2BHAA

E. coli aminopeptidase p in complex with substrate
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 155
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bhaA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bhaA02
3FMQA 4RZZA 1YW9A 2GG3A 2GGBA 2Q8KA 2EA2A 1KQ9A 5E2CA 2GU7A 4EGEA 4S2TP 5FCHA 2EA4A 1R5GA 2B3HA 2Q95A 4IPAA 1XNZA 4B28A 1C23A 1Y1NA 4FLKA 4FO8A 2BHCA 1O0XA 2BHDA 3PKAA 4IKTA 2BHBA 2GZ5A 2BWYA 1YW7A 3PN9A 1M35A 4Z7MA 5CDEA 3L7GA 1C22A 4U71A 2GG0A 4RGZ1 1BN5A 4IF7A 4IKUA 2B3KA 1N51A 3TAVA 4S2RP 3PKCA 1QXZA 1BOAA 4IU6A 2NQ6A 1QXYA 3S6BA 4FLLA 2BWVA 3IL0A 5E5BA 3O5VA 3IU9A 2GG2A 1R58A 4RZYA 2B3LA 4ZWUA 2GU4A 4HXXA 3CB5A 2P9AA 1KQ0A 3TB5A 2GA2A 4MATA 4U76A 4U75A 5JI6A 4U6JA 4U1BA 2V3YA 1YJ3A 4A6VA 4U69A 4QR8A 2HOWA 2GU5A 1W2MA 1C24A 2NQ7A 2V3ZA 1PV9A 1JAWA 3BIPA 1WLRA 2V3XA 1CHMA 3BIQA 2OAZA 2GU6A 2V6CA 4A6WA 2ZSGA 1QXWA 3PKEA 4R60A 2BHAA 1XGNA 1W7VA 1XGSA 3MX6A 3L24A 2BWWA 4U73A 4FLIA 4U6ZA 1YW8A 2P99A 2GG7A 5CDLA 2EVMA 2BWSA 5FCFA 2Q92A 4JUQA 2EVCA 1WN1A 2BWTA 4IECA 3RVAA 4FUKA 4PNCA 3FMRA 3PKDA 3FM3A 4U70A 5CDVA 2GGCA 2Q96A 2BH3A 3PEBA 4ZWOA 1MATA 2P98A 5D6EA 1WL6A 1C27A 2GTXA 2BWUA 4S00A 4IKRA 3BITA 4S01A 2GG8A 4ZNGA 4FLJA 2GG5A 3PKBA 3QOCA 2OKNA 3OVKA 1R5HA 2EVOA 2G6PA 5JFRA 1WL9A 3MR1A 3Q6DA 1C21A 4U6CA 2BN7A 2ADUA 2Q93A 5CLSA 5JHUA 4KM3A 2Q94A 4PV4A 3D27A 2BB7A 3IG4A 3IU8A 3CTZA 5CNXA 1WBQA 2MATA 1QZYA 3RORA 4U6EA 5CIKA 2GG9A 1A16A 1WKMA 2IW2A 2BWXA 3IU7A 4IKSA 4OOKA 4U6WA 1XGMA 1YVMA 3MATA 4IDYA 5D6FA 3CB6A 3I7MA 2DFIA 1KP0A 1XGOA 4ZWPA 5CE6A 1WY2A 1B59A 3OOOA 4FKCA 4FO7A 1B6AA
chains in the Genus database with same CATH superfamily
3FMQA 4RZZA 1YW9A 2GG3A 2GGBA 2Q8KA 2EA2A 1KQ9A 5E2CA 2GU7A 4EGEA 4S2TP 5FCHA 2EA4A 1R5GA 2B3HA 2Q95A 4IPAA 1XNZA 4B28A 1C23A 1Y1NA 4FLKA 4FO8A 2BHCA 1O0XA 2BHDA 3PKAA 4IKTA 2BHBA 2GZ5A 2BWYA 1YW7A 3PN9A 1M35A 4Z7MA 5CDEA 3L7GA 1C22A 4U71A 2GG0A 4RGZ1 1BN5A 4IF7A 4IKUA 2B3KA 1N51A 3TAVA 4S2RP 3PKCA 1QXZA 1BOAA 4IU6A 2NQ6A 1QXYA 3S6BA 4FLLA 2BWVA 3IL0A 5E5BA 3O5VA 3IU9A 2GG2A 1R58A 4RZYA 2B3LA 4ZWUA 2GU4A 4HXXA 3CB5A 2P9AA 1KQ0A 3TB5A 2GA2A 4MATA 4U76A 4U75A 5JI6A 4U6JA 