2BHXA

Radiation damage of the schiff base in phosphoserine aminotransferase (structure a)
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
360
structure length
360
Chain Sequence
VKQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKENA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
publication title Strain Relief at the Active Site of Phosphoserine Aminotransferase Induced by Radiation Damage.
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Transferase
total genus 127
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2bhxA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2bhxA02
2VGTA 3AOWA 2DOUA 1M0OA 1WKGA 1E5FA 2AY6A 1MLZA 2Z9VA 4RJ0A 4LNJA 1X2AA 2BKWA 2C44A 5FT6A 4GE7A 1OHYA 2Z9UA 3DODA 2HOYA 2VMSA 2Z1ZA 1DGEA 1N31A 2HP2A 2EPJA 3EIBA 4R5ZA 1AJRA 1E5EA 1JS6A 2QB3A 2VMZA 2VMPA 4MQRA 3G7QA 5G4JA 1Y4IA 2W7MA 3RBLA 3B1EA 4E77A 2TPLA 3A2BA 3WGBA 4UHNA 1OHWA 1VP4A 1C0NA 4Y0HA 5D95A 3GZDC 1CZEA 1CQ7A 1GEXA 3MC6A 4GE9A 3CQ4A 3PDXA 4OBUA 5EFSA 4ZM4A 1C7NA 2JJFA 1G4VA 3B1CA 4JEWA 2Z1YA 4AZJA 3HL2A 3EI7A 4ISYA 3QBOA 3BWOA 3HDOA 3RQ1A 2ZY4A 3KGXA 3WCOA 2PB2A 1AJSA 4OCAA 3HMUA 1FG7A 2VYCA 1SF2A 5J8QA 3H14A 2VI9A 1AAMA 1ELUA 3FFRA 1DTYA 3VOMA 1V72A 1B8GA 4JEYA 4IYOB 4F5MA 2Z67A 2OATA 2VMUA 3F6TA 1O69A 1TARA 1LC5A 5LHAA 1I41A 2AY5A 2VGSA 4A72A 5I92A 1LC7A 2V1PA 3ZRPA 4WXFA 1AKBA 1D7UA 3DU4A 2CINA 1MAQA 1G7WA 1WSTA 2Z61A 3OP7A 4GE4A 3WGCA 1YJYA 4WYFA 2AY8A 5EIGA 4WLHA 1GEWA 3KKIA 1IAXA 5HDMA 2OGAA 4BA4A 2YCNA 4JE5A 1TOIA 5AX8A 2C0RA 4WYDA 4U2HA 1S08A 1EJIA 2VMWA 1RVYA 2W8UA 3AOVA 1LW5A 2CTZA 4FFCA 1U08A 4Q76A 4RJYA 1ZOBA 4UHOA 4A6TA 1AY8A 9AATA 3A9ZA 4ATQA 2QBTA 2YKYA 3MAFB 1W7LA 4N0BA 1KMJA 4IW7A 3AATA 4MSOA 4Y0DA 3DXVA 2HOXA 1CZCA 1ARGA 2QMAA 3HT4A 5F9SA 1AHXA 2VMTA 3EI8A 3NDNA 3NU7A 1O62A 2WK9A 3EI6A 4GEBA 3VP6A 7AATA 1UU1A 2BI1A 4W1VA 2W8VA 2ZYJA 5EUDA 3DXWA 3AEOA 3TCMA 3EZ1A 4AH3A 4F5LA 2ZJGA 4AO9A 1B5PA 2AEUA 4F5GA 3II0A 1X28A 2BIAA 2QA3A 2W7FA 3MC6C 3NYTA 5E3KA 3MADA 1RV4A 1I48A 4U1TA 2BYLA 3EI5A 1OXPA 5EUNA 2EH6A 2HUIA 4GDYA 4GRXA 3JWAA 2ZY5A 2QLRA 4M2JA 1AY5A 2VGWA 1CS1A 1WYUB 3GZDA 3HQTA 2Z9WA 5D5SA 4IXOA 1DJEA 1JG8A 4WXBA 1MAPA 3I4JA 3CAIA 1DKAA 2DR1A 3ASBA 4EB5A 1GCKA 1D2FA 3QPGA 3H7FA 3FRKA 2D61A 4ZDPA 1S09A 3RBFA 3FZ7A 3WLXA 1BQAA 2W8TA 2ORDA 4RIZA 4DGTA 4F5KA 3K40A 4O6ZA 2PO3A 4ZWMA 1QISA 1OHVA 2C81A 3B1DA 2Z9XA 3COGA 3QI6A 1YIYA 2HP1A 2FYFA 1M4NA 3ZRQA 3RCHB 5DJ9A 1B9HA 1BKGA 1AMRA 3LV2A 3R9AA 1H0CA 3CQ5A 3PAAA 4I8AA 1V2EA 4E1OA 3B8XA 4MY5A 4TV7A 1RVUA 1OXOA 3K7YA 4WBTA 1TOKA 2D66A 1JS3A 2E7UA 1CL2A 2JISA 4JEXA 3TFUA 4CBSA 2R5CA 3B46A 2BWPA 4P3MA 4JF0A 2ZUKA 3W1IA 4HVKA 1LS3A 4WXGA 4FL0A 2O1BA 5G0AA 3NRAA 1ZODA 3N5MA 3QN6A 2YCTA 4WB0B 2AY3A 2W8JA 2HOZA 1BJOB 4Q75A 3BN1A 1ASLA 3E77A 3TFTA 3DZZA 4ZM3A 1WYVB 3E2ZB 1ELQA 4ZAHA 2E7IA 4XEWA 1Z7DA 3FDBA 1WYTA 3FZ6A 4MQPA 3DRDA 3EUCA 1M0QA 3PD6B 1GBNA 2AY7A 3VK3A 1ASEA 1SZUA 2AY1A 4EU1A 3W1JA 4ZSWA 2YRIA 1J04A 4KYOA 2VMQA 4DBCA 2VMNA 4IYOA 4MKJA 4CXRA 2OKJA 1M0PA 1SZSA 2VMOA 4B9BA 4DQ6A 3BV0A 2FN6A 4MQQA 3JTXA 1AAWA 1BQDA 3WKSA 4ADEA 2YKUA 1C7OA 1KMKA 4R8DA 4W1WA 1EG5A 1OATA 2CFBA 1N2TA 3FZ8A 4BHDA 5EAVA 3ATHA 3P6KA 4OT8A 2YHKA 3FVSA 3FSLA 5G4IA 5IWQA 3CQ6A 4Y0IA 2E54A 2PB0A 1IVRA 3NYSA 1YNUA 4HF8A 1T3IA 3NTJA 3QHXA 4OC9A 2VMYA 3MAFA 2EGYA 3AENA 4J5UA 4XJMA 2HORA 1GC3A 1AX4A 4B98A 2GB3A 1IBJA 4XJPA 3JU7A 1B9IA 2EZ2A 3FQ8A 3IF2A 4WYAA 3FFHA 5G09A 3G8MA 3AEJC 4MGRA 3A9YA 1MDXA 3ACZA 4F5JA 3RUYA 5E4ZA 2DGLA 3PJ0A 4LW2A 1AMQA 1M0NA 2CANA 4MKKA 1AMSA 2AATA 1G7XA 1W7MA 1XI9A 1YJSA 3BWNC 3FVXA 1X0MA 4LNLA 1LW4A 4A6UA 1ARTA 3BCBA 4OMAA 1M6SA 3NU8A 2YKXA 3A9XA 3HBXA 1FG3A 3AEMA 4Q6RA 4R2NA 5FT8A 1BJNA 2JJEA 3ELEA 2W7GA 3ZZJA 1TASA 2DKJA 2OQXA 3JW9A 4LC3A 4F5IA 2XBNA 1W3UA 1AJSB 5HHYA 4ATPA 4K2MA 5DB5A 1N8PA 3PDBB 1VJOA 4KAMA 3DC1A 1WYUA 1SFFA 1ORDA 1QIRA 3ZRRA 1GEYA 2CH1A 4L0OA 4K2IA 1IAYA 1H1CA 3L8AA 4BA5A 3NUIA 1IX8A 3M5UA 3BCAA 4ADDA 3I5TA 2BI2A 1GC4A 5G2QA 3WZFA 3Q8NA 4PFNA 2DGMA 2ZY3A 4QGRA 2C7TA 1ARIA 1UKJA 2HUUA 1DGDA 1M7YA 1FC4A 3E6GA 5EIGB 3G0TA 3GWPA 1TATA 4RKDA 2HUFA 1TPLA 2AEVA 5LH9A 3IHJA 4JEVA 4RKCA 4EMYA 4PIWA 2FNUA 3UWCA 1ARSA 2X3LA 3RI6A 1YAAA 3FQ7A 4XAUA 1O4SA 4OYTA 3RCHA 1MDZA 2CSTA 3NYUA 1IX6A 1KL2A 3A8UX 4XJLA 1X29A 2VGZA 3MBBA 2BHXA 2CJGA 4XQ2A 2ZSLA 2YOBA 1CL1A 1AKAA 2W8WA 1ASFA 5C6UA 2VIBA 3LVMA 4RM1A 3LY1A 3FCRA 1CJ0A 4ITGA 3GETA 1PFFA 3UE8A 2BYJA 1IX7A 2VGVA 4IY7A 1I43A 4XJOA 1ECXA 2O0RA 1ZC9A 1TOEA 3DYDA 1BJOA 3EIAA 2CJHA 1AY4A 2BI3A 3I16A 1WYVA 5JAYA 3E2ZA 1KKPA 1RV3A 5M46A 3F9TA 4F5HA 2BWOA 4RLGA 3AEMC 3AEJA 1ASMA 1AIBA 2GMSA 3GSBA 3MAUA 3QGUA 1KL1A 2X5FA 2DKBA 2CB1A 4JF1A 4LW4A 2Z20A 2BI9A 2VLFA 3HVYA 2CY8A 3BWNA 3TATA 2VI8A 2G6WA 3MEBA 3E9KA 4PVFA 4W1XA 2JJGA 3TQXA 2EO5A 1DFOA 2BWNA 3OKSA 1QZ9A 5E5IA 2BIEA 3ISLA 3PIUA 1TOGA 4IXZA 1ASDA 1CQ6A 2W7IA 4A0RA 1MLYA 3USFA 4CBRA 3WX9A 1AMAA 4WD2A 3ZZKA 2ZY2A 1S06A 3D6KA 4ZDOA 5DX5A 1BS0A 1BT4A 1QITA 1ASAA 2AY2A 4ZSYA 2W7HA 4KXKA 4M2KA 2OKKA 1LC8A 2VGUA 1AICA 2BIGA 4W5KA 4OTLA 1ASNA 4IXSA 2ZC0A 4E3QA 4UOYA 3AEPA 5M4BA 1EQBA 3WKRA 1YIZA 3UAKA 1YOOA 4P7YA 5BJ3A 2W7DA 4EB7A 1XEYA 2R5CB 2HZPA 1V2FA 2W7LA 1S07A 3R4TA 4LNMA 5FT4A 3KGWA 4K2BA 2R5EA 1AHYA 4JE5D 4TMRA 3AV7A 5M4DA 1YJZA 3ASAA 3EZSA 3BB8A 1ASBA 3GBXA 1MGVA 1M32A 1SPAA 2VIAA 3MKJA 1AHFA 1DJUA 1B5OA 3FQAA 5EQCA 1Z3ZA 4ZDLA 1S0AA 1WYTB 3GR9A 3W1HA 4ADCA 3N0LA 2GMUA 2WK8A 2JGTA 4W91A 3PDBA 2CH2A 4WLJA 1TOJA 4A00A 3LWSA 4W8IA 3NNKA 3L44A 4WYGA 3HLMA 2QB2A 4OBVA 5DJ1A 5K8BA 1ASCA 1ASGA 2NMPA 3E2YA 2JG2A 1JF9A 2BI5A 3FVUA 5BJ4A 2W7JA 1AHEA 3JZLA 2VMXA 3GJUA 1BJ4A 4NOGA 2ZSMA 1O61A 2FM1A 3EI9A 4A0HA 3FKDA 2D65A 1IJIA 4JEZA 8AATA 2V0YA 1QJ3A 1GC2A 1LKCA 1UU2A 3PPLA 1W23A 4GSAA 3FDDA 2AY4A 3GZCA 4H51A 1B4XA 3LVLB 4PFFA 2FNIA 4UQVA 1SVVA 2CJDA 3FTBA 3KE3A 1P3WA 4A0FA 3T32A 3N75A 4BMKA 3FD0A 1BJWA 3AENB 1VEFA 4TN4A 1J32A 3DR4A 3WCNA 3BC8A 2AY9A 4BQ0A 2EZ1A 2YKVA 3LVKA 3VK4A 5FT5A 2WKAA 3PA9A 1PG8A 3BCXA 2XH1A 5TF5A 4E3RA 3E2FA 3LG0A 4WP0A 2FQ6A 2R2NA 2YRRA 1GDEA 1UU0A 2D5YA 1G4XA 3QM2A 3VAXA 1W7NA 2F8JA 1C4KA 2JJHA 4ZLVA 4RITA 1AIAA 2VMVA 3P1TA 3ECDA 4WYCA 2VLHA 3AELA 4UHMA 4ZWVA 1I29A 4Q31A 4F5FA 5EUEA 5HXXA 2YCPA 3NX3A 4WB0A 4R5FA 1D7VA 1D7RA 4ITXA 3DR7A 2OGEA 3PGYA 5EAAA 3LVJA 4A0GA 4AZKA 2X8UA 1BW0A 4M2MA 1GC0A 3JWBA 5M49A 4AO4A 4EFFA 1AKCA 1IUGA 1D7SA 4CVQA 2W7EA 1QGNA 5F8VA 3PD6A 1LK9A 3BS8A 3ELPA 1SZKA 2D63A 2O7CA 2Q7WA 2D64A 5G2PA 1PMOA 4AOAA 2X5DA 1GD9A 1KKJA 2W7KA 4WYEA 4J8LA 2WK7A 4N0WA 4XK1A 1MDOA 3CBFA 2E7JA 2GSAA 2R0TA 2RFVA 1AHGA 1PMMA 1DJ9A 2VMRA 3WY7A 1CQ8A 4F4EA 1WKHA 2GQNA 2D7ZA 3F0HA 3NUBA 4A6RA 4ADBA 2DGKA 4IX8A 4RAEA 1ARHA 1C7GA 1C9CA 4ZASA 2ZP7A 3K28A 1V2DA 1QJ5A 2D7YA 4CXQA 3VK2A
