2BHAA

E. coli aminopeptidase p in complex with substrate
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
440
structure length
440
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 155
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bhaA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bhaA02
3FMQA 3IG4A 1N51A 5CIKA 2Q96A 2P9AA 2BHAA 2V3YA 1YW9A 4IU6A 2B3KA 4IF7A 1WL9A 3D27A 2GG3A 4FO7A 4IDYA 4U6EA 2BWTA 1R5GA 2GG8A 2G6PA 2OAZA 2P99A 2P98A 3FMRA 4U76A 2GG5A 4B28A 4RGZ1 1WL6A 4S2RP 2BWVA 5E5BA 5JFRA 2GG9A 2GG0A 3MATA 2BH3A 3I7MA 5CDLA 4ZWUA 5D6EA 2GU7A 2GU5A 2Q94A 2BHDA 1B59A 4JUQA 2EVOA 1XGOA 1PV9A 2GU4A 4U71A 4A6VA 2EVCA 3MR1A 2BWXA 1XGMA 4U73A 1M35A 2BWSA 5CNXA 3PKEA 1XNZA 4S2TP 4RZYA 2EA4A 4Z7MA 1WKMA 4KM3A 4R60A 4IECA 5D6FA 2NQ7A 3BIQA 3CB5A 1MATA 1QXYA 3RORA 3IU8A 1KP0A 2GG7A 2BWYA 4QR8A 2V3ZA 1XGNA 5CDEA 3PN9A 1BOAA 4FLKA 4MATA 2BWWA 3L24A 5CDVA 2DFIA 3QOCA 2V6CA 2GA2A 1QZYA 1QXWA 3RVAA 3IU9A 2EVMA 4U75A 3OOOA 4FUKA 1B6AA 1C24A 2GZ5A 4FKCA 2BWUA 2Q8KA 1C21A 2GG2A 4FLJA 5JI6A 4ZNGA 4ZWOA 1WY2A 2V3XA 1XGSA 4U69A 1YVMA 2BHCA 1BN5A 4PNCA 3L7GA 4U1BA 4IPAA 4A6WA 4ZWPA 1C27A 2EA2A 3IU7A 4IKUA 1WN1A 3OVKA 2OKNA 3PKBA 1WBQA 1R5HA 3PKCA 4OOKA 4IKTA 1Y1NA 1R58A 1WLRA 3PKAA 3TB5A 1W7VA 3Q6DA 3BITA 1O0XA 4IKRA 1C22A 2HOWA 3PKDA 4HXXA 4IKSA 5JHUA 2GTXA 4RZZA 5CE6A 2GGBA 2MATA 2Q93A 4U6ZA 1A16A 2ZSGA 4EGEA 2BHBA 4FLIA 2IW2A 5E2CA 2BB7A 3O5VA 2B3LA 4U70A 2GGCA 1QXZA 4S00A 3PEBA 1C23A 1YW7A 3CTZA 4PV4A 2B3HA 3MX6A 5CLSA 2NQ6A 3S6BA 2BN7A 2GU6A 5FCHA 1KQ9A 3CB6A 4FO8A 1CHMA 1YW8A 2Q92A 1JAWA 4U6WA 3TAVA 1KQ0A 2ADUA 4U6CA 1YJ3A 1W2MA 3FM3A 4U6JA 5FCFA 3BIPA 3IL0A 2Q95A 4S01A 4FLLA
chains in the Genus database with same CATH superfamily
3FMQA 3IG4A 1N51A 5CIKA 2Q96A 2P9AA 2BHAA 2V3YA 1YW9A 4IU6A 2B3KA 4IF7A 1WL9A 3D27A 2GG3A 4FO7A 4IDYA 4U6EA 2BWTA 1R5GA 2GG8A 2G6PA 2OAZA 2P99A 2P98A 3FMRA 4U76A 2GG5A 4B28A 4RGZ1 1WL6A 4S2RP 2BWVA 5E5BA 5JFRA 2GG9A 2GG0A 3MATA 2BH3A 3I7MA 5CDLA 4ZWUA 5D6EA 2GU7A 2GU5A 2Q94A 2BHDA 1B59A 4JUQA 2EVOA 1XGOA 1PV9A 2GU4A 4U71A 4A6VA 2EVCA 3MR1A 2BWXA 1XGMA 4U73A 1M35A 2BWSA 5CNXA 3PKEA 1XNZA 4S2TP 4RZYA 2EA4A 