4U1BA 2V3YA 1YJ3A 4A6VA 4U69A 4QR8A 2HOWA 2GU5A 1W2MA 1C24A 2NQ7A 2V3ZA 1PV9A 1JAWA 3BIPA 1WLRA 2V3XA 1CHMA 3BIQA 2OAZA 2GU6A 2V6CA 4A6WA 2ZSGA 1QXWA 3PKEA 4R60A 2BHAA 1XGNA 1W7VA 1XGSA 3MX6A 3L24A 2BWWA 4U73A 4FLIA 4U6ZA 1YW8A 2P99A 2GG7A 5CDLA 2EVMA 2BWSA 5FCFA 2Q92A 4JUQA 2EVCA 1WN1A 2BWTA 4IECA 3RVAA 4FUKA 4PNCA 3FMRA 3PKDA 3FM3A 4U70A 5CDVA 2GGCA 2Q96A 2BH3A 3PEBA 4ZWOA 1MATA 2P98A 5D6EA 1WL6A 1C27A 2GTXA 2BWUA 4S00A 4IKRA 3BITA 4S01A 2GG8A 4ZNGA 4FLJA 2GG5A 3PKBA 3QOCA 2OKNA 3OVKA 1R5HA 2EVOA 2G6PA 5JFRA 1WL9A 3MR1A 3Q6DA 1C21A 4U6CA 2BN7A 2ADUA 2Q93A 5CLSA 5JHUA 4KM3A 2Q94A 4PV4A 3D27A 2BB7A 3IG4A 3IU8A 3CTZA 5CNXA 1WBQA 2MATA 1QZYA 3RORA 4U6EA 5CIKA 2GG9A 1A16A 1WKMA 2IW2A 2BWXA 3IU7A 4IKSA 4OOKA 4U6WA 1XGMA 1YVMA 3MATA 4IDYA 5D6FA 3CB6A 3I7MA 2DFIA 1KP0A 1XGOA 4ZWPA 5CE6A 1WY2A 1B59A 3OOOA 4FKCA 4FO7A 1B6AA
chains in the Genus database with same CATH topology
3FMQA 4RZZA 1YW9A 2GG3A 2GGBA 2Q8KA 2EA2A 1KQ9A 5E2CA 2GU7A 4EGEA 4S2TP 5FCHA 2EA4A 1R5GA 2B3HA 2Q95A 4IPAA 1XNZA 4B28A 1C23A 1Y1NA 4FLKA 4FO8A 2BHCA 1O0XA 2BHDA 3PKAA 4IKTA 2BHBA 2GZ5A 2BWYA 1YW7A 3PN9A 1M35A 4Z7MA 5CDEA 3L7GA 1C22A 4U71A 2GG0A 4RGZ1 1BN5A 4IF7A 4IKUA 2B3KA 1N51A 3TAVA 4S2RP 3PKCA 1QXZA 1BOAA 4IU6A 2NQ6A 1QXYA 3S6BA 4FLLA 2BWVA 3IL0A 5E5BA 3O5VA 3IU9A 2GG2A 1R58A 4RZYA 2B3LA 4ZWUA 2GU4A 4HXXA 3CB5A 2P9AA 1KQ0A 3TB5A 2GA2A 4MATA 4U76A 4U75A 5JI6A 4U6JA 4U1BA 2V3YA 1YJ3A 4A6VA 4U69A 4QR8A 2HOWA 2GU5A 1W2MA 1C24A 2NQ7A 2V3ZA 1PV9A 1JAWA 3BIPA 1WLRA 2V3XA 1CHMA 3BIQA 2OAZA 2GU6A 2V6CA 4A6WA 2ZSGA 1QXWA 3PKEA 4R60A 2BHAA 1XGNA 1W7VA 1XGSA 3MX6A 3L24A 2BWWA 4U73A 4FLIA 4U6ZA 1YW8A 2P99A 2GG7A 5CDLA 2EVMA 2BWSA 5FCFA 2Q92A 4JUQA 2EVCA 1WN1A 2BWTA 4IECA 3RVAA 4FUKA 4PNCA 3FMRA 3PKDA 3FM3A 4U70A 5CDVA 2GGCA 2Q96A 2BH3A 3PEBA 4ZWOA 1MATA 2P98A 5D6EA 1WL6A 1C27A 2GTXA 2BWUA 4S00A 4IKRA 3BITA 4S01A 2GG8A 4ZNGA 4FLJA 2GG5A 3PKBA 3QOCA 2OKNA 3OVKA 1R5HA 2EVOA 2G6PA 5JFRA 1WL9A 3MR1A 3Q6DA 1C21A 4U6CA 2BN7A 2ADUA 2Q93A 5CLSA 5JHUA 4KM3A 2Q94A 4PV4A 3D27A 2BB7A 3IG4A 3IU8A 3CTZA 5CNXA 1WBQA 2MATA 1QZYA 3RORA 4U6EA 5CIKA 2GG9A 1A16A 1WKMA 2IW2A 2BWXA 3IU7A 4IKSA 