chains in the Genus database with same CATH superfamily
2VGTA 3AOWA 2DOUA 1M0OA 1WKGA 1E5FA 2AY6A 1MLZA 2Z9VA 4RJ0A 4LNJA 1X2AA 2BKWA 2C44A 5FT6A 4GE7A 1OHYA 2Z9UA 3N4XA 2G7JA 3DODA 2HOYA 2VMSA 2Z1ZA 1DGEA 1N31A 2HP2A 2EPJA 3EIBA 4R5ZA 1AJRA 1E5EA 1JS6A 2QB3A 2VMZA 2VMPA 4MQRA 3G7QA 5G4JA 1Y4IA 2W7MA 3RBLA 3B1EA 4E77A 2TPLA 3A2BA 3WGBA 4UHNA 1OHWA 1VP4A 1C0NA 4Y0HA 5D95A 3GZDC 1CZEA 1CQ7A 1GEXA 3MC6A 4GE9A 3CQ4A 3PDXA 4OBUA 5EFSA 4ZM4A 1C7NA 2JJFA 1G4VA 3B1CA 4JEWA 2Z1YA 4AZJA 3HL2A 3EI7A 4ISYA 3QBOA 3BWOA 3HDOA 3RQ1A 2ZY4A 3KGXA 3WCOA 2PB2A 1AJSA 4OCAA 3HMUA 1FG7A 2VYCA 1SF2A 5J8QA 3H14A 2VI9A 1AAMA 1ELUA 3FFRA 1DTYA 3VOMA 1V72A 1B8GA 4JEYA 4IYOB 4F5MA 2Z67A 2OATA 2VMUA 3F6TA 1O69A 1TARA 1LC5A 5LHAA 1I41A 2AY5A 2VGSA 4A72A 5I92A 1LC7A 2V1PA 3ZRPA 4WXFA 1AKBA 1D7UA 3DU4A 2CINA 1MAQA 1G7WA 1WSTA 2Z61A 3OP7A 4GE4A 3WGCA 1YJYA 4WYFA 2AY8A 5EIGA 4WLHA 1GEWA 3KKIA 1IAXA 5HDMA 2OGAA 4BA4A 2YCNA 4JE5A 1TOIA 5AX8A 2C0RA 4WYDA 4U2HA 1S08A 1EJIA 2VMWA 1RVYA 2W8UA 3AOVA 1LW5A 2CTZA 4FFCA 1U08A 4Q76A 4RJYA 1ZOBA 4UHOA 4A6TA 1AY8A 9AATA 3A9ZA 4ATQA 2QBTA 2YKYA 3MAFB 1W7LA 4N0BA 1KMJA 4IW7A 3AATA 4MSOA 4Y0DA 3DXVA 2HOXA 1CZCA 1ARGA 2QMAA 3HT4A 5F9SA 1AHXA 2VMTA 3EI8A 3NDNA 3NU7A 1O62A 2WK9A 3EI6A 4GEBA 3VP6A 7AATA 1UU1A 2BI1A 4W1VA 2W8VA 2ZYJA 5EUDA 3DXWA 3AEOA 3TCMA 3EZ1A 4AH3A 4F5LA 2ZJGA 4AO9A 1B5PA 2AEUA 4F5GA 3II0A 1X28A 2BIAA 2QA3A 2W7FA 3MC6C 3NYTA 5E3KA 3MADA 1RV4A 1I48A 4U1TA 2BYLA 3EI5A 1OXPA 5EUNA 2EH6A 2HUIA 4GDYA 4GRXA 3JWAA 2ZY5A 2QLRA 4M2JA 1AY5A 2VGWA 1CS1A 1WYUB 3GZDA 3HQTA 2Z9WA 5D5SA 4IXOA 1DJEA 1JG8A 4WXBA 1MAPA 3I4JA 3CAIA 1DKAA 2DR1A 3ASBA 4EB5A 1GCKA 1D2FA 3QPGA 3H7FA 3FRKA 2D61A 4ZDPA 1S09A 3RBFA 3FZ7A 3WLXA 1BQAA 2W8TA 2ORDA 4RIZA 4DGTA 4F5KA 3K40A 4O6ZA 2PO3A 4ZWMA 1QISA 1OHVA 2C81A 3B1DA 2Z9XA 3COGA 3QI6A 1YIYA 2HP1A 2FYFA 1M4NA 3ZRQA 3RCHB 5DJ9A 1B9HA 1BKGA 1AMRA 3LV2A 3R9AA 1H0CA 3CQ5A 3PAAA 4I8AA 1V2EA 4E1OA 3B8XA 4MY5A 4TV7A 1RVUA 1OXOA 3K7YA 4WBTA 1TOKA 2D66A 1JS3A 2E7UA 1CL2A 2JISA 4JEXA 3TFUA 4CBSA 2R5CA 3B46A 2BWPA 4P3MA 4JF0A 2ZUKA 3W1IA 4HVKA 1LS3A 4WXGA 4FL0A 2O1BA 5G0AA 3NRAA 1ZODA 3N5MA 3QN6A 2YCTA 4WB0B 2FKIA 2AY3A 2W8JA 2HOZA 1BJOB 4Q75A 3BN1A 1ASLA 3E77A 3TFTA 2WB6A 3DZZA 4ZM3A 2QSRA 1WYVB 3E2ZB 1ELQA 4ZAHA 2E7IA 4XEWA 1Z7DA 3FDBA 1WYTA 3FZ6A 4MQPA 3DRDA 3EUCA 1M0QA 3PD6B 1GBNA 2AY7A 3VK3A 1ASEA 1SZUA 2AY1A 4EU1A 3W1JA 4ZSWA 2YRIA 1J04A 4KYOA 2VMQA 4DBCA 2VMNA 4IYOA 4MKJA 4CXRA 2OKJA 1M0PA 1SZSA 2VMOA 4B9BA 4DQ6A 3BV0A 2FN6A 4MQQA 3JTXA 1AAWA 1BQDA 3WKSA 4ADEA 2YKUA 1C7OA 1KMKA 4R8DA 4W1WA 1EG5A 1OATA 2CFBA 1N2TA 3FZ8A 4BHDA 5EAVA 3ATHA 3P6KA 4OT8A 2YHKA 3FVSA 3FSLA 5G4IA 5IWQA 3CQ6A 4Y0IA 2E54A 2PB0A 1IVRA 3NYSA 1YNUA 4HF8A 1T3IA 3NTJA 3QHXA 4OC9A 2VMYA 3MAFA 2EGYA 3AENA 4J5UA 4XJMA 2HORA 1GC3A 1AX4A 4B98A 2GB3A 1IBJA 4XJPA 3JU7A 1B9IA 2EZ2A 3FQ8A 3IF2A 4WYAA 3FFHA 5G09A 3G8MA 3AEJC 4MGRA 3A9YA 1MDXA 3ACZA 4F5JA 3RUYA 5E4ZA 2DGLA 3PJ0A 2EYQA 4LW2A 1AMQA 1M0NA 2CANA 4MKKA 1AMSA 2AATA 1G7XA 1W7MA 1XI9A 1YJSA 3BWNC 3FVXA 1X0MA 4LNLA 1LW4A 4A6UA 1ARTA 3BCBA 4OMAA 1M6SA 3NU8A 2YKXA 3A9XA 3HBXA 1FG3A 3AEMA 4Q6RA 4R2NA 5FT8A 1BJNA 2JJEA 3ELEA 2W7GA 3ZZJA 1TASA 2DKJA 2OQXA 3JW9A 4LC3A 4F5IA 2XBNA 1W3UA 1AJSB 5HHYA 4ATPA 4K2MA 5DB5A 1N8PA 3PDBB 1VJOA 4KAMA 3DC1A 1WYUA 1SFFA 1ORDA 1QIRA 3ZRRA 1GEYA 2CH1A 4L0OA 4K2IA 1IAYA 1H1CA 3L8AA 4BA5A 3NUIA 1IX8A 3M5UA 3BCAA 4ADDA 3I5TA 2BI2A 1GC4A 5G2QA 3WZFA 3Q8NA 4PFNA 2DGMA 2ZY3A 4QGRA 2C7TA 1ARIA 1UKJA 2HUUA 1DGDA 1M7YA 1FC4A 3E6GA 5EIGB 3G0TA 3GWPA 1TATA 4RKDA 2HUFA 1TPLA 2AEVA 5LH9A 3IHJA 4JEVA 4RKCA 4EMYA 4PIWA 2FNUA 3UWCA 1ARSA 2X3LA 3RI6A 1YAAA 3FQ7A 4XAUA 1O4SA 4OYTA 3RCHA 1MDZA 2CSTA 3NYUA 1IX6A 1KL2A 3A8UX 4XJLA 1X29A 2VGZA 3MBBA 2BHXA 2CJGA 4XQ2A 2ZSLA 2YOBA 1CL1A 1AKAA 2W8WA 1ASFA 5C6UA 2VIBA 1KAFA 3LVMA 4RM1A 3LY1A 3FCRA 1CJ0A 4ITGA 3GETA 1PFFA 3UE8A 2BYJA 1IX7A 2VGVA 4IY7A 1I43A 4XJOA 1ECXA 2O0RA 1ZC9A 1TOEA 3DYDA 1BJOA 3EIAA 2CJHA 1AY4A 2BI3A 3I16A 4K05A 1WYVA 5JAYA 3E2ZA 1KKPA 1RV3A 5M46A 5KTBA 3F9TA 4F5HA 2BWOA 4RLGA 3AEMC 3AEJA 1ASMA 1AIBA 2GMSA 3GSBA 3MAUA 3N4SA 3QGUA 1KL1A 2X5FA 2DKBA 2CB1A 4JF1A 4LW4A 2Z20A 2BI9A 2VLFA 3HVYA 2CY8A 3BWNA 3TATA 2VI8A 2G6WA 3MEBA 3E9KA 4PVFA 4W1XA 2JJGA 3TQXA 2EO5A 1DFOA 2BWNA 3OKSA 1QZ9A 5E5IA 2BIEA 3ISLA 3PIUA 1TOGA 4IXZA 1ASDA 1CQ6A 2W7IA 4A0RA 1MLYA 3USFA 4CBRA 3WX9A 1AMAA 4WD2A 3ZZKA 2ZY2A 1S06A 3D6KA 4ZDOA 5DX5A 1BS0A 1BT4A 1QITA 1ASAA 2AY2A 4ZSYA 2W7HA 4KXKA 4M2KA 2OKKA 1LC8A 2VGUA 1AICA 2BIGA 4W5KA 4OTLA 1ASNA 4IXSA 2ZC0A 4E3QA 4UOYA 3AEPA 5M4BA 1EQBA 3WKRA 1YIZA 3UAKA 1YOOA 4P7YA 5BJ3A 2W7DA 4EB7A 1XEYA 2R5CB 2HZPA 1V2FA 2W7LA 1S07A 3R4TA 4LNMA 5FT4A 3KGWA 4K2BA 2R5EA 1AHYA 4JE5D 4TMRA 3AV7A 5M4DA 1YJZA 3ASAA 3EZSA 3BB8A 1ASBA 3GBXA 1MGVA 1M32A 1SPAA 2VIAA 3MKJA 1AHFA 1DJUA 1B5OA 3FQAA 5EQCA 1Z3ZA 4ZDLA 1S0AA 1WYTB 3GR9A 3W1HA 4ADCA 2A1VA 3N0LA 2GMUA 2WK8A 2JGTA 4W91A 3PDBA 2CH2A 4WLJA 1TOJA 4A00A 3LWSA 4W8IA 3NNKA 3L44A 4WYGA 3HLMA 2QB2A 2KFPA 4OBVA 5DJ1A 5K8BA 1ASCA 1ASGA 2NMPA 3E2YA 2JG2A 