2BI1A

Radiation damage of the schiff base in phosphoserine aminotransferase (structure b)
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
360
structure length
360
Chain Sequence
VKQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKENA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Strain Relief at the Active Site of Phosphoserine Aminotransferase Induced by Radiation Damage.
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Transferase
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
total genus 127
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2bi1A01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2bi1A02
4GE7A 1QITA 2VMVA 4WXGA 4ZASA 1I48A 1ASNA 1LC8A 3DRDA 1KKJA 1M0NA 2W8UA 1DFOA 3AEJA 3FFRA 3NDNA 2YCPA 5F8VA 1S07A 4PVFA 4ATPA 2XBNA 1ASCA 2YCNA 4GEBA 1N8PA 4BA5A 3LV2A 4RJ0A 2GQNA 4UHNA 1WYUA 3FFHA 3ZZJA 4XJLA 2YKVA 3JW9A 3DODA 1TOIA 1FG3A 1CZCA 1AY5A 4J8LA 2GMUA 2X5FA 2AEVA 3GBXA 4W8IA 5AX8A 3WCOA 1C7OA 1GDEA 2W8JA 3MAFA 2AY2A 1IX7A 1KL2A 3EUCA 4ISYA 4W5KA 1U08A 3NX3A 4A72A 4DBCA 3QGUA 2TPLA 3AV7A 1LK9A 2AY4A 5DX5A 3UE8A 1RV4A 5EAAA 2HOZA 5F9SA 2VMRA 4UHOA 1I41A 3AOVA 1KKPA 3ZRRA 2VGZA 4OYTA 1CQ8A 1AHGA 4JF1A 1SZSA 3ACZA 2QMAA 3EIAA 3NRAA 4R8DA 1JS6A 4EU1A 4JEYA 2D66A 3VK2A 3ZRPA 4BQ0A 4PFFA 1VJOA 3PJ0A 3MAFB 2ZJGA 1W7MA 2ZC0A 4W1XA 4IW7A 4WYDA 4F5MA 1MAPA 3LVJA 2OQXA 5DJ9A 4MY5A 2V1PA 2X3LA 2VMUA 3GSBA 5M4DA 3AENB 2CJDA 4WYAA 2E7IA 4ZSWA 3K40A 1IX6A 4ADDA 4RIZA 4A6UA 1EJIA 3LVMA 4KYOA 5D95A 2W7IA 4OMAA 4LNMA 3AEMA 2VMPA 1GBNA 5BJ3A 1W23A 3CQ6A 3ELEA 1M0OA 3E2ZB 1AMRA 4Y0DA 3BC8A 2YCTA 2AY3A 1UU1A 3AOWA 1YJSA 1AMQA 2XH1A 4N0BA 4UOYA 4ZDOA 2W7LA 4LNLA 2PO3A 2QA3A 2D61A 2Z61A 2AY1A 5J8QA 3MC6A 3RCHA 3B1DA 5M4BA 1YJZA 4WLJA 4XEWA 1O4SA 2YKUA 3EIBA 3EI6A 4U2HA 1AKBA 4WLHA 4ZSYA 5FT8A 3E77A 2R0TA 1D7SA 3FVUA 3H14A 3HLMA 3OKSA 2VLHA 3R4TA 1QGNA 3DXVA 4RITA 1PFFA 3NUIA 4ZAHA 2QB3A 1CL1A 4B98A 3BS8A 1LW5A 3FD0A 4AZKA 2R5EA 1Z3ZA 1J04A 2Z9WA 3W1JA 1ASEA 5EIGB 3EI7A 2AY9A 3TATA 4F5GA 1DTYA 4TMRA 3BV0A 2YOBA 4WP0A 3VK3A 3NYSA 2D5YA 1AMSA 2D63A 2VGTA 3L8AA 2DR1A 3FQAA 1DJUA 3QN6A 2BWNA 4AO9A 4BHDA 2DKBA 4A6RA 4RAEA 1WKGA 2EPJA 3MEBA 4MKJA 1AHXA 2O1BA 2R5CB 3WKRA 1IBJA 3H7FA 1OHWA 3KGXA 3ZZKA 2VMXA 1AJSB 2CB1A 4L0OA 2BWPA 2BIEA 3WCNA 3JZLA 3JWBA 1ARTA 3AELA 2VMZA 1EG5A 3AATA 3G7QA 3PAAA 4Q6RA 2HOXA 3FCRA 3W1IA 1ASDA 1M0PA 2C0RA 3GZDC 1CQ7A 1TOEA 2VMSA 1TOGA 1S08A 3AEPA 4CXRA 4AOAA 2ZYJA 2AY6A 4ITGA 1AX4A 2CTZA 2BI9A 1GC3A 2X5DA 3M5UA 1GEYA 3DR4A 4E3QA 3A9XA 3FRKA 4JF0A 2QLRA 2W7DA 3B1CA 4U1TA 1AAMA 2EGYA 4K2MA 3PIUA 1LC5A 4WYFA 2VI8A 1XI9A 4Q75A 1M4NA 4FFCA 1XEYA 2DKJA 2HUIA 2OKKA 4R2NA 1T3IA 1AKCA 2V0YA 3IF2A 2DGMA 1B5PA 1C9CA 3WLXA 1LC7A 1D7RA 2Z9XA 3NYUA 1MLYA 2Z1YA 3QM2A 2W7KA 1GCKA 1W3UA 2DGLA 2FNUA 3PPLA 4WD2A 2QBTA 2YKYA 3PDBB 4GSAA 1LS3A 3GZCA 3HDOA 4WYCA 1Z7DA 1V2FA 4LNJA 1KMJA 1CZEA 1WYVA 1OXOA 1X28A 2FN6A 4JEWA 2W7JA 2W7EA 5EIGA 3NTJA 1GC2A 1M7YA 3QBOA 4A0RA 4CBSA 3ATHA 4ADEA 2Z67A 3FVXA 4JE5A 1TPLA 3T32A 2BI1A 2CSTA 4IYOA 4LW2A 2ZP7A 3EI9A 4LW4A 3EZ1A 1OHVA 3I5TA 2NMPA 1D7VA 1AICA 1PMMA 1X2AA 2VMQA 3N5MA 4ZLVA 3DU4A 2R5CA 4WYGA 4JE5D 1MLZA 2VGVA 4MQRA 2BYJA 8AATA 1CS1A 3PGYA 3FTBA 1TOJA 5G2QA 1BJOA 3R9AA 1AIAA 2VMYA 1ZC9A 3FVSA 2W8VA 3JWAA 1M0QA 2AY7A 2HOYA 3RQ1A 2BIGA 3AEOA 3NU7A 4WBTA 3FDDA 2VMNA 3LY1A 1BS0A 4FL0A 3EI5A 4ADBA 4WB0B 4EMYA 3E2YA 2E54A 1SF2A 3KE3A 3DC1A 1C0NA 4Y0HA 1ASLA 1OXPA 1EQBA 1SZUA 1V2EA 3BWOA 4QGRA 3UWCA 1ELQA 3VK4A 4IX8A 4ZDLA 5LHAA 1E5FA 2BKWA 2OATA 4MGRA 1IJIA 1O61A 1V2DA 1BJOB 1I43A 4B9BA 1O69A 1DKAA 4E3RA 3HQTA 2PB2A 1TASA 3E9KA 4F5FA 5LH9A 1BJ4A 2HUFA 1BJWA 3CQ4A 2W8WA 4BMKA 3MAUA 3WGCA 1V72A 3KKIA 3G0TA 4Q76A 1W7LA 3GZDA 4OBUA 4RLGA 3VAXA 1GC4A 4Y0IA 3MC6C 1S09A 1ZODA 4MQPA 1WYVB 1SZKA 3ISLA 3LVLB 2JJHA 3FQ8A 2DOUA 4JEXA 3WX9A 5EAVA 4A0GA 4RKCA 4A0HA 1AMAA 1C4KA 3BCAA 3CBFA 2OGAA 3COGA 4M2MA 4XK1A 5D5SA 2BWOA 3RBLA 1IAYA 3WGBA 1N2TA 5E5IA 2YHKA 2W8TA 3G8MA 2YRRA 1G7WA 2OGEA 2ZY2A 4CVQA 4EB7A 2JJFA 3Q8NA 1YNUA 1G4VA 4I8AA 4ZDPA 2E7JA 5EUNA 2E7UA 3HVYA 2VGUA 4PIWA 4HVKA 1MGVA 1ELUA 1WKHA 1B8GA 1S06A 2ZY3A 1TATA 1O62A 3EZSA 3BB8A 3EI8A 1X0MA 2Z9VA 3MADA 4F5HA 3TFTA 2BHXA 4KXKA 3K28A 3FKDA 2WK7A 1AJRA 3DR7A 4UQVA 2W7FA 5DB5A 2VMWA 4F5IA 2BYLA 3GWPA 1UU0A 4XJMA 2JGTA 4KAMA 3ASAA 4WB0A 1IVRA 2EH6A 5E3KA 4W1VA 2OKJA 3FSLA 3OP7A 4IXOA 2AATA 2VMOA 4WXBA 2G6WA 4JEVA 1GD9A 1RVUA 1JF9A 3K7YA 4E1OA 1M32A 4OT8A 1ASBA 2JJEA 1B5OA 1DGDA 2D7ZA 2VIAA 3RI6A 3N75A 1WSTA 1GEWA 3N0LA 3FQ7A 3GR9A 3F0HA 3DXWA 9AATA 2W7GA 5JAYA 2GSAA 4DGTA 2QB2A 4XJOA 1KL1A 4HF8A 4P7YA 1RVYA 2VI9A 3HMUA 3A9ZA 3JTXA 1QISA 3HL2A 3B46A 1MAQA 2VMTA 3USFA 1P3WA 2PB0A 2WKAA 2AY5A 3A8UX 3IHJA 2C81A 4GE9A 1OHYA 4IXZA 4MKKA 3WZFA 1IX8A 3TQXA 5DJ1A 3NUBA 3PDBA 1SPAA 3I16A 1UU2A 3FZ8A 3B1EA 2ZY5A 4AO4A 3UAKA 1MDOA 3KGWA 3MBBA 2Z20A 1H1CA 3FZ6A 