2BHDA

Mg substituted e. coli aminopeptidase p in complex with product
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 157
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bhdA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bhdA02
2B3HA 4QR8A 4FLIA 2GZ5A 2GG0A 1PV9A 2EVMA 2Q93A 4U6ZA 1QZYA 3PKEA 2BHDA 3IU7A 4FUKA 4IU6A 2P99A 4MATA 4FLJA 4FLKA 3Q6DA 1B6AA 3PEBA 2BHCA 2GU4A 1M35A 4FO8A 1WKMA 1C22A 2BWSA 1YW8A 4HXXA 5E5BA 2B3LA 1KP0A 2GG8A 4IF7A 3CTZA 1WLRA 5JFRA 4ZWOA 1QXWA 3PKCA 4U6JA 2BWXA 1N51A 1XGMA 3MX6A 2P9AA 3RVAA 2BWUA 3I7MA 4FKCA 2ADUA 3BITA 2BHBA 5CDEA 1O0XA 1WY2A 3PN9A 3L7GA 3QOCA 5CDVA 2B3KA 2GGCA 2V6CA 3IU9A 4OOKA 1W2MA 2BWVA 4R60A 4PNCA 3CB6A 4IKTA 4B28A 3MATA 4U6EA 1JAWA 2GG7A 3FMQA 1R58A 1KQ9A 3TAVA 3MR1A 2HOWA 4IDYA 3OOOA 2V3XA 4S2RP 2GG2A 2BWYA 2GU6A 1B59A 1C21A 1WBQA 5CIKA 4IKSA 5D6FA 4U6WA 3S6BA 3BIQA 4ZWPA 2BWTA 1Y1NA 2BWWA 4FO7A 4S00A 2EA2A 3FM3A 1BN5A 4RZYA 1XGNA 4ZWUA 4KM3A 4Z7MA 1BOAA 4S01A 4EGEA 4IECA 2GU7A 4U76A 2EVOA 1R5HA 2NQ7A 2GGBA 1WN1A 3L24A 3O5VA 2DFIA 2Q94A 1C27A 1WL9A 1W7VA 4RZZA 4U73A 3RORA 2BHAA 1YW9A 2G6PA 2Q95A 2GG9A 1XGSA 4RGZ1 4A6VA 4U1BA 4IKUA 3TB5A 2EVCA 2Q8KA 1YW7A 1WL6A 2V3ZA 2GTXA 1A16A 2MATA 1MATA 5CLSA 4U70A 4U69A 2EA4A 1YVMA 5FCHA 3BIPA 4IKRA 4IPAA 4S2TP 3IU8A 5JHUA 2BB7A 2BH3A 2V3YA 3FMRA 3CB5A 1XGOA 4FLLA 2GU5A 1C24A 4A6WA 2NQ6A 5FCFA 4U6CA 5E2CA 2ZSGA 5CNXA 2GG5A 2Q96A 2Q92A 2OAZA 1QXZA 1R5GA 1KQ0A 3IL0A 3PKDA 2GG3A 3PKBA 3PKAA 4U75A 2BN7A 1QXYA 3D27A 1XNZA 1C23A 5D6EA 3OVKA 1CHMA 2OKNA 4ZNGA 5CDLA 2P98A 2IW2A 3IG4A 1YJ3A 4U71A 2GA2A 4JUQA 5JI6A 4PV4A 5CE6A
chains in the Genus database with same CATH superfamily
2B3HA 4QR8A 4FLIA 2GZ5A 2GG0A 1PV9A 2EVMA 2Q93A 4U6ZA 1QZYA 3PKEA 2BHDA 3IU7A 4FUKA 4IU6A 2P99A 4MATA 4FLJA 4FLKA 3Q6DA 1B6AA 3PEBA 2BHCA 2GU4A 1M35A 4FO8A 1WKMA 1C22A 2BWSA 1YW8A 4HXXA 5E5BA 2B3LA 1KP0A 2GG8A 4IF7A 3CTZA 1WLRA 5JFRA 4ZWOA 1QXWA 3PKCA 4U6JA 2BWXA 1N51A 1XGMA 3MX6A 2P9AA 3RVAA 2BWUA 3I7MA 4FKCA 2ADUA 3BITA 2BHBA 5CDEA 1O0XA 1WY2A 3PN9A 3L7GA 3QOCA 5CDVA 2B3KA 2GGCA 2V6CA 3IU9A 4OOKA 1W2MA 2BWVA 4R60A 4PNCA 3CB6A 4IKTA 4B28A 3MATA 4U6EA 1JAWA 