1JF9A 2BI5A 3FVUA 5BJ4A 2W7JA 1AHEA 3JZLA 2VMXA 3GJUA 1BJ4A 4NOGA 2ZSMA 1O61A 2FM1A 3EI9A 4A0HA 3FKDA 2D65A 1IJIA 4JEZA 8AATA 2V0YA 1QJ3A 1GC2A 1LKCA 1UU2A 3PPLA 1W23A 4GSAA 3FDDA 2AY4A 3GZCA 4H51A 1B4XA 3LVLB 4PFFA 2FNIA 4UQVA 1SVVA 2CJDA 3H9XA 3FTBA 3KE3A 1P3WA 4A0FA 3T32A 3N75A 4BMKA 3FD0A 1BJWA 3AENB 1VEFA 4TN4A 1J32A 3DR4A 3WCNA 3BC8A 2AY9A 4BQ0A 2EZ1A 2YKVA 3LVKA 3VK4A 5FT5A 2WKAA 3PA9A 1PG8A 3BCXA 2XH1A 5TF5A 4E3RA 3E2FA 3LG0A 4WP0A 2FQ6A 2R2NA 2YRRA 1GDEA 1UU0A 2D5YA 1G4XA 3QM2A 3N7NA 3VAXA 1W7NA 2F8JA 1C4KA 2JJHA 4ZLVA 4RITA 1AIAA 2VMVA 3P1TA 3ECDA 4WYCA 2VLHA 3AELA 4UHMA 4ZWVA 1I29A 4Q31A 4F5FA 5EUEA 5HXXA 2YCPA 3NX3A 4H63Q 4WB0A 4R5FA 1D7VA 1D7RA 4ITXA 3DR7A 2OGEA 3PGYA 5EAAA 3LVJA 4A0GA 4AZKA 2X8UA 1BW0A 4M2MA 1GC0A 3JWBA 5M49A 4AO4A 4EFFA 1AKCA 1IUGA 1D7SA 4CVQA 2W7EA 1QGNA 5F8VA 3PD6A 1LK9A 3BS8A 3ELPA 1SZKA 2D63A 2O7CA 2Q7WA 2D64A 5G2PA 1PMOA 4AOAA 3N4RA 2X5DA 1GD9A 1KKJA 2W7KA 4WYEA 4J8LA 2WK7A 4N0WA 4XK1A 1MDOA 3CBFA 2E7JA 2GSAA 2R0TA 2RFVA 1AHGA 1PMMA 1DJ9A 2VMRA 3WY7A 1CQ8A 4F4EA 1WKHA 2GQNA 2D7ZA 3F0HA 3NUBA 4A6RA 4ADBA 2DGKA 4IX8A 4RAEA 1ARHA 1C7GA 1C9CA 4ZASA 2ZP7A 3K28A 1V2DA 1QJ5A 2D7YA 4CXQA 3VK2A
chains in the Genus database with same CATH topology
2VGTA 3AOWA 2DOUA 1M0OA 1WKGA 1E5FA 2AY6A 1MLZA 2Z9VA 4RJ0A 4LNJA 1X2AA 2BKWA 2C44A 5FT6A 4GE7A 1OHYA 2Z9UA 3N4XA 2G7JA 3DODA 2HOYA 2VMSA 2Z1ZA 1DGEA 1N31A 2HP2A 2EPJA 3EIBA 4R5ZA 1AJRA 1E5EA 1JS6A 2QB3A 2VMZA 2VMPA 4MQRA 3G7QA 5G4JA 1Y4IA 2W7MA 3RBLA 3B1EA 4E77A 2TPLA 3A2BA 3WGBA 4UHNA 1OHWA 1VP4A 1C0NA 4Y0HA 5D95A 3GZDC 1CZEA 1CQ7A 1GEXA 3MC6A 4GE9A 3CQ4A 3PDXA 4OBUA 5EFSA 4ZM4A 1C7NA 2JJFA 1G4VA 3B1CA 4JEWA 2Z1YA 4AZJA 3HL2A 3EI7A 4ISYA 3QBOA 3BWOA 3HDOA 3RQ1A 2ZY4A 3KGXA 3WCOA 2PB2A 1AJSA 4OCAA 3HMUA 1FG7A 2VYCA 1SF2A 5J8QA 3H14A 2VI9A 1AAMA 1ELUA 3FFRA 1DTYA 3VOMA 1V72A 1B8GA 4JEYA 4IYOB 4F5MA 2Z67A 2OATA 2VMUA 3F6TA 1O69A 1TARA 1LC5A 5LHAA 1I41A 2AY5A 2VGSA 4A72A 5I92A 1LC7A 2V1PA 3ZRPA 4WXFA 1AKBA 1D7UA 3DU4A 2CINA 1MAQA 1G7WA 1WSTA 2Z61A 3OP7A 4GE4A 3WGCA 1YJYA 4WYFA 2AY8A 5EIGA 4WLHA 1GEWA 3KKIA 1IAXA 5HDMA 2OGAA 4BA4A 2YCNA 4JE5A 1TOIA 5AX8A 2C0RA 4WYDA 4U2HA 1S08A 1EJIA 2VMWA 1RVYA 2W8UA 3AOVA 1LW5A 2CTZA 4FFCA 1U08A 4Q76A 4RJYA 1ZOBA 4UHOA 4A6TA 1AY8A 9AATA 3A9ZA 4ATQA 2QBTA 2YKYA 3MAFB 1W7LA 4N0BA 1KMJA 4IW7A 3AATA 4MSOA 4Y0DA 3DXVA 2HOXA 1CZCA 1ARGA 2QMAA 3HT4A 5F9SA 1AHXA 2VMTA 3EI8A 3NDNA 3NU7A 1O62A 2WK9A 3EI6A 4GEBA 3VP6A 7AATA 1UU1A 2BI1A 4W1VA 2W8VA 2ZYJA 5EUDA 3DXWA 3AEOA 3TCMA 3EZ1A 4AH3A 4F5LA 2ZJGA 4AO9A 1B5PA 2AEUA 4F5GA 3II0A 1X28A 2BIAA 2QA3A 2W7FA 3MC6C 3NYTA 5E3KA 3MADA 1RV4A 1I48A 4U1TA 2BYLA 3EI5A 1OXPA 5EUNA 2EH6A 2HUIA 4GDYA 4GRXA 3JWAA 2ZY5A 2QLRA 4M2JA 1AY5A 2VGWA 1CS1A 1WYUB 3GZDA 3HQTA 2Z9WA 5D5SA 4IXOA 1DJEA 1JG8A 4WXBA 1MAPA 3I4JA 3CAIA 1DKAA 2DR1A 3ASBA 4EB5A 1GCKA 1D2FA 3QPGA 3H7FA 3FRKA 2D61A 4ZDPA 1S09A 3RBFA 3FZ7A 3WLXA 1BQAA 2W8TA 2ORDA 4RIZA 4DGTA 4F5KA 3K40A 4O6ZA 2PO3A 4ZWMA 1QISA 1OHVA 2C81A 3B1DA 2Z9XA 3COGA 3QI6A 1YIYA 2HP1A 2FYFA 1M4NA 3ZRQA 3RCHB 5DJ9A 1B9HA 1BKGA 1AMRA 3LV2A 3R9AA 1H0CA 3CQ5A 3PAAA 4I8AA 1V2EA 4E1OA 3B8XA 4MY5A 4TV7A 1RVUA 1OXOA 3K7YA 4WBTA 1TOKA 2D66A 1JS3A 2E7UA 1CL2A 2JISA 4JEXA 3TFUA 4CBSA 2R5CA 3B46A 2BWPA 4P3MA 4JF0A 2ZUKA 3W1IA 4HVKA 1LS3A 4WXGA 4FL0A 2O1BA 5G0AA 3NRAA 1ZODA 3N5MA 3QN6A 2YCTA 4WB0B 2FKIA 2AY3A 2W8JA 2HOZA 1BJOB 4Q75A 3BN1A 1ASLA 3E77A 3TFTA 2WB6A 3DZZA 4ZM3A 2QSRA 1WYVB 3E2ZB 1ELQA 4ZAHA 2E7IA 4XEWA 1Z7DA 3FDBA 1WYTA 3FZ6A 4MQPA 3DRDA 3EUCA 1M0QA 3PD6B 1GBNA 2AY7A 3VK3A 1ASEA 1SZUA 2AY1A 4EU1A 3W1JA 4ZSWA 2YRIA 1J04A 4KYOA 2VMQA 4DBCA 2VMNA 4IYOA 4MKJA 4CXRA 2OKJA 1M0PA 1SZSA 2VMOA 4B9BA 4DQ6A 3BV0A 2FN6A 4MQQA 3JTXA 1AAWA 1BQDA 3WKSA 4ADEA 2YKUA 1C7OA 1KMKA 4R8DA 4W1WA 1EG5A 1OATA 2CFBA 1N2TA 3FZ8A 4BHDA 5EAVA 3ATHA 3P6KA 4OT8A 2YHKA 3FVSA 3FSLA 5G4IA 5IWQA 3CQ6A 4Y0IA 2E54A 2PB0A 1IVRA 3NYSA 1YNUA 4HF8A 1T3IA 3NTJA 3QHXA 4OC9A 2VMYA 3MAFA 2EGYA 3AENA 4J5UA 4XJMA 2HORA 1GC3A 1AX4A 4B98A 2GB3A 1IBJA 4XJPA 3JU7A 1B9IA 2EZ2A 3FQ8A 3IF2A 4WYAA 3FFHA 5G09A 3G8MA 3AEJC 4MGRA 3A9YA 1MDXA 3ACZA 4F5JA 3RUYA 5E4ZA 2DGLA 3PJ0A 2EYQA 4LW2A 1AMQA 1M0NA 2CANA 4MKKA 1AMSA 2AATA 1G7XA 1W7MA 1XI9A 1YJSA 3BWNC 3FVXA 1X0MA 4LNLA 1LW4A 4A6UA 1ARTA 3BCBA 4OMAA 1M6SA 3NU8A 2YKXA 3A9XA 3HBXA 1FG3A 3AEMA 4Q6RA 4R2NA 5FT8A 1BJNA 2JJEA 3ELEA 2W7GA 3ZZJA 1TASA 2DKJA 2OQXA 3JW9A 4LC3A 4F5IA 2XBNA 1W3UA 1AJSB 5HHYA 4ATPA 4K2MA 5DB5A 1N8PA 3PDBB 1VJOA 4KAMA 3DC1A 1WYUA 1SFFA 1ORDA 1QIRA 3ZRRA 1GEYA 2CH1A 4L0OA 4K2IA 1IAYA 1H1CA 3L8AA 4BA5A 3NUIA 1IX8A 3M5UA 3BCAA 4ADDA 3I5TA 2BI2A 1GC4A 5G2QA 3WZFA 3Q8NA 4PFNA 2DGMA 2ZY3A 4QGRA 2C7TA 1ARIA 1UKJA 2HUUA 1DGDA 1M7YA 1FC4A 3E6GA 5EIGB 3G0TA 3GWPA 1TATA 4RKDA 2HUFA 1TPLA 2AEVA 5LH9A 3IHJA 4JEVA 4RKCA 4EMYA 4PIWA 2FNUA 3UWCA 1ARSA 2X3LA 3RI6A 1YAAA 3FQ7A 4XAUA 1O4SA 4OYTA 3RCHA 1MDZA 2CSTA 3NYUA 1IX6A 1KL2A 3A8UX 4XJLA 1X29A 2VGZA 3MBBA 2BHXA 2CJGA 4XQ2A 2ZSLA 2YOBA 1CL1A 1AKAA 2W8WA 1ASFA 5C6UA 2VIBA 3LVMA 4RM1A 3LY1A 3FCRA 1CJ0A 4ITGA 3GETA 1PFFA 3UE8A 2BYJA 1IX7A 2VGVA 4IY7A 1I43A 4XJOA 1ECXA 2O0RA 1ZC9A 1TOEA 3DYDA 1BJOA 3EIAA 2CJHA 1AY4A 2BI3A 3I16A 4K05A 1WYVA 5JAYA 3E2ZA 1KKPA 1RV3A 5M46A 5KTBA 3F9TA 4F5HA 2BWOA 4RLGA 3AEMC 3AEJA 1ASMA 1AIBA 2GMSA 3GSBA 3MAUA 3N4SA 3QGUA 1KL1A 2X5FA 2DKBA 2CB1A 4JF1A 4LW4A 2Z20A 2BI9A 2VLFA 3HVYA 2CY8A 3BWNA 3TATA 2VI8A 2G6WA 3MEBA 3E9KA 4PVFA 4W1XA 2JJGA 3TQXA 2EO5A 1DFOA 2BWNA 3OKSA 1QZ9A 5E5IA 2BIEA 3ISLA 3PIUA 1TOGA 4IXZA 1ASDA 1CQ6A 2W7IA 4A0RA 1MLYA 3USFA 4CBRA 3WX9A 1AMAA 4WD2A 3ZZKA 2ZY2A 1S06A 3D6KA 4ZDOA 5DX5A 1BS0A 1BT4A 1QITA 1ASAA 2AY2A 4ZSYA 2W7HA 4KXKA 4M2KA 2OKKA 1LC8A 2VGUA 1AICA 2BIGA 4W5KA 4OTLA 1ASNA 4IXSA 2ZC0A 4E3QA 4UOYA 3AEPA 5M4BA 1EQBA 3WKRA 1YIZA 3UAKA 1YOOA 4P7YA 5BJ3A 2W7DA 4EB7A 1XEYA 2R5CB 2HZPA 1V2FA 2W7LA 1S07A 3R4TA 4LNMA 5FT4A 3KGWA 4K2BA 2R5EA 