5IWQA 2FYFA 1WYTB 1BKGA 1ARIA 7AATA 2CJGA 3NU8A 3BWNA 1BQAA 1C7NA 4IY7A 4JEZA 4Q31A 4TV7A 1I29A 2HP1A 4MSOA 3LVKA 3BWNC 3VOMA 1G4XA 1DJEA 1BT4A 4GDYA 4R5FA 1YAAA 2VGSA 4W91A 2ZY4A 1CQ6A 1QJ3A 2FQ6A 3LG0A 2BI5A 4RM1A 4F5LA 1ZOBA 3MKJA 5EQCA 4DQ6A 5FT5A 5HHYA 1H0CA 1MDZA 1KMKA 2O0RA 3ASBA 3QI6A 4M2JA 1UKJA 1D7UA 2ORDA 3D6KA 3ELPA 1QIRA 4AZJA 3B8XA 3JU7A 1CL2A 1VP4A 3E2FA 3PDXA 1PMOA 4WXFA 2W7HA 3A2BA 3RBFA 4UHMA 1GEXA 1SVVA 1C7GA 1YJYA 5HDMA 1AHFA 2CY8A 5K8BA 4OCAA 5EUEA 3WY7A 4E77A 5C6UA 4XAUA 2D64A 4ZWMA 2Q7WA 2RFVA 4PFNA 2W7MA 1ASMA 2BI2A 5E4ZA 4K2IA 4OTLA 5G4JA 2WK9A 3AEJC 5M49A 2HP2A 3FDBA 2VIBA 2O7CA 4IYOB 2JG2A 3RCHB 3PD6A 1E5EA 1QZ9A 4OBVA 1OATA 1ARHA 2HZPA 1TARA 4F5KA 1MDXA 3AEMC 5G2PA 4EB5A 1ECXA 2EO5A 2EZ2A 1IAXA 4M2KA 1AHEA 4ATQA 2WK8A 4K2BA 3I4JA 4R5ZA 1B4XA 4GRXA 5HXXA 4EFFA 1DGEA 3PA9A 4NOGA 4GE4A 4ADCA 5BJ4A 2HORA 2CH2A 2CH1A 1WYTA 2F8JA 1RV3A 4MQQA 2VLFA 2D7YA 1B9HA 3P6KA 4A6TA 3LWSA 1Y4IA 4W1WA 3PD6B 1YOOA 4ZWVA 3F6TA 4A0FA 1QJ5A 1JS3A 3E2ZA 5TF5A 1ARSA 2JISA 1LW4A 2DGKA 2ZUKA 4CBRA 1PG8A 2YKXA 1AHYA 2GB3A 3HT4A 5FT4A 2ZSLA 4WYEA 2CJHA 1AJSA 2D65A 4H51A 4IXSA 2BI3A 4LC3A 3W1HA 3NYTA 1AKAA 4ITXA 2X8UA 3ZRQA 4TN4A 5M46A 2Z1ZA 1AIBA 1YIYA 3GETA 4ZM3A 1CJ0A 3DZZA 1M6SA 1G7XA 2FM1A 1YIZA 3QHXA 5I92A 2VGWA 3RUYA 4O6ZA 4OC9A 1JG8A 3WKSA 1VEFA 2BIAA 3II0A 4BA4A 1BQDA 4A00A 1W7NA 4RJYA 1BJNA 3GJUA 2FNIA 3BCBA 1ASAA 1ARGA 3E6GA 3NNKA 4XJPA 1BW0A 2HUUA 3CAIA 5EFSA 2R2NA 3BCXA 2EZ1A 3TCMA 1SFFA 2CFBA 2CANA 1ASFA 1IUGA 3FZ7A 4AH3A 2VYCA 1AY4A 2JJGA 2Z9UA 4N0WA 4J5UA 3TFUA 3QPGA 3P1TA 4ZM4A 1DJ9A 2ZSMA 5G0AA 3VP6A 3BN1A 1D2FA 3A9YA 1ORDA 2C7TA 4F5JA 3DYDA 3CQ5A 2AEUA 3F9TA 3ECDA 2C44A 1AY8A 1X29A 5G09A 4F4EA 4XQ2A 1TOKA 5FT6A 4CXQA 3AENA 1AAWA 1N31A 1S0AA 1WYUB 3L44A 4RKDA 2AY8A 1ASGA 1FC4A 4P3MA 1J32A 1B9IA 1FG7A 1GC0A 2CINA 2YRIA 5G4IA 2GMSA 3HBXA 5EUDA 1LKCA
chains in the Genus database with same CATH superfamily
4GE7A 1QITA 2VMVA 4WXGA 4ZASA 1I48A 1ASNA 1LC8A 3DRDA 1KKJA 1M0NA 2W8UA 1DFOA 3AEJA 3FFRA 3NDNA 2YCPA 5F8VA 1S07A 4PVFA 4ATPA 2XBNA 1ASCA 2YCNA 4GEBA 1N8PA 4BA5A 3LV2A 4RJ0A 2GQNA 4UHNA 1WYUA 3FFHA 3ZZJA 4XJLA 2YKVA 3JW9A 3DODA 1TOIA 1FG3A 1CZCA 1AY5A 4J8LA 2GMUA 2X5FA 2AEVA 3GBXA 4W8IA 5AX8A 3WCOA 1C7OA 1GDEA 2W8JA 3MAFA 2AY2A 2WB6A 1IX7A 1KL2A 3EUCA 4ISYA 4W5KA 1U08A 3NX3A 4A72A 4DBCA 3QGUA 2TPLA 3AV7A 1LK9A 2AY4A 5DX5A 3UE8A 1RV4A 5EAAA 2HOZA 5F9SA 2VMRA 4UHOA 1I41A 3AOVA 1KKPA 3ZRRA 2VGZA 4OYTA 1CQ8A 1AHGA 4JF1A 1SZSA 3ACZA 2QMAA 3EIAA 3NRAA 4R8DA 1JS6A 4EU1A 4JEYA 2D66A 3VK2A 3ZRPA 4BQ0A 4PFFA 1VJOA 3PJ0A 3MAFB 2ZJGA 1W7MA 2ZC0A 4W1XA 4IW7A 4WYDA 4F5MA 1MAPA 3LVJA 2OQXA 5DJ9A 4MY5A 2V1PA 2X3LA 2VMUA 3GSBA 5M4DA 3AENB 2CJDA 4WYAA 2E7IA 4ZSWA 2EYQA 3K40A 1IX6A 4ADDA 4RIZA 4A6UA 1EJIA 3LVMA 4KYOA 5D95A 2W7IA 4OMAA 4LNMA 3AEMA 2VMPA 1GBNA 5BJ3A 1W23A 3CQ6A 3ELEA 1M0OA 3E2ZB 1AMRA 4Y0DA 3BC8A 2YCTA 2AY3A 1UU1A 3AOWA 1YJSA 1AMQA 2XH1A 4N0BA 4UOYA 4ZDOA 2W7LA 4LNLA 2PO3A 2QA3A 2D61A 2Z61A 3N7NA 2AY1A 5J8QA 3MC6A 3RCHA 3B1DA 5M4BA 1YJZA 4WLJA 4XEWA 1O4SA 2YKUA 3EIBA 3EI6A 4U2HA 1AKBA 4WLHA 4ZSYA 5FT8A 3E77A 2R0TA 1D7SA 3FVUA 3H14A 3HLMA 3OKSA 2VLHA 3R4TA 1QGNA 3DXVA 4RITA 1PFFA 3NUIA 4ZAHA 2QB3A 1CL1A 4B98A 3BS8A 4K05A 1LW5A 3FD0A 4AZKA 2R5EA 1Z3ZA 1J04A 2Z9WA 3W1JA 1ASEA 5EIGB 3EI7A 2AY9A 3TATA 4F5GA 1DTYA 4TMRA 3BV0A 2YOBA 4WP0A 3VK3A 3NYSA 2D5YA 1AMSA 2D63A 2VGTA 3L8AA 2DR1A 3FQAA 1DJUA 3QN6A 2BWNA 4AO9A 4BHDA 2DKBA 4A6RA 4RAEA 1WKGA 2FKIA 2EPJA 3MEBA 4MKJA 1AHXA 2QSRA 2O1BA 2R5CB 3WKRA 3N4SA 1IBJA 3H7FA 1OHWA 3N4RA 3KGXA 3ZZKA 2VMXA 1AJSB 2CB1A 4L0OA 2BWPA 2BIEA 3WCNA 3JZLA 3JWBA 1ARTA 3AELA 2VMZA 1EG5A 3AATA 3G7QA 3PAAA 4Q6RA 2HOXA 3FCRA 3W1IA 1ASDA 1M0PA 2C0RA 3GZDC 1CQ7A 1TOEA 2VMSA 1TOGA 1S08A 3AEPA 4CXRA 4AOAA 2ZYJA 2AY6A 3N4XA 4ITGA 1AX4A 2CTZA 2BI9A 1GC3A 2X5DA 3M5UA 1GEYA 3DR4A 4E3QA 3A9XA 3FRKA 4JF0A 2QLRA 2W7DA 3B1CA 4U1TA 1AAMA 2EGYA 4K2MA 3PIUA 1LC5A 4WYFA 2VI8A 1XI9A 4Q75A 1M4NA 4FFCA 1XEYA 2DKJA 2HUIA 2OKKA 4R2NA 1T3IA 1AKCA 2V0YA 3IF2A 2DGMA 1B5PA 1C9CA 3WLXA 1LC7A 1D7RA 2Z9XA 3NYUA 1MLYA 2Z1YA 3QM2A 2W7KA 1GCKA 1W3UA 2DGLA 2FNUA 3PPLA 4WD2A 2QBTA 2YKYA 3PDBB 4GSAA 1LS3A 3GZCA 3HDOA 4WYCA 1Z7DA 1V2FA 4LNJA 1KMJA 1CZEA 1WYVA 1OXOA 1X28A 2FN6A 4JEWA 2W7JA 2W7EA 5EIGA 3NTJA 1GC2A 1M7YA 3QBOA 4A0RA 4CBSA 3ATHA 4ADEA 2Z67A 3FVXA 4JE5A 1TPLA 3T32A 2BI1A 2CSTA 4IYOA 4LW2A 2ZP7A 3EI9A 4LW4A 3EZ1A 1OHVA 3I5TA 2NMPA 1D7VA 1AICA 1PMMA 1X2AA 2VMQA 3N5MA 4ZLVA 3DU4A 2R5CA 4WYGA 4JE5D 1MLZA 2VGVA 4MQRA 2BYJA 8AATA 1CS1A 3PGYA 3FTBA 1TOJA 5G2QA 1BJOA 3R9AA 1AIAA 2VMYA 1ZC9A 3FVSA 2W8VA 3JWAA 1M0QA 2AY7A 2HOYA 3RQ1A 2BIGA 3AEOA 3NU7A 4WBTA 3FDDA 2VMNA 3LY1A 1BS0A 4FL0A 3EI5A 4ADBA 4WB0B 4EMYA 3E2YA 2E54A 1SF2A 3KE3A 3DC1A 1C0NA 4Y0HA 1ASLA 1OXPA 1EQBA 1SZUA 1V2EA 3BWOA 4QGRA 2KFPA 3UWCA 1ELQA 3VK4A 4IX8A 4ZDLA 5LHAA 1E5FA 2BKWA 2OATA 4MGRA 