2BHXA

Radiation damage of the schiff base in phosphoserine aminotransferase (structure a)
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
360
structure length
360
Chain Sequence
VKQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKENA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Strain Relief at the Active Site of Phosphoserine Aminotransferase Induced by Radiation Damage.
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Transferase
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
total genus 127
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2bhxA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2bhxA02
1I43A 3H14A 3OKSA 1V72A 2VGSA 4XJPA 4PIWA 2W7KA 5FT6A 2BI2A 4WLHA 5I92A 1CS1A 1B4XA 1KKPA 3PDBB 1SFFA 9AATA 2VMQA 3BWOA 3LVMA 1IX7A 5E3KA 1I41A 2YKYA 4RIZA 1YJSA 2AY5A 4O6ZA 3FRKA 4WYAA 2HOXA 2FN6A 4A0RA 4HVKA 1PFFA 3UE8A 1LKCA 1JS6A 5TF5A 4ZWVA 5BJ3A 1C0NA 1LC8A 4WYDA 4Y0HA 5AX8A 5E5IA 5G4JA 2W7IA 1XEYA 2C81A 2YKVA 3UAKA 4B98A 4QGRA 1AKCA 1OATA 3BWNC 3E2ZB 2W7GA 3NU8A 3WKRA 4R5FA 3COGA 2Z61A 4J5UA 2BI1A 2DGLA 2RFVA 2DKBA 1X29A 3NYSA 2W7FA 4IXZA 4ZLVA 4DBCA 2FNIA 4TN4A 1LK9A 3R9AA 4ADBA 4R8DA 1MDOA 1GEXA 3FZ8A 3FQAA 3RQ1A 1Z3ZA 2QA3A 2BI9A 3BCXA 1ASCA 2JG2A 2YCNA 3D6KA 3RCHA 3QI6A 3WGBA 2ZSLA 1IUGA 4CVQA 1D7RA 2OKJA 4N0BA 4F5FA 3G0TA 1AX4A 4XJMA 4OYTA 1MLZA 3FVSA 2BKWA 4IXSA 5C6UA 3E6GA 1O61A 3W1IA 1TOKA 3ASBA 3FKDA 3CAIA 1ASAA 2D64A 3TFTA 3NU7A 3NUBA 4UQVA 7AATA 4A72A 4XJOA 2AATA 2BYJA 1ARSA 3NUIA 1DKAA 1ASFA 1OHVA 2VMZA 3DRDA 4EB5A 1AHGA 1CQ8A 1AHEA 1C7GA 4F5KA 1DJ9A 1TARA 3II0A 1SF2A 2F8JA 3VAXA 1KMJA 1TPLA 4RAEA 1CZEA 3EI8A 4JF0A 1X0MA 1EG5A 1IX8A 3B1EA 1M32A 2VMVA 5EQCA 1SZUA 2W8WA 3CQ5A 1AKAA 1BJWA 5FT8A 1RV3A 1OXPA 1CL2A 3H7FA 1C7OA 1G7WA 4ZDPA 4E3RA 2CSTA 2DKJA 1P3WA 5DJ1A 4BHDA 2HUFA 2BYLA 1ZOBA 5DX5A 1WKGA 3FTBA 4PFNA 4BQ0A 1GCKA 3P6KA 1Y4IA 2FYFA 1SVVA 2YHKA 3HVYA 4A0GA 2G6WA 1GC0A 1V2EA 2YCPA 1ASBA 4XK1A 3ZZJA 3R4TA 1I48A 3PD6A 1AJSB 2OKKA 4JEZA 1QGNA 1B9HA 4K2IA 4JF1A 1OHWA 2YCTA 2EZ2A 5M4BA 1S07A 3DXWA 1AY5A 4Q76A 4IY7A 2PB2A 5JAYA 2ZY4A 1W7NA 1MAQA 2CJDA 1TATA 2JISA 2VGWA 4CBRA 1AMQA 1D7VA 1E5FA 4GSAA 4IW7A 1AY8A 1GC3A 1QZ9A 1BQAA 5EUDA 4RM1A 1N31A 3UWCA 2BI5A 3OP7A 1IBJA 2ZY3A 1OHYA 4WYCA 3N0LA 2QB3A 2HZPA 2Z9UA 1E5EA 1TOGA 4CXRA 5EUNA 2ZJGA 3CQ6A 3DYDA 2BIEA 3HLMA 2JJEA 3AEOA 3FDBA 2EH6A 1C9CA 3GWPA 4R2NA 2VMTA 3LWSA 4ITXA 1AHFA 1MDZA 4A0FA 1GEYA 1O69A 2D61A 3AOVA 4OMAA 5EIGA 3RBLA 1YNUA 3LV2A 4XJLA 2WKAA 4IYOA 3EZ1A 3WLXA 4MKJA 5EFSA 3K7YA 3GZDA 2JJFA 4WXFA 3NX3A 3I16A 1ZC9A 2W7JA 4GRXA 1GC2A 1YAAA 2HUUA 1KL1A 2XBNA 1IAXA 5DB5A 2VMNA 4W8IA 3WCOA 4M2KA 3CQ4A 1XI9A 3WCNA 1S09A 2BIAA 4WXGA 4RJ0A 4MSOA 1FG3A 1AAMA 1B5PA 2HOYA 1MLYA 4E77A 4F5IA 2CY8A 1C7NA 1V2FA 3ECDA 5M49A 1I29A 1ASMA 3AEPA 4FFCA 2GB3A 2W7DA 4JEXA 4UHOA 1G7XA 4DQ6A 2GQNA 1JF9A 2GSAA 4EB7A 2JJGA 3BC8A 5HDMA 1Z7DA 2D7YA 5J8QA 1WYUA 2CINA 2YOBA 1TOIA 1V2DA 4GE4A 4JE5D 3KGWA 2FNUA 3NYTA 4OT8A 2OGAA 4ZWMA 1M0NA 4TV7A 4ADCA 2WK7A 3E2YA 4AZJA 1CQ6A 1ELUA 3EZSA 5BJ4A 2Z9VA 2VMSA 1QIRA 1EQBA 1GC4A 3TATA 2AY1A 1JG8A 2BWPA 3QHXA 2Q7WA 8AATA 1LC7A 1ZODA 1ARIA 3IHJA 4MY5A 1U08A 3AEMA 1DTYA 1ASEA 2QLRA 2Z9XA 3B1DA 2HP1A 1AKBA 1W23A 2E7JA 2W7MA 3DR4A 3VOMA 3MC6A 3HL2A 4EU1A 4AZKA 4Q6RA 2DR1A 2OQXA 3EI7A 4RKCA 3K40A 3USFA 3I5TA 1H1CA 4A6RA 4BMKA 3G7QA 4ITGA 2CB1A 3GETA 1O62A 3I4JA 5DJ9A 4KXKA 2YRIA 1ELQA 4P7YA 3B8XA 2AEUA 2VIBA 1ASNA 2W8UA 3FZ7A 4W91A 1X28A 3B46A 4TMRA 4DGTA 1UU0A 3T32A 5D95A 2DGKA 4A0HA 1AICA 2OATA 4WXBA 5G2QA 1MAPA 4BA5A 1EJIA 1M0QA 3BB8A 3NYUA 3A8UX 3EIBA 3PDBA 3DR7A 4RITA 1WYVA 2E7IA 2HUIA 2ZY5A 2EGYA 1TOEA 2CFBA 2R5EA 2Z67A 3E77A 3AOWA 2VMOA 5EUEA 2CH1A 2ORDA 1D7SA 2VGVA 2VMWA 3GJUA 3PDXA 3FZ6A 3QBOA 4K2BA 5LH9A 1TOJA 2D66A 3JW9A 4F5LA 1YIZA 4MKKA 4WP0A 1LC5A 2AY2A 5M46A 4U1TA 3JZLA 3FCRA 3EIAA 4AOAA 1QISA 1AMAA 2W7HA 3NNKA 2D65A 3HBXA 2HOZA 4PVFA 2AY4A 1B8GA 3AV7A 4PFFA 4GEBA 1J04A 4MQPA 1CQ7A 2DGMA 2W8VA 4GE9A 4RLGA 2AEVA 3P1TA 4W5KA 5FT5A 4A00A 1FC4A 3CBFA 4EMYA 2O7CA 3ACZA 4LC3A 4W1XA 4WBTA 4ADEA 3KKIA 3DZZA 4AO4A 2PB0A 4WYEA 1BKGA 4LW4A 2TPLA 2AY8A 3G8MA 2VGUA 5FT4A 2ZP7A 4A6TA 1X2AA 3AEJC 5HHYA 3RBFA 3NDNA 3HT4A 4IXOA 3TCMA 4CXQA 5F8VA 1VP4A 4P3MA 3EI6A 4WB0B 3EI9A 1BS0A 2JGTA 5M4DA 3AENA 3VK2A 3QPGA 5HXXA 2OGEA 4OTLA 2E54A 3LVLB 1BJ4A 4JEWA 5IWQA 3RI6A 4GE7A 4F4EA 3NRAA 3MADA 4KAMA 2AY7A 1ARHA 2GMSA 4ZAHA 3ASAA 1AY4A 1ARGA 1PMOA 4ISYA 3PIUA 4OCAA 1MDXA 5G4IA 1DJUA 1FG7A 1YIYA 3ATHA 1W3UA 3GZDC 1ASGA 2HORA 2VGTA 3MEBA 3W1HA 1ECXA 1KL2A 4Y0DA 4AO9A 1OXOA 4OBUA 1GBNA 2Z1YA 4U2HA 1VJOA 1WYVB 4ZM4A 1LW4A 2CJHA 3HDOA 3BCAA 4M2JA 2AY9A 1AAWA 3RCHB 1N8PA 3MAUA 3PPLA 1C4KA 4I8AA 3BV0A 3GR9A 4RKDA 1M7YA 4A6UA 4ZM3A 2R5CB 2YKXA 1ORDA 2Z9WA 3A9YA 2WK9A 3DU4A 4ZSYA 3EI5A 4ZDLA 1G4XA 3FQ8A 2EZ1A 1S0AA 1UU2A 1SZKA 2BIGA 2X3LA 4MQRA 4UHNA 1W7MA 3FDDA 3EUCA 1RV4A 2BWOA 2VI9A 5G09A 3MAFA 2CANA 3F6TA 4XEWA 3WY7A 4OBVA 3GBXA 1DGEA 4M2MA 4R5ZA 1WYTB 2CTZA 1AHXA 1QITA 1IX6A 1KKJA 3TQXA 1ARTA 3FVXA 4E1OA 2AY6A 1LS3A 2QBTA 2BHXA 2VLHA 3KE3A 2D63A 2BI3A 2Z1ZA 4RJYA 1GEWA 2W7LA 3ISLA 4B9BA 1T3IA 2PO3A 1N2TA 3W1JA 3L44A 3AEMC 3ZRPA 2EPJA 2W8TA 2FM1A 3DODA 3N5MA 1M0PA 3F0HA 3Q8NA 3VP6A 3TFUA 2CJGA 3MC6C 5F9SA 3ELEA 2O0RA 2VGZA 2D5YA 4WYGA 2FQ6A 3MKJA 3DXVA 3M5UA 2JJHA 2X5DA 1BT4A 1WKHA 4IX8A 3QGUA 4Y0IA 1M4NA 4L0OA 3PAAA 3WGCA 3WX9A 3FD0A 1GD9A 3PD6B 4EFFA 3ELPA 2VIAA 2WK8A 3FQ7A 3NTJA 2C7TA 2R5CA 3RUYA 4AH3A 3FVUA 3JWAA 3WZFA 2C0RA 2W7EA 4BA4A 2X5FA 1B5OA 5D5SA 1B9IA 4OC9A 1VEFA 1AJRA 3K28A 2CH2A 1YOOA 2ZSMA 1UU1A 4W1WA 1W7LA 2VMUA 1LW5A 3JTXA 3A2BA 3VK3A 4LNMA 2VMRA 4LNJA 3GSBA 3N75A 4WYFA 2DOUA 1AMSA 1JS3A 1CJ0A 1O4SA 3B1CA 3BCBA 4WB0A 3ZRQA 1WYTA 2X8UA 1QJ5A 1BJOB 2HP2A 3A9XA 3A9ZA 2E7UA 3WKSA 4XQ2A 4WD2A 1DGDA 3DC1A 4HF8A 1RVYA 1GDEA 2ZYJA 1BJNA 4ZASA 4K2MA 4MQQA 1CL1A 3F9TA 2Z20A 1S06A 3AENB 3L8AA 1RVUA 2BWNA 4JEVA 5EAAA 2VI8A 4IYOB 4LW2A 1M0OA 1UKJA 2V1PA 4W1VA 4F5GA 4N0WA 4XAUA 4MGRA 2C44A 1AIBA 2R0TA 3PGYA 1SPAA 5K8BA 1BW0A 1J32A 3PJ0A 4F5HA 1TASA 3PA9A 4Q31A 2R2NA 3KGXA 3AELA 2D7ZA 4ADDA 1MGVA 3LG0A 2QMAA 4CBSA 3VK4A 4H51A 4GDYA 3BWNA 5EIGB 4J8LA 4FL0A 1SZSA 3MAFB 3FFHA 1IJIA 2O1BA 4ATQA 1IVRA 1YJZA 1D7UA 1QJ3A 1S08A 1IAYA 3BN1A 1M6SA 4JE5A 4UOYA 4ZSWA 3JU7A 2ZUKA 2V0YA 3AEJA 3HQTA 3GZCA 5G0AA 2VMYA 1AMRA 1AHYA 4F5JA 1PMMA 3HMUA 3LVKA 1AIAA 2YRRA 3IF2A 2VYCA 1ASDA 1WYUB 2W8JA 3LY1A 1PG8A 4JEYA 4KYOA 3LVJA 1H0CA 3QM2A 3E9KA 4NOGA 2YKUA 2NMPA 1BJOA 5E4ZA 1BQDA 1AJSA 3E2ZA 3MBBA 2VMXA 3AATA 2QB2A 3FFRA 5EAVA 4LNLA 2AY3A 2ZC0A 1YJYA 3ZRRA 1D2FA 3BS8A 3E2FA 4WLJA 1G4VA 3QN6A 4ZDOA 1ASLA 1CZCA 3ZZKA 1WSTA 3JWBA 1DFOA 4UHMA 2EO5A 2VMPA 1KMKA 5G2PA 2ZY2A 2GMUA 4ATPA 4F5MA 5LHAA 1DJEA 4Q75A 2VLFA 4E3QA 2XH1A 3FSLA