1AHYA 4JE5D 4TMRA 3AV7A 5M4DA 1YJZA 3ASAA 3EZSA 3BB8A 1ASBA 3GBXA 1MGVA 1M32A 1SPAA 2VIAA 3MKJA 1AHFA 1DJUA 1B5OA 3FQAA 5EQCA 1Z3ZA 4ZDLA 1S0AA 1WYTB 3GR9A 3W1HA 4ADCA 2A1VA 3N0LA 2GMUA 2WK8A 2JGTA 4W91A 3PDBA 2CH2A 4WLJA 1TOJA 4A00A 3LWSA 4W8IA 3NNKA 3L44A 4WYGA 3HLMA 2QB2A 2KFPA 4OBVA 5DJ1A 5K8BA 1ASCA 1ASGA 2NMPA 3E2YA 2JG2A 1JF9A 2BI5A 3FVUA 5BJ4A 2W7JA 1AHEA 3JZLA 2VMXA 3GJUA 1BJ4A 4NOGA 2ZSMA 1O61A 2FM1A 3EI9A 4A0HA 3FKDA 2D65A 1IJIA 4JEZA 8AATA 2V0YA 1QJ3A 1GC2A 1LKCA 1UU2A 3PPLA 1W23A 4GSAA 3FDDA 2AY4A 3GZCA 4H51A 1B4XA 3LVLB 4PFFA 2FNIA 4UQVA 1SVVA 2CJDA 3H9XA 3FTBA 3KE3A 1P3WA 4A0FA 3T32A 3N75A 4BMKA 3FD0A 1BJWA 3AENB 1VEFA 4TN4A 1J32A 3DR4A 3WCNA 3BC8A 2AY9A 4BQ0A 2EZ1A 2YKVA 3LVKA 3VK4A 5FT5A 2WKAA 3PA9A 1PG8A 3BCXA 2XH1A 5TF5A 4E3RA 3E2FA 3LG0A 4WP0A 2FQ6A 2R2NA 2YRRA 1GDEA 1UU0A 2D5YA 1G4XA 3QM2A 3N7NA 3VAXA 1W7NA 2F8JA 1C4KA 2JJHA 4ZLVA 4RITA 1AIAA 2VMVA 3P1TA 3ECDA 4WYCA 2VLHA 3AELA 4UHMA 4ZWVA 1I29A 4Q31A 4F5FA 5EUEA 5HXXA 2YCPA 3NX3A 4H63Q 4WB0A 4R5FA 1D7VA 1D7RA 4ITXA 3DR7A 2OGEA 3PGYA 5EAAA 3LVJA 4A0GA 4AZKA 2X8UA 1BW0A 4M2MA 1GC0A 3JWBA 5M49A 4AO4A 4EFFA 1AKCA 1IUGA 1D7SA 4CVQA 2W7EA 1QGNA 5F8VA 3PD6A 1LK9A 3BS8A 3ELPA 1SZKA 2D63A 2O7CA 2Q7WA 2D64A 5G2PA 1PMOA 4AOAA 3N4RA 2X5DA 1GD9A 1KKJA 2W7KA 4WYEA 4J8LA 2WK7A 4N0WA 4XK1A 1MDOA 3CBFA 2E7JA 2GSAA 2R0TA 2RFVA 1AHGA 1PMMA 1DJ9A 2VMRA 3WY7A 1CQ8A 4F4EA 1WKHA 2GQNA 2D7ZA 3F0HA 3NUBA 4A6RA 4ADBA 2DGKA 4IX8A 4RAEA 1ARHA 1C7GA 1C9CA 4ZASA 2ZP7A 3K28A 1V2DA 1QJ5A 2D7YA 4CXQA 3VK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGT A;  3AOW A;  2DOU A;  1M0O A;  1WKG A;  1E5F A;  2AY6 A;  1MLZ A;  2Z9V A;  4RJ0 A;  4LNJ A;  1X2A A;  2BKW A;  2C44 A;  5FT6 A;  4GE7 A;  1OHY A;  2Z9U A;  3DOD A;  2HOY A;  2VMS A;  2Z1Z A;  1DGE A;  1N31 A;  2HP2 A;  2EPJ A;  3EIB A;  4R5Z A;  1AJR A;  1E5E A;  1JS6 A;  2QB3 A;  2VMZ A;  2VMP A;  4MQR A;  3G7Q A;  5G4J A;  1Y4I A;  2W7M A;  3RBL A;  3B1E A;  4E77 A;  2TPL A;  3A2B A;  3WGB A;  4UHN A;  1OHW A;  1VP4 A;  1C0N A;  4Y0H A;  5D95 A;  3GZD C;  1CZE A;  1CQ7 A;  1GEX A;  3MC6 A;  4GE9 A;  3CQ4 A;  3PDX A;  4OBU A;  5EFS A;  4ZM4 A;  1C7N A;  2JJF A;  1G4V A;  3B1C A;  4JEW A;  2Z1Y A;  4AZJ A;  3HL2 A;  3EI7 A;  4ISY A;  3QBO A;  3BWO A;  3HDO A;  3RQ1 A;  2ZY4 A;  3KGX A;  3WCO A;  2PB2 A;  1AJS A;  4OCA A;  3HMU A;  1FG7 A;  2VYC A;  1SF2 A;  5J8Q A;  3H14 A;  2VI9 A;  1AAM A;  1ELU A;  3FFR A;  1DTY A;  3VOM A;  1V72 A;  1B8G A;  4JEY A;  4IYO B;  4F5M A;  2Z67 A;  2OAT A;  2VMU A;  3F6T A;  1O69 A;  1TAR A;  1LC5 A;  5LHA A;  1I41 A;  2AY5 A;  2VGS A;  4A72 A;  5I92 A;  1LC7 A;  2V1P A;  3ZRP A;  4WXF A;  1AKB A;  1D7U A;  3DU4 A;  2CIN A;  1MAQ A;  1G7W A;  1WST A;  2Z61 A;  3OP7 A;  4GE4 A;  3WGC A;  1YJY A;  4WYF A;  2AY8 A;  5EIG A;  4WLH A;  1GEW A;  3KKI A;  1IAX A;  5HDM A;  2OGA A;  4BA4 A;  2YCN A;  4JE5 A;  1TOI A;  5AX8 A;  2C0R A;  4WYD A;  4U2H A;  1S08 A;  1EJI A;  2VMW A;  1RVY A;  2W8U A;  3AOV A;  1LW5 A;  2CTZ A;  4FFC A;  1U08 A;  4Q76 A;  4RJY A;  1ZOB A;  4UHO A;  4A6T A;  1AY8 A;  9AAT A;  3A9Z A;  4ATQ A;  2QBT A;  2YKY A;  3MAF B;  1W7L A;  4N0B A;  1KMJ A;  4IW7 A;  3AAT A;  4MSO A;  4Y0D A;  3DXV A;  2HOX A;  1CZC A;  1ARG A;  2QMA A;  3HT4 A;  5F9S A;  1AHX A;  2VMT A;  3EI8 A;  3NDN A;  3NU7 A;  1O62 A;  2WK9 A;  3EI6 A;  4GEB A;  3VP6 A;  7AAT A;  1UU1 A;  2BI1 A;  4W1V A;  2W8V A;  2ZYJ A;  5EUD A;  3DXW A;  3AEO A;  3TCM A;  3EZ1 A;  4AH3 A;  4F5L A;  2ZJG A;  4AO9 A;  1B5P A;  2AEU A;  4F5G A;  3II0 A;  1X28 A;  2BIA A;  2QA3 A;  2W7F A;  3MC6 C;  3NYT A;  5E3K A;  3MAD A;  1RV4 A;  1I48 A;  4U1T A;  2BYL A;  3EI5 A;  1OXP A;  5EUN A;  2EH6 A;  2HUI A;  4GDY A;  4GRX A;  3JWA A;  2ZY5 A;  2QLR A;  4M2J A;  1AY5 A;  2VGW A;  1CS1 A;  1WYU B;  3GZD A;  3HQT A;  2Z9W A;  5D5S A;  4IXO A;  1DJE A;  1JG8 A;  4WXB A;  1MAP A;  3I4J A;  3CAI A;  1DKA A;  2DR1 A;  3ASB A;  4EB5 A;  1GCK A;  1D2F A;  3QPG A;  3H7F A;  3FRK A;  2D61 A;  4ZDP A;  1S09 A;  3RBF A;  3FZ7 A;  3WLX A;  1BQA A;  2W8T A;  2ORD A;  4RIZ A;  4DGT A;  4F5K A;  3K40 A;  4O6Z A;  2PO3 A;  4ZWM A;  1QIS A;  1OHV A;  2C81 A;  3B1D A;  2Z9X A;  3COG A;  3QI6 A;  1YIY A;  2HP1 A;  2FYF A;  1M4N A;  3ZRQ A;  3RCH B;  5DJ9 A;  1B9H A;  1BKG A;  1AMR A;  3LV2 A;  3R9A A;  1H0C A;  3CQ5 A;  3PAA A;  4I8A A;  1V2E A;  4E1O A;  3B8X A;  4MY5 A;  4TV7 A;  1RVU A;  1OXO A;  3K7Y A;  4WBT A;  1TOK A;  2D66 A;  1JS3 A;  2E7U A;  1CL2 A;  2JIS A;  4JEX A;  3TFU A;  4CBS A;  2R5C A;  3B46 A;  2BWP A;  4P3M A;  4JF0 A;  2ZUK A;  3W1I A;  4HVK A;  1LS3 A;  4WXG A;  4FL0 A;  2O1B A;  5G0A A;  3NRA A;  1ZOD A;  3N5M A;  3QN6 A;  2YCT A;  4WB0 B;  2AY3 A;  2W8J A;  2HOZ A;  1BJO B;  4Q75 A;  3BN1 A;  1ASL A;  3E77 A;  3TFT A;  3DZZ A;  4ZM3 A;  1WYV B;  3E2Z B;  1ELQ A;  4ZAH A;  2E7I A;  4XEW A;  1Z7D A;  3FDB A;  1WYT A;  3FZ6 A;  4MQP A;  3DRD A;  3EUC A;  1M0Q A;  3PD6 B;  1GBN A;  2AY7 A;  3VK3 A;  1ASE A;  1SZU A;  2AY1 A;  4EU1 A;  3W1J A;  4ZSW A;  2YRI A;  1J04 A;  4KYO A;  2VMQ A;  4DBC A;  2VMN A;  4IYO A;  4MKJ A;  4CXR A;  2OKJ A;  1M0P A;  1SZS A;  2VMO A;  4B9B A;  4DQ6 A;  3BV0 A;  2FN6 A;  4MQQ A;  3JTX A;  1AAW A;  1BQD A;  3WKS A;  4ADE A;  2YKU A;  1C7O A;  1KMK A;  4R8D A;  4W1W A;  1EG5 A;  1OAT A;  2CFB A;  1N2T A;  3FZ8 A;  4BHD A;  5EAV A;  3ATH A;  3P6K A;  4OT8 A;  2YHK A;  3FVS A;  3FSL A;  5G4I A;  5IWQ A;  3CQ6 A;  4Y0I A;  2E54 A;  2PB0 A;  1IVR A;  3NYS A;  1YNU A;  4HF8 A;  1T3I A;  3NTJ A;  3QHX A;  4OC9 A;  2VMY A;  3MAF A;  2EGY A;  3AEN A;  4J5U A;  4XJM A;  2HOR A;  1GC3 A;  1AX4 A;  4B98 A;  2GB3 A;  1IBJ A;  4XJP A;  3JU7 A;  1B9I A;  2EZ2 A;  3FQ8 A;  3IF2 A;  4WYA A;  3FFH A;  5G09 A;  3G8M A;  3AEJ C;  4MGR A;  3A9Y A;  1MDX A;  3ACZ A;  4F5J A;  3RUY A;  5E4Z A;  2DGL