2BHDA

Mg substituted e. coli aminopeptidase p in complex with product
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 157
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bhdA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bhdA02
2V6CA 4U6ZA 2BWTA 3IL0A 5E5BA 3FMQA 3BITA 2BWYA 5CLSA 1QXZA 1YVMA 3PKDA 2OAZA 1O0XA 1QXWA 4U71A 4IPAA 4U6WA 4RZYA 5CDEA 1XGSA 2BH3A 4FO7A 2MATA 2GG8A 3D27A 4U70A 4IKTA 5CNXA 1MATA 3FMRA 3CTZA 3PKBA 4FLLA 2EVMA 1A16A 4S00A 2BWVA 1N51A 3PEBA 2IW2A 3IU8A 3IG4A 2Q93A 1KQ9A 5FCHA 3O5VA 4FLIA 4U76A 2GU4A 2GG0A 1W7VA 3RVAA 1XGNA 1XGMA 2BHAA 2V3ZA 1WN1A 4U73A 3OOOA 3CB6A 1QXYA 2GG3A 2GU6A 5D6EA 4FO8A 4HXXA 3BIQA 4RGZ1 2Q92A 2GU7A 4IU6A 3MX6A 2G6PA 3Q6DA 4FLKA 5JFRA 4S2TP 1C24A 4U1BA 2EA2A 4FKCA 4ZWUA 4ZNGA 5CE6A 2B3HA 1JAWA 2DFIA 4EGEA 1C22A 4IKSA 1YW7A 4PV4A 4IKUA 4QR8A 1YJ3A 3PKCA 4KM3A 4U6EA 3BIPA 4B28A 2NQ6A 4PNCA 5CIKA 3TB5A 3TAVA 1WBQA 2GZ5A 2ADUA 2P9AA 4MATA 1WY2A 1KP0A 2ZSGA 3L24A 4ZWOA 4IKRA 4U6JA 4IECA 2B3KA 3L7GA 4ZWPA 2GG7A 2BHBA 2GU5A 4FUKA 2BB7A 1R5GA 1YW9A 1M35A 1QZYA 1WLRA 1B6AA 2BWSA 2P99A 3QOCA 4JUQA 1WL6A 4U6CA 4FLJA 1C27A 2BHDA 1YW8A 4U69A 4R60A 3PKEA 3PKAA 1WKMA 1KQ0A 2GA2A 1PV9A 3PN9A 2Q95A 2OKNA 2V3YA 3MR1A 1W2MA 1WL9A 4IDYA 3FM3A 2HOWA 2NQ7A 3I7MA 1CHMA 2GTXA 2V3XA 2GG2A 2GG5A 1BN5A 4S01A 5CDLA 2Q96A 5D6FA 3CB5A 2GG9A 4S2RP 4OOKA 1R58A 2B3LA 2BWWA 3IU9A 1R5HA 4U75A 5FCFA 4IF7A 1BOAA 3RORA 2GGBA 5JI6A 2BWXA 5CDVA 2EA4A 2Q8KA 2BWUA 4A6WA 2Q94A 1C23A 2BN7A 1XGOA 1B59A 3OVKA 3S6BA 5JHUA 2EVCA 4A6VA 1XNZA 3IU7A 1Y1NA 2P98A 2EVOA 2BHCA 2GGCA 4RZZA 4Z7MA 1C21A 3MATA 5E2CA
chains in the Genus database with same CATH superfamily
2V6CA 4U6ZA 2BWTA 3IL0A 5E5BA 3FMQA 3BITA 2BWYA 5CLSA 1QXZA 1YVMA 3PKDA 2OAZA 1O0XA 1QXWA 4U71A 4IPAA 4U6WA 4RZYA 5CDEA 1XGSA 2BH3A 4FO7A 2MATA 2GG8A 3D27A 4U70A 4IKTA 5CNXA 1MATA 3FMRA 3CTZA 3PKBA 4FLLA 2EVMA 1A16A 4S00A 2BWVA 1N51A 3PEBA 2IW2A 3IU8A 3IG4A 2Q93A 1KQ9A 5FCHA 3O5VA 4FLIA 4U76A 2GU4A 2GG0A 1W7VA 3RVAA 1XGNA 1XGMA 2BHAA 2V3ZA 1WN1A 4U73A 3OOOA 3CB6A 1QXYA 2GG3A 2GU6A 5D6EA 4FO8A 4HXXA 3BIQA 4RGZ1 2Q92A 2GU7A 4IU6A 3MX6A 2G6PA 3Q6DA 4FLKA 5JFRA 