6A A;  5E2C A;  1YW9 A;  3I7M A;  4IKT A;  5FCH A;  3S6B A;  4MAT A;  2GG2 A;  4FUK A;  4IKU A;  4U75 A;  4Z7M A;  2MAT A;  2V3X A;  3IG4 A;  4U1B A;  3TAV A;  1WKM A;  4KM3 A;  1M35 A;  2ZSG A;  2V3Z A;  4S01 A;  5CIK A;  2OKN A;  4U6W A;  1C27 A;  1XNZ A;  4U76 A;  1R5G A;  1XGO A;  4U70 A;  5E5B A;  1XGS A;  1W7V A;  1WL6 A;  4OOK A;  1C24 A;  3CB6 A;  2Q93 A;  2BWT A;  4S2T P;  5CDL A;  1KQ0 A;  2OAZ A;  3PKC A;  2BHA A;  3OVK A;  4S00 A;  1W2M A;  2BWU A;  1B59 A;  3CB5 A;  3IU8 A;  2GU7 A;  5CNX A;  2BWX A;  4PNC A;  1Y1N A;  2GG7 A;  4JUQ A;  1BN5 A;  2P98 A;  2GGB A;  4U6J A;  1A16 A;  3PKB A;  4FKC A;  4B28 A;  2BWS A;  2IW2 A;  2NQ7 A;  3MR1 A;  5JHU A;  4IKR A;  4FLK A;  5CDE A;  3FM3 A;  4U6E A;  3OOO A;  4IKS A;  1QXW A;  4FLJ A;  1QXY A;  4S2R P;  3QOC A;  1MAT A;  2Q92 A;  4IF7 A;  1YW7 A;  3PN9 A;  4RZY A;  4ZWU A;  3CTZ A;  5CLS A;  1XGN A;  2HOW A;  3PEB A;  4ZWP A;  2BWV A;  1PV9 A;  3PKA A;  5D6E A;  1C23 A;  2ADU A;  4U6C A;  3MAT A;  1R5H A;  3PKE A;  1JAW A;  1C21 A;  3BIP A;  3Q6D A;  4RZZ A;  2G6P A;  2GU5 A;  2BHC A;  2Q95 A;  3MX6 A;  2Q94 A;  2EA2 A;  2V6C A;  4IPA A;  4U6Z A;  2EVO A;  3FMR A;  5D6F A;  1C22 A;  1BOA A;  1QXZ A;  4IEC A;  3BIQ A;  2GG3 A;  1KQ9 A;  1YW8 A;  4ZWO A;  1WLR A;  2NQ6 A;  2BHB A;  1XGM A;  2GA2 A;  4U71 A;  3PKD A;  3IU9 A;  4EGE A;  2P99 A;  2BN7 A;  3L7G A;  4R60 A;  2B3L A;  4A6V A;  3L24 A;  3IU7 A;  4PV4 A;  2GTX A;  1CHM A;  4QR8 A;  2GG8 A;  2B3H A;  5JFR A;  3BIT A;  3ROR A;  1YJ3 A;  4A6W A;  3RVA A;  2GG0 A;  4IU6 A;  5CE6 A;  1QZY A;  4RGZ 1;  4U73 A;  2Q96 A;  4FLL A;  5FCF A;  2BB7 A;  2EA4 A;  5CDV A;  2EVC A;  5JI6 A;  1WBQ A;  3TB5 A;  2B3K A;  2BHD A;  1KP0 A;  2BWW A;  2V3Y A;  1WL9 A;  4FO7 A;  2BH3 A;  1YVM A;  2GG5 A;  4FO8 A;  1O0X A;  1WY2 A;  3FMQ A;  1R58 A;  2GGC A;  2EVM A;  2GU4 A;  2GU6 A;  2GZ5 A;  1WN1 A;  3O5V A;  2P9A A;  4ZNG A;  1N51 A;  4IDY A;  4U69 A;  4HXX A;  4FLI A; 
#chains in the Genus database with same CATH homology