A;  3PJ0 A;  4LW2 A;  1AMQ A;  1M0N A;  2CAN A;  4MKK A;  1AMS A;  2AAT A;  1G7X A;  1W7M A;  1XI9 A;  1YJS A;  3BWN C;  3FVX A;  1X0M A;  4LNL A;  1LW4 A;  4A6U A;  1ART A;  3BCB A;  4OMA A;  1M6S A;  3NU8 A;  2YKX A;  3A9X A;  3HBX A;  1FG3 A;  3AEM A;  4Q6R A;  4R2N A;  5FT8 A;  1BJN A;  2JJE A;  3ELE A;  2W7G A;  3ZZJ A;  1TAS A;  2DKJ A;  2OQX A;  3JW9 A;  4LC3 A;  4F5I A;  2XBN A;  1W3U A;  1AJS B;  5HHY A;  4ATP A;  4K2M A;  5DB5 A;  1N8P A;  3PDB B;  1VJO A;  4KAM A;  3DC1 A;  1WYU A;  1SFF A;  1ORD A;  1QIR A;  3ZRR A;  1GEY A;  2CH1 A;  4L0O A;  4K2I A;  1IAY A;  1H1C A;  3L8A A;  4BA5 A;  3NUI A;  1IX8 A;  3M5U A;  3BCA A;  4ADD A;  3I5T A;  2BI2 A;  1GC4 A;  5G2Q A;  3WZF A;  3Q8N A;  4PFN A;  2DGM A;  2ZY3 A;  4QGR A;  2C7T A;  1ARI A;  1UKJ A;  2HUU A;  1DGD A;  1M7Y A;  1FC4 A;  3E6G A;  5EIG B;  3G0T A;  3GWP A;  1TAT A;  4RKD A;  2HUF A;  1TPL A;  2AEV A;  5LH9 A;  3IHJ A;  4JEV A;  4RKC A;  4EMY A;  4PIW A;  2FNU A;  3UWC A;  1ARS A;  2X3L A;  3RI6 A;  1YAA A;  3FQ7 A;  4XAU A;  1O4S A;  4OYT A;  3RCH A;  1MDZ A;  2CST A;  3NYU A;  1IX6 A;  1KL2 A;  3A8U X;  4XJL A;  1X29 A;  2VGZ A;  3MBB A;  2BHX A;  2CJG A;  4XQ2 A;  2ZSL A;  2YOB A;  1CL1 A;  1AKA A;  2W8W A;  1ASF A;  5C6U A;  2VIB A;  3LVM A;  4RM1 A;  3LY1 A;  3FCR A;  1CJ0 A;  4ITG A;  3GET A;  1PFF A;  3UE8 A;  2BYJ A;  1IX7 A;  2VGV A;  4IY7 A;  1I43 A;  4XJO A;  1ECX A;  2O0R A;  1ZC9 A;  1TOE A;  3DYD A;  1BJO A;  3EIA A;  2CJH A;  1AY4 A;  2BI3 A;  3I16 A;  1WYV A;  5JAY A;  3E2Z A;  1KKP A;  1RV3 A;  5M46 A;  3F9T A;  4F5H A;  2BWO A;  4RLG A;  3AEM C;  3AEJ A;  1ASM A;  1AIB A;  2GMS A;  3GSB A;  3MAU A;  3QGU A;  1KL1 A;  2X5F A;  2DKB A;  2CB1 A;  4JF1 A;  4LW4 A;  2Z20 A;  2BI9 A;  2VLF A;  3HVY A;  2CY8 A;  3BWN A;  3TAT A;  2VI8 A;  2G6W A;  3MEB A;  3E9K A;  4PVF A;  4W1X A;  2JJG A;  3TQX A;  2EO5 A;  1DFO A;  2BWN A;  3OKS A;  1QZ9 A;  5E5I A;  2BIE A;  3ISL A;  3PIU A;  1TOG A;  4IXZ A;  1ASD A;  1CQ6 A;  2W7I A;  4A0R A;  1MLY A;  3USF A;  4CBR A;  3WX9 A;  1AMA A;  4WD2 A;  3ZZK A;  2ZY2 A;  1S06 A;  3D6K A;  4ZDO A;  5DX5 A;  1BS0 A;  1BT4 A;  1QIT A;  1ASA A;  2AY2 A;  4ZSY A;  2W7H A;  4KXK A;  4M2K A;  2OKK A;  1LC8 A;  2VGU A;  1AIC A;  2BIG A;  4W5K A;  4OTL A;  1ASN A;  4IXS A;  2ZC0 A;  4E3Q A;  4UOY A;  3AEP A;  5M4B A;  1EQB A;  3WKR A;  1YIZ A;  3UAK A;  1YOO A;  4P7Y A;  5BJ3 A;  2W7D A;  4EB7 A;  1XEY A;  2R5C B;  2HZP A;  1V2F A;  2W7L A;  1S07 A;  3R4T A;  4LNM A;  5FT4 A;  3KGW A;  4K2B A;  2R5E A;  1AHY A;  4JE5 D;  4TMR A;  3AV7 A;  5M4D A;  1YJZ A;  3ASA A;  3EZS A;  3BB8 A;  1ASB A;  3GBX A;  1MGV A;  1M32 A;  1SPA A;  2VIA A;  3MKJ A;  1AHF A;  1DJU A;  1B5O A;  3FQA A;  5EQC A;  1Z3Z A;  4ZDL A;  1S0A A;  1WYT B;  3GR9 A;  3W1H A;  4ADC A;  3N0L A;  2GMU A;  2WK8 A;  2JGT A;  4W91 A;  3PDB A;  2CH2 A;  4WLJ A;  1TOJ A;  4A00 A;  3LWS A;  4W8I A;  3NNK A;  3L44 A;  4WYG A;  3HLM A;  2QB2 A;  4OBV A;  5DJ1 A;  5K8B A;  1ASC A;  1ASG A;  2NMP A;  3E2Y A;  2JG2 A;  1JF9 A;  2BI5 A;  3FVU A;  5BJ4 A;  2W7J A;  1AHE A;  3JZL A;  2VMX A;  3GJU A;  1BJ4 A;  4NOG A;  2ZSM A;  1O61 A;  2FM1 A;  3EI9 A;  4A0H A;  3FKD A;  2D65 A;  1IJI A;  4JEZ A;  8AAT A;  2V0Y A;  1QJ3 A;  1GC2 A;  1LKC A;  1UU2 A;  3PPL A;  1W23 A;  4GSA A;  3FDD A;  2AY4 A;  3GZC A;  4H51 A;  1B4X A;  3LVL B;  4PFF A;  2FNI A;  4UQV A;  1SVV A;  2CJD A;  3FTB A;  3KE3 A;  1P3W A;  4A0F A;  3T32 A;  3N75 A;  4BMK A;  3FD0 A;  1BJW A;  3AEN B;  1VEF A;  4TN4 A;  1J32 A;  3DR4 A;  3WCN A;  3BC8 A;  2AY9 A;  4BQ0 A;  2EZ1 A;  2YKV A;  3LVK A;  3VK4 A;  5FT5 A;  2WKA A;  3PA9 A;  1PG8 A;  3BCX A;  2XH1 A;  5TF5 A;  4E3R A;  3E2F A;  3LG0 A;  4WP0 A;  2FQ6 A;  2R2N A;  2YRR A;  1GDE A;  1UU0 A;  2D5Y A;  1G4X A;  3QM2 A;  3VAX A;  1W7N A;  2F8J A;  1C4K A;  2JJH A;  4ZLV A;  4RIT A;  1AIA A;  2VMV A;  3P1T A;  3ECD A;  4WYC A;  2VLH A;  3AEL A;  4UHM A;  4ZWV A;  1I29 A;  4Q31 A;  4F5F A;  5EUE A;  5HXX A;  2YCP A;  3NX3 A;  4WB0 A;  4R5F A;  1D7V A;  1D7R A;  4ITX A;  3DR7 A;  2OGE A;  3PGY A;  5EAA A;  3LVJ A;  4A0G A;  4AZK A;  2X8U A;  1BW0 A;  4M2M A;  1GC0 A;  3JWB A;  5M49 A;  4AO4 A;  4EFF A;  1AKC A;  1IUG A;  1D7S A;  4CVQ A;  2W7E A;  1QGN A;  5F8V A;  3PD6 A;  1LK9 A;  3BS8 A;  3ELP A;  1SZK A;  2D63 A;  2O7C A;  2Q7W A;  2D64 A;  5G2P A;  1PMO A;  4AOA A;  2X5D A;  1GD9 A;  1KKJ A;  2W7K A;  4WYE A;  4J8L A;  2WK7 A;  4N0W A;  4XK1 A;  1MDO A;  3CBF A;  2E7J A;  2GSA A;  2R0T A;  2RFV A;  1AHG A;  1PMM A;  1DJ9 A;  2VMR A;  3WY7 A;  1CQ8 A;  4F4E A;  1WKH A;  2GQN A;  2D7Z A;  3F0H A;  3NUB A;  4A6R A;  4ADB A;  2DGK A;  4IX8 A;  4RAE A;  1ARH A;  1C7G A;  1C9C A;  4ZAS A;  2ZP7 A;  3K28 A;  1V2D A;  1QJ5 A;  2D7Y A;  4CXQ A;  3VK2 A; 
#chains in the Genus database with same CATH topology
 2VGT A;  3AOW A;  2DOU A;  1M0O A;  1WKG A;  1E5F A;  2AY6 A;  1MLZ A;  2Z9V A;  4RJ0 A;  4LNJ A;  1X2A A;  2BKW A;  2C44 A;  5FT6 A;  4GE7 A;  1OHY A;  2Z9U A;  3N4X A;  2G7J A;  3DOD A;  2HOY A;  2VMS A;  2Z1Z A;  1DGE A;  1N31 A;  2HP2 A;  2EPJ A;  3EIB A;  4R5Z A;  1AJR A;  1E5E A;  1JS6 A;  2QB3 A;  2VMZ A;  2VMP A;  4MQR A;  3G7Q A;  5G4J A;  1Y4I A;  2W7M A;  3RBL A;  3B1E A;  4E77 A;  2TPL A;  3A2B A;  3WGB A;  4UHN A;  1OHW A;  1VP4 A;  1C0N A;  4Y0H A;  5D95 A;  3GZD C;  1CZE A;  1CQ7 A;  1GEX A;  3MC6 A;  4GE9 A;  3CQ4 A;  3PDX A;  4OBU A;  5EFS A;  4ZM4 A;  1C7N A;  2JJF A;  1G4V A;  3B1C A;  4JEW A;  2Z1Y A;  4AZJ A;  3HL2 A;  3EI7 A;  4ISY A;  3QBO A;  3BWO A;  3HDO A;  3RQ1 A;  2ZY4 A;  3KGX A;  3WCO A;  2PB2 A;  1AJS A;  4OCA A;  3HMU A;  1FG7 A;  2VYC A;  1SF2 A;  5J8Q A;  3H14 A;  2VI9 A;  1AAM A;  1ELU A;  3FFR A;  1DTY A;  3VOM A;  1V72 A;  1B8G A;  4JEY A;  4IYO B;  4F5M A;  2Z67 A;  2OAT A;  2VMU A;  3F6T A;  