1IJIA 1O61A 1V2DA 1BJOB 1I43A 4B9BA 1O69A 1DKAA 4E3RA 3HQTA 2PB2A 1TASA 3E9KA 4F5FA 5LH9A 1BJ4A 2HUFA 1BJWA 3CQ4A 2W8WA 4BMKA 3MAUA 3WGCA 1V72A 3KKIA 3G0TA 4Q76A 1W7LA 3GZDA 4OBUA 4RLGA 3VAXA 1GC4A 4Y0IA 3MC6C 2A1VA 1S09A 1ZODA 4MQPA 1WYVB 1SZKA 3ISLA 3LVLB 2JJHA 3FQ8A 2DOUA 4JEXA 3WX9A 5EAVA 4A0GA 4RKCA 4A0HA 1AMAA 1C4KA 3BCAA 3CBFA 2OGAA 3COGA 4M2MA 4XK1A 5D5SA 2BWOA 3RBLA 1IAYA 3WGBA 1N2TA 5E5IA 2YHKA 2W8TA 3G8MA 2YRRA 1G7WA 2OGEA 2ZY2A 4CVQA 4EB7A 2JJFA 3Q8NA 1YNUA 4H63Q 1G4VA 4I8AA 4ZDPA 2E7JA 5EUNA 2E7UA 3HVYA 2VGUA 4PIWA 4HVKA 1MGVA 1ELUA 1WKHA 1B8GA 1S06A 2ZY3A 1TATA 1O62A 3EZSA 3BB8A 3EI8A 1X0MA 2Z9VA 3MADA 4F5HA 3TFTA 2BHXA 4KXKA 3K28A 3FKDA 2WK7A 1AJRA 3DR7A 4UQVA 2W7FA 5DB5A 2VMWA 4F5IA 2BYLA 3GWPA 1UU0A 4XJMA 2JGTA 4KAMA 3ASAA 4WB0A 1IVRA 2EH6A 5E3KA 4W1VA 2OKJA 3FSLA 3OP7A 4IXOA 2AATA 2VMOA 4WXBA 2G6WA 4JEVA 1GD9A 1RVUA 1JF9A 3K7YA 4E1OA 1M32A 4OT8A 1ASBA 2JJEA 1B5OA 1DGDA 2D7ZA 2VIAA 3RI6A 3N75A 1WSTA 1GEWA 3N0LA 3FQ7A 3GR9A 3F0HA 3DXWA 9AATA 2W7GA 5JAYA 2GSAA 4DGTA 2QB2A 4XJOA 1KL1A 4HF8A 4P7YA 1RVYA 2VI9A 3HMUA 3A9ZA 3JTXA 1QISA 3HL2A 3B46A 1MAQA 2VMTA 3USFA 1P3WA 2PB0A 2WKAA 2AY5A 3A8UX 3IHJA 2C81A 4GE9A 1OHYA 4IXZA 4MKKA 3WZFA 1IX8A 3TQXA 5DJ1A 3NUBA 3PDBA 1SPAA 1KAFA 3I16A 1UU2A 3FZ8A 3B1EA 2ZY5A 4AO4A 3UAKA 1MDOA 3KGWA 3MBBA 2Z20A 1H1CA 3FZ6A 5IWQA 2FYFA 1WYTB 1BKGA 1ARIA 7AATA 2CJGA 3NU8A 3BWNA 1BQAA 1C7NA 4IY7A 4JEZA 4Q31A 4TV7A 1I29A 2HP1A 4MSOA 3LVKA 3BWNC 3VOMA 1G4XA 1DJEA 1BT4A 4GDYA 4R5FA 1YAAA 2VGSA 4W91A 2ZY4A 1CQ6A 1QJ3A 2FQ6A 3LG0A 2BI5A 4RM1A 4F5LA 5KTBA 1ZOBA 3MKJA 5EQCA 4DQ6A 5FT5A 5HHYA 1H0CA 1MDZA 1KMKA 2O0RA 3ASBA 3QI6A 4M2JA 1UKJA 1D7UA 2ORDA 3D6KA 3ELPA 1QIRA 4AZJA 3B8XA 3JU7A 1CL2A 1VP4A 3E2FA 3PDXA 1PMOA 4WXFA 2W7HA 3A2BA 3RBFA 4UHMA 1GEXA 1SVVA 1C7GA 1YJYA 5HDMA 1AHFA 2CY8A 5K8BA 4OCAA 5EUEA 3WY7A 4E77A 5C6UA 4XAUA 2D64A 4ZWMA 2Q7WA 2RFVA 4PFNA 2W7MA 1ASMA 2BI2A 5E4ZA 4K2IA 4OTLA 5G4JA 2WK9A 3H9XA 3AEJC 5M49A 2HP2A 3FDBA 2VIBA 2O7CA 4IYOB 2JG2A 3RCHB 3PD6A 1E5EA 1QZ9A 4OBVA 1OATA 1ARHA 2HZPA 1TARA 4F5KA 1MDXA 3AEMC 5G2PA 4EB5A 1ECXA 2EO5A 2EZ2A 1IAXA 4M2KA 1AHEA 4ATQA 2WK8A 4K2BA 3I4JA 4R5ZA 1B4XA 4GRXA 5HXXA 4EFFA 1DGEA 3PA9A 4NOGA 4GE4A 4ADCA 5BJ4A 2HORA 2CH2A 2CH1A 1WYTA 2F8JA 1RV3A 4MQQA 2VLFA 2D7YA 1B9HA 3P6KA 4A6TA 3LWSA 1Y4IA 4W1WA 3PD6B 1YOOA 4ZWVA 3F6TA 4A0FA 1QJ5A 1JS3A 3E2ZA 5TF5A 1ARSA 2JISA 1LW4A 2DGKA 2ZUKA 4CBRA 1PG8A 2YKXA 2G7JA 1AHYA 2GB3A 3HT4A 5FT4A 2ZSLA 4WYEA 2CJHA 1AJSA 2D65A 4H51A 4IXSA 2BI3A 4LC3A 3W1HA 3NYTA 1AKAA 4ITXA 2X8UA 3ZRQA 4TN4A 5M46A 2Z1ZA 1AIBA 1YIYA 3GETA 4ZM3A 1CJ0A 3DZZA 1M6SA 1G7XA 2FM1A 1YIZA 3QHXA 5I92A 2VGWA 3RUYA 4O6ZA 4OC9A 1JG8A 3WKSA 1VEFA 2BIAA 3II0A 4BA4A 1BQDA 4A00A 1W7NA 4RJYA 1BJNA 3GJUA 2FNIA 3BCBA 1ASAA 1ARGA 3E6GA 3NNKA 4XJPA 1BW0A 2HUUA 3CAIA 5EFSA 2R2NA 3BCXA 2EZ1A 3TCMA 1SFFA 2CFBA 2CANA 1ASFA 1IUGA 3FZ7A 4AH3A 2VYCA 1AY4A 2JJGA 2Z9UA 4N0WA 4J5UA 3TFUA 3QPGA 3P1TA 4ZM4A 1DJ9A 2ZSMA 5G0AA 3VP6A 3BN1A 1D2FA 3A9YA 1ORDA 2C7TA 4F5JA 3DYDA 3CQ5A 2AEUA 3F9TA 3ECDA 2C44A 1AY8A 1X29A 5G09A 4F4EA 4XQ2A 1TOKA 5FT6A 4CXQA 3AENA 1AAWA 1N31A 1S0AA 1WYUB 3L44A 4RKDA 2AY8A 1ASGA 1FC4A 4P3MA 1J32A 1B9IA 1FG7A 1GC0A 2CINA 2YRIA 5G4IA 2GMSA 3HBXA 5EUDA 1LKCA
chains in the Genus database with same CATH topology
4GE7A 1QITA 2VMVA 4WXGA 4ZASA 1I48A 1ASNA 1LC8A 3DRDA 1KKJA 1M0NA 2W8UA 1DFOA 3AEJA 3FFRA 3NDNA 2YCPA 5F8VA 1S07A 4PVFA 4ATPA 2XBNA 1ASCA 2YCNA 4GEBA 1N8PA 4BA5A 3LV2A 4RJ0A 2GQNA 4UHNA 1WYUA 3FFHA 3ZZJA 4XJLA 2YKVA 3JW9A 3DODA 1TOIA 1FG3A 1CZCA 1AY5A 4J8LA 2GMUA 2X5FA 2AEVA 3GBXA 4W8IA 5AX8A 3WCOA 1C7OA 1GDEA 2W8JA 3MAFA 2AY2A 2WB6A 1IX7A 1KL2A 3EUCA 4ISYA 4W5KA 1U08A 3NX3A 4A72A 4DBCA 3QGUA 2TPLA 3AV7A 1LK9A 2AY4A 5DX5A 3UE8A 1RV4A 5EAAA 2HOZA 5F9SA 2VMRA 4UHOA 1I41A 3AOVA 1KKPA 3ZRRA 2VGZA 4OYTA 1CQ8A 1AHGA 4JF1A 1SZSA 3ACZA 2QMAA 3EIAA 3NRAA 4R8DA 1JS6A 4EU1A 4JEYA 2D66A 3VK2A 3ZRPA 4BQ0A 4PFFA 1VJOA 3PJ0A 3MAFB 2ZJGA 1W7MA 2ZC0A 4W1XA 4IW7A 4WYDA 4F5MA 1MAPA 3LVJA 2OQXA 5DJ9A 4MY5A 2V1PA 2X3LA 2VMUA 3GSBA 5M4DA 3AENB 2CJDA 4WYAA 2E7IA 4ZSWA 2EYQA 3K40A 1IX6A 4ADDA 4RIZA 4A6UA 1EJIA 3LVMA 4KYOA 5D95A 2W7IA 4OMAA 4LNMA 3AEMA 2VMPA 1GBNA 5BJ3A 1W23A 3CQ6A 3ELEA 1M0OA 3E2ZB 1AMRA 4Y0DA 3BC8A 2YCTA 2AY3A 1UU1A 3AOWA 1YJSA 1AMQA 2XH1A 4N0BA 4UOYA 4ZDOA 2W7LA 4LNLA 2PO3A 2QA3A 2D61A 2Z61A 3N7NA 2AY1A 5J8QA 3MC6A 3RCHA 3B1DA 5M4BA 1YJZA 4WLJA 4XEWA 1O4SA 2YKUA 3EIBA 3EI6A 4U2HA 1AKBA 4WLHA 4ZSYA 5FT8A 3E77A 2R0TA 1D7SA 3FVUA 3H14A 3HLMA 3OKSA 2VLHA 3R4TA 1QGNA 3DXVA 4RITA 1PFFA 3NUIA 4ZAHA 2QB3A 1CL1A 4B98A 3BS8A 4K05A 1LW5A 3FD0A 4AZKA 2R5EA 1Z3ZA 1J04A 2Z9WA 3W1JA 1ASEA 5EIGB 3EI7A 2AY9A 3TATA 4F5GA 1DTYA 4TMRA 3BV0A 2YOBA 4WP0A 3VK3A 3NYSA 2D5YA 1AMSA 2D63A 2VGTA 3L8AA 2DR1A 3FQAA 1DJUA 3QN6A 2BWNA 4AO9A 4BHDA 2DKBA 4A6RA 4RAEA 1WKGA 2FKIA 2EPJA 3MEBA 4MKJA 1AHXA 2QSRA 