4S2TP 1C24A 4U1BA 2EA2A 4FKCA 4ZWUA 4ZNGA 5CE6A 2B3HA 1JAWA 2DFIA 4EGEA 1C22A 4IKSA 1YW7A 4PV4A 4IKUA 4QR8A 1YJ3A 3PKCA 4KM3A 4U6EA 3BIPA 4B28A 2NQ6A 4PNCA 5CIKA 3TB5A 3TAVA 1WBQA 2GZ5A 2ADUA 2P9AA 4MATA 1WY2A 1KP0A 2ZSGA 3L24A 4ZWOA 4IKRA 4U6JA 4IECA 2B3KA 3L7GA 4ZWPA 2GG7A 2BHBA 2GU5A 4FUKA 2BB7A 1R5GA 1YW9A 1M35A 1QZYA 1WLRA 1B6AA 2BWSA 2P99A 3QOCA 4JUQA 1WL6A 4U6CA 4FLJA 1C27A 2BHDA 1YW8A 4U69A 4R60A 3PKEA 3PKAA 1WKMA 1KQ0A 2GA2A 1PV9A 3PN9A 2Q95A 2OKNA 2V3YA 3MR1A 1W2MA 1WL9A 4IDYA 3FM3A 2HOWA 2NQ7A 3I7MA 1CHMA 2GTXA 2V3XA 2GG2A 2GG5A 1BN5A 4S01A 5CDLA 2Q96A 5D6FA 3CB5A 2GG9A 4S2RP 4OOKA 1R58A 2B3LA 2BWWA 3IU9A 1R5HA 4U75A 5FCFA 4IF7A 1BOAA 3RORA 2GGBA 5JI6A 2BWXA 5CDVA 2EA4A 2Q8KA 2BWUA 4A6WA 2Q94A 1C23A 2BN7A 1XGOA 1B59A 3OVKA 3S6BA 5JHUA 2EVCA 4A6VA 1XNZA 3IU7A 1Y1NA 2P98A 2EVOA 2BHCA 2GGCA 4RZZA 4Z7MA 1C21A 3MATA 5E2CA
chains in the Genus database with same CATH topology
2V6CA 4U6ZA 2BWTA 3IL0A 5E5BA 3FMQA 3BITA 2BWYA 5CLSA 1QXZA 1YVMA 3PKDA 2OAZA 1O0XA 1QXWA 4U71A 4IPAA 4U6WA 4RZYA 5CDEA 1XGSA 2BH3A 4FO7A 2MATA 2GG8A 3D27A 4U70A 4IKTA 5CNXA 1MATA 3FMRA 3CTZA 3PKBA 4FLLA 2EVMA 1A16A 4S00A 2BWVA 1N51A 3PEBA 2IW2A 3IU8A 3IG4A 2Q93A 1KQ9A 5FCHA 3O5VA 4FLIA 4U76A 2GU4A 2GG0A 1W7VA 3RVAA 1XGNA 1XGMA 2BHAA 2V3ZA 1WN1A 4U73A 3OOOA 3CB6A 1QXYA 2GG3A 2GU6A 5D6EA 4FO8A 4HXXA 3BIQA 4RGZ1 2Q92A 2GU7A 4IU6A 3MX6A 2G6PA 3Q6DA 4FLKA 5JFRA 4S2TP 1C24A 4U1BA 2EA2A 4FKCA 4ZWUA 4ZNGA 5CE6A 2B3HA 1JAWA 2DFIA 4EGEA 1C22A 4IKSA 1YW7A 4PV4A 4IKUA 4QR8A 1YJ3A 3PKCA 4KM3A 4U6EA 3BIPA 4B28A 2NQ6A 4PNCA 5CIKA 3TB5A 3TAVA 1WBQA 2GZ5A 2ADUA 2P9AA 4MATA 1WY2A 1KP0A 2ZSGA 3L24A 4ZWOA 4IKRA 4U6JA 4IECA 2B3KA 3L7GA 4ZWPA 2GG7A 2BHBA 2GU5A 4FUKA 2BB7A 1R5GA 1YW9A 1M35A 1QZYA 1WLRA 1B6AA 2BWSA 2P99A 3QOCA 4JUQA 1WL6A 4U6CA 4FLJA 1C27A 2BHDA 1YW8A 4U69A 4R60A 3PKEA 3PKAA 1WKMA 1KQ0A 2GA2A 1PV9A 3PN9A 2Q95A 2OKNA 2V3YA 3MR1A 1W2MA 1WL9A 4IDYA 3FM3A 2HOWA 2NQ7A 3I7MA 1CHMA 2GTXA 2V3XA 2GG2A 2GG5A 1BN5A 4S01A 5CDLA 2Q96A 5D6FA 3CB5A 2GG9A 4S2RP 4OOKA 1R58A 2B3LA 2BWWA 3IU9A 1R5HA 4U75A 5FCFA 4IF7A 1BOAA 3RORA 2GGBA 5JI6A 2BWXA 5CDVA 2EA4A 2Q8KA 2BWUA 4A6WA 