2BHAA

E. coli aminopeptidase p in complex with substrate
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 155
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bhaA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bhaA02
2GTXA 1YW8A 1YW9A 5CNXA 2BHBA 1KQ9A 4S00A 3RVAA 5CDVA 1QZYA 2Q96A 2GG3A 3CB5A 3CB6A 1JAWA 3FM3A 3IU7A 1W2MA 4U6WA 5JFRA 2OKNA 3D27A 5CE6A 3MATA 2GGBA 4FO7A 5CIKA 5E5BA 4IKTA 1XNZA 4OOKA 4U6CA 2B3LA 2Q8KA 2EA4A 5JHUA 2MATA 4U6JA 4Z7MA 2BWVA 4U73A 2GG7A 3PKBA 3PKEA 1WN1A 1PV9A 4B28A 4FUKA 1WY2A 4FLIA 4IDYA 3IL0A 1WLRA 2ZSGA 4S2RP 3BITA 2GG8A 5D6EA 4IU6A 4FO8A 1CHMA 1WBQA 4FKCA 1KQ0A 1B6AA 3IU9A 4IKUA 1R58A 2Q95A 2GG2A 1MATA 2BWUA 1C21A 3PKAA 4PV4A 4KM3A 1M35A 2G6PA 5FCHA 1YJ3A 1XGOA 2Q92A 2V3ZA 4U1BA 2GG5A 2GGCA 2GU7A 5D6FA 3FMRA 2BH3A 5FCFA 3Q6DA 2BWYA 4ZWUA 2GZ5A 1W7VA 5CDLA 3OVKA 2V6CA 3I7MA 4U6ZA 1KP0A 3QOCA 4MATA 1BN5A 2V3XA 4ZNGA 1O0XA 4U71A 3PN9A 2BWTA 1QXZA 3IU8A 4EGEA 4HXXA 3PKDA 1Y1NA 1C24A 1XGSA 1C23A 4U75A 3BIQA 2GU5A 5E2CA 1B59A 1YW7A 3MX6A 2P98A 3TB5A 2EVCA 2IW2A 4ZWPA 2Q94A 4FLJA 4IECA 1R5HA 3O5VA 2BWSA 1YVMA 2V3YA 2GA2A 2GU6A 3PEBA 4S01A 4R60A 4S2TP 2BN7A 1XGMA 4ZWOA 4RGZ1 2HOWA 2NQ7A 2DFIA 2OAZA 1R5GA 4JUQA 1WKMA 4U76A 3MR1A 3L24A 4U69A 1WL9A 2EA2A 2GU4A 2P9AA 5CLSA 1BOAA 3IG4A 2B3HA 2Q93A 3PKCA 2BWWA 1A16A 5CDEA 1C22A 4FLLA 3L7GA 3OOOA 1QXYA 2BB7A 1QXWA 4U6EA 2BHAA 1C27A 4RZZA 2BWXA 2BHDA 2GG0A 3CTZA 4RZYA 2BHCA 1WL6A 4IPAA 2B3KA 2NQ6A 4A6VA 2EVOA 4QR8A 3RORA 4IF7A 1N51A 4IKSA 1XGNA 3FMQA 4FLKA 2ADUA 4A6WA 2EVMA 2GG9A 4PNCA 3S6BA 2P99A 3TAVA 5JI6A 4IKRA 3BIPA 4U70A
chains in the Genus database with same CATH superfamily
2GTXA 1YW8A 1YW9A 5CNXA 2BHBA 1KQ9A 4S00A 3RVAA 5CDVA 1QZYA 2Q96A 2GG3A 3CB5A 3CB6A 1JAWA 3FM3A 3IU7A 1W2MA 4U6WA 5JFRA 2OKNA 3D27A 5CE6A 3MATA 2GGBA 4FO7A 5CIKA 5E5BA 4IKTA 1XNZA 4OOKA 4U6CA 2B3LA 2Q8KA 2EA4A 5JHUA 2MATA 4U6JA 4Z7MA 2BWVA 4U73A 2GG7A 3PKBA 3PKEA 1WN1A 1PV9A 4B28A 4FUKA 1WY2A 4FLIA 4IDYA 3IL0A 1WLRA 2ZSGA 4S2RP 3BITA 2GG8A 5D6EA 4IU6A 4FO8A 1CHMA 1WBQA 4FKCA 1KQ0A 1B6AA 3IU9A 4IKUA 1R58A 2Q95A 2GG2A 1MATA 2BWUA 1C21A 3PKAA 4PV4A 4KM3A 1M35A 2G6PA 5FCHA 