4OOKA 4U6WA 1XGMA 1YVMA 3MATA 4IDYA 5D6FA 3CB6A 3I7MA 2DFIA 1KP0A 1XGOA 4ZWPA 5CE6A 1WY2A 1B59A 3OOOA 4FKCA 4FO7A 1B6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMQ A;  4RZZ A;  1YW9 A;  2GG3 A;  2GGB A;  2Q8K A;  2EA2 A;  1KQ9 A;  5E2C A;  2GU7 A;  4EGE A;  4S2T P;  5FCH A;  2EA4 A;  1R5G A;  2B3H A;  2Q95 A;  4IPA A;  1XNZ A;  4B28 A;  1C23 A;  1Y1N A;  4FLK A;  4FO8 A;  2BHC A;  1O0X A;  2BHD A;  3PKA A;  4IKT A;  2BHB A;  2GZ5 A;  2BWY A;  1YW7 A;  3PN9 A;  1M35 A;  4Z7M A;  5CDE A;  3L7G A;  1C22 A;  4U71 A;  2GG0 A;  4RGZ 1;  1BN5 A;  4IF7 A;  4IKU A;  2B3K A;  1N51 A;  3TAV A;  4S2R P;  3PKC A;  1QXZ A;  1BOA A;  4IU6 A;  2NQ6 A;  1QXY A;  3S6B A;  4FLL A;  2BWV A;  3IL0 A;  5E5B A;  3O5V A;  3IU9 A;  2GG2 A;  1R58 A;  4RZY A;  2B3L A;  4ZWU A;  2GU4 A;  4HXX A;  3CB5 A;  2P9A A;  1KQ0 A;  3TB5 A;  2GA2 A;  4MAT A;  4U76 A;  4U75 A;  5JI6 A;  4U6J A;  4U1B A;  2V3Y A;  1YJ3 A;  4A6V A;  4U69 A;  4QR8 A;  2HOW A;  2GU5 A;  1W2M A;  1C24 A;  2NQ7 A;  2V3Z A;  1PV9 A;  1JAW A;  3BIP A;  1WLR A;  2V3X A;  1CHM A;  3BIQ A;  2OAZ A;  2GU6 A;  2V6C A;  4A6W A;  2ZSG A;  1QXW A;  3PKE A;  4R60 A;  2BHA A;  1XGN A;  1W7V A;  1XGS A;  3MX6 A;  3L24 A;  2BWW A;  4U73 A;  4FLI A;  4U6Z A;  1YW8 A;  2P99 A;  2GG7 A;  5CDL A;  2EVM A;  2BWS A;  5FCF A;  2Q92 A;  4JUQ A;  2EVC A;  1WN1 A;  2BWT A;  4IEC A;  3RVA A;  4FUK A;  4PNC A;  3FMR A;  3PKD A;  3FM3 A;  4U70 A;  5CDV A;  2GGC A;  2Q96 A;  2BH3 A;  3PEB A;  4ZWO A;  1MAT A;  2P98 A;  5D6E A;  1WL6 A;  1C27 A;  2GTX A;  2BWU A;  4S00 A;  4IKR A;  3BIT A;  4S01 A;  2GG8 A;  4ZNG A;  4FLJ A;  2GG5 A;  3PKB A;  3QOC A;  2OKN A;  3OVK A;  1R5H A;  2EVO A;  2G6P A;  5JFR A;  1WL9 A;  3MR1 A;  3Q6D A;  1C21 A;  4U6C A;  2BN7 A;  2ADU A;  2Q93 A;  5CLS A;  5JHU A;  4KM3 A;  2Q94 A;  4PV4 A;  3D27 A;  2BB7 A;  3IG4 A;  3IU8 A;  3CTZ A;  5CNX A;  1WBQ A;  2MAT A;  1QZY A;  3ROR A;  4U6E A;  5CIK A;  2GG9 A;  1A16 A;  1WKM A;  2IW2 A;  2BWX A;  3IU7 A;  4IKS A;  4OOK A;  4U6W A;  1XGM A;  1YVM A;  3MAT A;  4IDY A;  5D6F A;  3CB6 A;  3I7M A;  2DFI A;  1KP0 A;  1XGO A;  4ZWP A;  5CE6 A;  1WY2 A;  1B59 A;  3OOO A;  4FKC A;  4FO7 A;  1B6A A; 
