2BHDA

Mg substituted e. coli aminopeptidase p in complex with product
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 157
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bhdA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bhdA02
4HXXA 2BWWA 2IW2A 2GU7A 2P99A 4U6WA 2V3XA 2OAZA 3MR1A 3CB6A 4IECA 4FLKA 2BWXA 3BITA 5FCFA 1B6AA 4U70A 4S2TP 1QZYA 2Q94A 1W7VA 1KQ9A 4FLLA 5CNXA 2GG8A 1W2MA 2BB7A 1MATA 4FO8A 1C21A 2GU5A 4A6VA 4FO7A 1PV9A 4OOKA 3BIQA 5E2CA 4U6CA 4IU6A 2V6CA 4ZWOA 1XGOA 1WL6A 2GGBA 2NQ6A 5D6FA 1KP0A 2BWYA 2GG0A 2P9AA 4U76A 5E5BA 3CTZA 4U69A 1C22A 3RORA 5JFRA 2B3HA 3FMRA 2BWTA 2V3YA 1R58A 1CHMA 1O0XA 4A6WA 4PV4A 2GTXA 4IKRA 4U1BA 3FMQA 1YVMA 4QR8A 2ZSGA 1C27A 2BHBA 4S00A 4FUKA 3PKEA 1R5GA 1Y1NA 2Q92A 5JHUA 4Z7MA 4S2RP 1M35A 2BWVA 5CLSA 3PN9A 2BHCA 2GA2A 2GZ5A 3L24A 4B28A 5CIKA 5CDEA 1JAWA 2GG5A 1XNZA 1KQ0A 4U6EA 2GG7A 2GGCA 3QOCA 4FKCA 1WY2A 2BH3A 4ZWUA 3IU7A 2Q8KA 4R60A 3TB5A 2BHAA 2HOWA 2EVMA 2EA4A 2GG3A 3IU9A 3FM3A 4IF7A 1XGSA 2GU4A 2EVCA 1YW8A 4IPAA 2BN7A 1YW9A 3IL0A 5D6EA 1C24A 4RZYA 2ADUA 4U73A 1QXWA 2B3KA 4U71A 3CB5A 1XGMA 2Q95A 2NQ7A 4RGZ1 2BHDA 2Q96A 2OKNA 1YW7A 3OVKA 4S01A 4JUQA 2V3ZA 3L7GA 1QXYA 1WBQA 2EA2A 3IG4A 4RZZA 4EGEA 3PKBA 2BWSA 1WL9A 4ZNGA 1YJ3A 4IKSA 2G6PA 1XGNA 3BIPA 1A16A 1N51A 3MATA 4U75A 3S6BA 5FCHA 1B59A 1BOAA 4FLIA 4IKUA 4FLJA 1R5HA 4MATA 3OOOA 5CDVA 2B3LA 2Q93A 3Q6DA 4ZWPA 1WKMA 4U6JA 4IDYA 3IU8A 2MATA 5JI6A 1BN5A 3PKAA 3PKDA 2BWUA 5CE6A 1WN1A 1QXZA 3I7MA 4IKTA 3PKCA 2GU6A 3D27A 3O5VA 3PEBA 2EVOA 2DFIA 3RVAA 4PNCA 4KM3A 3MX6A 2GG2A 2GG9A 2P98A 3TAVA 4U6ZA 5CDLA 1WLRA 1C23A
chains in the Genus database with same CATH superfamily
4HXXA 2BWWA 2IW2A 2GU7A 2P99A 4U6WA 2V3XA 2OAZA 3MR1A 3CB6A 4IECA 4FLKA 2BWXA 3BITA 5FCFA 1B6AA 4U70A 4S2TP 1QZYA 2Q94A 1W7VA 1KQ9A 4FLLA 5CNXA 2GG8A 1W2MA 2BB7A 1MATA 4FO8A 1C21A 2GU5A 4A6VA 4FO7A 1PV9A 4OOKA 3BIQA 5E2CA 4U6CA 4IU6A 2V6CA 4ZWOA 1XGOA 1WL6A 2GGBA 2NQ6A 5D6FA 1KP0A 2BWYA 2GG0A 2P9AA 4U76A 5E5BA 3CTZA 4U69A 1C22A 3RORA 5JFRA 2B3HA 3FMRA 2BWTA 2V3YA 1R58A 1CHMA 1O0XA 4A6WA 4PV4A 2GTXA 4IKRA 4U1BA 3FMQA 1YVMA 4QR8A 2ZSGA 1C27A 2BHBA 4S00A 4FUKA 