4Z7MA 1WKMA 4KM3A 4R60A 4IECA 5D6FA 2NQ7A 3BIQA 3CB5A 1MATA 1QXYA 3RORA 3IU8A 1KP0A 2GG7A 2BWYA 4QR8A 2V3ZA 1XGNA 5CDEA 3PN9A 1BOAA 4FLKA 4MATA 2BWWA 3L24A 5CDVA 2DFIA 3QOCA 2V6CA 2GA2A 1QZYA 1QXWA 3RVAA 3IU9A 2EVMA 4U75A 3OOOA 4FUKA 1B6AA 1C24A 2GZ5A 4FKCA 2BWUA 2Q8KA 1C21A 2GG2A 4FLJA 5JI6A 4ZNGA 4ZWOA 1WY2A 2V3XA 1XGSA 4U69A 1YVMA 2BHCA 1BN5A 4PNCA 3L7GA 4U1BA 4IPAA 4A6WA 4ZWPA 1C27A 2EA2A 3IU7A 4IKUA 1WN1A 3OVKA 2OKNA 3PKBA 1WBQA 1R5HA 3PKCA 4OOKA 4IKTA 1Y1NA 1R58A 1WLRA 3PKAA 3TB5A 1W7VA 3Q6DA 3BITA 1O0XA 4IKRA 1C22A 2HOWA 3PKDA 4HXXA 4IKSA 5JHUA 2GTXA 4RZZA 5CE6A 2GGBA 2MATA 2Q93A 4U6ZA 1A16A 2ZSGA 4EGEA 2BHBA 4FLIA 2IW2A 5E2CA 2BB7A 3O5VA 2B3LA 4U70A 2GGCA 1QXZA 4S00A 3PEBA 1C23A 1YW7A 3CTZA 4PV4A 2B3HA 3MX6A 5CLSA 2NQ6A 3S6BA 2BN7A 2GU6A 5FCHA 1KQ9A 3CB6A 4FO8A 1CHMA 1YW8A 2Q92A 1JAWA 4U6WA 3TAVA 1KQ0A 2ADUA 4U6CA 1YJ3A 1W2MA 3FM3A 4U6JA 5FCFA 3BIPA 3IL0A 2Q95A 4S01A 4FLLA
chains in the Genus database with same CATH topology
3FMQA 3IG4A 1N51A 5CIKA 2Q96A 2P9AA 2BHAA 2V3YA 1YW9A 4IU6A 2B3KA 4IF7A 1WL9A 3D27A 2GG3A 4FO7A 4IDYA 4U6EA 2BWTA 1R5GA 2GG8A 2G6PA 2OAZA 2P99A 2P98A 3FMRA 4U76A 2GG5A 4B28A 4RGZ1 1WL6A 4S2RP 2BWVA 5E5BA 5JFRA 2GG9A 2GG0A 3MATA 2BH3A 3I7MA 5CDLA 4ZWUA 5D6EA 2GU7A 2GU5A 2Q94A 2BHDA 1B59A 4JUQA 2EVOA 1XGOA 1PV9A 2GU4A 4U71A 4A6VA 2EVCA 3MR1A 2BWXA 1XGMA 4U73A 1M35A 2BWSA 5CNXA 3PKEA 1XNZA 4S2TP 4RZYA 2EA4A 4Z7MA 1WKMA 4KM3A 4R60A 4IECA 5D6FA 2NQ7A 3BIQA 3CB5A 1MATA 1QXYA 3RORA 3IU8A 1KP0A 2GG7A 2BWYA 4QR8A 2V3ZA 1XGNA 5CDEA 3PN9A 1BOAA 4FLKA 4MATA 2BWWA 3L24A 5CDVA 2DFIA 3QOCA 2V6CA 2GA2A 1QZYA 1QXWA 3RVAA 3IU9A 2EVMA 4U75A 3OOOA 4FUKA 1B6AA 1C24A 2GZ5A 4FKCA 2BWUA 2Q8KA 1C21A 2GG2A 4FLJA 5JI6A 4ZNGA 4ZWOA 1WY2A 2V3XA 1XGSA 4U69A 1YVMA 2BHCA 1BN5A 4PNCA 3L7GA 4U1BA 4IPAA 4A6WA 4ZWPA 1C27A 2EA2A 3IU7A 4IKUA 1WN1A 3OVKA 2OKNA 3PKBA 1WBQA 1R5HA 3PKCA 4OOKA 4IKTA 1Y1NA 1R58A 1WLRA 3PKAA 3TB5A 1W7VA 3Q6DA 3BITA 1O0XA 4IKRA 1C22A 2HOWA 3PKDA 4HXXA 4IKSA 5JHUA 2GTXA 4RZZA 5CE6A 2GGBA 2MATA 2Q93A 4U6ZA 1A16A 2ZSGA 4EGEA 2BHBA 4FLIA 2IW2A 5E2CA 2BB7A 3O5VA 2B3LA 4U70A 2GGCA 1QXZA 4S00A 3PEBA 1C23A 1YW7A 3CTZA 4PV4A 2B3HA 3MX6A 