chains in the Genus database with same CATH superfamily
1I43A 3H14A 3OKSA 1V72A 2VGSA 4XJPA 4PIWA 2W7KA 5FT6A 2BI2A 4WLHA 5I92A 1CS1A 1B4XA 1KKPA 3PDBB 1SFFA 9AATA 2VMQA 3BWOA 3LVMA 1IX7A 5E3KA 1I41A 2YKYA 4RIZA 1YJSA 2AY5A 4O6ZA 3FRKA 4WYAA 2HOXA 2FN6A 4A0RA 4HVKA 1PFFA 3UE8A 1LKCA 1JS6A 5TF5A 4ZWVA 5BJ3A 2FKIA 1C0NA 1LC8A 4WYDA 4Y0HA 5AX8A 5E5IA 5G4JA 2W7IA 1XEYA 2C81A 2YKVA 3UAKA 4B98A 4QGRA 1AKCA 1OATA 3BWNC 3E2ZB 2W7GA 3NU8A 3WKRA 4R5FA 3COGA 2KFPA 2Z61A 4J5UA 2BI1A 2DGLA 2RFVA 2DKBA 1X29A 3NYSA 2W7FA 4IXZA 4ZLVA 4DBCA 2FNIA 4TN4A 1LK9A 3R9AA 4ADBA 4R8DA 1MDOA 1GEXA 3FZ8A 3FQAA 3RQ1A 1Z3ZA 2QA3A 2BI9A 3BCXA 1ASCA 2JG2A 2YCNA 3D6KA 3RCHA 3QI6A 3WGBA 2ZSLA 1IUGA 4CVQA 1D7RA 2OKJA 4N0BA 4F5FA 3G0TA 1AX4A 4XJMA 4OYTA 1MLZA 3N4XA 3FVSA 2BKWA 4IXSA 5C6UA 3E6GA 1O61A 3W1IA 1TOKA 3ASBA 3FKDA 3CAIA 1ASAA 2D64A 3TFTA 3NU7A 3NUBA 4UQVA 7AATA 4A72A 4XJOA 2AATA 2BYJA 1ARSA 3NUIA 1DKAA 1ASFA 1OHVA 2VMZA 3DRDA 4EB5A 1AHGA 1CQ8A 1AHEA 1C7GA 4F5KA 1DJ9A 1TARA 3II0A 1SF2A 2F8JA 3VAXA 1KMJA 1TPLA 4RAEA 1CZEA 3EI8A 4JF0A 1X0MA 1EG5A 1IX8A 3B1EA 1M32A 2VMVA 5EQCA 1SZUA 2W8WA 3CQ5A 1AKAA 1BJWA 5FT8A 3N7NA 1RV3A 1OXPA 1CL2A 3H7FA 1C7OA 1G7WA 4ZDPA 4E3RA 2CSTA 2DKJA 1P3WA 5DJ1A 4BHDA 2HUFA 2BYLA 1ZOBA 5DX5A 1WKGA 3FTBA 2EYQA 4PFNA 4BQ0A 1GCKA 3P6KA 1Y4IA 2FYFA 1SVVA 2YHKA 3HVYA 4A0GA 2G6WA 1GC0A 1V2EA 2YCPA 1ASBA 4XK1A 3ZZJA 3R4TA 1I48A 3PD6A 1AJSB 2OKKA 4JEZA 1QGNA 1B9HA 4K2IA 4JF1A 1OHWA 2YCTA 2EZ2A 5M4BA 1S07A 3DXWA 1AY5A 4Q76A 4IY7A 2PB2A 5JAYA 2ZY4A 1W7NA 1MAQA 2CJDA 1TATA 2JISA 2VGWA 4CBRA 1AMQA 1D7VA 1E5FA 4GSAA 4IW7A 1AY8A 1GC3A 1QZ9A 1BQAA 5EUDA 4RM1A 1N31A 3UWCA 2BI5A 3OP7A 1IBJA 2ZY3A 1OHYA 4WYCA 3N0LA 2QB3A 2HZPA 2Z9UA 1E5EA 1TOGA 4CXRA 5EUNA 2ZJGA 3CQ6A 3DYDA 2BIEA 3HLMA 2JJEA 3AEOA 3FDBA 2EH6A 1C9CA 3GWPA 4R2NA 2VMTA 3LWSA 4ITXA 1AHFA 1MDZA 4A0FA 1GEYA 1O69A 2D61A 3AOVA 4OMAA 5EIGA 3RBLA 1YNUA 3LV2A 4XJLA 2WKAA 4IYOA 3EZ1A 3WLXA 4MKJA 5EFSA 3K7YA 3GZDA 2JJFA 4WXFA 3NX3A 3I16A 1ZC9A 2W7JA 4GRXA 1GC2A 1YAAA 2HUUA 1KL1A 2XBNA 1IAXA 5DB5A 2VMNA 4W8IA 3WCOA 4M2KA 3CQ4A 1XI9A 3WCNA 1S09A 2BIAA 4WXGA 4RJ0A 4MSOA 1FG3A 1AAMA 1B5PA 2HOYA 1MLYA 4E77A 4F5IA 2CY8A 1C7NA 1V2FA 3ECDA 5M49A 1I29A 1ASMA 3AEPA 4FFCA 2GB3A 2W7DA 4JEXA 4UHOA 1G7XA 4DQ6A 2GQNA 1JF9A 2GSAA 4EB7A 2JJGA 3BC8A 5HDMA 1Z7DA 2D7YA 5J8QA 1WYUA 2CINA 2YOBA 1TOIA 1V2DA 4GE4A 4JE5D 3KGWA 2FNUA 3NYTA 4OT8A 2OGAA 4ZWMA 1M0NA 4TV7A 4ADCA 2WK7A 3E2YA 4AZJA 1CQ6A 1ELUA 3EZSA 5BJ4A 2A1VA 2Z9VA 2VMSA 1QIRA 1EQBA 1GC4A 3TATA 2AY1A 1JG8A 2BWPA 3QHXA 2Q7WA 8AATA 1LC7A 1ZODA 1ARIA 3IHJA 4MY5A 1U08A 3AEMA 1DTYA 1ASEA 2QLRA 2Z9XA 3B1DA 2HP1A 1AKBA 1W23A 2E7JA 2W7MA 3DR4A 3VOMA 3MC6A 3HL2A 4EU1A 4AZKA 4Q6RA 2DR1A 2OQXA 3EI7A 4RKCA 3K40A 3USFA 3I5TA 1H1CA 4A6RA 4K05A 4BMKA 3G7QA 4ITGA 2CB1A 3GETA 1O62A 3I4JA 5DJ9A 3N4RA 4KXKA 2YRIA 1ELQA 4P7YA 3B8XA 2AEUA 2VIBA 1ASNA 2W8UA 3FZ7A 4W91A 1X28A 3B46A 4TMRA 4DGTA 1UU0A 3T32A 5D95A 2DGKA 4A0HA 1AICA 2OATA 4WXBA 5G2QA 1MAPA 4BA5A 1EJIA 1M0QA 3BB8A 3NYUA 3A8UX 3EIBA 3H9XA 3PDBA 3DR7A 4RITA 1WYVA 2E7IA 2HUIA 2ZY5A 2EGYA 1TOEA 2CFBA 2R5EA 2Z67A 3E77A 3AOWA 2VMOA 5EUEA 2CH1A 2ORDA 1D7SA 2VGVA 2VMWA 3GJUA 3PDXA 3FZ6A 3QBOA 4K2BA 5LH9A 1TOJA 2D66A 3JW9A 4F5LA 1YIZA 4MKKA 4WP0A 1LC5A 2AY2A 5M46A 4U1TA 3JZLA 3FCRA 3EIAA 4AOAA 1QISA 1AMAA 2W7HA 3NNKA 2D65A 3HBXA 2HOZA 4PVFA 2AY4A 1B8GA 3AV7A 4PFFA 4GEBA 1J04A 4MQPA 1CQ7A 2DGMA 2W8VA 4GE9A 4RLGA 2AEVA 3P1TA 4W5KA 5FT5A 4A00A 1FC4A 3CBFA 4EMYA 2O7CA 3ACZA 4LC3A 4W1XA 4WBTA 4ADEA 3KKIA 3DZZA 4AO4A 2PB0A 4WYEA 1BKGA 4LW4A 2TPLA 2AY8A 3G8MA 2VGUA 5FT4A 2ZP7A 4A6TA 1X2AA 3AEJC 5HHYA 3RBFA 3NDNA 3HT4A 4IXOA 3TCMA 4CXQA 5F8VA 2QSRA 1VP4A 4P3MA 3EI6A 4WB0B 3EI9A 1BS0A 2JGTA 5M4DA 3AENA 3VK2A 3QPGA 5HXXA 2OGEA 4OTLA 2E54A 3LVLB 1BJ4A 4JEWA 5IWQA 3RI6A 4GE7A 4F4EA 3NRAA 3MADA 4KAMA 2AY7A 1ARHA 2GMSA 4ZAHA 3ASAA 1AY4A 1ARGA 1PMOA 4ISYA 3PIUA 4OCAA 1MDXA 5G4IA 1DJUA 1FG7A 1YIYA 3ATHA 1W3UA 3GZDC 1ASGA 2HORA 2VGTA 3MEBA 3W1HA 1ECXA 1KL2A 4Y0DA 4AO9A 1OXOA 4OBUA 1GBNA 2Z1YA 4U2HA 1VJOA 1WYVB 4ZM4A 1LW4A 2CJHA 3HDOA 3BCAA 4M2JA 2AY9A 1AAWA 3RCHB 1N8PA 3MAUA 3PPLA 1C4KA 4I8AA 3BV0A 3GR9A 4RKDA 1M7YA 4A6UA 4ZM3A 2R5CB 2YKXA 1ORDA 2Z9WA 3A9YA 2WK9A 3DU4A 4ZSYA 3EI5A 4ZDLA 1G4XA 3FQ8A 2EZ1A 1S0AA 1UU2A 1SZKA 2BIGA 2X3LA 4MQRA 4UHNA 1W7MA 3FDDA 3EUCA 1RV4A 2BWOA 2VI9A 5G09A 3MAFA 2CANA 3F6TA 4XEWA 3WY7A 4OBVA 3GBXA 1DGEA 4M2MA 4R5ZA 1WYTB 2CTZA 1AHXA 1QITA 1IX6A 1KKJA 3TQXA 1ARTA 3FVXA 4E1OA 2AY6A 1LS3A 2QBTA 2BHXA 2VLHA 3KE3A 2D63A 2BI3A 2Z1ZA 4RJYA 1GEWA 2W7LA 3ISLA 4B9BA 1T3IA 2PO3A 1N2TA 3W1JA 3L44A 3AEMC 3ZRPA 2EPJA 2W8TA 1KAFA 2FM1A 3DODA 3N5MA 1M0PA 3F0HA 3Q8NA 3VP6A 3TFUA 2CJGA 3MC6C 5F9SA 3ELEA 2O0RA 2VGZA 2D5YA 4WYGA 2FQ6A 3MKJA 3DXVA 3M5UA 2JJHA 2X5DA 1BT4A 1WKHA 4IX8A 3QGUA 4Y0IA 1M4NA 4L0OA 3PAAA 3WGCA 3WX9A 3FD0A 1GD9A 3PD6B 4EFFA 3ELPA 2VIAA 2WK8A 3FQ7A 3NTJA 2C7TA 2R5CA 3RUYA 4AH3A 3FVUA 3JWAA 3WZFA 2C0RA 2W7EA 4BA4A 2X5FA 1B5OA 5D5SA 1B9IA 4OC9A 1VEFA 1AJRA 3K28A 2CH2A 1YOOA 