2BHAA

E. coli aminopeptidase p in complex with substrate
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 155
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bhaA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bhaA02
4U6ZA 4RZYA 3BITA 3IU9A 1WL9A 2V3ZA 4ZWOA 4U6WA 4RZZA 2Q93A 2Q94A 1KQ9A 1YW7A 1BOAA 1KQ0A 4EGEA 3S6BA 4IKSA 1XGOA 2EA4A 1QXWA 1XNZA 2OKNA 5FCHA 1MATA 4IKUA 1R5HA 4S00A 5E2CA 3RVAA 2GG2A 1O0XA 4R60A 1PV9A 5CNXA 2B3KA 1WN1A 2BHCA 2NQ6A 5CLSA 2GA2A 5JFRA 1C27A 3RORA 4FKCA 2BN7A 3PN9A 5CIKA 3OVKA 4U6JA 4S01A 4B28A 2GGBA 4U69A 1WY2A 3BIPA 3CB5A 1A16A 4Z7MA 5E5BA 2ZSGA 4FO7A 3CTZA 3MATA 1B59A 2V3YA 2OAZA 2P9AA 4IDYA 1YJ3A 4IU6A 3IU8A 4PNCA 2Q96A 1XGSA 5D6EA 2HOWA 4U71A 4A6VA 1KP0A 3TB5A 2BWYA 2GG5A 1N51A 1YVMA 3MR1A 3QOCA 2BHAA 1BN5A 2G6PA 3PKDA 4IECA 4S2TP 2BWUA 4ZNGA 2BWSA 3MX6A 4IF7A 2V3XA 5CDVA 1XGMA 2BB7A 2BH3A 4FUKA 4U76A 1C21A 1YW9A 3PKCA 3L24A 4U6CA 4U70A 1WKMA 1C24A 2MATA 3PKEA 5FCFA 1XGNA 4IKTA 2BWVA 3O5VA 1WBQA 2Q8KA 5CDLA 2EA2A 1M35A 1QXZA 1R58A 2P99A 4FO8A 4MATA 2GTXA 2EVMA 2DFIA 1WL6A 2Q92A 1JAWA 2IW2A 4RGZ1 1QXYA 2GU7A 3IL0A 4U1BA 2ADUA 3PKBA 2GGCA 3OOOA 5D6FA 2EVCA 2BHBA 4IKRA 2P98A 2GG0A 4FLLA 1C22A 4U6EA 5JI6A 2GG7A 5CDEA 4OOKA 1QZYA 2BWWA 3BIQA 2EVOA 1CHMA 2NQ7A 5CE6A 3PKAA 3PEBA 1W2MA 3Q6DA 1R5GA 2GG9A 5JHUA 3FM3A 4KM3A 3I7MA 2GU6A 3FMRA 3IU7A 2GZ5A 4FLKA 4IPAA 1W7VA 2BHDA 4HXXA 3IG4A 2B3LA 4FLJA 4FLIA 4JUQA 3D27A 2GG3A 1Y1NA 1WLRA 3CB6A 2Q95A 2GU4A 4QR8A 4ZWPA 2GG8A 4U73A 2BWXA 4PV4A 3FMQA 2V6CA 1YW8A 4S2RP 4U75A 1C23A 4A6WA 2BWTA 2B3HA 3L7GA 1B6AA 2GU5A 4ZWUA 3TAVA
chains in the Genus database with same CATH superfamily
4U6ZA 4RZYA 3BITA 3IU9A 1WL9A 2V3ZA 4ZWOA 4U6WA 4RZZA 2Q93A 2Q94A 1KQ9A 1YW7A 1BOAA 1KQ0A 4EGEA 3S6BA 4IKSA 1XGOA 2EA4A 1QXWA 1XNZA 2OKNA 5FCHA 1MATA 4IKUA 1R5HA 4S00A 5E2CA 3RVAA 2GG2A 1O0XA 4R60A 1PV9A 5CNXA 2B3KA 1WN1A 2BHCA 2NQ6A 5CLSA 2GA2A 5JFRA 1C27A 3RORA 4FKCA 2BN7A 3PN9A 5CIKA 3OVKA 4U6JA 4S01A 4B28A 2GGBA 4U69A 1WY2A 3BIPA 3CB5A 1A16A 4Z7MA 5E5BA 2ZSGA 4FO7A 3CTZA 3MATA 1B59A 2V3YA 2OAZA 2P9AA 4IDYA 1YJ3A 4IU6A 3IU8A 4PNCA 2Q96A 1XGSA 5D6EA 2HOWA 4U71A 4A6VA 