2Q94A 1C23A 2BN7A 1XGOA 1B59A 3OVKA 3S6BA 5JHUA 2EVCA 4A6VA 1XNZA 3IU7A 1Y1NA 2P98A 2EVOA 2BHCA 2GGCA 4RZZA 4Z7MA 1C21A 3MATA 5E2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6C A;  4U6Z A;  2BWT A;  3IL0 A;  5E5B A;  3FMQ A;  3BIT A;  2BWY A;  5CLS A;  1QXZ A;  1YVM A;  3PKD A;  2OAZ A;  1O0X A;  1QXW A;  4U71 A;  4IPA A;  4U6W A;  4RZY A;  5CDE A;  1XGS A;  2BH3 A;  4FO7 A;  2MAT A;  2GG8 A;  3D27 A;  4U70 A;  4IKT A;  5CNX A;  1MAT A;  3FMR A;  3CTZ A;  3PKB A;  4FLL A;  2EVM A;  1A16 A;  4S00 A;  2BWV A;  1N51 A;  3PEB A;  2IW2 A;  3IU8 A;  3IG4 A;  2Q93 A;  1KQ9 A;  5FCH A;  3O5V A;  4FLI A;  4U76 A;  2GU4 A;  2GG0 A;  1W7V A;  3RVA A;  1XGN A;  1XGM A;  2BHA A;  2V3Z A;  1WN1 A;  4U73 A;  3OOO A;  3CB6 A;  1QXY A;  2GG3 A;  2GU6 A;  5D6E A;  4FO8 A;  4HXX A;  3BIQ A;  4RGZ 1;  2Q92 A;  2GU7 A;  4IU6 A;  3MX6 A;  2G6P A;  3Q6D A;  4FLK A;  5JFR A;  4S2T P;  1C24 A;  4U1B A;  2EA2 A;  4FKC A;  4ZWU A;  4ZNG A;  5CE6 A;  2B3H A;  1JAW A;  2DFI A;  4EGE A;  1C22 A;  4IKS A;  1YW7 A;  4PV4 A;  4IKU A;  4QR8 A;  1YJ3 A;  3PKC A;  4KM3 A;  4U6E A;  3BIP A;  4B28 A;  2NQ6 A;  4PNC A;  5CIK A;  3TB5 A;  3TAV A;  1WBQ A;  2GZ5 A;  2ADU A;  2P9A A;  4MAT A;  1WY2 A;  1KP0 A;  2ZSG A;  3L24 A;  4ZWO A;  4IKR A;  4U6J A;  4IEC A;  2B3K A;  3L7G A;  4ZWP A;  2GG7 A;  2BHB A;  2GU5 A;  4FUK A;  2BB7 A;  1R5G A;  1YW9 A;  1M35 A;  1QZY A;  1WLR A;  1B6A A;  2BWS A;  2P99 A;  3QOC A;  4JUQ A;  1WL6 A;  4U6C A;  4FLJ A;  1C27 A;  2BHD A;  1YW8 A;  4U69 A;  4R60 A;  3PKE A;  3PKA A;  1WKM A;  1KQ0 A;  2GA2 A;  1PV9 A;  3PN9 A;  2Q95 A;  2OKN A;  2V3Y A;  3MR1 A;  1W2M A;  1WL9 A;  4IDY A;  3FM3 A;  2HOW A;  2NQ7 A;  3I7M A;  1CHM A;  2GTX A;  2V3X A;  2GG2 A;  2GG5 A;  1BN5 A;  4S01 A;  5CDL A;  2Q96 A;  5D6F A;  3CB5 A;  2GG9 A;  4S2R P;  4OOK A;  1R58 A;  2B3L A;  2BWW A;  3IU9 A;  1R5H A;  4U75 A;  5FCF A;  4IF7 A;  1BOA A;  3ROR A;  2GGB A;  5JI6 A;  2BWX A;  5CDV A;  2EA4 A;  2Q8K A;  2BWU A;  4A6W A;  2Q94 A;  1C23 A;  2BN7 A;  1XGO A;  1B59 A;  3OVK A;  3S6B A;  5JHU A;  2EVC A;  4A6V A;  1XNZ A;  3IU7 A;  1Y1N A;  2P98 A;  2EVO A;  2BHC A;  2GGC A;  4RZZ A;  4Z7M A;  1C21 A;  3MAT A;  5E2C A; 