3PKEA 1R5GA 1Y1NA 2Q92A 5JHUA 4Z7MA 4S2RP 1M35A 2BWVA 5CLSA 3PN9A 2BHCA 2GA2A 2GZ5A 3L24A 4B28A 5CIKA 5CDEA 1JAWA 2GG5A 1XNZA 1KQ0A 4U6EA 2GG7A 2GGCA 3QOCA 4FKCA 1WY2A 2BH3A 4ZWUA 3IU7A 2Q8KA 4R60A 3TB5A 2BHAA 2HOWA 2EVMA 2EA4A 2GG3A 3IU9A 3FM3A 4IF7A 1XGSA 2GU4A 2EVCA 1YW8A 4IPAA 2BN7A 1YW9A 3IL0A 5D6EA 1C24A 4RZYA 2ADUA 4U73A 1QXWA 2B3KA 4U71A 3CB5A 1XGMA 2Q95A 2NQ7A 4RGZ1 2BHDA 2Q96A 2OKNA 1YW7A 3OVKA 4S01A 4JUQA 2V3ZA 3L7GA 1QXYA 1WBQA 2EA2A 3IG4A 4RZZA 4EGEA 3PKBA 2BWSA 1WL9A 4ZNGA 1YJ3A 4IKSA 2G6PA 1XGNA 3BIPA 1A16A 1N51A 3MATA 4U75A 3S6BA 5FCHA 1B59A 1BOAA 4FLIA 4IKUA 4FLJA 1R5HA 4MATA 3OOOA 5CDVA 2B3LA 2Q93A 3Q6DA 4ZWPA 1WKMA 4U6JA 4IDYA 3IU8A 2MATA 5JI6A 1BN5A 3PKAA 3PKDA 2BWUA 5CE6A 1WN1A 1QXZA 3I7MA 4IKTA 3PKCA 2GU6A 3D27A 3O5VA 3PEBA 2EVOA 2DFIA 3RVAA 4PNCA 4KM3A 3MX6A 2GG2A 2GG9A 2P98A 3TAVA 4U6ZA 5CDLA 1WLRA 1C23A
chains in the Genus database with same CATH topology
4HXXA 2BWWA 2IW2A 2GU7A 2P99A 4U6WA 2V3XA 2OAZA 3MR1A 3CB6A 4IECA 4FLKA 2BWXA 3BITA 5FCFA 1B6AA 4U70A 4S2TP 1QZYA 2Q94A 1W7VA 1KQ9A 4FLLA 5CNXA 2GG8A 1W2MA 2BB7A 1MATA 4FO8A 1C21A 2GU5A 4A6VA 4FO7A 1PV9A 4OOKA 3BIQA 5E2CA 4U6CA 4IU6A 2V6CA 4ZWOA 1XGOA 1WL6A 2GGBA 2NQ6A 5D6FA 1KP0A 2BWYA 2GG0A 2P9AA 4U76A 5E5BA 3CTZA 4U69A 1C22A 3RORA 5JFRA 2B3HA 3FMRA 2BWTA 2V3YA 1R58A 1CHMA 1O0XA 4A6WA 4PV4A 2GTXA 4IKRA 4U1BA 3FMQA 1YVMA 4QR8A 2ZSGA 1C27A 2BHBA 4S00A 4FUKA 3PKEA 1R5GA 1Y1NA 2Q92A 5JHUA 4Z7MA 4S2RP 1M35A 2BWVA 5CLSA 3PN9A 2BHCA 2GA2A 2GZ5A 3L24A 4B28A 5CIKA 5CDEA 1JAWA 2GG5A 1XNZA 1KQ0A 4U6EA 2GG7A 2GGCA 3QOCA 4FKCA 1WY2A 2BH3A 4ZWUA 3IU7A 2Q8KA 4R60A 3TB5A 2BHAA 2HOWA 2EVMA 2EA4A 2GG3A 3IU9A 3FM3A 4IF7A 1XGSA 2GU4A 2EVCA 1YW8A 4IPAA 2BN7A 1YW9A 3IL0A 5D6EA 1C24A 4RZYA 2ADUA 4U73A 1QXWA 2B3KA 4U71A 3CB5A 1XGMA 2Q95A 2NQ7A 4RGZ1 2BHDA 2Q96A 2OKNA 1YW7A 3OVKA 4S01A 4JUQA 2V3ZA 3L7GA 1QXYA 1WBQA 2EA2A 3IG4A 4RZZA 4EGEA 3PKBA 2BWSA 1WL9A 4ZNGA 1YJ3A 4IKSA 2G6PA 1XGNA 3BIPA 1A16A 1N51A 3MATA 4U75A 3S6BA 5FCHA 1B59A 1BOAA 4FLIA 4IKUA 4FLJA 1R5HA 4MATA 3OOOA 5CDVA 2B3LA 2Q93A 3Q6DA 4ZWPA 1WKMA 4U6JA 4IDYA 3IU8A 2MATA 5JI6A 1BN5A 3PKAA 3PKDA 2BWUA 5CE6A 1WN1A 