1KP0A 3TB5A 2BWYA 2GG5A 1N51A 1YVMA 3MR1A 3QOCA 2BHAA 1BN5A 2G6PA 3PKDA 4IECA 4S2TP 2BWUA 4ZNGA 2BWSA 3MX6A 4IF7A 2V3XA 5CDVA 1XGMA 2BB7A 2BH3A 4FUKA 4U76A 1C21A 1YW9A 3PKCA 3L24A 4U6CA 4U70A 1WKMA 1C24A 2MATA 3PKEA 5FCFA 1XGNA 4IKTA 2BWVA 3O5VA 1WBQA 2Q8KA 5CDLA 2EA2A 1M35A 1QXZA 1R58A 2P99A 4FO8A 4MATA 2GTXA 2EVMA 2DFIA 1WL6A 2Q92A 1JAWA 2IW2A 4RGZ1 1QXYA 2GU7A 3IL0A 4U1BA 2ADUA 3PKBA 2GGCA 3OOOA 5D6FA 2EVCA 2BHBA 4IKRA 2P98A 2GG0A 4FLLA 1C22A 4U6EA 5JI6A 2GG7A 5CDEA 4OOKA 1QZYA 2BWWA 3BIQA 2EVOA 1CHMA 2NQ7A 5CE6A 3PKAA 3PEBA 1W2MA 3Q6DA 1R5GA 2GG9A 5JHUA 3FM3A 4KM3A 3I7MA 2GU6A 3FMRA 3IU7A 2GZ5A 4FLKA 4IPAA 1W7VA 2BHDA 4HXXA 3IG4A 2B3LA 4FLJA 4FLIA 4JUQA 3D27A 2GG3A 1Y1NA 1WLRA 3CB6A 2Q95A 2GU4A 4QR8A 4ZWPA 2GG8A 4U73A 2BWXA 4PV4A 3FMQA 2V6CA 1YW8A 4S2RP 4U75A 1C23A 4A6WA 2BWTA 2B3HA 3L7GA 1B6AA 2GU5A 4ZWUA 3TAVA
chains in the Genus database with same CATH topology
4U6ZA 4RZYA 3BITA 3IU9A 1WL9A 2V3ZA 4ZWOA 4U6WA 4RZZA 2Q93A 2Q94A 1KQ9A 1YW7A 1BOAA 1KQ0A 4EGEA 3S6BA 4IKSA 1XGOA 2EA4A 1QXWA 1XNZA 2OKNA 5FCHA 1MATA 4IKUA 1R5HA 4S00A 5E2CA 3RVAA 2GG2A 1O0XA 4R60A 1PV9A 5CNXA 2B3KA 1WN1A 2BHCA 2NQ6A 5CLSA 2GA2A 5JFRA 1C27A 3RORA 4FKCA 2BN7A 3PN9A 5CIKA 3OVKA 4U6JA 4S01A 4B28A 2GGBA 4U69A 1WY2A 3BIPA 3CB5A 1A16A 4Z7MA 5E5BA 2ZSGA 4FO7A 3CTZA 3MATA 1B59A 2V3YA 2OAZA 2P9AA 4IDYA 1YJ3A 4IU6A 3IU8A 4PNCA 2Q96A 1XGSA 5D6EA 2HOWA 4U71A 4A6VA 1KP0A 3TB5A 2BWYA 2GG5A 1N51A 1YVMA 3MR1A 3QOCA 2BHAA 1BN5A 2G6PA 3PKDA 4IECA 4S2TP 2BWUA 4ZNGA 2BWSA 3MX6A 4IF7A 2V3XA 5CDVA 1XGMA 2BB7A 2BH3A 4FUKA 4U76A 1C21A 1YW9A 3PKCA 3L24A 4U6CA 4U70A 1WKMA 1C24A 2MATA 3PKEA 5FCFA 1XGNA 4IKTA 2BWVA 3O5VA 1WBQA 2Q8KA 5CDLA 2EA2A 1M35A 1QXZA 1R58A 2P99A 4FO8A 4MATA 2GTXA 2EVMA 2DFIA 1WL6A 2Q92A 1JAWA 2IW2A 4RGZ1 1QXYA 2GU7A 3IL0A 4U1BA 2ADUA 3PKBA 2GGCA 3OOOA 5D6FA 2EVCA 2BHBA 4IKRA 2P98A 2GG0A 4FLLA 1C22A 4U6EA 5JI6A 2GG7A 5CDEA 4OOKA 1QZYA 2BWWA 3BIQA 2EVOA 1CHMA 2NQ7A 5CE6A 3PKAA 3PEBA 1W2MA 3Q6DA 1R5GA 2GG9A 5JHUA 3FM3A 4KM3A 3I7MA 2GU6A 3FMRA 3IU7A 2GZ5A 4FLKA 4IPAA 1W7VA 2BHDA 4HXXA 3IG4A 2B3LA 4FLJA 4FLIA 4JUQA 3D27A 2GG3A 1Y1NA 1WLRA 3CB6A 2Q95A 2GU4A 