 2BWY A;  2Q8K A;  2GG9 A;  2DFI A;  3D27 A;  3IL0 A;  1B6A A;  5E2C A;  1YW9 A;  3I7M A;  4IKT A;  5FCH A;  3S6B A;  4MAT A;  2GG2 A;  4FUK A;  4IKU A;  4U75 A;  4Z7M A;  2MAT A;  2V3X A;  3IG4 A;  4U1B A;  3TAV A;  1WKM A;  4KM3 A;  1M35 A;  2ZSG A;  2V3Z A;  4S01 A;  5CIK A;  2OKN A;  4U6W A;  1C27 A;  1XNZ A;  4U76 A;  1R5G A;  1XGO A;  4U70 A;  5E5B A;  1XGS A;  1W7V A;  1WL6 A;  4OOK A;  1C24 A;  3CB6 A;  2Q93 A;  2BWT A;  4S2T P;  5CDL A;  1KQ0 A;  2OAZ A;  3PKC A;  2BHA A;  3OVK A;  4S00 A;  1W2M A;  2BWU A;  1B59 A;  3CB5 A;  3IU8 A;  2GU7 A;  5CNX A;  2BWX A;  4PNC A;  1Y1N A;  2GG7 A;  4JUQ A;  1BN5 A;  2P98 A;  2GGB A;  4U6J A;  1A16 A;  3PKB A;  4FKC A;  4B28 A;  2BWS A;  2IW2 A;  2NQ7 A;  3MR1 A;  5JHU A;  4IKR A;  4FLK A;  5CDE A;  3FM3 A;  4U6E A;  3OOO A;  4IKS A;  1QXW A;  4FLJ A;  1QXY A;  4S2R P;  3QOC A;  1MAT A;  2Q92 A;  4IF7 A;  1YW7 A;  3PN9 A;  4RZY A;  4ZWU A;  3CTZ A;  5CLS A;  1XGN A;  2HOW A;  3PEB A;  4ZWP A;  2BWV A;  1PV9 A;  3PKA A;  5D6E A;  1C23 A;  2ADU A;  4U6C A;  3MAT A;  1R5H A;  3PKE A;  1JAW A;  1C21 A;  3BIP A;  3Q6D A;  4RZZ A;  2G6P A;  2GU5 A;  2BHC A;  2Q95 A;  3MX6 A;  2Q94 A;  2EA2 A;  2V6C A;  4IPA A;  4U6Z A;  2EVO A;  3FMR A;  5D6F A;  1C22 A;  1BOA A;  1QXZ A;  4IEC A;  3BIQ A;  2GG3 A;  1KQ9 A;  1YW8 A;  4ZWO A;  1WLR A;  2NQ6 A;  2BHB A;  1XGM A;  2GA2 A;  4U71 A;  3PKD A;  3IU9 A;  4EGE A;  2P99 A;  2BN7 A;  3L7G A;  4R60 A;  2B3L A;  4A6V A;  3L24 A;  3IU7 A;  4PV4 A;  2GTX A;  1CHM A;  4QR8 A;  2GG8 A;  2B3H A;  5JFR A;  3BIT A;  3ROR A;  1YJ3 A;  4A6W A;  3RVA A;  2GG0 A;  4IU6 A;  5CE6 A;  1QZY A;  4RGZ 1;  4U73 A;  2Q96 A;  4FLL A;  5FCF A;  2BB7 A;  2EA4 A;  5CDV A;  2EVC A;  5JI6 A;  1WBQ A;  3TB5 A;  2B3K A;  2BHD A;  1KP0 A;  2BWW A;  2V3Y A;  1WL9 A;  4FO7 A;  2BH3 A;  1YVM A;  2GG5 A;  4FO8 A;  1O0X A;  1WY2 A;  3FMQ A;  1R58 A;  2GGC A;  2EVM A;  2GU4 A;  2GU6 A;  2GZ5 A;  1WN1 A;  3O5V A;  2P9A A;  4ZNG A;  1N51 A;  4IDY A;  4U69 A;  4HXX A;  4FLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...