#chains in the Genus database with same CATH topology
 3FMQ A;  4RZZ A;  1YW9 A;  2GG3 A;  2GGB A;  2Q8K A;  2EA2 A;  1KQ9 A;  5E2C A;  2GU7 A;  4EGE A;  4S2T P;  5FCH A;  2EA4 A;  1R5G A;  2B3H A;  2Q95 A;  4IPA A;  1XNZ A;  4B28 A;  1C23 A;  1Y1N A;  4FLK A;  4FO8 A;  2BHC A;  1O0X A;  2BHD A;  3PKA A;  4IKT A;  2BHB A;  2GZ5 A;  2BWY A;  1YW7 A;  3PN9 A;  1M35 A;  4Z7M A;  5CDE A;  3L7G A;  1C22 A;  4U71 A;  2GG0 A;  4RGZ 1;  1BN5 A;  4IF7 A;  4IKU A;  2B3K A;  1N51 A;  3TAV A;  4S2R P;  3PKC A;  1QXZ A;  1BOA A;  4IU6 A;  2NQ6 A;  1QXY A;  3S6B A;  4FLL A;  2BWV A;  3IL0 A;  5E5B A;  3O5V A;  3IU9 A;  2GG2 A;  1R58 A;  4RZY A;  2B3L A;  4ZWU A;  2GU4 A;  4HXX A;  3CB5 A;  2P9A A;  1KQ0 A;  3TB5 A;  2GA2 A;  4MAT A;  4U76 A;  4U75 A;  5JI6 A;  4U6J A;  4U1B A;  2V3Y A;  1YJ3 A;  4A6V A;  4U69 A;  4QR8 A;  2HOW A;  2GU5 A;  1W2M A;  1C24 A;  2NQ7 A;  2V3Z A;  1PV9 A;  1JAW A;  3BIP A;  1WLR A;  2V3X A;  1CHM A;  3BIQ A;  2OAZ A;  2GU6 A;  2V6C A;  4A6W A;  2ZSG A;  1QXW A;  3PKE A;  4R60 A;  2BHA A;  1XGN A;  1W7V A;  1XGS A;  3MX6 A;  3L24 A;  2BWW A;  4U73 A;  4FLI A;  4U6Z A;  1YW8 A;  2P99 A;  2GG7 A;  5CDL A;  2EVM A;  2BWS A;  5FCF A;  2Q92 A;  4JUQ A;  2EVC A;  1WN1 A;  2BWT A;  4IEC A;  3RVA A;  4FUK A;  4PNC A;  3FMR A;  3PKD A;  3FM3 A;  4U70 A;  5CDV A;  2GGC A;  2Q96 A;  2BH3 A;  3PEB A;  4ZWO A;  1MAT A;  2P98 A;  5D6E A;  1WL6 A;  1C27 A;  2GTX A;  2BWU A;  4S00 A;  4IKR A;  3BIT A;  4S01 A;  2GG8 A;  4ZNG A;  4FLJ A;  2GG5 A;  3PKB A;  3QOC A;  2OKN A;  3OVK A;  1R5H A;  2EVO A;  2G6P A;  5JFR A;  1WL9 A;  3MR1 A;  3Q6D A;  1C21 A;  4U6C A;  2BN7 A;  2ADU A;  2Q93 A;  5CLS A;  5JHU A;  4KM3 A;  2Q94 A;  4PV4 A;  3D27 A;  2BB7 A;  3IG4 A;  3IU8 A;  3CTZ A;  5CNX A;  1WBQ A;  2MAT A;  1QZY A;  3ROR A;  4U6E A;  5CIK A;  2GG9 A;  1A16 A;  1WKM A;  2IW2 A;  2BWX A;  3IU7 A;  4IKS A;  4OOK A;  4U6W A;  1XGM A;  1YVM A;  3MAT A;  4IDY A;  5D6F A;  3CB6 A;  3I7M A;  2DFI A;  1KP0 A;  1XGO A;  4ZWP A;  5CE6 A;  1WY2 A;  1B59 A;  3OOO A;  4FKC A;  4FO7 A;  1B6A A; 