5CLSA 2NQ6A 3S6BA 2BN7A 2GU6A 5FCHA 1KQ9A 3CB6A 4FO8A 1CHMA 1YW8A 2Q92A 1JAWA 4U6WA 3TAVA 1KQ0A 2ADUA 4U6CA 1YJ3A 1W2MA 3FM3A 4U6JA 5FCFA 3BIPA 3IL0A 2Q95A 4S01A 4FLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMQ A;  3IG4 A;  1N51 A;  5CIK A;  2Q96 A;  2P9A A;  2BHA A;  2V3Y A;  1YW9 A;  4IU6 A;  2B3K A;  4IF7 A;  1WL9 A;  3D27 A;  2GG3 A;  4FO7 A;  4IDY A;  4U6E A;  2BWT A;  1R5G A;  2GG8 A;  2G6P A;  2OAZ A;  2P99 A;  2P98 A;  3FMR A;  4U76 A;  2GG5 A;  4B28 A;  4RGZ 1;  1WL6 A;  4S2R P;  2BWV A;  5E5B A;  5JFR A;  2GG9 A;  2GG0 A;  3MAT A;  2BH3 A;  3I7M A;  5CDL A;  4ZWU A;  5D6E A;  2GU7 A;  2GU5 A;  2Q94 A;  2BHD A;  1B59 A;  4JUQ A;  2EVO A;  1XGO A;  1PV9 A;  2GU4 A;  4U71 A;  4A6V A;  2EVC A;  3MR1 A;  2BWX A;  1XGM A;  4U73 A;  1M35 A;  2BWS A;  5CNX A;  3PKE A;  1XNZ A;  4S2T P;  4RZY A;  2EA4 A;  4Z7M A;  1WKM A;  4KM3 A;  4R60 A;  4IEC A;  5D6F A;  2NQ7 A;  3BIQ A;  3CB5 A;  1MAT A;  1QXY A;  3ROR A;  3IU8 A;  1KP0 A;  2GG7 A;  2BWY A;  4QR8 A;  2V3Z A;  1XGN A;  5CDE A;  3PN9 A;  1BOA A;  4FLK A;  4MAT A;  2BWW A;  3L24 A;  5CDV A;  2DFI A;  3QOC A;  2V6C A;  2GA2 A;  1QZY A;  1QXW A;  3RVA A;  3IU9 A;  2EVM A;  4U75 A;  3OOO A;  4FUK A;  1B6A A;  1C24 A;  2GZ5 A;  4FKC A;  2BWU A;  2Q8K A;  1C21 A;  2GG2 A;  4FLJ A;  5JI6 A;  4ZNG A;  4ZWO A;  1WY2 A;  2V3X A;  1XGS A;  4U69 A;  1YVM A;  2BHC A;  1BN5 A;  4PNC A;  3L7G A;  4U1B A;  4IPA A;  4A6W A;  4ZWP A;  1C27 A;  2EA2 A;  3IU7 A;  4IKU A;  1WN1 A;  3OVK A;  2OKN A;  3PKB A;  1WBQ A;  1R5H A;  3PKC A;  4OOK A;  4IKT A;  1Y1N A;  1R58 A;  1WLR A;  3PKA A;  3TB5 A;  1W7V A;  3Q6D A;  3BIT A;  1O0X A;  4IKR A;  1C22 A;  2HOW A;  3PKD A;  4HXX A;  4IKS A;  5JHU A;  2GTX A;  4RZZ A;  5CE6 A;  2GGB A;  2MAT A;  2Q93 A;  4U6Z A;  1A16 A;  2ZSG A;  4EGE A;  2BHB A;  4FLI A;  2IW2 A;  5E2C A;  2BB7 A;  3O5V A;  2B3L A;  4U70 A;  2GGC A;  1QXZ A;  4S00 A;  3PEB A;  1C23 A;  1YW7 A;  3CTZ A;  4PV4 A;  2B3H A;  3MX6 A;  5CLS A;  2NQ6 A;  3S6B A;  2BN7 A;  2GU6 A;  5FCH A;  1KQ9 A;  3CB6 A;  4FO8 A;  1CHM A;  1YW8 A;  2Q92 A;  1JAW A;  4U6W A;  3TAV A;  1KQ0 A;  2ADU A;  4U6C A;  1YJ3 A;  1W2M A;  3FM3 A;  4U6J A;  5FCF A;  3BIP A;  3IL0 A;  2Q95 A;  4S01 A;  4FLL A; 