2O1BA 2R5CB 3WKRA 3N4SA 1IBJA 3H7FA 1OHWA 3N4RA 3KGXA 3ZZKA 2VMXA 1AJSB 2CB1A 4L0OA 2BWPA 2BIEA 3WCNA 3JZLA 3JWBA 1ARTA 3AELA 2VMZA 1EG5A 3AATA 3G7QA 3PAAA 4Q6RA 2HOXA 3FCRA 3W1IA 1ASDA 1M0PA 2C0RA 3GZDC 1CQ7A 1TOEA 2VMSA 1TOGA 1S08A 3AEPA 4CXRA 4AOAA 2ZYJA 2AY6A 3N4XA 4ITGA 1AX4A 2CTZA 2BI9A 1GC3A 2X5DA 3M5UA 1GEYA 3DR4A 4E3QA 3A9XA 3FRKA 4JF0A 2QLRA 2W7DA 3B1CA 4U1TA 1AAMA 2EGYA 4K2MA 3PIUA 1LC5A 4WYFA 2VI8A 1XI9A 4Q75A 1M4NA 4FFCA 1XEYA 2DKJA 2HUIA 2OKKA 4R2NA 1T3IA 1AKCA 2V0YA 3IF2A 2DGMA 1B5PA 1C9CA 3WLXA 1LC7A 1D7RA 2Z9XA 3NYUA 1MLYA 2Z1YA 3QM2A 2W7KA 1GCKA 1W3UA 2DGLA 2FNUA 3PPLA 4WD2A 2QBTA 2YKYA 3PDBB 4GSAA 1LS3A 3GZCA 3HDOA 4WYCA 1Z7DA 1V2FA 4LNJA 1KMJA 1CZEA 1WYVA 1OXOA 1X28A 2FN6A 4JEWA 2W7JA 2W7EA 5EIGA 3NTJA 1GC2A 1M7YA 3QBOA 4A0RA 4CBSA 3ATHA 4ADEA 2Z67A 3FVXA 4JE5A 1TPLA 3T32A 2BI1A 2CSTA 4IYOA 4LW2A 2ZP7A 3EI9A 4LW4A 3EZ1A 1OHVA 3I5TA 2NMPA 1D7VA 1AICA 1PMMA 1X2AA 2VMQA 3N5MA 4ZLVA 3DU4A 2R5CA 4WYGA 4JE5D 1MLZA 2VGVA 4MQRA 2BYJA 8AATA 1CS1A 3PGYA 3FTBA 1TOJA 5G2QA 1BJOA 3R9AA 1AIAA 2VMYA 1ZC9A 3FVSA 2W8VA 3JWAA 1M0QA 2AY7A 2HOYA 3RQ1A 2BIGA 3AEOA 3NU7A 4WBTA 3FDDA 2VMNA 3LY1A 1BS0A 4FL0A 3EI5A 4ADBA 4WB0B 4EMYA 3E2YA 2E54A 1SF2A 3KE3A 3DC1A 1C0NA 4Y0HA 1ASLA 1OXPA 1EQBA 1SZUA 1V2EA 3BWOA 4QGRA 2KFPA 3UWCA 1ELQA 3VK4A 4IX8A 4ZDLA 5LHAA 1E5FA 2BKWA 2OATA 4MGRA 1IJIA 1O61A 1V2DA 1BJOB 1I43A 4B9BA 1O69A 1DKAA 4E3RA 3HQTA 2PB2A 1TASA 3E9KA 4F5FA 5LH9A 1BJ4A 2HUFA 1BJWA 3CQ4A 2W8WA 4BMKA 3MAUA 3WGCA 1V72A 3KKIA 3G0TA 4Q76A 1W7LA 3GZDA 4OBUA 4RLGA 3VAXA 1GC4A 4Y0IA 3MC6C 2A1VA 1S09A 1ZODA 4MQPA 1WYVB 1SZKA 3ISLA 3LVLB 2JJHA 3FQ8A 2DOUA 4JEXA 3WX9A 5EAVA 4A0GA 4RKCA 4A0HA 1AMAA 1C4KA 3BCAA 3CBFA 2OGAA 3COGA 4M2MA 4XK1A 5D5SA 2BWOA 3RBLA 1IAYA 3WGBA 1N2TA 5E5IA 2YHKA 2W8TA 3G8MA 2YRRA 1G7WA 2OGEA 2ZY2A 4CVQA 4EB7A 2JJFA 3Q8NA 1YNUA 4H63Q 1G4VA 4I8AA 4ZDPA 2E7JA 5EUNA 2E7UA 3HVYA 2VGUA 4PIWA 4HVKA 1MGVA 1ELUA 1WKHA 1B8GA 1S06A 2ZY3A 1TATA 1O62A 3EZSA 3BB8A 3EI8A 1X0MA 2Z9VA 3MADA 4F5HA 3TFTA 2BHXA 4KXKA 3K28A 3FKDA 2WK7A 1AJRA 3DR7A 4UQVA 2W7FA 5DB5A 2VMWA 4F5IA 2BYLA 3GWPA 1UU0A 4XJMA 2JGTA 4KAMA 3ASAA 4WB0A 1IVRA 2EH6A 5E3KA 4W1VA 2OKJA 3FSLA 3OP7A 4IXOA 2AATA 2VMOA 4WXBA 2G6WA 4JEVA 1GD9A 1RVUA 1JF9A 3K7YA 4E1OA 1M32A 4OT8A 1ASBA 2JJEA 1B5OA 1DGDA 2D7ZA 2VIAA 3RI6A 3N75A 1WSTA 1GEWA 3N0LA 3FQ7A 3GR9A 3F0HA 3DXWA 9AATA 2W7GA 5JAYA 2GSAA 4DGTA 2QB2A 4XJOA 1KL1A 4HF8A 4P7YA 1RVYA 2VI9A 3HMUA 3A9ZA 3JTXA 1QISA 3HL2A 3B46A 1MAQA 2VMTA 3USFA 1P3WA 2PB0A 2WKAA 2AY5A 3A8UX 3IHJA 2C81A 4GE9A 1OHYA 4IXZA 4MKKA 3WZFA 1IX8A 3TQXA 5DJ1A 3NUBA 3PDBA 1SPAA 3I16A 1UU2A 3FZ8A 3B1EA 2ZY5A 4AO4A 3UAKA 1MDOA 3KGWA 3MBBA 2Z20A 1H1CA 3FZ6A 5IWQA 2FYFA 1WYTB 1BKGA 1ARIA 7AATA 2CJGA 3NU8A 3BWNA 1BQAA 1C7NA 4IY7A 4JEZA 4Q31A 4TV7A 1I29A 2HP1A 4MSOA 3LVKA 3BWNC 3VOMA 1G4XA 1DJEA 1BT4A 4GDYA 4R5FA 1YAAA 2VGSA 4W91A 2ZY4A 1CQ6A 1QJ3A 2FQ6A 3LG0A 2BI5A 4RM1A 4F5LA 5KTBA 1ZOBA 3MKJA 5EQCA 4DQ6A 5FT5A 5HHYA 1H0CA 1MDZA 1KMKA 2O0RA 3ASBA 3QI6A 4M2JA 1UKJA 1D7UA 2ORDA 3D6KA 3ELPA 1QIRA 4AZJA 3B8XA 3JU7A 1CL2A 1VP4A 3E2FA 3PDXA 1PMOA 4WXFA 2W7HA 3A2BA 3RBFA 4UHMA 1GEXA 1SVVA 1C7GA 1YJYA 5HDMA 1AHFA 2CY8A 5K8BA 4OCAA 5EUEA 3WY7A 4E77A 5C6UA 4XAUA 2D64A 4ZWMA 2Q7WA 2RFVA 4PFNA 2W7MA 1ASMA 2BI2A 5E4ZA 4K2IA 4OTLA 5G4JA 2WK9A 3H9XA 3AEJC 5M49A 2HP2A 3FDBA 2VIBA 2O7CA 4IYOB 2JG2A 3RCHB 3PD6A 1E5EA 1QZ9A 4OBVA 1OATA 1ARHA 2HZPA 1TARA 4F5KA 1MDXA 3AEMC 5G2PA 4EB5A 1ECXA 2EO5A 2EZ2A 1IAXA 4M2KA 1AHEA 4ATQA 2WK8A 4K2BA 3I4JA 4R5ZA 1B4XA 4GRXA 5HXXA 4EFFA 1DGEA 3PA9A 4NOGA 4GE4A 4ADCA 5BJ4A 2HORA 2CH2A 2CH1A 1WYTA 2F8JA 1RV3A 4MQQA 2VLFA 2D7YA 1B9HA 3P6KA 4A6TA 3LWSA 1Y4IA 4W1WA 3PD6B 1YOOA 4ZWVA 3F6TA 4A0FA 1QJ5A 1JS3A 3E2ZA 5TF5A 1ARSA 2JISA 1LW4A 2DGKA 2ZUKA 4CBRA 1PG8A 2YKXA 2G7JA 1AHYA 2GB3A 3HT4A 5FT4A 2ZSLA 4WYEA 2CJHA 1AJSA 2D65A 4H51A 4IXSA 2BI3A 4LC3A 3W1HA 3NYTA 1AKAA 4ITXA 2X8UA 3ZRQA 4TN4A 5M46A 2Z1ZA 1AIBA 1YIYA 3GETA 4ZM3A 1CJ0A 3DZZA 1M6SA 1G7XA 2FM1A 1YIZA 3QHXA 5I92A 2VGWA 3RUYA 4O6ZA 4OC9A 1JG8A 3WKSA 1VEFA 2BIAA 3II0A 4BA4A 1BQDA 4A00A 1W7NA 4RJYA 1BJNA 3GJUA 2FNIA 3BCBA 1ASAA 1ARGA 3E6GA 3NNKA 4XJPA 1BW0A 2HUUA 3CAIA 5EFSA 2R2NA 3BCXA 2EZ1A 3TCMA 1SFFA 2CFBA 2CANA 1ASFA 1IUGA 3FZ7A 4AH3A 2VYCA 1AY4A 2JJGA 2Z9UA 4N0WA 4J5UA 3TFUA 3QPGA 3P1TA 4ZM4A 1DJ9A 2ZSMA 5G0AA 3VP6A 3BN1A 1D2FA 3A9YA 1ORDA 2C7TA 4F5JA 3DYDA 3CQ5A 2AEUA 3F9TA 3ECDA 2C44A 1AY8A 1X29A 5G09A 4F4EA 4XQ2A 1TOKA 5FT6A 4CXQA 3AENA 1AAWA 1N31A 1S0AA 1WYUB 3L44A 4RKDA 2AY8A 1ASGA 1FC4A 4P3MA 1J32A 1B9IA 1FG7A 1GC0A 2CINA 2YRIA 5G4IA 2GMSA 3HBXA 5EUDA 1LKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GE7 A;  1QIT A;  2VMV A;  4WXG A;  4ZAS A;  1I48 A;  1ASN A;  1LC8 A;  3DRD A;  1KKJ A;  1M0N A;  2W8U A;  1DFO A;  3AEJ A;  3FFR A;  3NDN A;  2YCP A;  5F8V A;  1S07 A;  4PVF A;  4ATP A;  2XBN A;  1ASC A;  2YCN