#chains in the Genus database with same CATH homology
 3FMQ A;  4RZZ A;  1YW9 A;  2GG3 A;  2GGB A;  2Q8K A;  2EA2 A;  1KQ9 A;  5E2C A;  2GU7 A;  4EGE A;  4S2T P;  5FCH A;  2EA4 A;  1R5G A;  2B3H A;  2Q95 A;  4IPA A;  1XNZ A;  4B28 A;  1C23 A;  1Y1N A;  4FLK A;  4FO8 A;  2BHC A;  1O0X A;  2BHD A;  3PKA A;  4IKT A;  2BHB A;  2GZ5 A;  2BWY A;  1YW7 A;  3PN9 A;  1M35 A;  4Z7M A;  5CDE A;  3L7G A;  1C22 A;  4U71 A;  2GG0 A;  4RGZ 1;  1BN5 A;  4IF7 A;  4IKU A;  2B3K A;  1N51 A;  3TAV A;  4S2R P;  3PKC A;  1QXZ A;  1BOA A;  4IU6 A;  2NQ6 A;  1QXY A;  3S6B A;  4FLL A;  2BWV A;  3IL0 A;  5E5B A;  3O5V A;  3IU9 A;  2GG2 A;  1R58 A;  4RZY A;  2B3L A;  4ZWU A;  2GU4 A;  4HXX A;  3CB5 A;  2P9A A;  1KQ0 A;  3TB5 A;  2GA2 A;  4MAT A;  4U76 A;  4U75 A;  5JI6 A;  4U6J A;  4U1B A;  2V3Y A;  1YJ3 A;  4A6V A;  4U69 A;  4QR8 A;  2HOW A;  2GU5 A;  1W2M A;  1C24 A;  2NQ7 A;  2V3Z A;  1PV9 A;  1JAW A;  3BIP A;  1WLR A;  2V3X A;  1CHM A;  3BIQ A;  2OAZ A;  2GU6 A;  2V6C A;  4A6W A;  2ZSG A;  1QXW A;  3PKE A;  4R60 A;  2BHA A;  1XGN A;  1W7V A;  1XGS A;  3MX6 A;  3L24 A;  2BWW A;  4U73 A;  4FLI A;  4U6Z A;  1YW8 A;  2P99 A;  2GG7 A;  5CDL A;  2EVM A;  2BWS A;  5FCF A;  2Q92 A;  4JUQ A;  2EVC A;  1WN1 A;  2BWT A;  4IEC A;  3RVA A;  4FUK A;  4PNC A;  3FMR A;  3PKD A;  3FM3 A;  4U70 A;  5CDV A;  2GGC A;  2Q96 A;  2BH3 A;  3PEB A;  4ZWO A;  1MAT A;  2P98 A;  5D6E A;  1WL6 A;  1C27 A;  2GTX A;  2BWU A;  4S00 A;  4IKR A;  3BIT A;  4S01 A;  2GG8 A;  4ZNG A;  4FLJ A;  2GG5 A;  3PKB A;  3QOC A;  2OKN A;  3OVK A;  1R5H A;  2EVO A;  2G6P A;  5JFR A;  1WL9 A;  3MR1 A;  3Q6D A;  1C21 A;  4U6C A;  2BN7 A;  2ADU A;  2Q93 A;  5CLS A;  5JHU A;  4KM3 A;  2Q94 A;  4PV4 A;  3D27 A;  2BB7 A;  3IG4 A;  3IU8 A;  3CTZ A;  5CNX A;  1WBQ A;  2MAT A;  1QZY A;  3ROR A;  4U6E A;  5CIK A;  2GG9 A;  1A16 A;  1WKM A;  2IW2 A;  2BWX A;  3IU7 A;  4IKS A;  4OOK A;  4U6W A;  1XGM A;  1YVM A;  3MAT A;  4IDY A;  5D6F A;  3CB6 A;  3I7M A;  2DFI A;  1KP0 A;  1XGO A;  4ZWP A;  5CE6 A;  1WY2 A;  1B59 A;  3OOO A;  4FKC A;  4FO7 A;  1B6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...