1QXZA 3I7MA 4IKTA 3PKCA 2GU6A 3D27A 3O5VA 3PEBA 2EVOA 2DFIA 3RVAA 4PNCA 4KM3A 3MX6A 2GG2A 2GG9A 2P98A 3TAVA 4U6ZA 5CDLA 1WLRA 1C23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXX A;  2BWW A;  2IW2 A;  2GU7 A;  2P99 A;  4U6W A;  2V3X A;  2OAZ A;  3MR1 A;  3CB6 A;  4IEC A;  4FLK A;  2BWX A;  3BIT A;  5FCF A;  1B6A A;  4U70 A;  4S2T P;  1QZY A;  2Q94 A;  1W7V A;  1KQ9 A;  4FLL A;  5CNX A;  2GG8 A;  1W2M A;  2BB7 A;  1MAT A;  4FO8 A;  1C21 A;  2GU5 A;  4A6V A;  4FO7 A;  1PV9 A;  4OOK A;  3BIQ A;  5E2C A;  4U6C A;  4IU6 A;  2V6C A;  4ZWO A;  1XGO A;  1WL6 A;  2GGB A;  2NQ6 A;  5D6F A;  1KP0 A;  2BWY A;  2GG0 A;  2P9A A;  4U76 A;  5E5B A;  3CTZ A;  4U69 A;  1C22 A;  3ROR A;  5JFR A;  2B3H A;  3FMR A;  2BWT A;  2V3Y A;  1R58 A;  1CHM A;  1O0X A;  4A6W A;  4PV4 A;  2GTX A;  4IKR A;  4U1B A;  3FMQ A;  1YVM A;  4QR8 A;  2ZSG A;  1C27 A;  2BHB A;  4S00 A;  4FUK A;  3PKE A;  1R5G A;  1Y1N A;  2Q92 A;  5JHU A;  4Z7M A;  4S2R P;  1M35 A;  2BWV A;  5CLS A;  3PN9 A;  2BHC A;  2GA2 A;  2GZ5 A;  3L24 A;  4B28 A;  5CIK A;  5CDE A;  1JAW A;  2GG5 A;  1XNZ A;  1KQ0 A;  4U6E A;  2GG7 A;  2GGC A;  3QOC A;  4FKC A;  1WY2 A;  2BH3 A;  4ZWU A;  3IU7 A;  2Q8K A;  4R60 A;  3TB5 A;  2BHA A;  2HOW A;  2EVM A;  2EA4 A;  2GG3 A;  3IU9 A;  3FM3 A;  4IF7 A;  1XGS A;  2GU4 A;  2EVC A;  1YW8 A;  4IPA A;  2BN7 A;  1YW9 A;  3IL0 A;  5D6E A;  1C24 A;  4RZY A;  2ADU A;  4U73 A;  1QXW A;  2B3K A;  4U71 A;  3CB5 A;  1XGM A;  2Q95 A;  2NQ7 A;  4RGZ 1;  2BHD A;  2Q96 A;  2OKN A;  1YW7 A;  3OVK A;  4S01 A;  4JUQ A;  2V3Z A;  3L7G A;  1QXY A;  1WBQ A;  2EA2 A;  3IG4 A;  4RZZ A;  4EGE A;  3PKB A;  2BWS A;  1WL9 A;  4ZNG A;  1YJ3 A;  4IKS A;  2G6P A;  1XGN A;  3BIP A;  1A16 A;  1N51 A;  3MAT A;  4U75 A;  3S6B A;  5FCH A;  1B59 A;  1BOA A;  4FLI A;  4IKU A;  4FLJ A;  1R5H A;  4MAT A;  3OOO A;  5CDV A;  2B3L A;  2Q93 A;  3Q6D A;  4ZWP A;  1WKM A;  4U6J A;  4IDY A;  3IU8 A;  2MAT A;  5JI6 A;  1BN5 A;  3PKA A;  3PKD A;  2BWU A;  5CE6 A;  1WN1 A;  1QXZ A;  3I7M A;  4IKT A;  3PKC A;  2GU6 A;  3D27 A;  3O5V A;  3PEB A;  2EVO A;  2DFI A;  3RVA A;  4PNC A;  4KM3 A;  3MX6 A;  2GG2 A;  2GG9 A;  2P98 A;  3TAV A;  4U6Z A;  5CDL A;  1WLR A;  1C23 A; 