1YJ3A 1XGOA 2Q92A 2V3ZA 4U1BA 2GG5A 2GGCA 2GU7A 5D6FA 3FMRA 2BH3A 5FCFA 3Q6DA 2BWYA 4ZWUA 2GZ5A 1W7VA 5CDLA 3OVKA 2V6CA 3I7MA 4U6ZA 1KP0A 3QOCA 4MATA 1BN5A 2V3XA 4ZNGA 1O0XA 4U71A 3PN9A 2BWTA 1QXZA 3IU8A 4EGEA 4HXXA 3PKDA 1Y1NA 1C24A 1XGSA 1C23A 4U75A 3BIQA 2GU5A 5E2CA 1B59A 1YW7A 3MX6A 2P98A 3TB5A 2EVCA 2IW2A 4ZWPA 2Q94A 4FLJA 4IECA 1R5HA 3O5VA 2BWSA 1YVMA 2V3YA 2GA2A 2GU6A 3PEBA 4S01A 4R60A 4S2TP 2BN7A 1XGMA 4ZWOA 4RGZ1 2HOWA 2NQ7A 2DFIA 2OAZA 1R5GA 4JUQA 1WKMA 4U76A 3MR1A 3L24A 4U69A 1WL9A 2EA2A 2GU4A 2P9AA 5CLSA 1BOAA 3IG4A 2B3HA 2Q93A 3PKCA 2BWWA 1A16A 5CDEA 1C22A 4FLLA 3L7GA 3OOOA 1QXYA 2BB7A 1QXWA 4U6EA 2BHAA 1C27A 4RZZA 2BWXA 2BHDA 2GG0A 3CTZA 4RZYA 2BHCA 1WL6A 4IPAA 2B3KA 2NQ6A 4A6VA 2EVOA 4QR8A 3RORA 4IF7A 1N51A 4IKSA 1XGNA 3FMQA 4FLKA 2ADUA 4A6WA 2EVMA 2GG9A 4PNCA 3S6BA 2P99A 3TAVA 5JI6A 4IKRA 3BIPA 4U70A
chains in the Genus database with same CATH topology
2GTXA 1YW8A 1YW9A 5CNXA 2BHBA 1KQ9A 4S00A 3RVAA 5CDVA 1QZYA 2Q96A 2GG3A 3CB5A 3CB6A 1JAWA 3FM3A 3IU7A 1W2MA 4U6WA 5JFRA 2OKNA 3D27A 5CE6A 3MATA 2GGBA 4FO7A 5CIKA 5E5BA 4IKTA 1XNZA 4OOKA 4U6CA 2B3LA 2Q8KA 2EA4A 5JHUA 2MATA 4U6JA 4Z7MA 2BWVA 4U73A 2GG7A 3PKBA 3PKEA 1WN1A 1PV9A 4B28A 4FUKA 1WY2A 4FLIA 4IDYA 3IL0A 1WLRA 2ZSGA 4S2RP 3BITA 2GG8A 5D6EA 4IU6A 4FO8A 1CHMA 1WBQA 4FKCA 1KQ0A 1B6AA 3IU9A 4IKUA 1R58A 2Q95A 2GG2A 1MATA 2BWUA 1C21A 3PKAA 4PV4A 4KM3A 1M35A 2G6PA 5FCHA 1YJ3A 1XGOA 2Q92A 2V3ZA 4U1BA 2GG5A 2GGCA 2GU7A 5D6FA 3FMRA 2BH3A 5FCFA 3Q6DA 2BWYA 4ZWUA 2GZ5A 1W7VA 5CDLA 3OVKA 2V6CA 3I7MA 4U6ZA 1KP0A 3QOCA 4MATA 1BN5A 2V3XA 4ZNGA 1O0XA 4U71A 3PN9A 2BWTA 1QXZA 3IU8A 4EGEA 4HXXA 3PKDA 1Y1NA 1C24A 1XGSA 1C23A 4U75A 3BIQA 2GU5A 5E2CA 1B59A 1YW7A 3MX6A 2P98A 3TB5A 2EVCA 2IW2A 4ZWPA 2Q94A 4FLJA 4IECA 1R5HA 3O5VA 2BWSA 1YVMA 2V3YA 2GA2A 2GU6A 3PEBA 4S01A 4R60A 4S2TP 2BN7A 1XGMA 4ZWOA 4RGZ1 2HOWA 2NQ7A 2DFIA 2OAZA 1R5GA 4JUQA 1WKMA 4U76A 3MR1A 3L24A 4U69A 1WL9A 2EA2A 2GU4A 2P9AA 5CLSA 1BOAA 3IG4A 2B3HA 2Q93A 3PKCA 2BWWA 1A16A 5CDEA 1C22A 4FLLA 3L7GA 3OOOA 1QXYA 2BB7A 1QXWA 4U6EA 2BHAA 1C27A 4RZZA 2BWXA 2BHDA 2GG0A 3CTZA 4RZYA 2BHCA 1WL6A 4IPAA 2B3KA 2NQ6A 4A6VA 2EVOA 