#chains in the Genus database with same CATH topology
 2V6C A;  4U6Z A;  2BWT A;  3IL0 A;  5E5B A;  3FMQ A;  3BIT A;  2BWY A;  5CLS A;  1QXZ A;  1YVM A;  3PKD A;  2OAZ A;  1O0X A;  1QXW A;  4U71 A;  4IPA A;  4U6W A;  4RZY A;  5CDE A;  1XGS A;  2BH3 A;  4FO7 A;  2MAT A;  2GG8 A;  3D27 A;  4U70 A;  4IKT A;  5CNX A;  1MAT A;  3FMR A;  3CTZ A;  3PKB A;  4FLL A;  2EVM A;  1A16 A;  4S00 A;  2BWV A;  1N51 A;  3PEB A;  2IW2 A;  3IU8 A;  3IG4 A;  2Q93 A;  1KQ9 A;  5FCH A;  3O5V A;  4FLI A;  4U76 A;  2GU4 A;  2GG0 A;  1W7V A;  3RVA A;  1XGN A;  1XGM A;  2BHA A;  2V3Z A;  1WN1 A;  4U73 A;  3OOO A;  3CB6 A;  1QXY A;  2GG3 A;  2GU6 A;  5D6E A;  4FO8 A;  4HXX A;  3BIQ A;  4RGZ 1;  2Q92 A;  2GU7 A;  4IU6 A;  3MX6 A;  2G6P A;  3Q6D A;  4FLK A;  5JFR A;  4S2T P;  1C24 A;  4U1B A;  2EA2 A;  4FKC A;  4ZWU A;  4ZNG A;  5CE6 A;  2B3H A;  1JAW A;  2DFI A;  4EGE A;  1C22 A;  4IKS A;  1YW7 A;  4PV4 A;  4IKU A;  4QR8 A;  1YJ3 A;  3PKC A;  4KM3 A;  4U6E A;  3BIP A;  4B28 A;  2NQ6 A;  4PNC A;  5CIK A;  3TB5 A;  3TAV A;  1WBQ A;  2GZ5 A;  2ADU A;  2P9A A;  4MAT A;  1WY2 A;  1KP0 A;  2ZSG A;  3L24 A;  4ZWO A;  4IKR A;  4U6J A;  4IEC A;  2B3K A;  3L7G A;  4ZWP A;  2GG7 A;  2BHB A;  2GU5 A;  4FUK A;  2BB7 A;  1R5G A;  1YW9 A;  1M35 A;  1QZY A;  1WLR A;  1B6A A;  2BWS A;  2P99 A;  3QOC A;  4JUQ A;  1WL6 A;  4U6C A;  4FLJ A;  1C27 A;  2BHD A;  1YW8 A;  4U69 A;  4R60 A;  3PKE A;  3PKA A;  1WKM A;  1KQ0 A;  2GA2 A;  1PV9 A;  3PN9 A;  2Q95 A;  2OKN A;  2V3Y A;  3MR1 A;  1W2M A;  1WL9 A;  4IDY A;  3FM3 A;  2HOW A;  2NQ7 A;  3I7M A;  1CHM A;  2GTX A;  2V3X A;  2GG2 A;  2GG5 A;  1BN5 A;  4S01 A;  5CDL A;  2Q96 A;  5D6F A;  3CB5 A;  2GG9 A;  4S2R P;  4OOK A;  1R58 A;  2B3L A;  2BWW A;  3IU9 A;  1R5H A;  4U75 A;  5FCF A;  4IF7 A;  1BOA A;  3ROR A;  2GGB A;  5JI6 A;  2BWX A;  5CDV A;  2EA4 A;  2Q8K A;  2BWU A;  4A6W A;  2Q94 A;  1C23 A;  2BN7 A;  1XGO A;  1B59 A;  3OVK A;  3S6B A;  5JHU A;  2EVC A;  4A6V A;  1XNZ A;  3IU7 A;  1Y1N A;  2P98 A;  2EVO A;  2BHC A;  2GGC A;  4RZZ A;  4Z7M A;  1C21 A;  3MAT A;  5E2C A; 