2GG7A 3FMQA 1R58A 1KQ9A 3TAVA 3MR1A 2HOWA 4IDYA 3OOOA 2V3XA 4S2RP 2GG2A 2BWYA 2GU6A 1B59A 1C21A 1WBQA 5CIKA 4IKSA 5D6FA 4U6WA 3S6BA 3BIQA 4ZWPA 2BWTA 1Y1NA 2BWWA 4FO7A 4S00A 2EA2A 3FM3A 1BN5A 4RZYA 1XGNA 4ZWUA 4KM3A 4Z7MA 1BOAA 4S01A 4EGEA 4IECA 2GU7A 4U76A 2EVOA 1R5HA 2NQ7A 2GGBA 1WN1A 3L24A 3O5VA 2DFIA 2Q94A 1C27A 1WL9A 1W7VA 4RZZA 4U73A 3RORA 2BHAA 1YW9A 2G6PA 2Q95A 2GG9A 1XGSA 4RGZ1 4A6VA 4U1BA 4IKUA 3TB5A 2EVCA 2Q8KA 1YW7A 1WL6A 2V3ZA 2GTXA 1A16A 2MATA 1MATA 5CLSA 4U70A 4U69A 2EA4A 1YVMA 5FCHA 3BIPA 4IKRA 4IPAA 4S2TP 3IU8A 5JHUA 2BB7A 2BH3A 2V3YA 3FMRA 3CB5A 1XGOA 4FLLA 2GU5A 1C24A 4A6WA 2NQ6A 5FCFA 4U6CA 5E2CA 2ZSGA 5CNXA 2GG5A 2Q96A 2Q92A 2OAZA 1QXZA 1R5GA 1KQ0A 3IL0A 3PKDA 2GG3A 3PKBA 3PKAA 4U75A 2BN7A 1QXYA 3D27A 1XNZA 1C23A 5D6EA 3OVKA 1CHMA 2OKNA 4ZNGA 5CDLA 2P98A 2IW2A 3IG4A 1YJ3A 4U71A 2GA2A 4JUQA 5JI6A 4PV4A 5CE6A
chains in the Genus database with same CATH topology
2B3HA 4QR8A 4FLIA 2GZ5A 2GG0A 1PV9A 2EVMA 2Q93A 4U6ZA 1QZYA 3PKEA 2BHDA 3IU7A 4FUKA 4IU6A 2P99A 4MATA 4FLJA 4FLKA 3Q6DA 1B6AA 3PEBA 2BHCA 2GU4A 1M35A 4FO8A 1WKMA 1C22A 2BWSA 1YW8A 4HXXA 5E5BA 2B3LA 1KP0A 2GG8A 4IF7A 3CTZA 1WLRA 5JFRA 4ZWOA 1QXWA 3PKCA 4U6JA 2BWXA 1N51A 1XGMA 3MX6A 2P9AA 3RVAA 2BWUA 3I7MA 4FKCA 2ADUA 3BITA 2BHBA 5CDEA 1O0XA 1WY2A 3PN9A 3L7GA 3QOCA 5CDVA 2B3KA 2GGCA 2V6CA 3IU9A 4OOKA 1W2MA 2BWVA 4R60A 4PNCA 3CB6A 4IKTA 4B28A 3MATA 4U6EA 1JAWA 2GG7A 3FMQA 1R58A 1KQ9A 3TAVA 3MR1A 2HOWA 4IDYA 3OOOA 2V3XA 4S2RP 2GG2A 2BWYA 2GU6A 1B59A 1C21A 1WBQA 5CIKA 4IKSA 5D6FA 4U6WA 3S6BA 3BIQA 4ZWPA 2BWTA 1Y1NA 2BWWA 4FO7A 4S00A 2EA2A 3FM3A 1BN5A 4RZYA 1XGNA 4ZWUA 4KM3A 4Z7MA 1BOAA 4S01A 4EGEA 4IECA 2GU7A 4U76A 2EVOA 1R5HA 2NQ7A 2GGBA 1WN1A 3L24A 3O5VA 2DFIA 2Q94A 1C27A 1WL9A 1W7VA 4RZZA 4U73A 3RORA 2BHAA 1YW9A 2G6PA 2Q95A 2GG9A 1XGSA 4RGZ1 4A6VA 4U1BA 4IKUA 3TB5A 2EVCA 2Q8KA 1YW7A 1WL6A 2V3ZA 2GTXA 1A16A 2MATA 1MATA 5CLSA 4U70A 4U69A 2EA4A 1YVMA 5FCHA 3BIPA 4IKRA 4IPAA 4S2TP 3IU8A 5JHUA 2BB7A 2BH3A 2V3YA 3FMRA 3CB5A 1XGOA 4FLLA 2GU5A 1C24A 4A6WA 2NQ6A 5FCFA 4U6CA 5E2CA 2ZSGA 5CNXA 2GG5A 2Q96A 2Q92A 2OAZA 1QXZA 1R5GA 1KQ0A 3IL0A 3PKDA 2GG3A 3PKBA 3PKAA 