2ZSMA 1UU1A 4W1WA 1W7LA 2VMUA 1LW5A 3JTXA 3A2BA 3VK3A 4LNMA 2VMRA 4H63Q 4LNJA 3GSBA 3N75A 4WYFA 2DOUA 1AMSA 1JS3A 1CJ0A 1O4SA 3B1CA 3BCBA 4WB0A 3ZRQA 1WYTA 2X8UA 1QJ5A 1BJOB 5KTBA 2HP2A 3A9XA 3A9ZA 2E7UA 3WKSA 4XQ2A 4WD2A 1DGDA 3DC1A 4HF8A 1RVYA 1GDEA 2ZYJA 1BJNA 4ZASA 4K2MA 4MQQA 1CL1A 3F9TA 2Z20A 1S06A 3AENB 3L8AA 1RVUA 2BWNA 4JEVA 5EAAA 2VI8A 4IYOB 4LW2A 1M0OA 1UKJA 2V1PA 4W1VA 4F5GA 4N0WA 4XAUA 4MGRA 2WB6A 2C44A 1AIBA 2R0TA 3PGYA 1SPAA 5K8BA 1BW0A 1J32A 3PJ0A 4F5HA 1TASA 3PA9A 4Q31A 2R2NA 3KGXA 3AELA 2D7ZA 4ADDA 1MGVA 3LG0A 2QMAA 4CBSA 3VK4A 4H51A 4GDYA 3BWNA 5EIGB 4J8LA 4FL0A 1SZSA 3MAFB 3FFHA 1IJIA 2O1BA 4ATQA 1IVRA 1YJZA 1D7UA 1QJ3A 1S08A 1IAYA 3BN1A 1M6SA 4JE5A 4UOYA 4ZSWA 3JU7A 2ZUKA 2V0YA 3AEJA 3HQTA 3GZCA 5G0AA 2VMYA 1AMRA 1AHYA 4F5JA 1PMMA 3HMUA 3LVKA 1AIAA 2YRRA 3IF2A 2VYCA 1ASDA 1WYUB 2W8JA 3LY1A 1PG8A 4JEYA 4KYOA 3LVJA 1H0CA 3QM2A 3E9KA 4NOGA 2YKUA 2NMPA 1BJOA 5E4ZA 1BQDA 1AJSA 3E2ZA 3MBBA 2VMXA 3AATA 2QB2A 3FFRA 5EAVA 4LNLA 2AY3A 2ZC0A 1YJYA 3ZRRA 1D2FA 3BS8A 3E2FA 4WLJA 1G4VA 3QN6A 4ZDOA 2G7JA 1ASLA 1CZCA 3ZZKA 3N4SA 1WSTA 3JWBA 1DFOA 4UHMA 2EO5A 2VMPA 1KMKA 5G2PA 2ZY2A 2GMUA 4ATPA 4F5MA 5LHAA 1DJEA 4Q75A 2VLFA 4E3QA 2XH1A 3FSLA
chains in the Genus database with same CATH topology
1I43A 3H14A 3OKSA 1V72A 2VGSA 4XJPA 4PIWA 2W7KA 5FT6A 2BI2A 4WLHA 5I92A 1CS1A 1B4XA 1KKPA 3PDBB 1SFFA 9AATA 2VMQA 3BWOA 3LVMA 1IX7A 5E3KA 1I41A 2YKYA 4RIZA 1YJSA 2AY5A 4O6ZA 3FRKA 4WYAA 2HOXA 2FN6A 4A0RA 4HVKA 1PFFA 3UE8A 1LKCA 1JS6A 5TF5A 4ZWVA 5BJ3A 2FKIA 1C0NA 1LC8A 4WYDA 4Y0HA 5AX8A 5E5IA 5G4JA 2W7IA 1XEYA 2C81A 2YKVA 3UAKA 4B98A 4QGRA 1AKCA 1OATA 3BWNC 3E2ZB 2W7GA 3NU8A 3WKRA 4R5FA 3COGA 2KFPA 2Z61A 4J5UA 2BI1A 2DGLA 2RFVA 2DKBA 1X29A 3NYSA 2W7FA 4IXZA 4ZLVA 4DBCA 2FNIA 4TN4A 1LK9A 3R9AA 4ADBA 4R8DA 1MDOA 1GEXA 3FZ8A 3FQAA 3RQ1A 1Z3ZA 2QA3A 2BI9A 3BCXA 1ASCA 2JG2A 2YCNA 3D6KA 3RCHA 3QI6A 3WGBA 2ZSLA 1IUGA 4CVQA 1D7RA 2OKJA 4N0BA 4F5FA 3G0TA 1AX4A 4XJMA 4OYTA 1MLZA 3N4XA 3FVSA 2BKWA 4IXSA 5C6UA 3E6GA 1O61A 3W1IA 1TOKA 3ASBA 3FKDA 3CAIA 1ASAA 2D64A 3TFTA 3NU7A 3NUBA 4UQVA 7AATA 4A72A 4XJOA 2AATA 2BYJA 1ARSA 3NUIA 1DKAA 1ASFA 1OHVA 2VMZA 3DRDA 4EB5A 1AHGA 1CQ8A 1AHEA 1C7GA 4F5KA 1DJ9A 1TARA 3II0A 1SF2A 2F8JA 3VAXA 1KMJA 1TPLA 4RAEA 1CZEA 3EI8A 4JF0A 1X0MA 1EG5A 1IX8A 3B1EA 1M32A 2VMVA 5EQCA 1SZUA 2W8WA 3CQ5A 1AKAA 1BJWA 5FT8A 3N7NA 1RV3A 1OXPA 1CL2A 3H7FA 1C7OA 1G7WA 4ZDPA 4E3RA 2CSTA 2DKJA 1P3WA 5DJ1A 4BHDA 2HUFA 2BYLA 1ZOBA 5DX5A 1WKGA 3FTBA 2EYQA 4PFNA 4BQ0A 1GCKA 3P6KA 1Y4IA 2FYFA 1SVVA 2YHKA 3HVYA 4A0GA 2G6WA 1GC0A 1V2EA 2YCPA 1ASBA 4XK1A 3ZZJA 3R4TA 1I48A 3PD6A 1AJSB 2OKKA 4JEZA 1QGNA 1B9HA 4K2IA 4JF1A 1OHWA 2YCTA 2EZ2A 5M4BA 1S07A 3DXWA 1AY5A 4Q76A 4IY7A 2PB2A 5JAYA 2ZY4A 1W7NA 1MAQA 2CJDA 1TATA 2JISA 2VGWA 4CBRA 1AMQA 1D7VA 1E5FA 4GSAA 4IW7A 1AY8A 1GC3A 1QZ9A 1BQAA 5EUDA 4RM1A 1N31A 3UWCA 2BI5A 3OP7A 1IBJA 2ZY3A 1OHYA 4WYCA 3N0LA 2QB3A 2HZPA 2Z9UA 1E5EA 1TOGA 4CXRA 5EUNA 2ZJGA 3CQ6A 3DYDA 2BIEA 3HLMA 2JJEA 3AEOA 3FDBA 2EH6A 1C9CA 3GWPA 4R2NA 2VMTA 3LWSA 4ITXA 1AHFA 1MDZA 4A0FA 1GEYA 1O69A 2D61A 3AOVA 4OMAA 5EIGA 3RBLA 1YNUA 3LV2A 4XJLA 2WKAA 4IYOA 3EZ1A 3WLXA 4MKJA 5EFSA 3K7YA 3GZDA 2JJFA 4WXFA 3NX3A 3I16A 1ZC9A 2W7JA 4GRXA 1GC2A 1YAAA 2HUUA 1KL1A 2XBNA 1IAXA 5DB5A 2VMNA 4W8IA 3WCOA 4M2KA 3CQ4A 1XI9A 3WCNA 1S09A 2BIAA 4WXGA 4RJ0A 4MSOA 1FG3A 1AAMA 1B5PA 2HOYA 1MLYA 4E77A 4F5IA 2CY8A 1C7NA 1V2FA 3ECDA 5M49A 1I29A 1ASMA 3AEPA 4FFCA 2GB3A 2W7DA 4JEXA 4UHOA 1G7XA 4DQ6A 2GQNA 1JF9A 2GSAA 4EB7A 2JJGA 3BC8A 5HDMA 1Z7DA 2D7YA 5J8QA 1WYUA 2CINA 2YOBA 1TOIA 1V2DA 4GE4A 4JE5D 3KGWA 2FNUA 3NYTA 4OT8A 2OGAA 4ZWMA 1M0NA 4TV7A 4ADCA 2WK7A 3E2YA 4AZJA 1CQ6A 1ELUA 3EZSA 5BJ4A 2A1VA 2Z9VA 2VMSA 1QIRA 1EQBA 1GC4A 3TATA 2AY1A 1JG8A 2BWPA 3QHXA 2Q7WA 8AATA 1LC7A 1ZODA 1ARIA 3IHJA 4MY5A 1U08A 3AEMA 1DTYA 1ASEA 2QLRA 2Z9XA 3B1DA 2HP1A 1AKBA 1W23A 2E7JA 2W7MA 3DR4A 3VOMA 3MC6A 3HL2A 4EU1A 4AZKA 4Q6RA 2DR1A 2OQXA 3EI7A 4RKCA 3K40A 3USFA 3I5TA 1H1CA 4A6RA 4K05A 4BMKA 3G7QA 4ITGA 2CB1A 3GETA 1O62A 3I4JA 5DJ9A 3N4RA 4KXKA 2YRIA 1ELQA 4P7YA 3B8XA 2AEUA 2VIBA 1ASNA 2W8UA 3FZ7A 4W91A 1X28A 3B46A 4TMRA 4DGTA 1UU0A 3T32A 5D95A 2DGKA 4A0HA 1AICA 2OATA 4WXBA 5G2QA 1MAPA 4BA5A 1EJIA 1M0QA 3BB8A 3NYUA 3A8UX 3EIBA 3H9XA 3PDBA 3DR7A 4RITA 1WYVA 2E7IA 2HUIA 2ZY5A 2EGYA 1TOEA 2CFBA 2R5EA 2Z67A 3E77A 3AOWA 2VMOA 5EUEA 2CH1A 2ORDA 1D7SA 2VGVA 2VMWA 3GJUA 3PDXA 3FZ6A 3QBOA 4K2BA 5LH9A 1TOJA 2D66A 3JW9A 4F5LA 1YIZA 4MKKA 4WP0A 1LC5A 2AY2A 5M46A 4U1TA 3JZLA 3FCRA 3EIAA 4AOAA 1QISA 1AMAA 2W7HA 3NNKA 2D65A 3HBXA 2HOZA 4PVFA 2AY4A 1B8GA 3AV7A 4PFFA 4GEBA 1J04A 4MQPA 1CQ7A 2DGMA 2W8VA 4GE9A 4RLGA 2AEVA 3P1TA 4W5KA 5FT5A 4A00A 1FC4A 3CBFA 4EMYA 2O7CA 3ACZA 4LC3A 4W1XA 4WBTA 4ADEA 3KKIA 3DZZA 4AO4A 2PB0A 4WYEA 1BKGA 4LW4A 2TPLA 2AY8A 3G8MA 2VGUA 5FT4A 2ZP7A 4A6TA 1X2AA 3AEJC 5HHYA 3RBFA 3NDNA 3HT4A 4IXOA 3TCMA 4CXQA 5F8VA 2QSRA 1VP4A 4P3MA 3EI6A 4WB0B 3EI9A 1BS0A 2JGTA 5M4DA 3AENA 3VK2A 3QPGA 5HXXA 2OGEA 4OTLA 2E54A 3LVLB 1BJ4A 4JEWA 5IWQA 3RI6A 4GE7A 4F4EA 3NRAA 3MADA 4KAMA 2AY7A 1ARHA 2GMSA 4ZAHA 3ASAA 1AY4A 1ARGA 1PMOA 4ISYA 3PIUA 4OCAA 1MDXA 5G4IA 1DJUA 1FG7A 1YIYA 3ATHA 1W3UA 3GZDC 1ASGA 2HORA 2VGTA 3MEBA 3W1HA 1ECXA 1KL2A 4Y0DA 4AO9A 1OXOA 4OBUA 1GBNA 2Z1YA 4U2HA 1VJOA 1WYVB 4ZM4A 1LW4A 2CJHA 3HDOA 3BCAA 4M2JA 2AY9A 1AAWA 3RCHB 1N8PA 3MAUA 3PPLA 1C4KA 4I8AA 3BV0A 3GR9A 4RKDA 1M7YA 4A6UA 4ZM3A 2R5CB 2YKXA 1ORDA 2Z9WA 3A9YA 2WK9A 3DU4A 4ZSYA 3EI5A 4ZDLA 1G4XA 3FQ8A 2EZ1A 1S0AA 1UU2A 1SZKA 2BIGA 2X3LA 4MQRA 4UHNA 1W7MA 3FDDA 3EUCA 1RV4A 2BWOA 2VI9A 5G09A 3MAFA 2CANA 3F6TA 4XEWA 3WY7A 4OBVA 3GBXA 1DGEA 4M2MA 4R5ZA 1WYTB 2CTZA 1AHXA 1QITA 1IX6A 1KKJA 3TQXA 1ARTA 3FVXA 4E1OA 2AY6A 1LS3A 2QBTA 2BHXA 2VLHA 3KE3A 2D63A 2BI3A 2Z1ZA 4RJYA 1GEWA 2W7LA 3ISLA 4B9BA 1T3IA 2PO3A 1N2TA 3W1JA 3L44A 3AEMC 3ZRPA 2EPJA 2W8TA 2FM1A 3DODA 3N5MA 1M0PA 3F0HA 3Q8NA 