1O69 A;  1TAR A;  1LC5 A;  5LHA A;  1I41 A;  2AY5 A;  2VGS A;  4A72 A;  5I92 A;  1LC7 A;  2V1P A;  3ZRP A;  4WXF A;  1AKB A;  1D7U A;  3DU4 A;  2CIN A;  1MAQ A;  1G7W A;  1WST A;  2Z61 A;  3OP7 A;  4GE4 A;  3WGC A;  1YJY A;  4WYF A;  2AY8 A;  5EIG A;  4WLH A;  1GEW A;  3KKI A;  1IAX A;  5HDM A;  2OGA A;  4BA4 A;  2YCN A;  4JE5 A;  1TOI A;  5AX8 A;  2C0R A;  4WYD A;  4U2H A;  1S08 A;  1EJI A;  2VMW A;  1RVY A;  2W8U A;  3AOV A;  1LW5 A;  2CTZ A;  4FFC A;  1U08 A;  4Q76 A;  4RJY A;  1ZOB A;  4UHO A;  4A6T A;  1AY8 A;  9AAT A;  3A9Z A;  4ATQ A;  2QBT A;  2YKY A;  3MAF B;  1W7L A;  4N0B A;  1KMJ A;  4IW7 A;  3AAT A;  4MSO A;  4Y0D A;  3DXV A;  2HOX A;  1CZC A;  1ARG A;  2QMA A;  3HT4 A;  5F9S A;  1AHX A;  2VMT A;  3EI8 A;  3NDN A;  3NU7 A;  1O62 A;  2WK9 A;  3EI6 A;  4GEB A;  3VP6 A;  7AAT A;  1UU1 A;  2BI1 A;  4W1V A;  2W8V A;  2ZYJ A;  5EUD A;  3DXW A;  3AEO A;  3TCM A;  3EZ1 A;  4AH3 A;  4F5L A;  2ZJG A;  4AO9 A;  1B5P A;  2AEU A;  4F5G A;  3II0 A;  1X28 A;  2BIA A;  2QA3 A;  2W7F A;  3MC6 C;  3NYT A;  5E3K A;  3MAD A;  1RV4 A;  1I48 A;  4U1T A;  2BYL A;  3EI5 A;  1OXP A;  5EUN A;  2EH6 A;  2HUI A;  4GDY A;  4GRX A;  3JWA A;  2ZY5 A;  2QLR A;  4M2J A;  1AY5 A;  2VGW A;  1CS1 A;  1WYU B;  3GZD A;  3HQT A;  2Z9W A;  5D5S A;  4IXO A;  1DJE A;  1JG8 A;  4WXB A;  1MAP A;  3I4J A;  3CAI A;  1DKA A;  2DR1 A;  3ASB A;  4EB5 A;  1GCK A;  1D2F A;  3QPG A;  3H7F A;  3FRK A;  2D61 A;  4ZDP A;  1S09 A;  3RBF A;  3FZ7 A;  3WLX A;  1BQA A;  2W8T A;  2ORD A;  4RIZ A;  4DGT A;  4F5K A;  3K40 A;  4O6Z A;  2PO3 A;  4ZWM A;  1QIS A;  1OHV A;  2C81 A;  3B1D A;  2Z9X A;  3COG A;  3QI6 A;  1YIY A;  2HP1 A;  2FYF A;  1M4N A;  3ZRQ A;  3RCH B;  5DJ9 A;  1B9H A;  1BKG A;  1AMR A;  3LV2 A;  3R9A A;  1H0C A;  3CQ5 A;  3PAA A;  4I8A A;  1V2E A;  4E1O A;  3B8X A;  4MY5 A;  4TV7 A;  1RVU A;  1OXO A;  3K7Y A;  4WBT A;  1TOK A;  2D66 A;  1JS3 A;  2E7U A;  1CL2 A;  2JIS A;  4JEX A;  3TFU A;  4CBS A;  2R5C A;  3B46 A;  2BWP A;  4P3M A;  4JF0 A;  2ZUK A;  3W1I A;  4HVK A;  1LS3 A;  4WXG A;  4FL0 A;  2O1B A;  5G0A A;  3NRA A;  1ZOD A;  3N5M A;  3QN6 A;  2YCT A;  4WB0 B;  2FKI A;  2AY3 A;  2W8J A;  2HOZ A;  1BJO B;  4Q75 A;  3BN1 A;  1ASL A;  3E77 A;  3TFT A;  2WB6 A;  3DZZ A;  4ZM3 A;  2QSR A;  1WYV B;  3E2Z B;  1ELQ A;  4ZAH A;  2E7I A;  4XEW A;  1Z7D A;  3FDB A;  1WYT A;  3FZ6 A;  4MQP A;  3DRD A;  3EUC A;  1M0Q A;  3PD6 B;  1GBN A;  2AY7 A;  3VK3 A;  1ASE A;  1SZU A;  2AY1 A;  4EU1 A;  3W1J A;  4ZSW A;  2YRI A;  1J04 A;  4KYO A;  2VMQ A;  4DBC A;  2VMN A;  4IYO A;  4MKJ A;  4CXR A;  2OKJ A;  1M0P A;  1SZS A;  2VMO A;  4B9B A;  4DQ6 A;  3BV0 A;  2FN6 A;  4MQQ A;  3JTX A;  1AAW A;  1BQD A;  3WKS A;  4ADE A;  2YKU A;  1C7O A;  1KMK A;  4R8D A;  4W1W A;  1EG5 A;  1OAT A;  2CFB A;  1N2T A;  3FZ8 A;  4BHD A;  5EAV A;  3ATH A;  3P6K A;  4OT8 A;  2YHK A;  3FVS A;  3FSL A;  5G4I A;  5IWQ A;  3CQ6 A;  4Y0I A;  2E54 A;  2PB0 A;  1IVR A;  3NYS A;  1YNU A;  4HF8 A;  1T3I A;  3NTJ A;  3QHX A;  4OC9 A;  2VMY A;  3MAF A;  2EGY A;  3AEN A;  4J5U A;  4XJM A;  2HOR A;  1GC3 A;  1AX4 A;  4B98 A;  2GB3 A;  1IBJ A;  4XJP A;  3JU7 A;  1B9I A;  2EZ2 A;  3FQ8 A;  3IF2 A;  4WYA A;  3FFH A;  5G09 A;  3G8M A;  3AEJ C;  4MGR A;  3A9Y A;  1MDX A;  3ACZ A;  4F5J A;  3RUY A;  5E4Z A;  2DGL A;  3PJ0 A;  2EYQ A;  4LW2 A;  1AMQ A;  1M0N A;  2CAN A;  4MKK A;  1AMS A;  2AAT A;  1G7X A;  1W7M A;  1XI9 A;  1YJS A;  3BWN C;  3FVX A;  1X0M A;  4LNL A;  1LW4 A;  4A6U A;  1ART A;  3BCB A;  4OMA A;  1M6S A;  3NU8 A;  2YKX A;  3A9X A;  3HBX A;  1FG3 A;  3AEM A;  4Q6R A;  4R2N A;  5FT8 A;  1BJN A;  2JJE A;  3ELE A;  2W7G A;  3ZZJ A;  1TAS A;  2DKJ A;  2OQX A;  3JW9 A;  4LC3 A;  4F5I A;  2XBN A;  1W3U A;  1AJS B;  5HHY A;  4ATP A;  4K2M A;  5DB5 A;  1N8P A;  3PDB B;  1VJO A;  4KAM A;  3DC1 A;  1WYU A;  1SFF A;  1ORD A;  1QIR A;  3ZRR A;  1GEY A;  2CH1 A;  4L0O A;  4K2I A;  1IAY A;  1H1C A;  3L8A A;  4BA5 A;  3NUI A;  1IX8 A;  3M5U A;  3BCA A;  4ADD A;  3I5T A;  2BI2 A;  1GC4 A;  5G2Q A;  3WZF A;  3Q8N A;  4PFN A;  2DGM A;  2ZY3 A;  4QGR A;  2C7T A;  1ARI A;  1UKJ A;  2HUU A;  1DGD A;  1M7Y A;  1FC4 A;  3E6G A;  5EIG B;  3G0T A;  3GWP A;  1TAT A;  4RKD A;  2HUF A;  1TPL A;  2AEV A;  5LH9 A;  3IHJ A;  4JEV A;  4RKC A;  4EMY A;  4PIW A;  2FNU A;  3UWC A;  1ARS A;  2X3L A;  3RI6 A;  1YAA A;  3FQ7 A;  4XAU A;  1O4S A;  4OYT A;  3RCH A;  1MDZ A;  2CST A;  3NYU A;  1IX6 A;  1KL2 A;  3A8U X;  4XJL A;  1X29 A;  2VGZ A;  3MBB A;  2BHX A;  2CJG A;  4XQ2 A;  2ZSL A;  2YOB A;  1CL1 A;  1AKA A;  2W8W A;  1ASF A;  5C6U A;  2VIB A;  1KAF A;  3LVM A;  4RM1 A;  3LY1 A;  3FCR A;  1CJ0 A;  4ITG A;  3GET A;  1PFF A;  3UE8 A;  2BYJ A;  1IX7 A;  2VGV A;  4IY7 A;  1I43 A;  4XJO A;  1ECX A;  2O0R A;  1ZC9 A;  1TOE A;  3DYD A;  1BJO A;  3EIA A;  2CJH A;  1AY4 A;  2BI3 A;  3I16 A;  4K05 A;  1WYV A;  5JAY A;  3E2Z A;  1KKP A;  1RV3 A;  5M46 A;  5KTB A;  3F9T A;  4F5H A;  2BWO A;  4RLG A;  3AEM C;  3AEJ A;  1ASM A;  1AIB A;  2GMS A;  3GSB A;  3MAU A;  3N4S A;  3QGU A;  1KL1 A;  2X5F A;  2DKB A;  2CB1 A;  4JF1 A;  4LW4 A;  2Z20 A;  2BI9 A;  2VLF A;  3HVY A;  2CY8 A;  3BWN A;  3TAT A;  2VI8 A;  2G6W A;  3MEB A;  3E9K A;  4PVF A;  4W1X A;  2JJG A;  3TQX A;  2EO5 A;  1DFO A;  2BWN A;  3OKS A;  1QZ9 A;  5E5I A;  2BIE A;  3ISL A;  3PIU A;  1TOG A;  4IXZ A;  1ASD A;  1CQ6 A;  2W7I A;  4A0R A;  1MLY A;  3USF A;  4CBR A;  3WX9 A;  1AMA A;  4WD2 A;  3ZZK A;  2ZY2 A;  1S06 A;  3D6K A;  4ZDO A;  5DX5 A;  1BS0 A;  1BT4 A;  1QIT A;  1ASA A;  2AY2 A;  4ZSY A;  2W7H A;  4KXK A;  4M2K A;  2OKK A;  1LC8 A;  2VGU A;  1AIC A;  2BIG A;  4W5K A;  4OTL A;  1ASN A;  4IXS A;  2ZC0 A;  4E3Q A;  4UOY A;  3AEP A;  5M4B A;  1EQB A;  3WKR A;  1YIZ A;  3UAK A;  1YOO A;  4P7Y A;  5BJ3 A;  2W7D A;  4EB7 A;  1XEY A;  2R5C B;  2HZP A;  1V2F