4QR8A 4ZWPA 2GG8A 4U73A 2BWXA 4PV4A 3FMQA 2V6CA 1YW8A 4S2RP 4U75A 1C23A 4A6WA 2BWTA 2B3HA 3L7GA 1B6AA 2GU5A 4ZWUA 3TAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U6Z A;  4RZY A;  3BIT A;  3IU9 A;  1WL9 A;  2V3Z A;  4ZWO A;  4U6W A;  4RZZ A;  2Q93 A;  2Q94 A;  1KQ9 A;  1YW7 A;  1BOA A;  1KQ0 A;  4EGE A;  3S6B A;  4IKS A;  1XGO A;  2EA4 A;  1QXW A;  1XNZ A;  2OKN A;  5FCH A;  1MAT A;  4IKU A;  1R5H A;  4S00 A;  5E2C A;  3RVA A;  2GG2 A;  1O0X A;  4R60 A;  1PV9 A;  5CNX A;  2B3K A;  1WN1 A;  2BHC A;  2NQ6 A;  5CLS A;  2GA2 A;  5JFR A;  1C27 A;  3ROR A;  4FKC A;  2BN7 A;  3PN9 A;  5CIK A;  3OVK A;  4U6J A;  4S01 A;  4B28 A;  2GGB A;  4U69 A;  1WY2 A;  3BIP A;  3CB5 A;  1A16 A;  4Z7M A;  5E5B A;  2ZSG A;  4FO7 A;  3CTZ A;  3MAT A;  1B59 A;  2V3Y A;  2OAZ A;  2P9A A;  4IDY A;  1YJ3 A;  4IU6 A;  3IU8 A;  4PNC A;  2Q96 A;  1XGS A;  5D6E A;  2HOW A;  4U71 A;  4A6V A;  1KP0 A;  3TB5 A;  2BWY A;  2GG5 A;  1N51 A;  1YVM A;  3MR1 A;  3QOC A;  2BHA A;  1BN5 A;  2G6P A;  3PKD A;  4IEC A;  4S2T P;  2BWU A;  4ZNG A;  2BWS A;  3MX6 A;  4IF7 A;  2V3X A;  5CDV A;  1XGM A;  2BB7 A;  2BH3 A;  4FUK A;  4U76 A;  1C21 A;  1YW9 A;  3PKC A;  3L24 A;  4U6C A;  4U70 A;  1WKM A;  1C24 A;  2MAT A;  3PKE A;  5FCF A;  1XGN A;  4IKT A;  2BWV A;  3O5V A;  1WBQ A;  2Q8K A;  5CDL A;  2EA2 A;  1M35 A;  1QXZ A;  1R58 A;  2P99 A;  4FO8 A;  4MAT A;  2GTX A;  2EVM A;  2DFI A;  1WL6 A;  2Q92 A;  1JAW A;  2IW2 A;  4RGZ 1;  1QXY A;  2GU7 A;  3IL0 A;  4U1B A;  2ADU A;  3PKB A;  2GGC A;  3OOO A;  5D6F A;  2EVC A;  2BHB A;  4IKR A;  2P98 A;  2GG0 A;  4FLL A;  1C22 A;  4U6E A;  5JI6 A;  2GG7 A;  5CDE A;  4OOK A;  1QZY A;  2BWW A;  3BIQ A;  2EVO A;  1CHM A;  2NQ7 A;  5CE6 A;  3PKA A;  3PEB A;  1W2M A;  3Q6D A;  1R5G A;  2GG9 A;  5JHU A;  3FM3 A;  4KM3 A;  3I7M A;  2GU6 A;  3FMR A;  3IU7 A;  2GZ5 A;  4FLK A;  4IPA A;  1W7V A;  2BHD A;  4HXX A;  3IG4 A;  2B3L A;  4FLJ A;  4FLI A;  4JUQ A;  3D27 A;  2GG3 A;  1Y1N A;  1WLR A;  3CB6 A;  2Q95 A;  2GU4 A;  4QR8 A;  4ZWP A;  2GG8 A;  4U73 A;  2BWX A;  4PV4 A;  3FMQ A;  2V6C A;  1YW8 A;  4S2R P;  4U75 A;  1C23 A;  4A6W A;  2BWT A;  2B3H A;  3L7G A;  1B6A A;  2GU5 A;  4ZWU A;  3TAV A; 