3VP6A 3TFUA 2CJGA 3MC6C 5F9SA 3ELEA 2O0RA 2VGZA 2D5YA 4WYGA 2FQ6A 3MKJA 3DXVA 3M5UA 2JJHA 2X5DA 1BT4A 1WKHA 4IX8A 3QGUA 4Y0IA 1M4NA 4L0OA 3PAAA 3WGCA 3WX9A 3FD0A 1GD9A 3PD6B 4EFFA 3ELPA 2VIAA 2WK8A 3FQ7A 3NTJA 2C7TA 2R5CA 3RUYA 4AH3A 3FVUA 3JWAA 3WZFA 2C0RA 2W7EA 4BA4A 2X5FA 1B5OA 5D5SA 1B9IA 4OC9A 1VEFA 1AJRA 3K28A 2CH2A 1YOOA 2ZSMA 1UU1A 4W1WA 1W7LA 2VMUA 1LW5A 3JTXA 3A2BA 3VK3A 4LNMA 2VMRA 4H63Q 4LNJA 3GSBA 3N75A 4WYFA 2DOUA 1AMSA 1JS3A 1CJ0A 1O4SA 3B1CA 3BCBA 4WB0A 3ZRQA 1WYTA 2X8UA 1QJ5A 1BJOB 5KTBA 2HP2A 3A9XA 3A9ZA 2E7UA 3WKSA 4XQ2A 4WD2A 1DGDA 3DC1A 4HF8A 1RVYA 1GDEA 2ZYJA 1BJNA 4ZASA 4K2MA 4MQQA 1CL1A 3F9TA 2Z20A 1S06A 3AENB 3L8AA 1RVUA 2BWNA 4JEVA 5EAAA 2VI8A 4IYOB 4LW2A 1M0OA 1UKJA 2V1PA 4W1VA 4F5GA 4N0WA 4XAUA 4MGRA 2WB6A 2C44A 1AIBA 2R0TA 3PGYA 1SPAA 5K8BA 1BW0A 1J32A 3PJ0A 4F5HA 1TASA 3PA9A 4Q31A 2R2NA 3KGXA 3AELA 2D7ZA 4ADDA 1MGVA 3LG0A 2QMAA 4CBSA 3VK4A 4H51A 4GDYA 3BWNA 5EIGB 4J8LA 4FL0A 1SZSA 3MAFB 3FFHA 1IJIA 2O1BA 4ATQA 1IVRA 1YJZA 1D7UA 1QJ3A 1S08A 1IAYA 3BN1A 1M6SA 4JE5A 4UOYA 4ZSWA 3JU7A 2ZUKA 2V0YA 3AEJA 3HQTA 3GZCA 5G0AA 2VMYA 1AMRA 1AHYA 4F5JA 1PMMA 3HMUA 3LVKA 1AIAA 2YRRA 3IF2A 2VYCA 1ASDA 1WYUB 2W8JA 3LY1A 1PG8A 4JEYA 4KYOA 3LVJA 1H0CA 3QM2A 3E9KA 4NOGA 2YKUA 2NMPA 1BJOA 5E4ZA 1BQDA 1AJSA 3E2ZA 3MBBA 2VMXA 3AATA 2QB2A 3FFRA 5EAVA 4LNLA 2AY3A 2ZC0A 1YJYA 3ZRRA 1D2FA 3BS8A 3E2FA 4WLJA 1G4VA 3QN6A 4ZDOA 2G7JA 1ASLA 1CZCA 3ZZKA 3N4SA 1WSTA 3JWBA 1DFOA 4UHMA 2EO5A 2VMPA 1KMKA 5G2PA 2ZY2A 2GMUA 4ATPA 4F5MA 5LHAA 1DJEA 4Q75A 2VLFA 4E3QA 2XH1A 3FSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I43 A;  3H14 A;  3OKS A;  1V72 A;  2VGS A;  4XJP A;  4PIW A;  2W7K A;  5FT6 A;  2BI2 A;  4WLH A;  5I92 A;  1CS1 A;  1B4X A;  1KKP A;  3PDB B;  1SFF A;  9AAT A;  2VMQ A;  3BWO A;  3LVM A;  1IX7 A;  5E3K A;  1I41 A;  2YKY A;  4RIZ A;  1YJS A;  2AY5 A;  4O6Z A;  3FRK A;  4WYA A;  2HOX A;  2FN6 A;  4A0R A;  4HVK A;  1PFF A;  3UE8 A;  1LKC A;  1JS6 A;  5TF5 A;  4ZWV A;  5BJ3 A;  1C0N A;  1LC8 A;  4WYD A;  4Y0H A;  5AX8 A;  5E5I A;  5G4J A;  2W7I A;  1XEY A;  2C81 A;  2YKV A;  3UAK A;  4B98 A;  4QGR A;  1AKC A;  1OAT A;  3BWN C;  3E2Z B;  2W7G A;  3NU8 A;  3WKR A;  4R5F A;  3COG A;  2Z61 A;  4J5U A;  2BI1 A;  2DGL A;  2RFV A;  2DKB A;  1X29 A;  3NYS A;  2W7F A;  4IXZ A;  4ZLV A;  4DBC A;  2FNI A;  4TN4 A;  1LK9 A;  3R9A A;  4ADB A;  4R8D A;  1MDO A;  1GEX A;  3FZ8 A;  3FQA A;  3RQ1 A;  1Z3Z A;  2QA3 A;  2BI9 A;  3BCX A;  1ASC A;  2JG2 A;  2YCN A;  3D6K A;  3RCH A;  3QI6 A;  3WGB A;  2ZSL A;  1IUG A;  4CVQ A;  1D7R A;  2OKJ A;  4N0B A;  4F5F A;  3G0T A;  1AX4 A;  4XJM A;  4OYT A;  1MLZ A;  3FVS A;  2BKW A;  4IXS A;  5C6U A;  3E6G A;  1O61 A;  3W1I A;  1TOK A;  3ASB A;  3FKD A;  3CAI A;  1ASA A;  2D64 A;  3TFT A;  3NU7 A;  3NUB A;  4UQV A;  7AAT A;  4A72 A;  4XJO A;  2AAT A;  2BYJ A;  1ARS A;  3NUI A;  1DKA A;  1ASF A;  1OHV A;  2VMZ A;  3DRD A;  4EB5 A;  1AHG A;  1CQ8 A;  1AHE A;  1C7G A;  4F5K A;  1DJ9 A;  1TAR A;  3II0 A;  1SF2 A;  2F8J A;  3VAX A;  1KMJ A;  1TPL A;  4RAE A;  1CZE A;  3EI8 A;  4JF0 A;  1X0M A;  1EG5 A;  1IX8 A;  3B1E A;  1M32 A;  2VMV A;  5EQC A;  1SZU A;  2W8W A;  3CQ5 A;  1AKA A;  1BJW A;  5FT8 A;  1RV3 A;  1OXP A;  1CL2 A;  3H7F A;  1C7O A;  1G7W A;  4ZDP A;  4E3R A;  2CST A;  2DKJ A;  1P3W A;  5DJ1 A;  4BHD A;  2HUF A;  2BYL A;  1ZOB A;  5DX5 A;  1WKG A;  3FTB A;  4PFN A;  4BQ0 A;  1GCK A;  3P6K A;  1Y4I A;  2FYF A;  1SVV A;  2YHK A;  3HVY A;  4A0G A;  2G6W A;  1GC0 A;  1V2E A;  2YCP A;  1ASB A;  4XK1 A;  3ZZJ A;  3R4T A;  1I48 A;  3PD6 A;  1AJS B;  2OKK A;  4JEZ A;  1QGN A;  1B9H A;  4K2I A;  4JF1 A;  1OHW A;  2YCT A;  2EZ2 A;  5M4B A;  1S07 A;  3DXW A;  1AY5 A;  4Q76 A;  4IY7 A;  2PB2 A;  5JAY A;  2ZY4 A;  1W7N A;  1MAQ A;  2CJD A;  1TAT A;  2JIS A;  2VGW A;  4CBR A;  1AMQ A;  1D7V A;  1E5F A;  4GSA A;  4IW7 A;  1AY8 A;  1GC3 A;  1QZ9 A;  1BQA A;  5EUD A;  4RM1 A;  1N31 A;  3UWC A;  2BI5 A;  3OP7 A;  1IBJ A;  2ZY3 A;  1OHY A;  4WYC A;  3N0L A;  2QB3 A;  2HZP A;  2Z9U A;  1E5E A;  1TOG A;  4CXR A;  5EUN A;  2ZJG A;  3CQ6 A;  3DYD A;  2BIE A;  3HLM A;  2JJE A;  3AEO A;  3FDB A;  2EH6 A;  1C9C A;  3GWP A;  4R2N A;  2VMT A;  3LWS A;  4ITX A;  1AHF A;  1MDZ A;  4A0F A;  1GEY A;  1O69 A;  2D61 A;  3AOV A;  4OMA A;  5EIG A;  3RBL A;  1YNU A;  3LV2 A;  4XJL A;  2WKA A;  4IYO A;  3EZ1 A;  3WLX A;  4MKJ A;  5EFS A;  3K7Y A;  3GZD A;  2JJF A;  4WXF A;  3NX3 A;  3I16 A;  1ZC9 A;  2W7J A;  4GRX A;  1GC2 A;  1YAA A;  2HUU A;  1KL1 A;  2XBN A;  1IAX A;  5DB5 A;  2VMN A;  4W8I A;  3WCO A;  4M2K A;  3CQ4 A;  1XI9 A;  3WCN A;  1S09 A;  2BIA A;  4WXG A;  4RJ0 A;  4MSO A;  1FG3 A;  1AAM A;  1B5P A;  2HOY A;  1MLY A;  4E77 A;  4F5I A;  2CY8 A;  1C7N A;  1V2F A;  3ECD A;  5M49 A;  1I29 A;  1ASM A;  3AEP A;  4FFC A;  2GB3 A;  2W7D A;  4JEX A;  4UHO A;  1G7X A;  4DQ6 A;  2GQN A;  1JF9 A;  2GSA A;  4EB7 A;  2JJG A;  3BC8 A;  5HDM A;  1Z7D A;  2D7Y A;  5J8Q A;  1WYU A;  2CIN A;  2YOB A;  1TOI A;  1V2D A;  4GE4 A;  4JE5 D;  3KGW A;  2FNU A;  3NYT A;  4OT8 A;  2OGA A;  4ZWM A;  1M0N A;  4TV7 A;  4ADC A;  2WK7 A;  3E2Y A;  4AZJ A;  1CQ6 A;  1ELU A;  3EZS A;  5BJ4 A;  2Z9V A;  2VMS A;  1QIR A;  1EQB A;  1GC4 A;  3TAT A;  2AY1 A;  1JG8 A;  2BWP A;  3QHX A;  2Q7W A;  8AAT A;  1LC7 A;  1ZOD A;  1ARI A;  3IHJ A;  4MY5 A;  1U08 A;  3AEM A;  1DTY A;  1ASE A;  2QLR A;  2Z9X A;  3B1D A;  2HP1 A;  1AKB A;  1W23 A;  2E7J A;  2W7M A;  3DR4 A;  3VOM A;  3MC6 A;  3HL2 A;  4EU1 A;  4AZK A;  4Q6R A;  2DR1 A;  2OQX A;  3EI7 A;  4RKC A;  3K40 A;  3USF A;  3I5T A;  1H1C A;  4A6R A;  4BMK A;  3G7Q A;  4ITG A;  2CB1 A;  3GET A;  1O62 A;  3I4J A;  5DJ9 A;  4KXK A;  2YRI A;  1ELQ A;  4P7Y A;  3B8X A;  2AEU A;  2VIB A;  1ASN A;  2W8U A;  3FZ7 A;  4W91 A;  1X28 A;  3B46 A;  4TMR A;  4DGT A;  1UU0 A;  3T32 A;  5D95 A;  2DGK