4QR8A 3RORA 4IF7A 1N51A 4IKSA 1XGNA 3FMQA 4FLKA 2ADUA 4A6WA 2EVMA 2GG9A 4PNCA 3S6BA 2P99A 3TAVA 5JI6A 4IKRA 3BIPA 4U70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTX A;  1YW8 A;  1YW9 A;  5CNX A;  2BHB A;  1KQ9 A;  4S00 A;  3RVA A;  5CDV A;  1QZY A;  2Q96 A;  2GG3 A;  3CB5 A;  3CB6 A;  1JAW A;  3FM3 A;  3IU7 A;  1W2M A;  4U6W A;  5JFR A;  2OKN A;  3D27 A;  5CE6 A;  3MAT A;  2GGB A;  4FO7 A;  5CIK A;  5E5B A;  4IKT A;  1XNZ A;  4OOK A;  4U6C A;  2B3L A;  2Q8K A;  2EA4 A;  5JHU A;  2MAT A;  4U6J A;  4Z7M A;  2BWV A;  4U73 A;  2GG7 A;  3PKB A;  3PKE A;  1WN1 A;  1PV9 A;  4B28 A;  4FUK A;  1WY2 A;  4FLI A;  4IDY A;  3IL0 A;  1WLR A;  2ZSG A;  4S2R P;  3BIT A;  2GG8 A;  5D6E A;  4IU6 A;  4FO8 A;  1CHM A;  1WBQ A;  4FKC A;  1KQ0 A;  1B6A A;  3IU9 A;  4IKU A;  1R58 A;  2Q95 A;  2GG2 A;  1MAT A;  2BWU A;  1C21 A;  3PKA A;  4PV4 A;  4KM3 A;  1M35 A;  2G6P A;  5FCH A;  1YJ3 A;  1XGO A;  2Q92 A;  2V3Z A;  4U1B A;  2GG5 A;  2GGC A;  2GU7 A;  5D6F A;  3FMR A;  2BH3 A;  5FCF A;  3Q6D A;  2BWY A;  4ZWU A;  2GZ5 A;  1W7V A;  5CDL A;  3OVK A;  2V6C A;  3I7M A;  4U6Z A;  1KP0 A;  3QOC A;  4MAT A;  1BN5 A;  2V3X A;  4ZNG A;  1O0X A;  4U71 A;  3PN9 A;  2BWT A;  1QXZ A;  3IU8 A;  4EGE A;  4HXX A;  3PKD A;  1Y1N A;  1C24 A;  1XGS A;  1C23 A;  4U75 A;  3BIQ A;  2GU5 A;  5E2C A;  1B59 A;  1YW7 A;  3MX6 A;  2P98 A;  3TB5 A;  2EVC A;  2IW2 A;  4ZWP A;  2Q94 A;  4FLJ A;  4IEC A;  1R5H A;  3O5V A;  2BWS A;  1YVM A;  2V3Y A;  2GA2 A;  2GU6 A;  3PEB A;  4S01 A;  4R60 A;  4S2T P;  2BN7 A;  1XGM A;  4ZWO A;  4RGZ 1;  2HOW A;  2NQ7 A;  2DFI A;  2OAZ A;  1R5G A;  4JUQ A;  1WKM A;  4U76 A;  3MR1 A;  3L24 A;  4U69 A;  1WL9 A;  2EA2 A;  2GU4 A;  2P9A A;  5CLS A;  1BOA A;  3IG4 A;  2B3H A;  2Q93 A;  3PKC A;  2BWW A;  1A16 A;  5CDE A;  1C22 A;  4FLL A;  3L7G A;  3OOO A;  1QXY A;  2BB7 A;  1QXW A;  4U6E A;  2BHA A;  1C27 A;  4RZZ A;  2BWX A;  2BHD A;  2GG0 A;  3CTZ A;  4RZY A;  2BHC A;  1WL6 A;  4IPA A;  2B3K A;  2NQ6 A;  4A6V A;  2EVO A;  4QR8 A;  3ROR A;  4IF7 A;  1N51 A;  4IKS A;  1XGN A;  3FMQ A;  4FLK A;  2ADU A;  4A6W A;  2EVM A;  2GG9 A;  4PNC A;  3S6B A;  2P99 A;  3TAV A;  5JI6 A;  4IKR A;  3BIP A;  4U70 A; 
#chains in the Genus database with same CATH topology
 2GTX A;  1YW8 A;  1YW9 A;  5CNX A;  2BHB A;  1KQ9 A;  4S00 A;  3RVA A;  5CDV A;  1QZY A;  2Q96 A;  2GG3 A;  3CB5 A;  3CB6 A;  1JAW A;  3FM3 A;  3IU7 A;  1W2M A;  4U6W A;  5JFR A;  2OKN A;  3D27 A;  5CE6 A;  3MAT A;  2GGB A;  4FO7 A;  5CIK A;  5E5B A;  4IKT A;  1XNZ A;  4OOK A;  4U6C A;  2B3L A;  2Q8K A;  2EA4 A;  5JHU A;  2MAT A;  4U6J A;  4Z7M A;  2BWV A;  4U73 A;  2GG7 A;  3PKB A;  3PKE A;  1WN1 A;  1PV9 A;  4B28 A;  4FUK A;  1WY2 A;  4FLI A;  4IDY A;  3IL0 A;  1WLR A;  2ZSG A;  4S2R P;  3BIT A;  2GG8 A;  5D6E A;  4IU6 A;  4FO8 A;  1CHM A;  1WBQ A;  4FKC A;  1KQ0 A;  1B6A A;  3IU9 A;  4IKU A;  1R58 A;  2Q95 A;  2GG2 A;  1MAT A;  2BWU A;  1C21 A;  3PKA A;  4PV4 A;  4KM3 A;  1M35 A;  2G6P A;  5FCH A;  1YJ3 A;  1XGO A;  2Q92 A;  2V3Z A;  4U1B A;  2GG5 A;  2GGC A;  2GU7 A;  5D6F A;  3FMR A;  2BH3 A;  5FCF A;  3Q6D A;  2BWY A;  4ZWU A;  2GZ5 A;  1W7V A;  5CDL A;  3OVK A;  2V6C A;  3I7M A;  4U6Z A;  1KP0 A;  3QOC A;  4MAT A;  1BN5 A;  2V3X A;  4ZNG A;  1O0X A;  4U71 A;  3PN9 A;  2BWT A;  1QXZ A;  3IU8 A;  4EGE A;  4HXX A;  3PKD A;  1Y1N A;  1C24 A;  1XGS A;  1C23 A;  4U75 A;  3BIQ A;  2GU5 A;  5E2C A;  1B59 A;  1YW7 A;  3MX6 A;  2P98 A;  3TB5 A;  2EVC A;  2IW2 A;  4ZWP A;  2Q94 A;  4FLJ A;  4IEC A;  1R5H A;  3O5V A;  2BWS A;  1YVM A;  2V3Y A;  2GA2 A;  2GU6 A;  3PEB A;  4S01 A;  4R60 A;  4S2T P;  2BN7 A;  1XGM A;  4ZWO A;  4RGZ 1;  2HOW A;  2NQ7 A;  2DFI A;  2OAZ A;  1R5G A;  4JUQ A;  1WKM A;  4U76 A;  3MR1 A;  3L24 A;  4U69 A;  1WL9 A;  2EA2 A;  2GU4 A;  2P9A A;  5CLS A;  1BOA A;  3IG4 A;  2B3H A;  2Q93 A;  3PKC A;  2BWW A;  1A16 A;  5CDE A;  1C22 A;  4FLL A;  3L7G A;  3OOO A;  1QXY A;  2BB7 A;  1QXW A;  4U6E A;  2BHA A;  1C27 A;  4RZZ A;  2BWX A;  2BHD A;  2GG0 A;  3CTZ A;  4RZY A;  2BHC A;  1WL6 A;  4IPA A;  2B3K A;  2NQ6 A;  4A6V A;  2EVO A;  4QR8 A;  3ROR A;  4IF7 A;  1N51 A;  4IKS A;  1XGN A;  3FMQ A;  4FLK A;  2ADU A;  4A6W A;  2EVM A;  2GG9 A;  4PNC A;  3S6B A;  2P99 A;  3TAV A;  5JI6 A;  4IKR A;  3BIP A;  4U70 A; 