#chains in the Genus database with same CATH topology
 4U6Z A;  4RZY A;  3BIT A;  3IU9 A;  1WL9 A;  2V3Z A;  4ZWO A;  4U6W A;  4RZZ A;  2Q93 A;  2Q94 A;  1KQ9 A;  1YW7 A;  1BOA A;  1KQ0 A;  4EGE A;  3S6B A;  4IKS A;  1XGO A;  2EA4 A;  1QXW A;  1XNZ A;  2OKN A;  5FCH A;  1MAT A;  4IKU A;  1R5H A;  4S00 A;  5E2C A;  3RVA A;  2GG2 A;  1O0X A;  4R60 A;  1PV9 A;  5CNX A;  2B3K A;  1WN1 A;  2BHC A;  2NQ6 A;  5CLS A;  2GA2 A;  5JFR A;  1C27 A;  3ROR A;  4FKC A;  2BN7 A;  3PN9 A;  5CIK A;  3OVK A;  4U6J A;  4S01 A;  4B28 A;  2GGB A;  4U69 A;  1WY2 A;  3BIP A;  3CB5 A;  1A16 A;  4Z7M A;  5E5B A;  2ZSG A;  4FO7 A;  3CTZ A;  3MAT A;  1B59 A;  2V3Y A;  2OAZ A;  2P9A A;  4IDY A;  1YJ3 A;  4IU6 A;  3IU8 A;  4PNC A;  2Q96 A;  1XGS A;  5D6E A;  2HOW A;  4U71 A;  4A6V A;  1KP0 A;  3TB5 A;  2BWY A;  2GG5 A;  1N51 A;  1YVM A;  3MR1 A;  3QOC A;  2BHA A;  1BN5 A;  2G6P A;  3PKD A;  4IEC A;  4S2T P;  2BWU A;  4ZNG A;  2BWS A;  3MX6 A;  4IF7 A;  2V3X A;  5CDV A;  1XGM A;  2BB7 A;  2BH3 A;  4FUK A;  4U76 A;  1C21 A;  1YW9 A;  3PKC A;  3L24 A;  4U6C A;  4U70 A;  1WKM A;  1C24 A;  2MAT A;  3PKE A;  5FCF A;  1XGN A;  4IKT A;  2BWV A;  3O5V A;  1WBQ A;  2Q8K A;  5CDL A;  2EA2 A;  1M35 A;  1QXZ A;  1R58 A;  2P99 A;  4FO8 A;  4MAT A;  2GTX A;  2EVM A;  2DFI A;  1WL6 A;  2Q92 A;  1JAW A;  2IW2 A;  4RGZ 1;  1QXY A;  2GU7 A;  3IL0 A;  4U1B A;  2ADU A;  3PKB A;  2GGC A;  3OOO A;  5D6F A;  2EVC A;  2BHB A;  4IKR A;  2P98 A;  2GG0 A;  4FLL A;  1C22 A;  4U6E A;  5JI6 A;  2GG7 A;  5CDE A;  4OOK A;  1QZY A;  2BWW A;  3BIQ A;  2EVO A;  1CHM A;  2NQ7 A;  5CE6 A;  3PKA A;  3PEB A;  1W2M A;  3Q6D A;  1R5G A;  2GG9 A;  5JHU A;  3FM3 A;  4KM3 A;  3I7M A;  2GU6 A;  3FMR A;  3IU7 A;  2GZ5 A;  4FLK A;  4IPA A;  1W7V A;  2BHD A;  4HXX A;  3IG4 A;  2B3L A;  4FLJ A;  4FLI A;  4JUQ A;  3D27 A;  2GG3 A;  1Y1N A;  1WLR A;  3CB6 A;  2Q95 A;  2GU4 A;  4QR8 A;  4ZWP A;  2GG8 A;  4U73 A;  2BWX A;  4PV4 A;  3FMQ A;  2V6C A;  1YW8 A;  4S2R P;  4U75 A;  1C23 A;  4A6W A;  2BWT A;  2B3H A;  3L7G A;  1B6A A;  2GU5 A;  4ZWU A;  3TAV A; 