A;  4GEB A;  1N8P A;  4BA5 A;  3LV2 A;  4RJ0 A;  2GQN A;  4UHN A;  1WYU A;  3FFH A;  3ZZJ A;  4XJL A;  2YKV A;  3JW9 A;  3DOD A;  1TOI A;  1FG3 A;  1CZC A;  1AY5 A;  4J8L A;  2GMU A;  2X5F A;  2AEV A;  3GBX A;  4W8I A;  5AX8 A;  3WCO A;  1C7O A;  1GDE A;  2W8J A;  3MAF A;  2AY2 A;  1IX7 A;  1KL2 A;  3EUC A;  4ISY A;  4W5K A;  1U08 A;  3NX3 A;  4A72 A;  4DBC A;  3QGU A;  2TPL A;  3AV7 A;  1LK9 A;  2AY4 A;  5DX5 A;  3UE8 A;  1RV4 A;  5EAA A;  2HOZ A;  5F9S A;  2VMR A;  4UHO A;  1I41 A;  3AOV A;  1KKP A;  3ZRR A;  2VGZ A;  4OYT A;  1CQ8 A;  1AHG A;  4JF1 A;  1SZS A;  3ACZ A;  2QMA A;  3EIA A;  3NRA A;  4R8D A;  1JS6 A;  4EU1 A;  4JEY A;  2D66 A;  3VK2 A;  3ZRP A;  4BQ0 A;  4PFF A;  1VJO A;  3PJ0 A;  3MAF B;  2ZJG A;  1W7M A;  2ZC0 A;  4W1X A;  4IW7 A;  4WYD A;  4F5M A;  1MAP A;  3LVJ A;  2OQX A;  5DJ9 A;  4MY5 A;  2V1P A;  2X3L A;  2VMU A;  3GSB A;  5M4D A;  3AEN B;  2CJD A;  4WYA A;  2E7I A;  4ZSW A;  3K40 A;  1IX6 A;  4ADD A;  4RIZ A;  4A6U A;  1EJI A;  3LVM A;  4KYO A;  5D95 A;  2W7I A;  4OMA A;  4LNM A;  3AEM A;  2VMP A;  1GBN A;  5BJ3 A;  1W23 A;  3CQ6 A;  3ELE A;  1M0O A;  3E2Z B;  1AMR A;  4Y0D A;  3BC8 A;  2YCT A;  2AY3 A;  1UU1 A;  3AOW A;  1YJS A;  1AMQ A;  2XH1 A;  4N0B A;  4UOY A;  4ZDO A;  2W7L A;  4LNL A;  2PO3 A;  2QA3 A;  2D61 A;  2Z61 A;  2AY1 A;  5J8Q A;  3MC6 A;  3RCH A;  3B1D A;  5M4B A;  1YJZ A;  4WLJ A;  4XEW A;  1O4S A;  2YKU A;  3EIB A;  3EI6 A;  4U2H A;  1AKB A;  4WLH A;  4ZSY A;  5FT8 A;  3E77 A;  2R0T A;  1D7S A;  3FVU A;  3H14 A;  3HLM A;  3OKS A;  2VLH A;  3R4T A;  1QGN A;  3DXV A;  4RIT A;  1PFF A;  3NUI A;  4ZAH A;  2QB3 A;  1CL1 A;  4B98 A;  3BS8 A;  1LW5 A;  3FD0 A;  4AZK A;  2R5E A;  1Z3Z A;  1J04 A;  2Z9W A;  3W1J A;  1ASE A;  5EIG B;  3EI7 A;  2AY9 A;  3TAT A;  4F5G A;  1DTY A;  4TMR A;  3BV0 A;  2YOB A;  4WP0 A;  3VK3 A;  3NYS A;  2D5Y A;  1AMS A;  2D63 A;  2VGT A;  3L8A A;  2DR1 A;  3FQA A;  1DJU A;  3QN6 A;  2BWN A;  4AO9 A;  4BHD A;  2DKB A;  4A6R A;  4RAE A;  1WKG A;  2EPJ A;  3MEB A;  4MKJ A;  1AHX A;  2O1B A;  2R5C B;  3WKR A;  1IBJ A;  3H7F A;  1OHW A;  3KGX A;  3ZZK A;  2VMX A;  1AJS B;  2CB1 A;  4L0O A;  2BWP A;  2BIE A;  3WCN A;  3JZL A;  3JWB A;  1ART A;  3AEL A;  2VMZ A;  1EG5 A;  3AAT A;  3G7Q A;  3PAA A;  4Q6R A;  2HOX A;  3FCR A;  3W1I A;  1ASD A;  1M0P A;  2C0R A;  3GZD C;  1CQ7 A;  1TOE A;  2VMS A;  1TOG A;  1S08 A;  3AEP A;  4CXR A;  4AOA A;  2ZYJ A;  2AY6 A;  4ITG A;  1AX4 A;  2CTZ A;  2BI9 A;  1GC3 A;  2X5D A;  3M5U A;  1GEY A;  3DR4 A;  4E3Q A;  3A9X A;  3FRK A;  4JF0 A;  2QLR A;  2W7D A;  3B1C A;  4U1T A;  1AAM A;  2EGY A;  4K2M A;  3PIU A;  1LC5 A;  4WYF A;  2VI8 A;  1XI9 A;  4Q75 A;  1M4N A;  4FFC A;  1XEY A;  2DKJ A;  2HUI A;  2OKK A;  4R2N A;  1T3I A;  1AKC A;  2V0Y A;  3IF2 A;  2DGM A;  1B5P A;  1C9C A;  3WLX A;  1LC7 A;  1D7R A;  2Z9X A;  3NYU A;  1MLY A;  2Z1Y A;  3QM2 A;  2W7K A;  1GCK A;  1W3U A;  2DGL A;  2FNU A;  3PPL A;  4WD2 A;  2QBT A;  2YKY A;  3PDB B;  4GSA A;  1LS3 A;  3GZC A;  3HDO A;  4WYC A;  1Z7D A;  1V2F A;  4LNJ A;  1KMJ A;  1CZE A;  1WYV A;  1OXO A;  1X28 A;  2FN6 A;  4JEW A;  2W7J A;  2W7E A;  5EIG A;  3NTJ A;  1GC2 A;  1M7Y A;  3QBO A;  4A0R A;  4CBS A;  3ATH A;  4ADE A;  2Z67 A;  3FVX A;  4JE5 A;  1TPL A;  3T32 A;  2BI1 A;  2CST A;  4IYO A;  4LW2 A;  2ZP7 A;  3EI9 A;  4LW4 A;  3EZ1 A;  1OHV A;  3I5T A;  2NMP A;  1D7V A;  1AIC A;  1PMM A;  1X2A A;  2VMQ A;  3N5M A;  4ZLV A;  3DU4 A;  2R5C A;  4WYG A;  4JE5 D;  1MLZ A;  2VGV A;  4MQR A;  2BYJ A;  8AAT A;  1CS1 A;  3PGY A;  3FTB A;  1TOJ A;  5G2Q A;  1BJO A;  3R9A A;  1AIA A;  2VMY A;  1ZC9 A;  3FVS A;  2W8V A;  3JWA A;  1M0Q A;  2AY7 A;  2HOY A;  3RQ1 A;  2BIG A;  3AEO A;  3NU7 A;  4WBT A;  3FDD A;  2VMN A;  3LY1 A;  1BS0 A;  4FL0 A;  3EI5 A;  4ADB A;  4WB0 B;  4EMY A;  3E2Y A;  2E54 A;  1SF2 A;  3KE3 A;  3DC1 A;  1C0N A;  4Y0H A;  1ASL A;  1OXP A;  1EQB A;  1SZU A;  1V2E A;  3BWO A;  4QGR A;  3UWC A;  1ELQ A;  3VK4 A;  4IX8 A;  4ZDL A;  5LHA A;  1E5F A;  2BKW A;  2OAT A;  4MGR A;  1IJI A;  1O61 A;  1V2D A;  1BJO B;  1I43 A;  4B9B A;  1O69 A;  1DKA A;  4E3R A;  3HQT A;  2PB2 A;  1TAS A;  3E9K A;  4F5F A;  5LH9 A;  1BJ4 A;  2HUF A;  1BJW A;  3CQ4 A;  2W8W A;  4BMK A;  3MAU A;  3WGC A;  1V72 A;  3KKI A;  3G0T A;  4Q76 A;  1W7L A;  3GZD A;  4OBU A;  4RLG A;  3VAX A;  1GC4 A;  4Y0I A;  3MC6 C;  1S09 A;  1ZOD A;  4MQP A;  1WYV B;  1SZK A;  3ISL A;  3LVL B;  2JJH A;  3FQ8 A;  2DOU A;  4JEX A;  3WX9 A;  5EAV A;  4A0G A;  4RKC A;  4A0H A;  1AMA A;  1C4K A;  3BCA A;  3CBF A;  2OGA A;  3COG A;  4M2M A;  4XK1 A;  5D5S A;  2BWO A;  3RBL A;  1IAY A;  3WGB A;  1N2T A;  5E5I A;  2YHK A;  2W8T A;  3G8M A;  2YRR A;  1G7W A;  2OGE A;  2ZY2 A;  4CVQ A;  4EB7 A;  2JJF A;  3Q8N A;  1YNU A;  1G4V A;  4I8A A;  4ZDP A;  2E7J A;  5EUN A;  2E7U A;  3HVY