#chains in the Genus database with same CATH homology
 2V6C A;  4U6Z A;  2BWT A;  3IL0 A;  5E5B A;  3FMQ A;  3BIT A;  2BWY A;  5CLS A;  1QXZ A;  1YVM A;  3PKD A;  2OAZ A;  1O0X A;  1QXW A;  4U71 A;  4IPA A;  4U6W A;  4RZY A;  5CDE A;  1XGS A;  2BH3 A;  4FO7 A;  2MAT A;  2GG8 A;  3D27 A;  4U70 A;  4IKT A;  5CNX A;  1MAT A;  3FMR A;  3CTZ A;  3PKB A;  4FLL A;  2EVM A;  1A16 A;  4S00 A;  2BWV A;  1N51 A;  3PEB A;  2IW2 A;  3IU8 A;  3IG4 A;  2Q93 A;  1KQ9 A;  5FCH A;  3O5V A;  4FLI A;  4U76 A;  2GU4 A;  2GG0 A;  1W7V A;  3RVA A;  1XGN A;  1XGM A;  2BHA A;  2V3Z A;  1WN1 A;  4U73 A;  3OOO A;  3CB6 A;  1QXY A;  2GG3 A;  2GU6 A;  5D6E A;  4FO8 A;  4HXX A;  3BIQ A;  4RGZ 1;  2Q92 A;  2GU7 A;  4IU6 A;  3MX6 A;  2G6P A;  3Q6D A;  4FLK A;  5JFR A;  4S2T P;  1C24 A;  4U1B A;  2EA2 A;  4FKC A;  4ZWU A;  4ZNG A;  5CE6 A;  2B3H A;  1JAW A;  2DFI A;  4EGE A;  1C22 A;  4IKS A;  1YW7 A;  4PV4 A;  4IKU A;  4QR8 A;  1YJ3 A;  3PKC A;  4KM3 A;  4U6E A;  3BIP A;  4B28 A;  2NQ6 A;  4PNC A;  5CIK A;  3TB5 A;  3TAV A;  1WBQ A;  2GZ5 A;  2ADU A;  2P9A A;  4MAT A;  1WY2 A;  1KP0 A;  2ZSG A;  3L24 A;  4ZWO A;  4IKR A;  4U6J A;  4IEC A;  2B3K A;  3L7G A;  4ZWP A;  2GG7 A;  2BHB A;  2GU5 A;  4FUK A;  2BB7 A;  1R5G A;  1YW9 A;  1M35 A;  1QZY A;  1WLR A;  1B6A A;  2BWS A;  2P99 A;  3QOC A;  4JUQ A;  1WL6 A;  4U6C A;  4FLJ A;  1C27 A;  2BHD A;  1YW8 A;  4U69 A;  4R60 A;  3PKE A;  3PKA A;  1WKM A;  1KQ0 A;  2GA2 A;  1PV9 A;  3PN9 A;  2Q95 A;  2OKN A;  2V3Y A;  3MR1 A;  1W2M A;  1WL9 A;  4IDY A;  3FM3 A;  2HOW A;  2NQ7 A;  3I7M A;  1CHM A;  2GTX A;  2V3X A;  2GG2 A;  2GG5 A;  1BN5 A;  4S01 A;  5CDL A;  2Q96 A;  5D6F A;  3CB5 A;  2GG9 A;  4S2R P;  4OOK A;  1R58 A;  2B3L A;  2BWW A;  3IU9 A;  1R5H A;  4U75 A;  5FCF A;  4IF7 A;  1BOA A;  3ROR A;  2GGB A;  5JI6 A;  2BWX A;  5CDV A;  2EA4 A;  2Q8K A;  2BWU A;  4A6W A;  2Q94 A;  1C23 A;  2BN7 A;  1XGO A;  1B59 A;  3OVK A;  3S6B A;  5JHU A;  2EVC A;  4A6V A;  1XNZ A;  3IU7 A;  1Y1N A;  2P98 A;  2EVO A;  2BHC A;  2GGC A;  4RZZ A;  4Z7M A;  1C21 A;  3MAT A;  5E2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...