A;  4A0H A;  1AIC A;  2OAT A;  4WXB A;  5G2Q A;  1MAP A;  4BA5 A;  1EJI A;  1M0Q A;  3BB8 A;  3NYU A;  3A8U X;  3EIB A;  3PDB A;  3DR7 A;  4RIT A;  1WYV A;  2E7I A;  2HUI A;  2ZY5 A;  2EGY A;  1TOE A;  2CFB A;  2R5E A;  2Z67 A;  3E77 A;  3AOW A;  2VMO A;  5EUE A;  2CH1 A;  2ORD A;  1D7S A;  2VGV A;  2VMW A;  3GJU A;  3PDX A;  3FZ6 A;  3QBO A;  4K2B A;  5LH9 A;  1TOJ A;  2D66 A;  3JW9 A;  4F5L A;  1YIZ A;  4MKK A;  4WP0 A;  1LC5 A;  2AY2 A;  5M46 A;  4U1T A;  3JZL A;  3FCR A;  3EIA A;  4AOA A;  1QIS A;  1AMA A;  2W7H A;  3NNK A;  2D65 A;  3HBX A;  2HOZ A;  4PVF A;  2AY4 A;  1B8G A;  3AV7 A;  4PFF A;  4GEB A;  1J04 A;  4MQP A;  1CQ7 A;  2DGM A;  2W8V A;  4GE9 A;  4RLG A;  2AEV A;  3P1T A;  4W5K A;  5FT5 A;  4A00 A;  1FC4 A;  3CBF A;  4EMY A;  2O7C A;  3ACZ A;  4LC3 A;  4W1X A;  4WBT A;  4ADE A;  3KKI A;  3DZZ A;  4AO4 A;  2PB0 A;  4WYE A;  1BKG A;  4LW4 A;  2TPL A;  2AY8 A;  3G8M A;  2VGU A;  5FT4 A;  2ZP7 A;  4A6T A;  1X2A A;  3AEJ C;  5HHY A;  3RBF A;  3NDN A;  3HT4 A;  4IXO A;  3TCM A;  4CXQ A;  5F8V A;  1VP4 A;  4P3M A;  3EI6 A;  4WB0 B;  3EI9 A;  1BS0 A;  2JGT A;  5M4D A;  3AEN A;  3VK2 A;  3QPG A;  5HXX A;  2OGE A;  4OTL A;  2E54 A;  3LVL B;  1BJ4 A;  4JEW A;  5IWQ A;  3RI6 A;  4GE7 A;  4F4E A;  3NRA A;  3MAD A;  4KAM A;  2AY7 A;  1ARH A;  2GMS A;  4ZAH A;  3ASA A;  1AY4 A;  1ARG A;  1PMO A;  4ISY A;  3PIU A;  4OCA A;  1MDX A;  5G4I A;  1DJU A;  1FG7 A;  1YIY A;  3ATH A;  1W3U A;  3GZD C;  1ASG A;  2HOR A;  2VGT A;  3MEB A;  3W1H A;  1ECX A;  1KL2 A;  4Y0D A;  4AO9 A;  1OXO A;  4OBU A;  1GBN A;  2Z1Y A;  4U2H A;  1VJO A;  1WYV B;  4ZM4 A;  1LW4 A;  2CJH A;  3HDO A;  3BCA A;  4M2J A;  2AY9 A;  1AAW A;  3RCH B;  1N8P A;  3MAU A;  3PPL A;  1C4K A;  4I8A A;  3BV0 A;  3GR9 A;  4RKD A;  1M7Y A;  4A6U A;  4ZM3 A;  2R5C B;  2YKX A;  1ORD A;  2Z9W A;  3A9Y A;  2WK9 A;  3DU4 A;  4ZSY A;  3EI5 A;  4ZDL A;  1G4X A;  3FQ8 A;  2EZ1 A;  1S0A A;  1UU2 A;  1SZK A;  2BIG A;  2X3L A;  4MQR A;  4UHN A;  1W7M A;  3FDD A;  3EUC A;  1RV4 A;  2BWO A;  2VI9 A;  5G09 A;  3MAF A;  2CAN A;  3F6T A;  4XEW A;  3WY7 A;  4OBV A;  3GBX A;  1DGE A;  4M2M A;  4R5Z A;  1WYT B;  2CTZ A;  1AHX A;  1QIT A;  1IX6 A;  1KKJ A;  3TQX A;  1ART A;  3FVX A;  4E1O A;  2AY6 A;  1LS3 A;  2QBT A;  2BHX A;  2VLH A;  3KE3 A;  2D63 A;  2BI3 A;  2Z1Z A;  4RJY A;  1GEW A;  2W7L A;  3ISL A;  4B9B A;  1T3I A;  2PO3 A;  1N2T A;  3W1J A;  3L44 A;  3AEM C;  3ZRP A;  2EPJ A;  2W8T A;  2FM1 A;  3DOD A;  3N5M A;  1M0P A;  3F0H A;  3Q8N A;  3VP6 A;  3TFU A;  2CJG A;  3MC6 C;  5F9S A;  3ELE A;  2O0R A;  2VGZ A;  2D5Y A;  4WYG A;  2FQ6 A;  3MKJ A;  3DXV A;  3M5U A;  2JJH A;  2X5D A;  1BT4 A;  1WKH A;  4IX8 A;  3QGU A;  4Y0I A;  1M4N A;  4L0O A;  3PAA A;  3WGC A;  3WX9 A;  3FD0 A;  1GD9 A;  3PD6 B;  4EFF A;  3ELP A;  2VIA A;  2WK8 A;  3FQ7 A;  3NTJ A;  2C7T A;  2R5C A;  3RUY A;  4AH3 A;  3FVU A;  3JWA A;  3WZF A;  2C0R A;  2W7E A;  4BA4 A;  2X5F A;  1B5O A;  5D5S A;  1B9I A;  4OC9 A;  1VEF A;  1AJR A;  3K28 A;  2CH2 A;  1YOO A;  2ZSM A;  1UU1 A;  4W1W A;  1W7L A;  2VMU A;  1LW5 A;  3JTX A;  3A2B A;  3VK3 A;  4LNM A;  2VMR A;  4LNJ A;  3GSB A;  3N75 A;  4WYF A;  2DOU A;  1AMS A;  1JS3 A;  1CJ0 A;  1O4S A;  3B1C A;  3BCB A;  4WB0 A;  3ZRQ A;  1WYT A;  2X8U A;  1QJ5 A;  1BJO B;  2HP2 A;  3A9X A;  3A9Z A;  2E7U A;  3WKS A;  4XQ2 A;  4WD2 A;  1DGD A;  3DC1 A;  4HF8 A;  1RVY A;  1GDE A;  2ZYJ A;  1BJN A;  4ZAS A;  4K2M A;  4MQQ A;  1CL1 A;  3F9T A;  2Z20 A;  1S06 A;  3AEN B;  3L8A A;  1RVU A;  2BWN A;  4JEV A;  5EAA A;  2VI8 A;  4IYO B;  4LW2 A;  1M0O A;  1UKJ A;  2V1P A;  4W1V A;  4F5G A;  4N0W A;  4XAU A;  4MGR A;  2C44 A;  1AIB A;  2R0T A;  3PGY A;  1SPA A;  5K8B A;  1BW0 A;  1J32 A;  3PJ0 A;  4F5H A;  1TAS A;  3PA9 A;  4Q31 A;  2R2N A;  3KGX A;  3AEL A;  2D7Z A;  4ADD A;  1MGV A;  3LG0 A;  2QMA A;  4CBS A;  3VK4 A;  4H51 A;  4GDY A;  3BWN A;  5EIG B;  4J8L A;  4FL0 A;  1SZS A;  3MAF B;  3FFH A;  1IJI A;  2O1B A;  4ATQ A;  1IVR A;  1YJZ A;  1D7U A;  1QJ3 A;  1S08 A;  1IAY A;  3BN1 A;  1M6S A;  4JE5 A;  4UOY A;  4ZSW A;  3JU7 A;  2ZUK A;  2V0Y A;  3AEJ A;  3HQT A;  3GZC A;  5G0A A;  2VMY A;  1AMR A;  1AHY A;  4F5J A;  1PMM A;  3HMU A;  3LVK A;  1AIA A;  2YRR A;  3IF2 A;  2VYC A;  1ASD A;  1WYU B;  2W8J A;  3LY1 A;  1PG8 A;  4JEY A;  4KYO A;  3LVJ A;  1H0C A;  3QM2 A;  3E9K A;  4NOG A;  2YKU A;  2NMP A;  1BJO A;  5E4Z A;  1BQD A;  1AJS A;  3E2Z A;  3MBB A;  2VMX A;  3AAT A;  2QB2 A;  3FFR A;  5EAV A;  4LNL A;  2AY3 A;  2ZC0 A;  1YJY A;  3ZRR A;  1D2F A;  3BS8 A;  3E2F A;  4WLJ A;  1G4V A;  3QN6 A;  4ZDO A;  1ASL A;  1CZC A;  3ZZK A;  1WST A;  3JWB A;  1DFO A;  4UHM A;  2EO5 A;  2VMP A;  1KMK A;  5G2P A;  2ZY2 A;  2GMU A;  4ATP A;  4F5M A;  5LHA A;  1DJE A;  4Q75 A;  2VLF A;  4E3Q A;  2XH1 A;  3FSL A; 
#chains in the Genus database with same CATH topology
 1I43 A;  3H14 A;  3OKS A;  1V72 A;  2VGS A;  4XJP A;  4PIW A;  2W7K A;  5FT6 A;  2BI2 A;  4WLH A;  5I92 A;  1CS1 A;  1B4X A;  1KKP A;  3PDB B;  1SFF A;  9AAT A;  2VMQ A;  3BWO A;  3LVM A;  1IX7 A;  5E3K A;  1I41 A;  2YKY A;  4RIZ A;  1YJS A;  2AY5 A;  4O6Z A;  3FRK A;  4WYA A;  2HOX A;  2FN6 A;  4A0R A;  4HVK A;  1PFF A;  3UE8 A;  1LKC A;  1JS6 A;  5TF5 A;  4ZWV A;  5BJ3 A;  2FKI A;  1C0N A;  1LC8 A;  4WYD A;  4Y0H A;  5AX8 A;  5E5I A;  5G4J A;  2W7I A;  1XEY A;  2C81 A;  2YKV A;  3UAK A;  4B98 A;  4QGR A;  1AKC A;  1OAT A;  3BWN C;  3E2Z B;  2W7G A;  3NU8 A;  3WKR A;  4R5F A;  3COG A;  2KFP A;  2Z61 A;  4J5U A;  2BI1 A;  2DGL A;  2RFV A;  2DKB A;  1X29 A;  3NYS A;  2W7F A;  4IXZ A;  4ZLV A;  4DBC A;  2FNI A;  4TN4 A;  1LK9 A;  3R9A A;  4ADB A;  4R8D A;  1MDO A;  1GEX A;  3FZ8 A;  3FQA A;  3RQ1 A;  1Z3Z A;  2QA3 A;  2BI9 A;  3BCX A;  1ASC A;  2JG2 A;  2YCN A;  3D6K A;  3RCH A;  3QI6 A;  3WGB A;  2ZSL A;  1IUG A;  4CVQ A;  1D7R A;  2OKJ A;  4N0B A;  4F5F A;  3G0T A;  1AX4 A;  4XJM A;  4OYT A;  1MLZ A;  3N4X A;  3FVS A;  2BKW A;  4IXS A;  5C6U A;  3E6G A;  1O61 A;  3W1I A;  1TOK A;  3ASB A;  3FKD A;  3CAI A;  1ASA A;  2D64 A;  3TFT A;  3NU7 A;  3NUB A;  4UQV A;  7AAT A;  4A72 A;  4XJO A;  2AAT A;  2BYJ A;  1ARS A;  3NUI A;  1DKA A;  1ASF A;  1OHV A;  2VMZ A;  3DRD A;  4EB5 A;  1AHG A;  1CQ8 A;  1AHE A;  1C7G A;  4F5K A;  1DJ9 A;  1TAR A;  3II0 A;  1SF2 A;  2F8J A;  3VAX A;  1KMJ A;  1TPL A;  4RAE A;  1CZE A;  3EI8 A;  4JF0 A;  1X0M A;  1EG5 A;  1IX8 A;  3B1E A;  1M32 A;  2VMV A;  5EQC A;  1SZU A;  2W8W A;  3CQ5 A;  1AKA A;  1BJW A;  5FT8 A;  3N7N A;  1RV3 A;  1OXP A;  1CL2 A;  3H7F A;  1C7O A;  1G7W A;  4ZDP A;  4E3R A;  2CST A;  2DKJ A;  1P3W A;  5DJ1 A;  4BHD A;  2HUF A;  2BYL A;  1ZOB A;  5DX5 A;  1WKG A;  3FTB A;  2EYQ A;  4PFN A;  4BQ0 A;  1GCK A;  3P6K A;  1Y4I A;  2FYF A;  1SVV A;  2YHK A;  3HVY A;  4A0G A;  2G6W A;  1GC0 A;  1V2E A;  2YCP A;  1ASB A;  4XK1 A;  3ZZJ A;  3R4T A;  1I48 A;  3PD6 A;  1AJS B;  2OKK A;  4JEZ A;  1QGN A;  1B9H A;  4K2I A;  4JF1 A;  1OHW A;  2YCT A;  2EZ2 A;  5M4B A;  1S07 A;  3DXW A;  1AY5 A;  4Q76 A;  4IY7 A;  2PB2 A;  5JAY A;  2ZY4 A;  1W7N A;  1MAQ A;  2CJD A;  1TAT A;  2JIS A;  2VGW A;  4CBR A;  1AMQ A;  1D7V A;  1E5F A;  4GSA A;  4IW7 A;  1AY8 A;  1GC3 A;  1QZ9 A;  1BQA A;  5EUD A;  4RM1 A;  1N31 A;  3UWC A;  2BI5 A;  3OP7 A;  1IBJ A;  2ZY3 A;  1OHY A;  4WYC A;  3N0L A;  2QB3 A;  2HZP A;  2Z9U A;  1E5E A;  1TOG A;  4CXR A;  5EUN A;  2ZJG A;  3CQ6 A;  3DYD A;  2BIE A;  3HLM A;  2JJE A;  3AEO A;  3FDB A;  2EH6 A;  1C9C A;  3GWP A;  4R2N A;  2VMT A;  3LWS A;  4ITX A;  1AHF A;  1MDZ A;  4A0F A;  1GEY A;  1O69 A;  2D61 A;  3AOV A;  4OMA A;  5EIG A;  3RBL A;  1YNU A;  3LV2 A;  4XJL A;  2WKA A;  4IYO A;  3EZ1 A;  3WLX A;  4MKJ A;  5EFS A;  3K7Y A;  3GZD A;  2JJF A;  4WXF A;  3NX3 A;  3I16 A;  1ZC9 A;  2W7J A;  4GRX A;  1GC2 A;  1YAA A;  2HUU A;  1KL1 A;  2XBN A;  1IAX A;  5DB5 A;  2VMN A;  4W8I A;  3WCO A;  4M2K A;  3CQ4 A;  1XI9 A;  3WCN A;  1S09 A;  2BIA A;  4WXG A;  4RJ0 A;  4MSO A;  1FG3 A;  1AAM A;  1B5P A;  2HOY A;  1MLY A;  4E77 A;  4F5I A;  2CY8 A;  1C7N A;  1V2F A;  3ECD A;  5M49 A;  1I29 A;  1ASM A;  3AEP A;  4FFC A;  2GB3 A;  2W7D A;  4JEX A;  4UHO A;  1G7X A;  4DQ6 A;  2GQN A;  1JF9 A;  2GSA A;  4EB7 A;  2JJG A;  3BC8 A;  5HDM A;  1Z7D A;  2D7Y A;  5J8Q A;  1WYU A;  2CIN A;  2YOB A;  1TOI A;  1V2D A;  4GE4 A;  4JE5 D;  3KGW A;  2FNU A;  3NYT A;  4OT8 A;  2OGA A;  4ZWM A;  1M0N A;  4TV7 A;  4ADC A;  2WK7 A;  3E2Y A;  4AZJ A;  1CQ6 A;  1ELU A;  3EZS A;  5BJ4 A;  2A1V A;  2Z9V A;  2VMS A;  1QIR A;  1EQB A;  1GC4 A;  3TAT A;  2AY1 A;  1JG8 A;  2BWP A;  3QHX A;  2Q7W A;  8AAT A;  1LC7 A;  1ZOD A;  1ARI A;  3IHJ A;  4MY5 A;  1U08 A;  3AEM A;  1DTY A;  1ASE A;  2QLR A;  2Z9X A;  3B1D A;  2HP1 A;  1AKB A;  1W23 A;  2E7J A;  2W7M A;  3DR4 A;  3VOM A;  3MC6 A;  3HL2 A;  4EU1 A;  4AZK A;  4Q6R A;  2DR1 A;  2OQX A;  3EI7 A;  4RKC A;  3K40 A;  3USF A;  3I5T A;  1H1C A;  4A6R A;  4K05 A;  4BMK A;  3G7Q A;  4ITG A;  2CB1 A;  3GET A;  1O62 A;  3I4J A;  5DJ9 A;  3N4R A;  4KXK A;  2YRI A;  1ELQ A;  4P7Y A;  3B8X A;  2AEU A;  2VIB A;  1ASN A;  2W8U A;  3FZ7 A;  4W91 A;  1X28 A;  3B46 A;  4TMR A;  4DGT A;  1UU0 A;  3T32 A;  5D95 A;  2DGK A;  4A0H A;  1AIC A;  2OAT A;  4WXB A;  5G2Q A;  1MAP A;  4BA5 A;  1EJI A;  1M0Q A;  3BB8 A;  3NYU A;  3A8U X;  3EIB A;  3H9X A;  3PDB A;  3DR7 A;  4RIT A;  1WYV A;  2E7I A;  2HUI A;  2ZY5 A;  2EGY A;  1TOE A;  2CFB A;  2R5E A;  2Z67 A;  3E77 A;  3AOW A;  2VMO A;  5EUE A;  2CH1 A;  2ORD A;  1D7S A;  2VGV A;  2VMW A;  3GJU A;  3PDX A;  3FZ6 A;  3QBO A;  4K2B A;  5LH9 A;  1TOJ A;  2D66 A;  3JW9 A;  4F5L A;  1YIZ A;  4MKK A;  4WP0 A;  1LC5 A;  2AY2 A;  5M46 A;  4U1T A;  3JZL A;  3FCR A;  3EIA A;  4AOA A;  1QIS A;  1AMA A;  2W7H A;  3NNK A;  2D65 A;  3HBX A;  2HOZ A;  4PVF A;  2AY4 A;  1B8G A;  3AV7 A;  4PFF A;  4GEB A;  1J04 A;  4MQP A;  1CQ7 A;  2DGM A;  2W8V A;  4GE9 A;  4RLG A;  2AEV A;  3P1T A;  4W5K A;  5FT5 A;  4A00 A;  1FC4 A;  3CBF A;  4EMY A;  2O7C A;  3ACZ A;  4LC3 A;  4W1X A;  4WBT A;  4ADE A;  3KKI A;  3DZZ A;  4AO4 A;  2PB0 A;  4WYE A;  1BKG A;  4LW4 A;  2TPL A;  2AY8 A;  3G8M A;  2VGU A;  5FT4 A;  2ZP7 A;  4A6T A;  1X2A A;  3AEJ C;  5HHY A;  3RBF A;  3NDN A;  3HT4 A;  4IXO A;  3TCM A;  4CXQ A;  5F8V A;  2QSR A;  1VP4 A;  4P3M A;  3EI6 A;  4WB0 B;  3EI9 A;  1BS0 A;  2JGT A;  5M4D A;  3AEN A;  3VK2 A;  3QPG A;  5HXX A;  2OGE A;  4OTL A;  2E54 A;  3LVL B;  1BJ4 A;  4JEW A;  5IWQ A;  3RI6 A;  4GE7 A;  4F4E A;  3NRA A;  3MAD A;  4KAM A;  2AY7 A;  1ARH A;  2GMS A;  4ZAH A;  3ASA A;  1AY4 A;  1ARG A;  1PMO A;  4ISY A;  3PIU A;  4OCA A;  1MDX A;  5G4I A;  1DJU A;  1FG7 A;  1YIY A;  3ATH A;  1W3U A;  3GZD C;  1ASG A;  2HOR A;  2VGT A;  3MEB A;  3W1H A;  1ECX A;  1KL2 A;  4Y0D A;  4AO9 A;  1OXO A;  4OBU A;  1GBN A;  2Z1Y A;  4U2H A;  1VJO A;  1WYV B;  4ZM4 A;  1LW4 A;  2CJH A;  3HDO A;  3BCA A;  4M2J A;  2AY9 A;  1AAW A;  3RCH B;  1N8P A;  3MAU A;  3PPL A;  1C4K A;  4I8A A;  3BV0 A;  3GR9 A;  4RKD A;  1M7Y A;  4A6U A;  4ZM3 A;  2R5C B;  2YKX A;  1ORD A;  2Z9W A;  3A9Y A;  2WK9 A;  3DU4 A;  4ZSY A;  3EI5 A;  4ZDL A;  1G4X A;  3FQ8 A;  2EZ1 A;  1S0A A;  1UU2 A;  1SZK A;  2BIG A;  2X3L A;  4MQR A;  4UHN A;  1W7M A;  3FDD A;  3EUC A;  1RV4 A;  2BWO A;  2VI9 A;  5G09 A;  3MAF A;  2CAN A;  3F6T A;  4XEW A;  3WY7 A;  4OBV A;  3GBX A;  1DGE A;  4M2M A;  4R5Z A;  1WYT B;  2CTZ A;  1AHX A;  1QIT A;  1IX6 A;  1KKJ A;  3TQX A;  1ART A;  3FVX A;  4E1O A;  2AY6 A;  1LS3 A;  2QBT A;  2BHX A;  2VLH A;  3KE3 A;  2D63 A;  2BI3 A;  2Z1Z A;  4RJY A;  1GEW A;  2W7L A;  3ISL A;  4B9B A;  1T3I A;  2PO3 A;  1N2T A;  3W1J A;  3L44 A;  3AEM C;  3ZRP A;  2EPJ A;  2W8T A;  1KAF A;  2FM1 