#chains in the Genus database with same CATH homology
 4U6Z A;  4RZY A;  3BIT A;  3IU9 A;  1WL9 A;  2V3Z A;  4ZWO A;  4U6W A;  4RZZ A;  2Q93 A;  2Q94 A;  1KQ9 A;  1YW7 A;  1BOA A;  1KQ0 A;  4EGE A;  3S6B A;  4IKS A;  1XGO A;  2EA4 A;  1QXW A;  1XNZ A;  2OKN A;  5FCH A;  1MAT A;  4IKU A;  1R5H A;  4S00 A;  5E2C A;  3RVA A;  2GG2 A;  1O0X A;  4R60 A;  1PV9 A;  5CNX A;  2B3K A;  1WN1 A;  2BHC A;  2NQ6 A;  5CLS A;  2GA2 A;  5JFR A;  1C27 A;  3ROR A;  4FKC A;  2BN7 A;  3PN9 A;  5CIK A;  3OVK A;  4U6J A;  4S01 A;  4B28 A;  2GGB A;  4U69 A;  1WY2 A;  3BIP A;  3CB5 A;  1A16 A;  4Z7M A;  5E5B A;  2ZSG A;  4FO7 A;  3CTZ A;  3MAT A;  1B59 A;  2V3Y A;  2OAZ A;  2P9A A;  4IDY A;  1YJ3 A;  4IU6 A;  3IU8 A;  4PNC A;  2Q96 A;  1XGS A;  5D6E A;  2HOW A;  4U71 A;  4A6V A;  1KP0 A;  3TB5 A;  2BWY A;  2GG5 A;  1N51 A;  1YVM A;  3MR1 A;  3QOC A;  2BHA A;  1BN5 A;  2G6P A;  3PKD A;  4IEC A;  4S2T P;  2BWU A;  4ZNG A;  2BWS A;  3MX6 A;  4IF7 A;  2V3X A;  5CDV A;  1XGM A;  2BB7 A;  2BH3 A;  4FUK A;  4U76 A;  1C21 A;  1YW9 A;  3PKC A;  3L24 A;  4U6C A;  4U70 A;  1WKM A;  1C24 A;  2MAT A;  3PKE A;  5FCF A;  1XGN A;  4IKT A;  2BWV A;  3O5V A;  1WBQ A;  2Q8K A;  5CDL A;  2EA2 A;  1M35 A;  1QXZ A;  1R58 A;  2P99 A;  4FO8 A;  4MAT A;  2GTX A;  2EVM A;  2DFI A;  1WL6 A;  2Q92 A;  1JAW A;  2IW2 A;  4RGZ 1;  1QXY A;  2GU7 A;  3IL0 A;  4U1B A;  2ADU A;  3PKB A;  2GGC A;  3OOO A;  5D6F A;  2EVC A;  2BHB A;  4IKR A;  2P98 A;  2GG0 A;  4FLL A;  1C22 A;  4U6E A;  5JI6 A;  2GG7 A;  5CDE A;  4OOK A;  1QZY A;  2BWW A;  3BIQ A;  2EVO A;  1CHM A;  2NQ7 A;  5CE6 A;  3PKA A;  3PEB A;  1W2M A;  3Q6D A;  1R5G A;  2GG9 A;  5JHU A;  3FM3 A;  4KM3 A;  3I7M A;  2GU6 A;  3FMR A;  3IU7 A;  2GZ5 A;  4FLK A;  4IPA A;  1W7V A;  2BHD A;  4HXX A;  3IG4 A;  2B3L A;  4FLJ A;  4FLI A;  4JUQ A;  3D27 A;  2GG3 A;  1Y1N A;  1WLR A;  3CB6 A;  2Q95 A;  2GU4 A;  4QR8 A;  4ZWP A;  2GG8 A;  4U73 A;  2BWX A;  4PV4 A;  3FMQ A;  2V6C A;  1YW8 A;  4S2R P;  4U75 A;  1C23 A;  4A6W A;  2BWT A;  2B3H A;  3L7G A;  1B6A A;  2GU5 A;  4ZWU A;  3TAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...