#chains in the Genus database with same CATH topology
 3FMQ A;  3IG4 A;  1N51 A;  5CIK A;  2Q96 A;  2P9A A;  2BHA A;  2V3Y A;  1YW9 A;  4IU6 A;  2B3K A;  4IF7 A;  1WL9 A;  3D27 A;  2GG3 A;  4FO7 A;  4IDY A;  4U6E A;  2BWT A;  1R5G A;  2GG8 A;  2G6P A;  2OAZ A;  2P99 A;  2P98 A;  3FMR A;  4U76 A;  2GG5 A;  4B28 A;  4RGZ 1;  1WL6 A;  4S2R P;  2BWV A;  5E5B A;  5JFR A;  2GG9 A;  2GG0 A;  3MAT A;  2BH3 A;  3I7M A;  5CDL A;  4ZWU A;  5D6E A;  2GU7 A;  2GU5 A;  2Q94 A;  2BHD A;  1B59 A;  4JUQ A;  2EVO A;  1XGO A;  1PV9 A;  2GU4 A;  4U71 A;  4A6V A;  2EVC A;  3MR1 A;  2BWX A;  1XGM A;  4U73 A;  1M35 A;  2BWS A;  5CNX A;  3PKE A;  1XNZ A;  4S2T P;  4RZY A;  2EA4 A;  4Z7M A;  1WKM A;  4KM3 A;  4R60 A;  4IEC A;  5D6F A;  2NQ7 A;  3BIQ A;  3CB5 A;  1MAT A;  1QXY A;  3ROR A;  3IU8 A;  1KP0 A;  2GG7 A;  2BWY A;  4QR8 A;  2V3Z A;  1XGN A;  5CDE A;  3PN9 A;  1BOA A;  4FLK A;  4MAT A;  2BWW A;  3L24 A;  5CDV A;  2DFI A;  3QOC A;  2V6C A;  2GA2 A;  1QZY A;  1QXW A;  3RVA A;  3IU9 A;  2EVM A;  4U75 A;  3OOO A;  4FUK A;  1B6A A;  1C24 A;  2GZ5 A;  4FKC A;  2BWU A;  2Q8K A;  1C21 A;  2GG2 A;  4FLJ A;  5JI6 A;  4ZNG A;  4ZWO A;  1WY2 A;  2V3X A;  1XGS A;  4U69 A;  1YVM A;  2BHC A;  1BN5 A;  4PNC A;  3L7G A;  4U1B A;  4IPA A;  4A6W A;  4ZWP A;  1C27 A;  2EA2 A;  3IU7 A;  4IKU A;  1WN1 A;  3OVK A;  2OKN A;  3PKB A;  1WBQ A;  1R5H A;  3PKC A;  4OOK A;  4IKT A;  1Y1N A;  1R58 A;  1WLR A;  3PKA A;  3TB5 A;  1W7V A;  3Q6D A;  3BIT A;  1O0X A;  4IKR A;  1C22 A;  2HOW A;  3PKD A;  4HXX A;  4IKS A;  5JHU A;  2GTX A;  4RZZ A;  5CE6 A;  2GGB A;  2MAT A;  2Q93 A;  4U6Z A;  1A16 A;  2ZSG A;  4EGE A;  2BHB A;  4FLI A;  2IW2 A;  5E2C A;  2BB7 A;  3O5V A;  2B3L A;  4U70 A;  2GGC A;  1QXZ A;  4S00 A;  3PEB A;  1C23 A;  1YW7 A;  3CTZ A;  4PV4 A;  2B3H A;  3MX6 A;  5CLS A;  2NQ6 A;  3S6B A;  2BN7 A;  2GU6 A;  5FCH A;  1KQ9 A;  3CB6 A;  4FO8 A;  1CHM A;  1YW8 A;  2Q92 A;  1JAW A;  4U6W A;  3TAV A;  1KQ0 A;  2ADU A;  4U6C A;  1YJ3 A;  1W2M A;  3FM3 A;  4U6J A;  5FCF A;  3BIP A;  3IL0 A;  2Q95 A;  4S01 A;  4FLL A; 