A;  3DOD A;  3N5M A;  1M0P A;  3F0H A;  3Q8N A;  3VP6 A;  3TFU A;  2CJG A;  3MC6 C;  5F9S A;  3ELE A;  2O0R A;  2VGZ A;  2D5Y A;  4WYG A;  2FQ6 A;  3MKJ A;  3DXV A;  3M5U A;  2JJH A;  2X5D A;  1BT4 A;  1WKH A;  4IX8 A;  3QGU A;  4Y0I A;  1M4N A;  4L0O A;  3PAA A;  3WGC A;  3WX9 A;  3FD0 A;  1GD9 A;  3PD6 B;  4EFF A;  3ELP A;  2VIA A;  2WK8 A;  3FQ7 A;  3NTJ A;  2C7T A;  2R5C A;  3RUY A;  4AH3 A;  3FVU A;  3JWA A;  3WZF A;  2C0R A;  2W7E A;  4BA4 A;  2X5F A;  1B5O A;  5D5S A;  1B9I A;  4OC9 A;  1VEF A;  1AJR A;  3K28 A;  2CH2 A;  1YOO A;  2ZSM A;  1UU1 A;  4W1W A;  1W7L A;  2VMU A;  1LW5 A;  3JTX A;  3A2B A;  3VK3 A;  4LNM A;  2VMR A;  4H63 Q;  4LNJ A;  3GSB A;  3N75 A;  4WYF A;  2DOU A;  1AMS A;  1JS3 A;  1CJ0 A;  1O4S A;  3B1C A;  3BCB A;  4WB0 A;  3ZRQ A;  1WYT A;  2X8U A;  1QJ5 A;  1BJO B;  5KTB A;  2HP2 A;  3A9X A;  3A9Z A;  2E7U A;  3WKS A;  4XQ2 A;  4WD2 A;  1DGD A;  3DC1 A;  4HF8 A;  1RVY A;  1GDE A;  2ZYJ A;  1BJN A;  4ZAS A;  4K2M A;  4MQQ A;  1CL1 A;  3F9T A;  2Z20 A;  1S06 A;  3AEN B;  3L8A A;  1RVU A;  2BWN A;  4JEV A;  5EAA A;  2VI8 A;  4IYO B;  4LW2 A;  1M0O A;  1UKJ A;  2V1P A;  4W1V A;  4F5G A;  4N0W A;  4XAU A;  4MGR A;  2WB6 A;  2C44 A;  1AIB A;  2R0T A;  3PGY A;  1SPA A;  5K8B A;  1BW0 A;  1J32 A;  3PJ0 A;  4F5H A;  1TAS A;  3PA9 A;  4Q31 A;  2R2N A;  3KGX A;  3AEL A;  2D7Z A;  4ADD A;  1MGV A;  3LG0 A;  2QMA A;  4CBS A;  3VK4 A;  4H51 A;  4GDY A;  3BWN A;  5EIG B;  4J8L A;  4FL0 A;  1SZS A;  3MAF B;  3FFH A;  1IJI A;  2O1B A;  4ATQ A;  1IVR A;  1YJZ A;  1D7U A;  1QJ3 A;  1S08 A;  1IAY A;  3BN1 A;  1M6S A;  4JE5 A;  4UOY A;  4ZSW A;  3JU7 A;  2ZUK A;  2V0Y A;  3AEJ A;  3HQT A;  3GZC A;  5G0A A;  2VMY A;  1AMR A;  1AHY A;  4F5J A;  1PMM A;  3HMU A;  3LVK A;  1AIA A;  2YRR A;  3IF2 A;  2VYC A;  1ASD A;  1WYU B;  2W8J A;  3LY1 A;  1PG8 A;  4JEY A;  4KYO A;  3LVJ A;  1H0C A;  3QM2 A;  3E9K A;  4NOG A;  2YKU A;  2NMP A;  1BJO A;  5E4Z A;  1BQD A;  1AJS A;  3E2Z A;  3MBB A;  2VMX A;  3AAT A;  2QB2 A;  3FFR A;  5EAV A;  4LNL A;  2AY3 A;  2ZC0 A;  1YJY A;  3ZRR A;  1D2F A;  3BS8 A;  3E2F A;  4WLJ A;  1G4V A;  3QN6 A;  4ZDO A;  2G7J A;  1ASL A;  1CZC A;  3ZZK A;  3N4S A;  1WST A;  3JWB A;  1DFO A;  4UHM A;  2EO5 A;  2VMP A;  1KMK A;  5G2P A;  2ZY2 A;  2GMU A;  4ATP A;  4F5M A;  5LHA A;  1DJE A;  4Q75 A;  2VLF A;  4E3Q A;  2XH1 A;  3FSL A; 
#chains in the Genus database with same CATH homology
 1I43 A;  3H14 A;  3OKS A;  1V72 A;  2VGS A;  4XJP A;  4PIW A;  2W7K A;  5FT6 A;  2BI2 A;  4WLH A;  5I92 A;  1CS1 A;  1B4X A;  1KKP A;  3PDB B;  1SFF A;  9AAT A;  2VMQ A;  3BWO A;  3LVM A;  1IX7 A;  5E3K A;  1I41 A;  2YKY A;  4RIZ A;  1YJS A;  2AY5 A;  4O6Z A;  3FRK A;  4WYA A;  2HOX A;  2FN6 A;  4A0R A;  4HVK A;  1PFF A;  3UE8 A;  1LKC A;  1JS6 A;  5TF5 A;  4ZWV A;  5BJ3 A;  2FKI A;  1C0N A;  1LC8 A;  4WYD A;  4Y0H A;  5AX8 A;  5E5I A;  5G4J A;  2W7I A;  1XEY A;  2C81 A;  2YKV A;  3UAK A;  4B98 A;  4QGR A;  1AKC A;  1OAT A;  3BWN C;  3E2Z B;  2W7G A;  3NU8 A;  3WKR A;  4R5F A;  3COG A;  2KFP A;  2Z61 A;  4J5U A;  2BI1 A;  2DGL A;  2RFV A;  2DKB A;  1X29 A;  3NYS A;  2W7F A;  4IXZ A;  4ZLV A;  4DBC A;  2FNI A;  4TN4 A;  1LK9 A;  3R9A A;  4ADB A;  4R8D A;  1MDO A;  1GEX A;  3FZ8 A;  3FQA A;  3RQ1 A;  1Z3Z A;  2QA3 A;  2BI9 A;  3BCX A;  1ASC A;  2JG2 A;  2YCN A;  3D6K A;  3RCH A;  3QI6 A;  3WGB A;  2ZSL A;  1IUG A;  4CVQ A;  1D7R A;  2OKJ A;  4N0B A;  4F5F A;  3G0T A;  1AX4 A;  4XJM A;  4OYT A;  1MLZ A;  3N4X A;  3FVS A;  2BKW A;  4IXS A;  5C6U A;  3E6G A;  1O61 A;  3W1I A;  1TOK A;  3ASB A;  3FKD A;  3CAI A;  1ASA A;  2D64 A;  3TFT A;  3NU7 A;  3NUB A;  4UQV A;  7AAT A;  4A72 A;  4XJO A;  2AAT A;  2BYJ A;  1ARS A;  3NUI A;  1DKA A;  1ASF A;  1OHV A;  2VMZ A;  3DRD A;  4EB5 A;  1AHG A;  1CQ8 A;  1AHE A;  1C7G A;  4F5K A;  1DJ9 A;  1TAR A;  3II0 A;  1SF2 A;  2F8J A;  3VAX A;  1KMJ A;  1TPL A;  4RAE A;  1CZE A;  3EI8 A;  4JF0 A;  1X0M A;  1EG5 A;  1IX8 A;  3B1E A;  1M32 A;  2VMV A;  5EQC A;  1SZU A;  2W8W A;  3CQ5 A;  1AKA A;  1BJW A;  5FT8 A;  3N7N A;  1RV3 A;  1OXP A;  1CL2 A;  3H7F A;  1C7O A;  1G7W A;  4ZDP A;  4E3R A;  2CST A;  2DKJ A;  1P3W A;  5DJ1 A;  4BHD A;  2HUF A;  2BYL A;  1ZOB A;  5DX5 A;  1WKG A;  3FTB A;  2EYQ A;  4PFN A;  4BQ0 A;  1GCK A;  3P6K A;  1Y4I A;  2FYF A;  1SVV A;  2YHK A;  3HVY A;  4A0G A;  2G6W A;  1GC0 A;  1V2E A;  2YCP A;  1ASB A;  4XK1 A;  3ZZJ A;  3R4T A;  1I48 A;  3PD6 A;  1AJS B;  2OKK A;  4JEZ A;  1QGN A;  1B9H A;  4K2I A;  4JF1 A;  1OHW A;  2YCT A;  2EZ2 A;  5M4B A;  1S07 A;  3DXW A;  1AY5 A;  4Q76 A;  4IY7 A;  2PB2 A;  5JAY A;  2ZY4 A;  1W7N A;  1MAQ A;  2CJD A;  1TAT A;  2JIS A;  2VGW A;  4CBR A;  1AMQ A;  1D7V A;  1E5F A;  4GSA A;  4IW7 A;  1AY8 A;  1GC3 A;  1QZ9 A;  1BQA A;  5EUD A;  4RM1 A;  1N31 A;  3UWC A;  2BI5 A;  3OP7 A;  1IBJ A;  2ZY3 A;  1OHY A;  4WYC A;  3N0L A;  2QB3 A;  2HZP A;  2Z9U A;  1E5E A;  1TOG A;  4CXR A;  5EUN A;  2ZJG A;  3CQ6 A;  3DYD A;  2BIE A;  3HLM A;  2JJE A;  3AEO A;  3FDB A;  2EH6 A;  1C9C A;  3GWP A;  4R2N A;  2VMT A;  3LWS A;  4ITX A;  1AHF A;  1MDZ A;  4A0F A;  1GEY A;  1O69 A;  2D61 A;  3AOV A;  4OMA A;  5EIG A;  3RBL A;  1YNU A;  3LV2 A;  4XJL A;  2WKA A;  4IYO A;  3EZ1 A;  3WLX A;  4MKJ A;  5EFS A;  3K7Y A;  3GZD A;  2JJF A;  4WXF A;  3NX3 A;  3I16 A;  1ZC9 A;  2W7J A;  4GRX A;  1GC2 A;  1YAA A;  2HUU A;  1KL1 A;  2XBN A;  1IAX A;  5DB5 A;  2VMN A;  4W8I A;  3WCO A;  4M2K A;  3CQ4 A;  1XI9 A;  3WCN A;  1S09 A;  2BIA A;  4WXG A;  4RJ0 A;  4MSO A;  1FG3 A;  1AAM A;  1B5P A;  2HOY A;  1MLY A;  4E77 A;  4F5I A;  2CY8 A;  1C7N A;  1V2F A;  3ECD A;  5M49 A;  1I29 A;  1ASM A;  3AEP A;  4FFC A;  2GB3 A;  2W7D A;  4JEX A;  4UHO A;  1G7X A;  4DQ6 A;  2GQN A;  1JF9 A;  2GSA A;  4EB7 A;  2JJG A;  3BC8 A;  5HDM A;  1Z7D A;  2D7Y A;  5J8Q A;  1WYU