A;  2VGU A;  4PIW A;  4HVK A;  1MGV A;  1ELU A;  1WKH A;  1B8G A;  1S06 A;  2ZY3 A;  1TAT A;  1O62 A;  3EZS A;  3BB8 A;  3EI8 A;  1X0M A;  2Z9V A;  3MAD A;  4F5H A;  3TFT A;  2BHX A;  4KXK A;  3K28 A;  3FKD A;  2WK7 A;  1AJR A;  3DR7 A;  4UQV A;  2W7F A;  5DB5 A;  2VMW A;  4F5I A;  2BYL A;  3GWP A;  1UU0 A;  4XJM A;  2JGT A;  4KAM A;  3ASA A;  4WB0 A;  1IVR A;  2EH6 A;  5E3K A;  4W1V A;  2OKJ A;  3FSL A;  3OP7 A;  4IXO A;  2AAT A;  2VMO A;  4WXB A;  2G6W A;  4JEV A;  1GD9 A;  1RVU A;  1JF9 A;  3K7Y A;  4E1O A;  1M32 A;  4OT8 A;  1ASB A;  2JJE A;  1B5O A;  1DGD A;  2D7Z A;  2VIA A;  3RI6 A;  3N75 A;  1WST A;  1GEW A;  3N0L A;  3FQ7 A;  3GR9 A;  3F0H A;  3DXW A;  9AAT A;  2W7G A;  5JAY A;  2GSA A;  4DGT A;  2QB2 A;  4XJO A;  1KL1 A;  4HF8 A;  4P7Y A;  1RVY A;  2VI9 A;  3HMU A;  3A9Z A;  3JTX A;  1QIS A;  3HL2 A;  3B46 A;  1MAQ A;  2VMT A;  3USF A;  1P3W A;  2PB0 A;  2WKA A;  2AY5 A;  3A8U X;  3IHJ A;  2C81 A;  4GE9 A;  1OHY A;  4IXZ A;  4MKK A;  3WZF A;  1IX8 A;  3TQX A;  5DJ1 A;  3NUB A;  3PDB A;  1SPA A;  3I16 A;  1UU2 A;  3FZ8 A;  3B1E A;  2ZY5 A;  4AO4 A;  3UAK A;  1MDO A;  3KGW A;  3MBB A;  2Z20 A;  1H1C A;  3FZ6 A;  5IWQ A;  2FYF A;  1WYT B;  1BKG A;  1ARI A;  7AAT A;  2CJG A;  3NU8 A;  3BWN A;  1BQA A;  1C7N A;  4IY7 A;  4JEZ A;  4Q31 A;  4TV7 A;  1I29 A;  2HP1 A;  4MSO A;  3LVK A;  3BWN C;  3VOM A;  1G4X A;  1DJE A;  1BT4 A;  4GDY A;  4R5F A;  1YAA A;  2VGS A;  4W91 A;  2ZY4 A;  1CQ6 A;  1QJ3 A;  2FQ6 A;  3LG0 A;  2BI5 A;  4RM1 A;  4F5L A;  1ZOB A;  3MKJ A;  5EQC A;  4DQ6 A;  5FT5 A;  5HHY A;  1H0C A;  1MDZ A;  1KMK A;  2O0R A;  3ASB A;  3QI6 A;  4M2J A;  1UKJ A;  1D7U A;  2ORD A;  3D6K A;  3ELP A;  1QIR A;  4AZJ A;  3B8X A;  3JU7 A;  1CL2 A;  1VP4 A;  3E2F A;  3PDX A;  1PMO A;  4WXF A;  2W7H A;  3A2B A;  3RBF A;  4UHM A;  1GEX A;  1SVV A;  1C7G A;  1YJY A;  5HDM A;  1AHF A;  2CY8 A;  5K8B A;  4OCA A;  5EUE A;  3WY7 A;  4E77 A;  5C6U A;  4XAU A;  2D64 A;  4ZWM A;  2Q7W A;  2RFV A;  4PFN A;  2W7M A;  1ASM A;  2BI2 A;  5E4Z A;  4K2I A;  4OTL A;  5G4J A;  2WK9 A;  3AEJ C;  5M49 A;  2HP2 A;  3FDB A;  2VIB A;  2O7C A;  4IYO B;  2JG2 A;  3RCH B;  3PD6 A;  1E5E A;  1QZ9 A;  4OBV A;  1OAT A;  1ARH A;  2HZP A;  1TAR A;  4F5K A;  1MDX A;  3AEM C;  5G2P A;  4EB5 A;  1ECX A;  2EO5 A;  2EZ2 A;  1IAX A;  4M2K A;  1AHE A;  4ATQ A;  2WK8 A;  4K2B A;  3I4J A;  4R5Z A;  1B4X A;  4GRX A;  5HXX A;  4EFF A;  1DGE A;  3PA9 A;  4NOG A;  4GE4 A;  4ADC A;  5BJ4 A;  2HOR A;  2CH2 A;  2CH1 A;  1WYT A;  2F8J A;  1RV3 A;  4MQQ A;  2VLF A;  2D7Y A;  1B9H A;  3P6K A;  4A6T A;  3LWS A;  1Y4I A;  4W1W A;  3PD6 B;  1YOO A;  4ZWV A;  3F6T A;  4A0F A;  1QJ5 A;  1JS3 A;  3E2Z A;  5TF5 A;  1ARS A;  2JIS A;  1LW4 A;  2DGK A;  2ZUK A;  4CBR A;  1PG8 A;  2YKX A;  1AHY A;  2GB3 A;  3HT4 A;  5FT4 A;  2ZSL A;  4WYE A;  2CJH A;  1AJS A;  2D65 A;  4H51 A;  4IXS A;  2BI3 A;  4LC3 A;  3W1H A;  3NYT A;  1AKA A;  4ITX A;  2X8U A;  3ZRQ A;  4TN4 A;  5M46 A;  2Z1Z A;  1AIB A;  1YIY A;  3GET A;  4ZM3 A;  1CJ0 A;  3DZZ A;  1M6S A;  1G7X A;  2FM1 A;  1YIZ A;  3QHX A;  5I92 A;  2VGW A;  3RUY A;  4O6Z A;  4OC9 A;  1JG8 A;  3WKS A;  1VEF A;  2BIA A;  3II0 A;  4BA4 A;  1BQD A;  4A00 A;  1W7N A;  4RJY A;  1BJN A;  3GJU A;  2FNI A;  3BCB A;  1ASA A;  1ARG A;  3E6G A;  3NNK A;  4XJP A;  1BW0 A;  2HUU A;  3CAI A;  5EFS A;  2R2N A;  3BCX A;  2EZ1 A;  3TCM A;  1SFF A;  2CFB A;  2CAN A;  1ASF A;  1IUG A;  3FZ7 A;  4AH3 A;  2VYC A;  1AY4 A;  2JJG A;  2Z9U A;  4N0W A;  4J5U A;  3TFU A;  3QPG A;  3P1T A;  4ZM4 A;  1DJ9 A;  2ZSM A;  5G0A A;  3VP6 A;  3BN1 A;  1D2F A;  3A9Y A;  1ORD A;  2C7T A;  4F5J A;  3DYD A;  3CQ5 A;  2AEU A;  3F9T A;  3ECD A;  2C44 A;  1AY8 A;  1X29 A;  5G09 A;  4F4E A;  4XQ2 A;  1TOK A;  5FT6 A;  4CXQ A;  3AEN A;  1AAW A;  1N31 A;  1S0A A;  1WYU B;  3L44 A;  4RKD A;  2AY8 A;  1ASG A;  1FC4 A;  4P3M A;  1J32 A;  1B9I A;  1FG7 A;  1GC0 A;  2CIN A;  2YRI A;  5G4I A;  2GMS A;  3HBX A;  5EUD A;  1LKC A; 
#chains in the Genus database with same CATH topology
 4GE7 A;  1QIT A;  2VMV A;  4WXG A;  4ZAS A;  1I48 A;  1ASN A;  1LC8 A;  3DRD A;  1KKJ A;  1M0N A;  2W8U A;  1DFO A;  3AEJ A;  3FFR A;  3NDN A;  2YCP A;  5F8V A;  1S07 A;  4PVF A;  4ATP A;  2XBN A;  1ASC A;  2YCN A;  4GEB A;  1N8P A;  4BA5 A;  3LV2 A;  4RJ0 A;  2GQN A;  4UHN A;  1WYU A;  3FFH A;  3ZZJ A;  4XJL A;  2YKV A;  3JW9 A;  3DOD A;  1TOI A;  1FG3 A;  1CZC A;  1AY5 A;  4J8L A;  2GMU A;  2X5F A;  2AEV A;  3GBX A;  4W8I A;  5AX8 A;  3WCO A;  1C7O A;  1GDE A;  2W8J A;  3MAF A;  2AY2 A;  2WB6 A;  1IX7 A;  1KL2 A;  3EUC A;  4ISY A;  4W5K A;  1U08 A;  3NX3 A;  4A72 A;  4DBC A;  3QGU A;  2TPL A;  3AV7 A;  1LK9 A;  2AY4 A;  5DX5 A;  3UE8 A;  1RV4 A;  5EAA A;  2HOZ A;  5F9S A;  2VMR A;  4UHO A;  1I41 A;  3AOV A;  1KKP A;  3ZRR A;  2VGZ A;  4OYT A;  