#chains in the Genus database with same CATH homology
 3FMQ A;  3IG4 A;  1N51 A;  5CIK A;  2Q96 A;  2P9A A;  2BHA A;  2V3Y A;  1YW9 A;  4IU6 A;  2B3K A;  4IF7 A;  1WL9 A;  3D27 A;  2GG3 A;  4FO7 A;  4IDY A;  4U6E A;  2BWT A;  1R5G A;  2GG8 A;  2G6P A;  2OAZ A;  2P99 A;  2P98 A;  3FMR A;  4U76 A;  2GG5 A;  4B28 A;  4RGZ 1;  1WL6 A;  4S2R P;  2BWV A;  5E5B A;  5JFR A;  2GG9 A;  2GG0 A;  3MAT A;  2BH3 A;  3I7M A;  5CDL A;  4ZWU A;  5D6E A;  2GU7 A;  2GU5 A;  2Q94 A;  2BHD A;  1B59 A;  4JUQ A;  2EVO A;  1XGO A;  1PV9 A;  2GU4 A;  4U71 A;  4A6V A;  2EVC A;  3MR1 A;  2BWX A;  1XGM A;  4U73 A;  1M35 A;  2BWS A;  5CNX A;  3PKE A;  1XNZ A;  4S2T P;  4RZY A;  2EA4 A;  4Z7M A;  1WKM A;  4KM3 A;  4R60 A;  4IEC A;  5D6F A;  2NQ7 A;  3BIQ A;  3CB5 A;  1MAT A;  1QXY A;  3ROR A;  3IU8 A;  1KP0 A;  2GG7 A;  2BWY A;  4QR8 A;  2V3Z A;  1XGN A;  5CDE A;  3PN9 A;  1BOA A;  4FLK A;  4MAT A;  2BWW A;  3L24 A;  5CDV A;  2DFI A;  3QOC A;  2V6C A;  2GA2 A;  1QZY A;  1QXW A;  3RVA A;  3IU9 A;  2EVM A;  4U75 A;  3OOO A;  4FUK A;  1B6A A;  1C24 A;  2GZ5 A;  4FKC A;  2BWU A;  2Q8K A;  1C21 A;  2GG2 A;  4FLJ A;  5JI6 A;  4ZNG A;  4ZWO A;  1WY2 A;  2V3X A;  1XGS A;  4U69 A;  1YVM A;  2BHC A;  1BN5 A;  4PNC A;  3L7G A;  4U1B A;  4IPA A;  4A6W A;  4ZWP A;  1C27 A;  2EA2 A;  3IU7 A;  4IKU A;  1WN1 A;  3OVK A;  2OKN A;  3PKB A;  1WBQ A;  1R5H A;  3PKC A;  4OOK A;  4IKT A;  1Y1N A;  1R58 A;  1WLR A;  3PKA A;  3TB5 A;  1W7V A;  3Q6D A;  3BIT A;  1O0X A;  4IKR A;  1C22 A;  2HOW A;  3PKD A;  4HXX A;  4IKS A;  5JHU A;  2GTX A;  4RZZ A;  5CE6 A;  2GGB A;  2MAT A;  2Q93 A;  4U6Z A;  1A16 A;  2ZSG A;  4EGE A;  2BHB A;  4FLI A;  2IW2 A;  5E2C A;  2BB7 A;  3O5V A;  2B3L A;  4U70 A;  2GGC A;  1QXZ A;  4S00 A;  3PEB A;  1C23 A;  1YW7 A;  3CTZ A;  4PV4 A;  2B3H A;  3MX6 A;  5CLS A;  2NQ6 A;  3S6B A;  2BN7 A;  2GU6 A;  5FCH A;  1KQ9 A;  3CB6 A;  4FO8 A;  1CHM A;  1YW8 A;  2Q92 A;  1JAW A;  4U6W A;  3TAV A;  1KQ0 A;  2ADU A;  4U6C A;  1YJ3 A;  1W2M A;  3FM3 A;  4U6J A;  5FCF A;  3BIP A;  3IL0 A;  2Q95 A;  4S01 A;  4FLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...