4U75A 2BN7A 1QXYA 3D27A 1XNZA 1C23A 5D6EA 3OVKA 1CHMA 2OKNA 4ZNGA 5CDLA 2P98A 2IW2A 3IG4A 1YJ3A 4U71A 2GA2A 4JUQA 5JI6A 4PV4A 5CE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3H A;  4QR8 A;  4FLI A;  2GZ5 A;  2GG0 A;  1PV9 A;  2EVM A;  2Q93 A;  4U6Z A;  1QZY A;  3PKE A;  2BHD A;  3IU7 A;  4FUK A;  4IU6 A;  2P99 A;  4MAT A;  4FLJ A;  4FLK A;  3Q6D A;  1B6A A;  3PEB A;  2BHC A;  2GU4 A;  1M35 A;  4FO8 A;  1WKM A;  1C22 A;  2BWS A;  1YW8 A;  4HXX A;  5E5B A;  2B3L A;  1KP0 A;  2GG8 A;  4IF7 A;  3CTZ A;  1WLR A;  5JFR A;  4ZWO A;  1QXW A;  3PKC A;  4U6J A;  2BWX A;  1N51 A;  1XGM A;  3MX6 A;  2P9A A;  3RVA A;  2BWU A;  3I7M A;  4FKC A;  2ADU A;  3BIT A;  2BHB A;  5CDE A;  1O0X A;  1WY2 A;  3PN9 A;  3L7G A;  3QOC A;  5CDV A;  2B3K A;  2GGC A;  2V6C A;  3IU9 A;  4OOK A;  1W2M A;  2BWV A;  4R60 A;  4PNC A;  3CB6 A;  4IKT A;  4B28 A;  3MAT A;  4U6E A;  1JAW A;  2GG7 A;  3FMQ A;  1R58 A;  1KQ9 A;  3TAV A;  3MR1 A;  2HOW A;  4IDY A;  3OOO A;  2V3X A;  4S2R P;  2GG2 A;  2BWY A;  2GU6 A;  1B59 A;  1C21 A;  1WBQ A;  5CIK A;  4IKS A;  5D6F A;  4U6W A;  3S6B A;  3BIQ A;  4ZWP A;  2BWT A;  1Y1N A;  2BWW A;  4FO7 A;  4S00 A;  2EA2 A;  3FM3 A;  1BN5 A;  4RZY A;  1XGN A;  4ZWU A;  4KM3 A;  4Z7M A;  1BOA A;  4S01 A;  4EGE A;  4IEC A;  2GU7 A;  4U76 A;  2EVO A;  1R5H A;  2NQ7 A;  2GGB A;  1WN1 A;  3L24 A;  3O5V A;  2DFI A;  2Q94 A;  1C27 A;  1WL9 A;  1W7V A;  4RZZ A;  4U73 A;  3ROR A;  2BHA A;  1YW9 A;  2G6P A;  2Q95 A;  2GG9 A;  1XGS A;  4RGZ 1;  4A6V A;  4U1B A;  4IKU A;  3TB5 A;  2EVC A;  2Q8K A;  1YW7 A;  1WL6 A;  2V3Z A;  2GTX A;  1A16 A;  2MAT A;  1MAT A;  5CLS A;  4U70 A;  4U69 A;  2EA4 A;  1YVM A;  5FCH A;  3BIP A;  4IKR A;  4IPA A;  4S2T P;  3IU8 A;  5JHU A;  2BB7 A;  2BH3 A;  2V3Y A;  3FMR A;  3CB5 A;  1XGO A;  4FLL A;  2GU5 A;  1C24 A;  4A6W A;  2NQ6 A;  5FCF A;  4U6C A;  5E2C A;  2ZSG A;  5CNX A;  2GG5 A;  2Q96 A;  2Q92 A;  2OAZ A;  1QXZ A;  1R5G A;  1KQ0 A;  3IL0 A;  3PKD A;  2GG3 A;  3PKB A;  3PKA A;  4U75 A;  2BN7 A;  1QXY A;  3D27 A;  1XNZ A;  1C23 A;  5D6E A;  3OVK A;  1CHM A;  2OKN A;  4ZNG A;  5CDL A;  2P98 A;  2IW2 A;  3IG4 A;  1YJ3 A;  4U71 A;  2GA2 A;  4JUQ A;  5JI6 A;  4PV4 A;  5CE6 A; 