#chains in the Genus database with same CATH topology
 4HXX A;  2BWW A;  2IW2 A;  2GU7 A;  2P99 A;  4U6W A;  2V3X A;  2OAZ A;  3MR1 A;  3CB6 A;  4IEC A;  4FLK A;  2BWX A;  3BIT A;  5FCF A;  1B6A A;  4U70 A;  4S2T P;  1QZY A;  2Q94 A;  1W7V A;  1KQ9 A;  4FLL A;  5CNX A;  2GG8 A;  1W2M A;  2BB7 A;  1MAT A;  4FO8 A;  1C21 A;  2GU5 A;  4A6V A;  4FO7 A;  1PV9 A;  4OOK A;  3BIQ A;  5E2C A;  4U6C A;  4IU6 A;  2V6C A;  4ZWO A;  1XGO A;  1WL6 A;  2GGB A;  2NQ6 A;  5D6F A;  1KP0 A;  2BWY A;  2GG0 A;  2P9A A;  4U76 A;  5E5B A;  3CTZ A;  4U69 A;  1C22 A;  3ROR A;  5JFR A;  2B3H A;  3FMR A;  2BWT A;  2V3Y A;  1R58 A;  1CHM A;  1O0X A;  4A6W A;  4PV4 A;  2GTX A;  4IKR A;  4U1B A;  3FMQ A;  1YVM A;  4QR8 A;  2ZSG A;  1C27 A;  2BHB A;  4S00 A;  4FUK A;  3PKE A;  1R5G A;  1Y1N A;  2Q92 A;  5JHU A;  4Z7M A;  4S2R P;  1M35 A;  2BWV A;  5CLS A;  3PN9 A;  2BHC A;  2GA2 A;  2GZ5 A;  3L24 A;  4B28 A;  5CIK A;  5CDE A;  1JAW A;  2GG5 A;  1XNZ A;  1KQ0 A;  4U6E A;  2GG7 A;  2GGC A;  3QOC A;  4FKC A;  1WY2 A;  2BH3 A;  4ZWU A;  3IU7 A;  2Q8K A;  4R60 A;  3TB5 A;  2BHA A;  2HOW A;  2EVM A;  2EA4 A;  2GG3 A;  3IU9 A;  3FM3 A;  4IF7 A;  1XGS A;  2GU4 A;  2EVC A;  1YW8 A;  4IPA A;  2BN7 A;  1YW9 A;  3IL0 A;  5D6E A;  1C24 A;  4RZY A;  2ADU A;  4U73 A;  1QXW A;  2B3K A;  4U71 A;  3CB5 A;  1XGM A;  2Q95 A;  2NQ7 A;  4RGZ 1;  2BHD A;  2Q96 A;  2OKN A;  1YW7 A;  3OVK A;  4S01 A;  4JUQ A;  2V3Z A;  3L7G A;  1QXY A;  1WBQ A;  2EA2 A;  3IG4 A;  4RZZ A;  4EGE A;  3PKB A;  2BWS A;  1WL9 A;  4ZNG A;  1YJ3 A;  4IKS A;  2G6P A;  1XGN A;  3BIP A;  1A16 A;  1N51 A;  3MAT A;  4U75 A;  3S6B A;  5FCH A;  1B59 A;  1BOA A;  4FLI A;  4IKU A;  4FLJ A;  1R5H A;  4MAT A;  3OOO A;  5CDV A;  2B3L A;  2Q93 A;  3Q6D A;  4ZWP A;  1WKM A;  4U6J A;  4IDY A;  3IU8 A;  2MAT A;  5JI6 A;  1BN5 A;  3PKA A;  3PKD A;  2BWU A;  5CE6 A;  1WN1 A;  1QXZ A;  3I7M A;  4IKT A;  3PKC A;  2GU6 A;  3D27 A;  3O5V A;  3PEB A;  2EVO A;  2DFI A;  3RVA A;  4PNC A;  4KM3 A;  3MX6 A;  2GG2 A;  2GG9 A;  2P98 A;  3TAV A;  4U6Z A;  5CDL A;  1WLR A;  1C23 A; 