1CQ8 A;  1AHG A;  4JF1 A;  1SZS A;  3ACZ A;  2QMA A;  3EIA A;  3NRA A;  4R8D A;  1JS6 A;  4EU1 A;  4JEY A;  2D66 A;  3VK2 A;  3ZRP A;  4BQ0 A;  4PFF A;  1VJO A;  3PJ0 A;  3MAF B;  2ZJG A;  1W7M A;  2ZC0 A;  4W1X A;  4IW7 A;  4WYD A;  4F5M A;  1MAP A;  3LVJ A;  2OQX A;  5DJ9 A;  4MY5 A;  2V1P A;  2X3L A;  2VMU A;  3GSB A;  5M4D A;  3AEN B;  2CJD A;  4WYA A;  2E7I A;  4ZSW A;  2EYQ A;  3K40 A;  1IX6 A;  4ADD A;  4RIZ A;  4A6U A;  1EJI A;  3LVM A;  4KYO A;  5D95 A;  2W7I A;  4OMA A;  4LNM A;  3AEM A;  2VMP A;  1GBN A;  5BJ3 A;  1W23 A;  3CQ6 A;  3ELE A;  1M0O A;  3E2Z B;  1AMR A;  4Y0D A;  3BC8 A;  2YCT A;  2AY3 A;  1UU1 A;  3AOW A;  1YJS A;  1AMQ A;  2XH1 A;  4N0B A;  4UOY A;  4ZDO A;  2W7L A;  4LNL A;  2PO3 A;  2QA3 A;  2D61 A;  2Z61 A;  3N7N A;  2AY1 A;  5J8Q A;  3MC6 A;  3RCH A;  3B1D A;  5M4B A;  1YJZ A;  4WLJ A;  4XEW A;  1O4S A;  2YKU A;  3EIB A;  3EI6 A;  4U2H A;  1AKB A;  4WLH A;  4ZSY A;  5FT8 A;  3E77 A;  2R0T A;  1D7S A;  3FVU A;  3H14 A;  3HLM A;  3OKS A;  2VLH A;  3R4T A;  1QGN A;  3DXV A;  4RIT A;  1PFF A;  3NUI A;  4ZAH A;  2QB3 A;  1CL1 A;  4B98 A;  3BS8 A;  4K05 A;  1LW5 A;  3FD0 A;  4AZK A;  2R5E A;  1Z3Z A;  1J04 A;  2Z9W A;  3W1J A;  1ASE A;  5EIG B;  3EI7 A;  2AY9 A;  3TAT A;  4F5G A;  1DTY A;  4TMR A;  3BV0 A;  2YOB A;  4WP0 A;  3VK3 A;  3NYS A;  2D5Y A;  1AMS A;  2D63 A;  2VGT A;  3L8A A;  2DR1 A;  3FQA A;  1DJU A;  3QN6 A;  2BWN A;  4AO9 A;  4BHD A;  2DKB A;  4A6R A;  4RAE A;  1WKG A;  2FKI A;  2EPJ A;  3MEB A;  4MKJ A;  1AHX A;  2QSR A;  2O1B A;  2R5C B;  3WKR A;  3N4S A;  1IBJ A;  3H7F A;  1OHW A;  3N4R A;  3KGX A;  3ZZK A;  2VMX A;  1AJS B;  2CB1 A;  4L0O A;  2BWP A;  2BIE A;  3WCN A;  3JZL A;  3JWB A;  1ART A;  3AEL A;  2VMZ A;  1EG5 A;  3AAT A;  3G7Q A;  3PAA A;  4Q6R A;  2HOX A;  3FCR A;  3W1I A;  1ASD A;  1M0P A;  2C0R A;  3GZD C;  1CQ7 A;  1TOE A;  2VMS A;  1TOG A;  1S08 A;  3AEP A;  4CXR A;  4AOA A;  2ZYJ A;  2AY6 A;  3N4X A;  4ITG A;  1AX4 A;  2CTZ A;  2BI9 A;  1GC3 A;  2X5D A;  3M5U A;  1GEY A;  3DR4 A;  4E3Q A;  3A9X A;  3FRK A;  4JF0 A;  2QLR A;  2W7D A;  3B1C A;  4U1T A;  1AAM A;  2EGY A;  4K2M A;  3PIU A;  1LC5 A;  4WYF A;  2VI8 A;  1XI9 A;  4Q75 A;  1M4N A;  4FFC A;  1XEY A;  2DKJ A;  2HUI A;  2OKK A;  4R2N A;  1T3I A;  1AKC A;  2V0Y A;  3IF2 A;  2DGM A;  1B5P A;  1C9C A;  3WLX A;  1LC7 A;  1D7R A;  2Z9X A;  3NYU A;  1MLY A;  2Z1Y A;  3QM2 A;  2W7K A;  1GCK A;  1W3U A;  2DGL A;  2FNU A;  3PPL A;  4WD2 A;  2QBT A;  2YKY A;  3PDB B;  4GSA A;  1LS3 A;  3GZC A;  3HDO A;  4WYC A;  1Z7D A;  1V2F A;  4LNJ A;  1KMJ A;  1CZE A;  1WYV A;  1OXO A;  1X28 A;  2FN6 A;  4JEW A;  2W7J A;  2W7E A;  5EIG A;  3NTJ A;  1GC2 A;  1M7Y A;  3QBO A;  4A0R A;  4CBS A;  3ATH A;  4ADE A;  2Z67 A;  3FVX A;  4JE5 A;  1TPL A;  3T32 A;  2BI1 A;  2CST A;  4IYO A;  4LW2 A;  2ZP7 A;  3EI9 A;  4LW4 A;  3EZ1 A;  1OHV A;  3I5T A;  2NMP A;  1D7V A;  1AIC A;  1PMM A;  1X2A A;  2VMQ A;  3N5M A;  4ZLV A;  3DU4 A;  2R5C A;  4WYG A;  4JE5 D;  1MLZ A;  2VGV A;  4MQR A;  2BYJ A;  8AAT A;  1CS1 A;  3PGY A;  3FTB A;  1TOJ A;  5G2Q A;  1BJO A;  3R9A A;  1AIA A;  2VMY A;  1ZC9 A;  3FVS A;  2W8V A;  3JWA A;  1M0Q A;  2AY7 A;  2HOY A;  3RQ1 A;  2BIG A;  3AEO A;  3NU7 A;  4WBT A;  3FDD A;  2VMN A;  3LY1 A;  1BS0 A;  4FL0 A;  3EI5 A;  4ADB A;  4WB0 B;  4EMY A;  3E2Y A;  2E54 A;  1SF2 A;  3KE3 A;  3DC1 A;  1C0N A;  4Y0H A;  1ASL A;  1OXP A;  1EQB A;  1SZU A;  1V2E A;  3BWO A;  4QGR A;  2KFP A;  3UWC A;  1ELQ A;  3VK4 A;  4IX8 A;  4ZDL A;  5LHA A;  1E5F A;  2BKW A;  2OAT A;  4MGR A;  1IJI A;  1O61 A;  1V2D A;  1BJO B;  1I43 A;  4B9B A;  1O69 A;  1DKA A;  4E3R A;  3HQT A;  2PB2 A;  1TAS A;  3E9K A;  4F5F A;  5LH9 A;  1BJ4 A;  2HUF A;  1BJW A;  3CQ4 A;  2W8W A;  4BMK A;  3MAU A;  3WGC A;  1V72 A;  3KKI A;  3G0T A;  4Q76 A;  1W7L A;  3GZD A;  4OBU A;  4RLG A;  3VAX A;  1GC4 A;  4Y0I A;  3MC6 C;  2A1V A;  1S09 A;  1ZOD A;  4MQP A;  1WYV B;  1SZK A;  3ISL A;  3LVL B;  2JJH A;  3FQ8 A;  2DOU A;  4JEX A;  3WX9 A;  5EAV A;  4A0G A;  4RKC A;  4A0H A;  1AMA A;  1C4K A;  3BCA A;  3CBF A;  2OGA A;  3COG A;  4M2M A;  4XK1 A;  5D5S A;  2BWO A;  3RBL A;  1IAY A;  3WGB A;  1N2T A;  5E5I A;  2YHK A;  2W8T A;  3G8M A;  2YRR A;  1G7W A;  2OGE A;  2ZY2 A;  4CVQ A;  4EB7 A;  2JJF A;  3Q8N A;  1YNU A;  4H63 Q;  1G4V A;  4I8A A;  4ZDP A;  2E7J A;  5EUN A;  2E7U A;  3HVY A;  2VGU A;  4PIW A;  4HVK A;  1MGV A;  1ELU A;  1WKH A;  1B8G A;  1S06 A;  2ZY3 A;  1TAT A;  1O62 A;  3EZS A;  3BB8 A;  3EI8 A;  1X0M A;  2Z9V A;  3MAD A;  4F5H A;  3TFT A;  2BHX A;  4KXK A;  3K28 A;  3FKD A;  2WK7 A;  1AJR A;  3DR7 A;  4UQV A;  2W7F A;  5DB5 A;  2VMW A;  4F5I A;  2BYL A;  3GWP A;  1UU0 A;  4XJM A;  2JGT A;  4KAM A;  3ASA A;  4WB0 A;  1IVR A;  2EH6 A;  5E3K A;  4W1V A;  2OKJ A;  3FSL A;  3OP7 A;  4IXO A;  2AAT A;  