A;  2CIN A;  2YOB A;  1TOI A;  1V2D A;  4GE4 A;  4JE5 D;  3KGW A;  2FNU A;  3NYT A;  4OT8 A;  2OGA A;  4ZWM A;  1M0N A;  4TV7 A;  4ADC A;  2WK7 A;  3E2Y A;  4AZJ A;  1CQ6 A;  1ELU A;  3EZS A;  5BJ4 A;  2A1V A;  2Z9V A;  2VMS A;  1QIR A;  1EQB A;  1GC4 A;  3TAT A;  2AY1 A;  1JG8 A;  2BWP A;  3QHX A;  2Q7W A;  8AAT A;  1LC7 A;  1ZOD A;  1ARI A;  3IHJ A;  4MY5 A;  1U08 A;  3AEM A;  1DTY A;  1ASE A;  2QLR A;  2Z9X A;  3B1D A;  2HP1 A;  1AKB A;  1W23 A;  2E7J A;  2W7M A;  3DR4 A;  3VOM A;  3MC6 A;  3HL2 A;  4EU1 A;  4AZK A;  4Q6R A;  2DR1 A;  2OQX A;  3EI7 A;  4RKC A;  3K40 A;  3USF A;  3I5T A;  1H1C A;  4A6R A;  4K05 A;  4BMK A;  3G7Q A;  4ITG A;  2CB1 A;  3GET A;  1O62 A;  3I4J A;  5DJ9 A;  3N4R A;  4KXK A;  2YRI A;  1ELQ A;  4P7Y A;  3B8X A;  2AEU A;  2VIB A;  1ASN A;  2W8U A;  3FZ7 A;  4W91 A;  1X28 A;  3B46 A;  4TMR A;  4DGT A;  1UU0 A;  3T32 A;  5D95 A;  2DGK A;  4A0H A;  1AIC A;  2OAT A;  4WXB A;  5G2Q A;  1MAP A;  4BA5 A;  1EJI A;  1M0Q A;  3BB8 A;  3NYU A;  3A8U X;  3EIB A;  3H9X A;  3PDB A;  3DR7 A;  4RIT A;  1WYV A;  2E7I A;  2HUI A;  2ZY5 A;  2EGY A;  1TOE A;  2CFB A;  2R5E A;  2Z67 A;  3E77 A;  3AOW A;  2VMO A;  5EUE A;  2CH1 A;  2ORD A;  1D7S A;  2VGV A;  2VMW A;  3GJU A;  3PDX A;  3FZ6 A;  3QBO A;  4K2B A;  5LH9 A;  1TOJ A;  2D66 A;  3JW9 A;  4F5L A;  1YIZ A;  4MKK A;  4WP0 A;  1LC5 A;  2AY2 A;  5M46 A;  4U1T A;  3JZL A;  3FCR A;  3EIA A;  4AOA A;  1QIS A;  1AMA A;  2W7H A;  3NNK A;  2D65 A;  3HBX A;  2HOZ A;  4PVF A;  2AY4 A;  1B8G A;  3AV7 A;  4PFF A;  4GEB A;  1J04 A;  4MQP A;  1CQ7 A;  2DGM A;  2W8V A;  4GE9 A;  4RLG A;  2AEV A;  3P1T A;  4W5K A;  5FT5 A;  4A00 A;  1FC4 A;  3CBF A;  4EMY A;  2O7C A;  3ACZ A;  4LC3 A;  4W1X A;  4WBT A;  4ADE A;  3KKI A;  3DZZ A;  4AO4 A;  2PB0 A;  4WYE A;  1BKG A;  4LW4 A;  2TPL A;  2AY8 A;  3G8M A;  2VGU A;  5FT4 A;  2ZP7 A;  4A6T A;  1X2A A;  3AEJ C;  5HHY A;  3RBF A;  3NDN A;  3HT4 A;  4IXO A;  3TCM A;  4CXQ A;  5F8V A;  2QSR A;  1VP4 A;  4P3M A;  3EI6 A;  4WB0 B;  3EI9 A;  1BS0 A;  2JGT A;  5M4D A;  3AEN A;  3VK2 A;  3QPG A;  5HXX A;  2OGE A;  4OTL A;  2E54 A;  3LVL B;  1BJ4 A;  4JEW A;  5IWQ A;  3RI6 A;  4GE7 A;  4F4E A;  3NRA A;  3MAD A;  4KAM A;  2AY7 A;  1ARH A;  2GMS A;  4ZAH A;  3ASA A;  1AY4 A;  1ARG A;  1PMO A;  4ISY A;  3PIU A;  4OCA A;  1MDX A;  5G4I A;  1DJU A;  1FG7 A;  1YIY A;  3ATH A;  1W3U A;  3GZD C;  1ASG A;  2HOR A;  2VGT A;  3MEB A;  3W1H A;  1ECX A;  1KL2 A;  4Y0D A;  4AO9 A;  1OXO A;  4OBU A;  1GBN A;  2Z1Y A;  4U2H A;  1VJO A;  1WYV B;  4ZM4 A;  1LW4 A;  2CJH A;  3HDO A;  3BCA A;  4M2J A;  2AY9 A;  1AAW A;  3RCH B;  1N8P A;  3MAU A;  3PPL A;  1C4K A;  4I8A A;  3BV0 A;  3GR9 A;  4RKD A;  1M7Y A;  4A6U A;  4ZM3 A;  2R5C B;  2YKX A;  1ORD A;  2Z9W A;  3A9Y A;  2WK9 A;  3DU4 A;  4ZSY A;  3EI5 A;  4ZDL A;  1G4X A;  3FQ8 A;  2EZ1 A;  1S0A A;  1UU2 A;  1SZK A;  2BIG A;  2X3L A;  4MQR A;  4UHN A;  1W7M A;  3FDD A;  3EUC A;  1RV4 A;  2BWO A;  2VI9 A;  5G09 A;  3MAF A;  2CAN A;  3F6T A;  4XEW A;  3WY7 A;  4OBV A;  3GBX A;  1DGE A;  4M2M A;  4R5Z A;  1WYT B;  2CTZ A;  1AHX A;  1QIT A;  1IX6 A;  1KKJ A;  3TQX A;  1ART A;  3FVX A;  4E1O A;  2AY6 A;  1LS3 A;  2QBT A;  2BHX A;  2VLH A;  3KE3 A;  2D63 A;  2BI3 A;  2Z1Z A;  4RJY A;  1GEW A;  2W7L A;  3ISL A;  4B9B A;  1T3I A;  2PO3 A;  1N2T A;  3W1J A;  3L44 A;  3AEM C;  3ZRP A;  2EPJ A;  2W8T A;  2FM1 A;  3DOD A;  3N5M A;  1M0P A;  3F0H A;  3Q8N A;  3VP6 A;  3TFU A;  2CJG A;  3MC6 C;  5F9S A;  3ELE A;  2O0R A;  2VGZ A;  2D5Y A;  4WYG A;  2FQ6 A;  3MKJ A;  3DXV A;  3M5U A;  2JJH A;  2X5D A;  1BT4 A;  1WKH A;  4IX8 A;  3QGU A;  4Y0I A;  1M4N A;  4L0O A;  3PAA A;  3WGC A;  3WX9 A;  3FD0 A;  1GD9 A;  3PD6 B;  4EFF A;  3ELP A;  2VIA A;  2WK8 A;  3FQ7 A;  3NTJ A;  2C7T A;  2R5C A;  3RUY A;  4AH3 A;  3FVU A;  3JWA A;  3WZF A;  2C0R A;  2W7E A;  4BA4 A;  2X5F A;  1B5O A;  5D5S A;  1B9I A;  4OC9 A;  1VEF A;  1AJR A;  3K28 A;  2CH2 A;  1YOO A;  2ZSM A;  1UU1 A;  4W1W A;  1W7L A;  2VMU A;  1LW5 A;  3JTX A;  3A2B A;  3VK3 A;  4LNM A;  2VMR A;  4H63 Q;  4LNJ A;  3GSB A;  3N75 A;  4WYF A;  2DOU A;  1AMS A;  1JS3 A;  1CJ0 A;  1O4S A;  3B1C A;  3BCB A;  4WB0 A;  3ZRQ A;  1WYT A;  2X8U A;  1QJ5 A;  1BJO B;  5KTB A;  2HP2 A;  3A9X A;  3A9Z A;  2E7U A;  3WKS A;  4XQ2 A;  4WD2 A;  1DGD A;  3DC1 A;  4HF8 A;  1RVY A;  1GDE A;  2ZYJ A;  1BJN A;  4ZAS A;  4K2M A;  4MQQ A;  1CL1 A;  3F9T A;  2Z20 A;  1S06 A;  3AEN B;  3L8A A;  1RVU A;  2BWN A;  4JEV A;  5EAA A;  2VI8 A;  4IYO B;  4LW2 A;  1M0O A;  1UKJ A;  2V1P A;  4W1V A;  4F5G A;  4N0W A;  4XAU A;  4MGR A;  2WB6 A;  2C44 A;  1AIB A;  2R0T A;  3PGY A;  1SPA A;  5K8B A;  1BW0 A;  1J32 A;  3PJ0 A;  4F5H A;  1TAS A;  3PA9 A;  4Q31 A;  2R2N A;  3KGX A;  3AEL A;  2D7Z A;  4ADD A;  1MGV A;  3LG0 A;  2QMA A;  4CBS A;  3VK4 A;  4H51 A;  4GDY A;  3BWN A;  5EIG B;  4J8L A;  4FL0 A;  1SZS A;  3MAF B;  3FFH A;  1IJI A;  2O1B A;  4ATQ A;  1IVR A;  1YJZ A;  1D7U A;  1QJ3 A;  1S08 A;  1IAY A;  3BN1 A;  1M6S A;  4JE5 A;  4UOY A;  4ZSW A;  3JU7 A;  2ZUK A;  2V0Y A;  3AEJ A;  3HQT A;  3GZC A;  5G0A A;  2VMY A;  1AMR A;  1AHY A;  4F5J A;  1PMM A;  3HMU A;  3LVK A;  1AIA A;  2YRR A;  3IF2 A;  2VYC A;  1ASD A;  1WYU B;  2W8J A;  3LY1 A;  1PG8 A;  4JEY A;  4KYO A;  3LVJ A;  1H0C A;  3QM2 A;  3E9K A;  4NOG A;  2YKU A;  2NMP A;  1BJO A;  5E4Z A;  1BQD A;  1AJS A;  3E2Z A;  3MBB A;  2VMX A;  3AAT A;  2QB2 A;  3FFR A;  5EAV A;  4LNL A;  2AY3 A;  2ZC0 A;  1YJY A;  3ZRR A;  1D2F A;  3BS8 A;  3E2F A;  4WLJ A;  1G4V A;  3QN6 A;  4ZDO A;  2G7J A;  1ASL A;  1CZC A;  3ZZK A;  3N4S A;  1WST A;  3JWB A;  1DFO A;  4UHM A;  2EO5 A;  2VMP A;  1KMK A;  5G2P A;  2ZY2 A;  2GMU A;  4ATP A;  4F5M A;  5LHA A;  1DJE A;  4Q75 A;  2VLF A;  4E3Q A;  2XH1 A;  3FSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...