#chains in the Genus database with same CATH homology
 4HXX A;  2BWW A;  2IW2 A;  2GU7 A;  2P99 A;  4U6W A;  2V3X A;  2OAZ A;  3MR1 A;  3CB6 A;  4IEC A;  4FLK A;  2BWX A;  3BIT A;  5FCF A;  1B6A A;  4U70 A;  4S2T P;  1QZY A;  2Q94 A;  1W7V A;  1KQ9 A;  4FLL A;  5CNX A;  2GG8 A;  1W2M A;  2BB7 A;  1MAT A;  4FO8 A;  1C21 A;  2GU5 A;  4A6V A;  4FO7 A;  1PV9 A;  4OOK A;  3BIQ A;  5E2C A;  4U6C A;  4IU6 A;  2V6C A;  4ZWO A;  1XGO A;  1WL6 A;  2GGB A;  2NQ6 A;  5D6F A;  1KP0 A;  2BWY A;  2GG0 A;  2P9A A;  4U76 A;  5E5B A;  3CTZ A;  4U69 A;  1C22 A;  3ROR A;  5JFR A;  2B3H A;  3FMR A;  2BWT A;  2V3Y A;  1R58 A;  1CHM A;  1O0X A;  4A6W A;  4PV4 A;  2GTX A;  4IKR A;  4U1B A;  3FMQ A;  1YVM A;  4QR8 A;  2ZSG A;  1C27 A;  2BHB A;  4S00 A;  4FUK A;  3PKE A;  1R5G A;  1Y1N A;  2Q92 A;  5JHU A;  4Z7M A;  4S2R P;  1M35 A;  2BWV A;  5CLS A;  3PN9 A;  2BHC A;  2GA2 A;  2GZ5 A;  3L24 A;  4B28 A;  5CIK A;  5CDE A;  1JAW A;  2GG5 A;  1XNZ A;  1KQ0 A;  4U6E A;  2GG7 A;  2GGC A;  3QOC A;  4FKC A;  1WY2 A;  2BH3 A;  4ZWU A;  3IU7 A;  2Q8K A;  4R60 A;  3TB5 A;  2BHA A;  2HOW A;  2EVM A;  2EA4 A;  2GG3 A;  3IU9 A;  3FM3 A;  4IF7 A;  1XGS A;  2GU4 A;  2EVC A;  1YW8 A;  4IPA A;  2BN7 A;  1YW9 A;  3IL0 A;  5D6E A;  1C24 A;  4RZY A;  2ADU A;  4U73 A;  1QXW A;  2B3K A;  4U71 A;  3CB5 A;  1XGM A;  2Q95 A;  2NQ7 A;  4RGZ 1;  2BHD A;  2Q96 A;  2OKN A;  1YW7 A;  3OVK A;  4S01 A;  4JUQ A;  2V3Z A;  3L7G A;  1QXY A;  1WBQ A;  2EA2 A;  3IG4 A;  4RZZ A;  4EGE A;  3PKB A;  2BWS A;  1WL9 A;  4ZNG A;  1YJ3 A;  4IKS A;  2G6P A;  1XGN A;  3BIP A;  1A16 A;  1N51 A;  3MAT A;  4U75 A;  3S6B A;  5FCH A;  1B59 A;  1BOA A;  4FLI A;  4IKU A;  4FLJ A;  1R5H A;  4MAT A;  3OOO A;  5CDV A;  2B3L A;  2Q93 A;  3Q6D A;  4ZWP A;  1WKM A;  4U6J A;  4IDY A;  3IU8 A;  2MAT A;  5JI6 A;  1BN5 A;  3PKA A;  3PKD A;  2BWU A;  5CE6 A;  1WN1 A;  1QXZ A;  3I7M A;  4IKT A;  3PKC A;  2GU6 A;  3D27 A;  3O5V A;  3PEB A;  2EVO A;  2DFI A;  3RVA A;  4PNC A;  4KM3 A;  3MX6 A;  2GG2 A;  2GG9 A;  2P98 A;  3TAV A;  4U6Z A;  5CDL A;  1WLR A;  1C23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...