A;  2W7L A;  1S07 A;  3R4T A;  4LNM A;  5FT4 A;  3KGW A;  4K2B A;  2R5E A;  1AHY A;  4JE5 D;  4TMR A;  3AV7 A;  5M4D A;  1YJZ A;  3ASA A;  3EZS A;  3BB8 A;  1ASB A;  3GBX A;  1MGV A;  1M32 A;  1SPA A;  2VIA A;  3MKJ A;  1AHF A;  1DJU A;  1B5O A;  3FQA A;  5EQC A;  1Z3Z A;  4ZDL A;  1S0A A;  1WYT B;  3GR9 A;  3W1H A;  4ADC A;  2A1V A;  3N0L A;  2GMU A;  2WK8 A;  2JGT A;  4W91 A;  3PDB A;  2CH2 A;  4WLJ A;  1TOJ A;  4A00 A;  3LWS A;  4W8I A;  3NNK A;  3L44 A;  4WYG A;  3HLM A;  2QB2 A;  2KFP A;  4OBV A;  5DJ1 A;  5K8B A;  1ASC A;  1ASG A;  2NMP A;  3E2Y A;  2JG2 A;  1JF9 A;  2BI5 A;  3FVU A;  5BJ4 A;  2W7J A;  1AHE A;  3JZL A;  2VMX A;  3GJU A;  1BJ4 A;  4NOG A;  2ZSM A;  1O61 A;  2FM1 A;  3EI9 A;  4A0H A;  3FKD A;  2D65 A;  1IJI A;  4JEZ A;  8AAT A;  2V0Y A;  1QJ3 A;  1GC2 A;  1LKC A;  1UU2 A;  3PPL A;  1W23 A;  4GSA A;  3FDD A;  2AY4 A;  3GZC A;  4H51 A;  1B4X A;  3LVL B;  4PFF A;  2FNI A;  4UQV A;  1SVV A;  2CJD A;  3H9X A;  3FTB A;  3KE3 A;  1P3W A;  4A0F A;  3T32 A;  3N75 A;  4BMK A;  3FD0 A;  1BJW A;  3AEN B;  1VEF A;  4TN4 A;  1J32 A;  3DR4 A;  3WCN A;  3BC8 A;  2AY9 A;  4BQ0 A;  2EZ1 A;  2YKV A;  3LVK A;  3VK4 A;  5FT5 A;  2WKA A;  3PA9 A;  1PG8 A;  3BCX A;  2XH1 A;  5TF5 A;  4E3R A;  3E2F A;  3LG0 A;  4WP0 A;  2FQ6 A;  2R2N A;  2YRR A;  1GDE A;  1UU0 A;  2D5Y A;  1G4X A;  3QM2 A;  3N7N A;  3VAX A;  1W7N A;  2F8J A;  1C4K A;  2JJH A;  4ZLV A;  4RIT A;  1AIA A;  2VMV A;  3P1T A;  3ECD A;  4WYC A;  2VLH A;  3AEL A;  4UHM A;  4ZWV A;  1I29 A;  4Q31 A;  4F5F A;  5EUE A;  5HXX A;  2YCP A;  3NX3 A;  4H63 Q;  4WB0 A;  4R5F A;  1D7V A;  1D7R A;  4ITX A;  3DR7 A;  2OGE A;  3PGY A;  5EAA A;  3LVJ A;  4A0G A;  4AZK A;  2X8U A;  1BW0 A;  4M2M A;  1GC0 A;  3JWB A;  5M49 A;  4AO4 A;  4EFF A;  1AKC A;  1IUG A;  1D7S A;  4CVQ A;  2W7E A;  1QGN A;  5F8V A;  3PD6 A;  1LK9 A;  3BS8 A;  3ELP A;  1SZK A;  2D63 A;  2O7C A;  2Q7W A;  2D64 A;  5G2P A;  1PMO A;  4AOA A;  3N4R A;  2X5D A;  1GD9 A;  1KKJ A;  2W7K A;  4WYE A;  4J8L A;  2WK7 A;  4N0W A;  4XK1 A;  1MDO A;  3CBF A;  2E7J A;  2GSA A;  2R0T A;  2RFV A;  1AHG A;  1PMM A;  1DJ9 A;  2VMR A;  3WY7 A;  1CQ8 A;  4F4E A;  1WKH A;  2GQN A;  2D7Z A;  3F0H A;  3NUB A;  4A6R A;  4ADB A;  2DGK A;  4IX8 A;  4RAE A;  1ARH A;  1C7G A;  1C9C A;  4ZAS A;  2ZP7 A;  3K28 A;  1V2D A;  1QJ5 A;  2D7Y A;  4CXQ A;  3VK2 A; 
#chains in the Genus database with same CATH homology
 2VGT A;  3AOW A;  2DOU A;  1M0O A;  1WKG A;  1E5F A;  2AY6 A;  1MLZ A;  2Z9V A;  4RJ0 A;  4LNJ A;  1X2A A;  2BKW A;  2C44 A;  5FT6 A;  4GE7 A;  1OHY A;  2Z9U A;  3N4X A;  2G7J A;  3DOD A;  2HOY A;  2VMS A;  2Z1Z A;  1DGE A;  1N31 A;  2HP2 A;  2EPJ A;  3EIB A;  4R5Z A;  1AJR A;  1E5E A;  1JS6 A;  2QB3 A;  2VMZ A;  2VMP A;  4MQR A;  3G7Q A;  5G4J A;  1Y4I A;  2W7M A;  3RBL A;  3B1E A;  4E77 A;  2TPL A;  3A2B A;  3WGB A;  4UHN A;  1OHW A;  1VP4 A;  1C0N A;  4Y0H A;  5D95 A;  3GZD C;  1CZE A;  1CQ7 A;  1GEX A;  3MC6 A;  4GE9 A;  3CQ4 A;  3PDX A;  4OBU A;  5EFS A;  4ZM4 A;  1C7N A;  2JJF A;  1G4V A;  3B1C A;  4JEW A;  2Z1Y A;  4AZJ A;  3HL2 A;  3EI7 A;  4ISY A;  3QBO A;  3BWO A;  3HDO A;  3RQ1 A;  2ZY4 A;  3KGX A;  3WCO A;  2PB2 A;  1AJS A;  4OCA A;  3HMU A;  1FG7 A;  2VYC A;  1SF2 A;  5J8Q A;  3H14 A;  2VI9 A;  1AAM A;  1ELU A;  3FFR A;  1DTY A;  3VOM A;  1V72 A;  1B8G A;  4JEY A;  4IYO B;  4F5M A;  2Z67 A;  2OAT A;  2VMU A;  3F6T A;  1O69 A;  1TAR A;  1LC5 A;  5LHA A;  1I41 A;  2AY5 A;  2VGS A;  4A72 A;  5I92 A;  1LC7 A;  2V1P A;  3ZRP A;  4WXF A;  1AKB A;  1D7U A;  3DU4 A;  2CIN A;  1MAQ A;  1G7W A;  1WST A;  2Z61 A;  3OP7 A;  4GE4 A;  3WGC A;  1YJY A;  4WYF A;  2AY8 A;  5EIG A;  4WLH A;  1GEW A;  3KKI A;  1IAX A;  5HDM A;  2OGA A;  4BA4 A;  2YCN A;  4JE5 A;  1TOI A;  5AX8 A;  2C0R A;  4WYD A;  4U2H A;  1S08 A;  1EJI A;  2VMW A;  1RVY A;  2W8U A;  3AOV A;  1LW5 A;  2CTZ A;  4FFC A;  1U08 A;  4Q76 A;  4RJY A;  1ZOB A;  4UHO A;  4A6T A;  1AY8 A;  9AAT A;  3A9Z A;  4ATQ A;  2QBT A;  2YKY A;  3MAF B;  1W7L A;  4N0B A;  1KMJ A;  4IW7 A;  3AAT A;  4MSO A;  4Y0D A;  3DXV A;  2HOX A;  1CZC A;  1ARG A;  2QMA A;  3HT4 A;  5F9S A;  1AHX A;  2VMT A;  3EI8 A;  3NDN A;  3NU7 A;  1O62 A;  2WK9 A;  3EI6 A;  4GEB A;  3VP6 A;  7AAT A;  1UU1 A;  2BI1 A;  4W1V A;  2W8V A;  2ZYJ A;  5EUD A;  3DXW A;  3AEO A;  3TCM A;  3EZ1 A;  4AH3 A;  4F5L A;  2ZJG A;  4AO9 A;  1B5P A;  2AEU A;  4F5G A;  3II0 A;  1X28 A;  2BIA A;  2QA3 A;  2W7F A;  3MC6 C;  3NYT A;  5E3K A;  3MAD A;  1RV4 A;  1I48 A;  4U1T A;  2BYL A;  3EI5 A;  1OXP A;  5EUN A;  2EH6 A;  2HUI A;  4GDY A;  4GRX A;  3JWA A;  2ZY5 A;  2QLR A;  4M2J A;  1AY5 A;  2VGW A;  1CS1 A;  1WYU B;  3GZD A;  3HQT A;  2Z9W A;  5D5S A;  4IXO A;  1DJE A;  1JG8 A;  4WXB A;  1MAP A;  3I4J A;  3CAI A;  1DKA A;  2DR1 A;  3ASB A;  4EB5 A;  1GCK A;  1D2F A;  3QPG A;  3H7F A;  3FRK A;  2D61 A;  4ZDP A;  1S09 A;  3RBF A;  3FZ7 A;  3WLX A;  1BQA A;  2W8T A;  2ORD A;  4RIZ A;  4DGT A;  4F5K A;  3K40 A;  4O6Z A;  2PO3 A;  4ZWM A;  1QIS A;  1OHV A;  2C81 A;  3B1D A;  2Z9X A;  3COG A;  3QI6 A;  1YIY A;  2HP1 A;  2FYF A;  1M4N A;  3ZRQ A;  3RCH B;  5DJ9 A;  1B9H A;  1BKG A;  1AMR A;  3LV2 A;  3R9A A;  1H0C A;  3CQ5 A;  3PAA A;  4I8A A;  1V2E A;  4E1O A;  3B8X A;  4MY5 A;  4TV7 A;  1RVU A;  1OXO A;  3K7Y A;  4WBT A;  1TOK A;  2D66 A;  1JS3 A;  2E7U A;  1CL2 A;  2JIS A;  4JEX A;  3TFU A;  4CBS A;  2R5C A;  3B46 A;  2BWP A;  4P3M A;  4JF0 A;  2ZUK A;  3W1I A;  4HVK A;  1LS3 A;  4WXG A;  4FL0 A;  2O1B A;  5G0A A;  3NRA A;  1ZOD A;  3N5M A;  3QN6 A;  2YCT A;  4WB0 B;  2FKI A;  2AY3 A;  2W8J A;  2HOZ A;  1BJO B;  4Q75 A;  3BN1 A;  1ASL A;  3E77 A;  3TFT A;  2WB6 A;  3DZZ A;  4ZM3 A;  2QSR A;  1WYV B;  3E2Z B;  1ELQ A;  4ZAH A;  2E7I A;  4XEW A;  1Z7D A;  3FDB A;  1WYT A;  3FZ6 A;  4MQP A;  3DRD A;  3EUC A;  1M0Q A;  