#chains in the Genus database with same CATH homology
 2GTX A;  1YW8 A;  1YW9 A;  5CNX A;  2BHB A;  1KQ9 A;  4S00 A;  3RVA A;  5CDV A;  1QZY A;  2Q96 A;  2GG3 A;  3CB5 A;  3CB6 A;  1JAW A;  3FM3 A;  3IU7 A;  1W2M A;  4U6W A;  5JFR A;  2OKN A;  3D27 A;  5CE6 A;  3MAT A;  2GGB A;  4FO7 A;  5CIK A;  5E5B A;  4IKT A;  1XNZ A;  4OOK A;  4U6C A;  2B3L A;  2Q8K A;  2EA4 A;  5JHU A;  2MAT A;  4U6J A;  4Z7M A;  2BWV A;  4U73 A;  2GG7 A;  3PKB A;  3PKE A;  1WN1 A;  1PV9 A;  4B28 A;  4FUK A;  1WY2 A;  4FLI A;  4IDY A;  3IL0 A;  1WLR A;  2ZSG A;  4S2R P;  3BIT A;  2GG8 A;  5D6E A;  4IU6 A;  4FO8 A;  1CHM A;  1WBQ A;  4FKC A;  1KQ0 A;  1B6A A;  3IU9 A;  4IKU A;  1R58 A;  2Q95 A;  2GG2 A;  1MAT A;  2BWU A;  1C21 A;  3PKA A;  4PV4 A;  4KM3 A;  1M35 A;  2G6P A;  5FCH A;  1YJ3 A;  1XGO A;  2Q92 A;  2V3Z A;  4U1B A;  2GG5 A;  2GGC A;  2GU7 A;  5D6F A;  3FMR A;  2BH3 A;  5FCF A;  3Q6D A;  2BWY A;  4ZWU A;  2GZ5 A;  1W7V A;  5CDL A;  3OVK A;  2V6C A;  3I7M A;  4U6Z A;  1KP0 A;  3QOC A;  4MAT A;  1BN5 A;  2V3X A;  4ZNG A;  1O0X A;  4U71 A;  3PN9 A;  2BWT A;  1QXZ A;  3IU8 A;  4EGE A;  4HXX A;  3PKD A;  1Y1N A;  1C24 A;  1XGS A;  1C23 A;  4U75 A;  3BIQ A;  2GU5 A;  5E2C A;  1B59 A;  1YW7 A;  3MX6 A;  2P98 A;  3TB5 A;  2EVC A;  2IW2 A;  4ZWP A;  2Q94 A;  4FLJ A;  4IEC A;  1R5H A;  3O5V A;  2BWS A;  1YVM A;  2V3Y A;  2GA2 A;  2GU6 A;  3PEB A;  4S01 A;  4R60 A;  4S2T P;  2BN7 A;  1XGM A;  4ZWO A;  4RGZ 1;  2HOW A;  2NQ7 A;  2DFI A;  2OAZ A;  1R5G A;  4JUQ A;  1WKM A;  4U76 A;  3MR1 A;  3L24 A;  4U69 A;  1WL9 A;  2EA2 A;  2GU4 A;  2P9A A;  5CLS A;  1BOA A;  3IG4 A;  2B3H A;  2Q93 A;  3PKC A;  2BWW A;  1A16 A;  5CDE A;  1C22 A;  4FLL A;  3L7G A;  3OOO A;  1QXY A;  2BB7 A;  1QXW A;  4U6E A;  2BHA A;  1C27 A;  4RZZ A;  2BWX A;  2BHD A;  2GG0 A;  3CTZ A;  4RZY A;  2BHC A;  1WL6 A;  4IPA A;  2B3K A;  2NQ6 A;  4A6V A;  2EVO A;  4QR8 A;  3ROR A;  4IF7 A;  1N51 A;  4IKS A;  1XGN A;  3FMQ A;  4FLK A;  2ADU A;  4A6W A;  2EVM A;  2GG9 A;  4PNC A;  3S6B A;  2P99 A;  3TAV A;  5JI6 A;  4IKR A;  3BIP A;  4U70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...