#chains in the Genus database with same CATH topology
 2B3H A;  4QR8 A;  4FLI A;  2GZ5 A;  2GG0 A;  1PV9 A;  2EVM A;  2Q93 A;  4U6Z A;  1QZY A;  3PKE A;  2BHD A;  3IU7 A;  4FUK A;  4IU6 A;  2P99 A;  4MAT A;  4FLJ A;  4FLK A;  3Q6D A;  1B6A A;  3PEB A;  2BHC A;  2GU4 A;  1M35 A;  4FO8 A;  1WKM A;  1C22 A;  2BWS A;  1YW8 A;  4HXX A;  5E5B A;  2B3L A;  1KP0 A;  2GG8 A;  4IF7 A;  3CTZ A;  1WLR A;  5JFR A;  4ZWO A;  1QXW A;  3PKC A;  4U6J A;  2BWX A;  1N51 A;  1XGM A;  3MX6 A;  2P9A A;  3RVA A;  2BWU A;  3I7M A;  4FKC A;  2ADU A;  3BIT A;  2BHB A;  5CDE A;  1O0X A;  1WY2 A;  3PN9 A;  3L7G A;  3QOC A;  5CDV A;  2B3K A;  2GGC A;  2V6C A;  3IU9 A;  4OOK A;  1W2M A;  2BWV A;  4R60 A;  4PNC A;  3CB6 A;  4IKT A;  4B28 A;  3MAT A;  4U6E A;  1JAW A;  2GG7 A;  3FMQ A;  1R58 A;  1KQ9 A;  3TAV A;  3MR1 A;  2HOW A;  4IDY A;  3OOO A;  2V3X A;  4S2R P;  2GG2 A;  2BWY A;  2GU6 A;  1B59 A;  1C21 A;  1WBQ A;  5CIK A;  4IKS A;  5D6F A;  4U6W A;  3S6B A;  3BIQ A;  4ZWP A;  2BWT A;  1Y1N A;  2BWW A;  4FO7 A;  4S00 A;  2EA2 A;  3FM3 A;  1BN5 A;  4RZY A;  1XGN A;  4ZWU A;  4KM3 A;  4Z7M A;  1BOA A;  4S01 A;  4EGE A;  4IEC A;  2GU7 A;  4U76 A;  2EVO A;  1R5H A;  2NQ7 A;  2GGB A;  1WN1 A;  3L24 A;  3O5V A;  2DFI A;  2Q94 A;  1C27 A;  1WL9 A;  1W7V A;  4RZZ A;  4U73 A;  3ROR A;  2BHA A;  1YW9 A;  2G6P A;  2Q95 A;  2GG9 A;  1XGS A;  4RGZ 1;  4A6V A;  4U1B A;  4IKU A;  3TB5 A;  2EVC A;  2Q8K A;  1YW7 A;  1WL6 A;  2V3Z A;  2GTX A;  1A16 A;  2MAT A;  1MAT A;  5CLS A;  4U70 A;  4U69 A;  2EA4 A;  1YVM A;  5FCH A;  3BIP A;  4IKR A;  4IPA A;  4S2T P;  3IU8 A;  5JHU A;  2BB7 A;  2BH3 A;  2V3Y A;  3FMR A;  3CB5 A;  1XGO A;  4FLL A;  2GU5 A;  1C24 A;  4A6W A;  2NQ6 A;  5FCF A;  4U6C A;  5E2C A;  2ZSG A;  5CNX A;  2GG5 A;  2Q96 A;  2Q92 A;  2OAZ A;  1QXZ A;  1R5G A;  1KQ0 A;  3IL0 A;  3PKD A;  2GG3 A;  3PKB A;  3PKA A;  4U75 A;  2BN7 A;  1QXY A;  3D27 A;  1XNZ A;  1C23 A;  5D6E A;  3OVK A;  1CHM A;  2OKN A;  4ZNG A;  5CDL A;  2P98 A;  2IW2 A;  3IG4 A;  1YJ3 A;  4U71 A;  2GA2 A;  4JUQ A;  5JI6 A;  4PV4 A;  5CE6 A; 