3PD6 B;  1GBN A;  2AY7 A;  3VK3 A;  1ASE A;  1SZU A;  2AY1 A;  4EU1 A;  3W1J A;  4ZSW A;  2YRI A;  1J04 A;  4KYO A;  2VMQ A;  4DBC A;  2VMN A;  4IYO A;  4MKJ A;  4CXR A;  2OKJ A;  1M0P A;  1SZS A;  2VMO A;  4B9B A;  4DQ6 A;  3BV0 A;  2FN6 A;  4MQQ A;  3JTX A;  1AAW A;  1BQD A;  3WKS A;  4ADE A;  2YKU A;  1C7O A;  1KMK A;  4R8D A;  4W1W A;  1EG5 A;  1OAT A;  2CFB A;  1N2T A;  3FZ8 A;  4BHD A;  5EAV A;  3ATH A;  3P6K A;  4OT8 A;  2YHK A;  3FVS A;  3FSL A;  5G4I A;  5IWQ A;  3CQ6 A;  4Y0I A;  2E54 A;  2PB0 A;  1IVR A;  3NYS A;  1YNU A;  4HF8 A;  1T3I A;  3NTJ A;  3QHX A;  4OC9 A;  2VMY A;  3MAF A;  2EGY A;  3AEN A;  4J5U A;  4XJM A;  2HOR A;  1GC3 A;  1AX4 A;  4B98 A;  2GB3 A;  1IBJ A;  4XJP A;  3JU7 A;  1B9I A;  2EZ2 A;  3FQ8 A;  3IF2 A;  4WYA A;  3FFH A;  5G09 A;  3G8M A;  3AEJ C;  4MGR A;  3A9Y A;  1MDX A;  3ACZ A;  4F5J A;  3RUY A;  5E4Z A;  2DGL A;  3PJ0 A;  2EYQ A;  4LW2 A;  1AMQ A;  1M0N A;  2CAN A;  4MKK A;  1AMS A;  2AAT A;  1G7X A;  1W7M A;  1XI9 A;  1YJS A;  3BWN C;  3FVX A;  1X0M A;  4LNL A;  1LW4 A;  4A6U A;  1ART A;  3BCB A;  4OMA A;  1M6S A;  3NU8 A;  2YKX A;  3A9X A;  3HBX A;  1FG3 A;  3AEM A;  4Q6R A;  4R2N A;  5FT8 A;  1BJN A;  2JJE A;  3ELE A;  2W7G A;  3ZZJ A;  1TAS A;  2DKJ A;  2OQX A;  3JW9 A;  4LC3 A;  4F5I A;  2XBN A;  1W3U A;  1AJS B;  5HHY A;  4ATP A;  4K2M A;  5DB5 A;  1N8P A;  3PDB B;  1VJO A;  4KAM A;  3DC1 A;  1WYU A;  1SFF A;  1ORD A;  1QIR A;  3ZRR A;  1GEY A;  2CH1 A;  4L0O A;  4K2I A;  1IAY A;  1H1C A;  3L8A A;  4BA5 A;  3NUI A;  1IX8 A;  3M5U A;  3BCA A;  4ADD A;  3I5T A;  2BI2 A;  1GC4 A;  5G2Q A;  3WZF A;  3Q8N A;  4PFN A;  2DGM A;  2ZY3 A;  4QGR A;  2C7T A;  1ARI A;  1UKJ A;  2HUU A;  1DGD A;  1M7Y A;  1FC4 A;  3E6G A;  5EIG B;  3G0T A;  3GWP A;  1TAT A;  4RKD A;  2HUF A;  1TPL A;  2AEV A;  5LH9 A;  3IHJ A;  4JEV A;  4RKC A;  4EMY A;  4PIW A;  2FNU A;  3UWC A;  1ARS A;  2X3L A;  3RI6 A;  1YAA A;  3FQ7 A;  4XAU A;  1O4S A;  4OYT A;  3RCH A;  1MDZ A;  2CST A;  3NYU A;  1IX6 A;  1KL2 A;  3A8U X;  4XJL A;  1X29 A;  2VGZ A;  3MBB A;  2BHX A;  2CJG A;  4XQ2 A;  2ZSL A;  2YOB A;  1CL1 A;  1AKA A;  2W8W A;  1ASF A;  5C6U A;  2VIB A;  3LVM A;  4RM1 A;  3LY1 A;  3FCR A;  1CJ0 A;  4ITG A;  3GET A;  1PFF A;  3UE8 A;  2BYJ A;  1IX7 A;  2VGV A;  4IY7 A;  1I43 A;  4XJO A;  1ECX A;  2O0R A;  1ZC9 A;  1TOE A;  3DYD A;  1BJO A;  3EIA A;  2CJH A;  1AY4 A;  2BI3 A;  3I16 A;  4K05 A;  1WYV A;  5JAY A;  3E2Z A;  1KKP A;  1RV3 A;  5M46 A;  5KTB A;  3F9T A;  4F5H A;  2BWO A;  4RLG A;  3AEM C;  3AEJ A;  1ASM A;  1AIB A;  2GMS A;  3GSB A;  3MAU A;  3N4S A;  3QGU A;  1KL1 A;  2X5F A;  2DKB A;  2CB1 A;  4JF1 A;  4LW4 A;  2Z20 A;  2BI9 A;  2VLF A;  3HVY A;  2CY8 A;  3BWN A;  3TAT A;  2VI8 A;  2G6W A;  3MEB A;  3E9K A;  4PVF A;  4W1X A;  2JJG A;  3TQX A;  2EO5 A;  1DFO A;  2BWN A;  3OKS A;  1QZ9 A;  5E5I A;  2BIE A;  3ISL A;  3PIU A;  1TOG A;  4IXZ A;  1ASD A;  1CQ6 A;  2W7I A;  4A0R A;  1MLY A;  3USF A;  4CBR A;  3WX9 A;  1AMA A;  4WD2 A;  3ZZK A;  2ZY2 A;  1S06 A;  3D6K A;  4ZDO A;  5DX5 A;  1BS0 A;  1BT4 A;  1QIT A;  1ASA A;  2AY2 A;  4ZSY A;  2W7H A;  4KXK A;  4M2K A;  2OKK A;  1LC8 A;  2VGU A;  1AIC A;  2BIG A;  4W5K A;  4OTL A;  1ASN A;  4IXS A;  2ZC0 A;  4E3Q A;  4UOY A;  3AEP A;  5M4B A;  1EQB A;  3WKR A;  1YIZ A;  3UAK A;  1YOO A;  4P7Y A;  5BJ3 A;  2W7D A;  4EB7 A;  1XEY A;  2R5C B;  2HZP A;  1V2F A;  2W7L A;  1S07 A;  3R4T A;  4LNM A;  5FT4 A;  3KGW A;  4K2B A;  2R5E A;  1AHY A;  4JE5 D;  4TMR A;  3AV7 A;  5M4D A;  1YJZ A;  3ASA A;  3EZS A;  3BB8 A;  1ASB A;  3GBX A;  1MGV A;  1M32 A;  1SPA A;  2VIA A;  3MKJ A;  1AHF A;  1DJU A;  1B5O A;  3FQA A;  5EQC A;  1Z3Z A;  4ZDL A;  1S0A A;  1WYT B;  3GR9 A;  3W1H A;  4ADC A;  2A1V A;  3N0L A;  2GMU A;  2WK8 A;  2JGT A;  4W91 A;  3PDB A;  2CH2 A;  4WLJ A;  1TOJ A;  4A00 A;  3LWS A;  4W8I A;  3NNK A;  3L44 A;  4WYG A;  3HLM A;  2QB2 A;  2KFP A;  4OBV A;  5DJ1 A;  5K8B A;  1ASC A;  1ASG A;  2NMP A;  3E2Y A;  2JG2 A;  1JF9 A;  2BI5 A;  3FVU A;  5BJ4 A;  2W7J A;  1AHE A;  3JZL A;  2VMX A;  3GJU A;  1BJ4 A;  4NOG A;  2ZSM A;  1O61 A;  2FM1 A;  3EI9 A;  4A0H A;  3FKD A;  2D65 A;  1IJI A;  4JEZ A;  8AAT A;  2V0Y A;  1QJ3 A;  1GC2 A;  1LKC A;  1UU2 A;  3PPL A;  1W23 A;  4GSA A;  3FDD A;  2AY4 A;  3GZC A;  4H51 A;  1B4X A;  3LVL B;  4PFF A;  2FNI A;  4UQV A;  1SVV A;  2CJD A;  3H9X A;  3FTB A;  3KE3 A;  1P3W A;  4A0F A;  3T32 A;  3N75 A;  4BMK A;  3FD0 A;  1BJW A;  3AEN B;  1VEF A;  4TN4 A;  1J32 A;  3DR4 A;  3WCN A;  3BC8 A;  2AY9 A;  4BQ0 A;  2EZ1 A;  2YKV A;  3LVK A;  3VK4 A;  5FT5 A;  2WKA A;  3PA9 A;  1PG8 A;  3BCX A;  2XH1 A;  5TF5 A;  4E3R A;  3E2F A;  3LG0 A;  4WP0 A;  2FQ6 A;  2R2N A;  2YRR A;  1GDE A;  1UU0 A;  2D5Y A;  1G4X A;  3QM2 A;  3N7N A;  3VAX A;  1W7N A;  2F8J A;  1C4K A;  2JJH A;  4ZLV A;  4RIT A;  1AIA A;  2VMV A;  3P1T A;  3ECD A;  4WYC A;  2VLH A;  3AEL A;  4UHM A;  4ZWV A;  1I29 A;  4Q31 A;  4F5F A;  5EUE A;  5HXX A;  2YCP A;  3NX3 A;  4H63 Q;  4WB0 A;  4R5F A;  1D7V A;  1D7R A;  4ITX A;  3DR7 A;  2OGE A;  3PGY A;  5EAA A;  3LVJ A;  4A0G A;  4AZK A;  2X8U A;  1BW0 A;  4M2M A;  1GC0 A;  3JWB A;  5M49 A;  4AO4 A;  4EFF A;  1AKC A;  1IUG A;  1D7S A;  4CVQ A;  2W7E A;  1QGN A;  5F8V A;  3PD6 A;  1LK9 A;  3BS8 A;  3ELP A;  1SZK A;  2D63 A;  2O7C A;  2Q7W A;  2D64 A;  5G2P A;  1PMO A;  4AOA A;  3N4R A;  2X5D A;  1GD9 A;  1KKJ A;  2W7K A;  4WYE A;  4J8L A;  2WK7 A;  4N0W A;  4XK1 A;  1MDO A;  3CBF A;  2E7J A;  2GSA A;  2R0T A;  2RFV A;  1AHG A;  1PMM A;  1DJ9 A;  2VMR A;  3WY7 A;  1CQ8 A;  4F4E A;  1WKH A;  2GQN A;  2D7Z A;  3F0H A;  3NUB A;  4A6R A;  4ADB A;  2DGK A;  4IX8 A;  4RAE A;  1ARH A;  1C7G A;  1C9C A;  4ZAS A;  2ZP7 A;  3K28 A;  1V2D A;  1QJ5 A;  2D7Y A;  4CXQ A;  3VK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...