#chains in the Genus database with same CATH homology
 2B3H A;  4QR8 A;  4FLI A;  2GZ5 A;  2GG0 A;  1PV9 A;  2EVM A;  2Q93 A;  4U6Z A;  1QZY A;  3PKE A;  2BHD A;  3IU7 A;  4FUK A;  4IU6 A;  2P99 A;  4MAT A;  4FLJ A;  4FLK A;  3Q6D A;  1B6A A;  3PEB A;  2BHC A;  2GU4 A;  1M35 A;  4FO8 A;  1WKM A;  1C22 A;  2BWS A;  1YW8 A;  4HXX A;  5E5B A;  2B3L A;  1KP0 A;  2GG8 A;  4IF7 A;  3CTZ A;  1WLR A;  5JFR A;  4ZWO A;  1QXW A;  3PKC A;  4U6J A;  2BWX A;  1N51 A;  1XGM A;  3MX6 A;  2P9A A;  3RVA A;  2BWU A;  3I7M A;  4FKC A;  2ADU A;  3BIT A;  2BHB A;  5CDE A;  1O0X A;  1WY2 A;  3PN9 A;  3L7G A;  3QOC A;  5CDV A;  2B3K A;  2GGC A;  2V6C A;  3IU9 A;  4OOK A;  1W2M A;  2BWV A;  4R60 A;  4PNC A;  3CB6 A;  4IKT A;  4B28 A;  3MAT A;  4U6E A;  1JAW A;  2GG7 A;  3FMQ A;  1R58 A;  1KQ9 A;  3TAV A;  3MR1 A;  2HOW A;  4IDY A;  3OOO A;  2V3X A;  4S2R P;  2GG2 A;  2BWY A;  2GU6 A;  1B59 A;  1C21 A;  1WBQ A;  5CIK A;  4IKS A;  5D6F A;  4U6W A;  3S6B A;  3BIQ A;  4ZWP A;  2BWT A;  1Y1N A;  2BWW A;  4FO7 A;  4S00 A;  2EA2 A;  3FM3 A;  1BN5 A;  4RZY A;  1XGN A;  4ZWU A;  4KM3 A;  4Z7M A;  1BOA A;  4S01 A;  4EGE A;  4IEC A;  2GU7 A;  4U76 A;  2EVO A;  1R5H A;  2NQ7 A;  2GGB A;  1WN1 A;  3L24 A;  3O5V A;  2DFI A;  2Q94 A;  1C27 A;  1WL9 A;  1W7V A;  4RZZ A;  4U73 A;  3ROR A;  2BHA A;  1YW9 A;  2G6P A;  2Q95 A;  2GG9 A;  1XGS A;  4RGZ 1;  4A6V A;  4U1B A;  4IKU A;  3TB5 A;  2EVC A;  2Q8K A;  1YW7 A;  1WL6 A;  2V3Z A;  2GTX A;  1A16 A;  2MAT A;  1MAT A;  5CLS A;  4U70 A;  4U69 A;  2EA4 A;  1YVM A;  5FCH A;  3BIP A;  4IKR A;  4IPA A;  4S2T P;  3IU8 A;  5JHU A;  2BB7 A;  2BH3 A;  2V3Y A;  3FMR A;  3CB5 A;  1XGO A;  4FLL A;  2GU5 A;  1C24 A;  4A6W A;  2NQ6 A;  5FCF A;  4U6C A;  5E2C A;  2ZSG A;  5CNX A;  2GG5 A;  2Q96 A;  2Q92 A;  2OAZ A;  1QXZ A;  1R5G A;  1KQ0 A;  3IL0 A;  3PKD A;  2GG3 A;  3PKB A;  3PKA A;  4U75 A;  2BN7 A;  1QXY A;  3D27 A;  1XNZ A;  1C23 A;  5D6E A;  3OVK A;  1CHM A;  2OKN A;  4ZNG A;  5CDL A;  2P98 A;  2IW2 A;  3IG4 A;  1YJ3 A;  4U71 A;  2GA2 A;  4JUQ A;  5JI6 A;  4PV4 A;  5CE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...