2VMO A;  4WXB A;  2G6W A;  4JEV A;  1GD9 A;  1RVU A;  1JF9 A;  3K7Y A;  4E1O A;  1M32 A;  4OT8 A;  1ASB A;  2JJE A;  1B5O A;  1DGD A;  2D7Z A;  2VIA A;  3RI6 A;  3N75 A;  1WST A;  1GEW A;  3N0L A;  3FQ7 A;  3GR9 A;  3F0H A;  3DXW A;  9AAT A;  2W7G A;  5JAY A;  2GSA A;  4DGT A;  2QB2 A;  4XJO A;  1KL1 A;  4HF8 A;  4P7Y A;  1RVY A;  2VI9 A;  3HMU A;  3A9Z A;  3JTX A;  1QIS A;  3HL2 A;  3B46 A;  1MAQ A;  2VMT A;  3USF A;  1P3W A;  2PB0 A;  2WKA A;  2AY5 A;  3A8U X;  3IHJ A;  2C81 A;  4GE9 A;  1OHY A;  4IXZ A;  4MKK A;  3WZF A;  1IX8 A;  3TQX A;  5DJ1 A;  3NUB A;  3PDB A;  1SPA A;  1KAF A;  3I16 A;  1UU2 A;  3FZ8 A;  3B1E A;  2ZY5 A;  4AO4 A;  3UAK A;  1MDO A;  3KGW A;  3MBB A;  2Z20 A;  1H1C A;  3FZ6 A;  5IWQ A;  2FYF A;  1WYT B;  1BKG A;  1ARI A;  7AAT A;  2CJG A;  3NU8 A;  3BWN A;  1BQA A;  1C7N A;  4IY7 A;  4JEZ A;  4Q31 A;  4TV7 A;  1I29 A;  2HP1 A;  4MSO A;  3LVK A;  3BWN C;  3VOM A;  1G4X A;  1DJE A;  1BT4 A;  4GDY A;  4R5F A;  1YAA A;  2VGS A;  4W91 A;  2ZY4 A;  1CQ6 A;  1QJ3 A;  2FQ6 A;  3LG0 A;  2BI5 A;  4RM1 A;  4F5L A;  5KTB A;  1ZOB A;  3MKJ A;  5EQC A;  4DQ6 A;  5FT5 A;  5HHY A;  1H0C A;  1MDZ A;  1KMK A;  2O0R A;  3ASB A;  3QI6 A;  4M2J A;  1UKJ A;  1D7U A;  2ORD A;  3D6K A;  3ELP A;  1QIR A;  4AZJ A;  3B8X A;  3JU7 A;  1CL2 A;  1VP4 A;  3E2F A;  3PDX A;  1PMO A;  4WXF A;  2W7H A;  3A2B A;  3RBF A;  4UHM A;  1GEX A;  1SVV A;  1C7G A;  1YJY A;  5HDM A;  1AHF A;  2CY8 A;  5K8B A;  4OCA A;  5EUE A;  3WY7 A;  4E77 A;  5C6U A;  4XAU A;  2D64 A;  4ZWM A;  2Q7W A;  2RFV A;  4PFN A;  2W7M A;  1ASM A;  2BI2 A;  5E4Z A;  4K2I A;  4OTL A;  5G4J A;  2WK9 A;  3H9X A;  3AEJ C;  5M49 A;  2HP2 A;  3FDB A;  2VIB A;  2O7C A;  4IYO B;  2JG2 A;  3RCH B;  3PD6 A;  1E5E A;  1QZ9 A;  4OBV A;  1OAT A;  1ARH A;  2HZP A;  1TAR A;  4F5K A;  1MDX A;  3AEM C;  5G2P A;  4EB5 A;  1ECX A;  2EO5 A;  2EZ2 A;  1IAX A;  4M2K A;  1AHE A;  4ATQ A;  2WK8 A;  4K2B A;  3I4J A;  4R5Z A;  1B4X A;  4GRX A;  5HXX A;  4EFF A;  1DGE A;  3PA9 A;  4NOG A;  4GE4 A;  4ADC A;  5BJ4 A;  2HOR A;  2CH2 A;  2CH1 A;  1WYT A;  2F8J A;  1RV3 A;  4MQQ A;  2VLF A;  2D7Y A;  1B9H A;  3P6K A;  4A6T A;  3LWS A;  1Y4I A;  4W1W A;  3PD6 B;  1YOO A;  4ZWV A;  3F6T A;  4A0F A;  1QJ5 A;  1JS3 A;  3E2Z A;  5TF5 A;  1ARS A;  2JIS A;  1LW4 A;  2DGK A;  2ZUK A;  4CBR A;  1PG8 A;  2YKX A;  2G7J A;  1AHY A;  2GB3 A;  3HT4 A;  5FT4 A;  2ZSL A;  4WYE A;  2CJH A;  1AJS A;  2D65 A;  4H51 A;  4IXS A;  2BI3 A;  4LC3 A;  3W1H A;  3NYT A;  1AKA A;  4ITX A;  2X8U A;  3ZRQ A;  4TN4 A;  5M46 A;  2Z1Z A;  1AIB A;  1YIY A;  3GET A;  4ZM3 A;  1CJ0 A;  3DZZ A;  1M6S A;  1G7X A;  2FM1 A;  1YIZ A;  3QHX A;  5I92 A;  2VGW A;  3RUY A;  4O6Z A;  4OC9 A;  1JG8 A;  3WKS A;  1VEF A;  2BIA A;  3II0 A;  4BA4 A;  1BQD A;  4A00 A;  1W7N A;  4RJY A;  1BJN A;  3GJU A;  2FNI A;  3BCB A;  1ASA A;  1ARG A;  3E6G A;  3NNK A;  4XJP A;  1BW0 A;  2HUU A;  3CAI A;  5EFS A;  2R2N A;  3BCX A;  2EZ1 A;  3TCM A;  1SFF A;  2CFB A;  2CAN A;  1ASF A;  1IUG A;  3FZ7 A;  4AH3 A;  2VYC A;  1AY4 A;  2JJG A;  2Z9U A;  4N0W A;  4J5U A;  3TFU A;  3QPG A;  3P1T A;  4ZM4 A;  1DJ9 A;  2ZSM A;  5G0A A;  3VP6 A;  3BN1 A;  1D2F A;  3A9Y A;  1ORD A;  2C7T A;  4F5J A;  3DYD A;  3CQ5 A;  2AEU A;  3F9T A;  3ECD A;  2C44 A;  1AY8 A;  1X29 A;  5G09 A;  4F4E A;  4XQ2 A;  1TOK A;  5FT6 A;  4CXQ A;  3AEN A;  1AAW A;  1N31 A;  1S0A A;  1WYU B;  3L44 A;  4RKD A;  2AY8 A;  1ASG A;  1FC4 A;  4P3M A;  1J32 A;  1B9I A;  1FG7 A;  1GC0 A;  2CIN A;  2YRI A;  5G4I A;  2GMS A;  3HBX A;  5EUD A;  1LKC A; 
#chains in the Genus database with same CATH homology
 4GE7 A;  1QIT A;  2VMV A;  4WXG A;  4ZAS A;  1I48 A;  1ASN A;  1LC8 A;  3DRD A;  1KKJ A;  1M0N A;  2W8U A;  1DFO A;  3AEJ A;  3FFR A;  3NDN A;  2YCP A;  5F8V A;  1S07 A;  4PVF A;  4ATP A;  2XBN A;  1ASC A;  2YCN A;  4GEB A;  1N8P A;  4BA5 A;  3LV2 A;  4RJ0 A;  2GQN A;  4UHN A;  1WYU A;  3FFH A;  3ZZJ A;  4XJL A;  2YKV A;  3JW9 A;  3DOD A;  1TOI A;  1FG3 A;  1CZC A;  1AY5 A;  4J8L A;  2GMU A;  2X5F A;  2AEV A;  3GBX A;  4W8I A;  5AX8 A;  3WCO A;  1C7O A;  1GDE A;  2W8J A;  3MAF A;  2AY2 A;  2WB6 A;  1IX7 A;  1KL2 A;  3EUC A;  4ISY A;  4W5K A;  1U08 A;  3NX3 A;  4A72 A;  4DBC A;  3QGU A;  2TPL A;  3AV7 A;  1LK9 A;  2AY4 A;  5DX5 A;  3UE8 A;  1RV4 A;  5EAA A;  2HOZ A;  5F9S A;  2VMR A;  4UHO A;  1I41 A;  3AOV A;  1KKP A;  3ZRR A;  2VGZ A;  4OYT A;  1CQ8 A;  1AHG A;  4JF1 A;  1SZS A;  3ACZ A;  2QMA A;  3EIA A;  3NRA A;  4R8D A;  1JS6 A;  4EU1 A;  4JEY A;  2D66 A;  3VK2 A;  3ZRP A;  4BQ0 A;  4PFF A;  1VJO A;  3PJ0 A;  3MAF B;  2ZJG A;  1W7M A;  2ZC0 A;  4W1X A;  4IW7 A;  4WYD A;  4F5M A;  1MAP A;  3LVJ A;  2OQX A;  5DJ9 A;  4MY5 A;  2V1P A;  2X3L A;  2VMU A;  3GSB A;  5M4D A;  3AEN B;  2CJD A;  4WYA A;  2E7I A;  4ZSW A;  2EYQ A;  3K40 A;  1IX6 A;  4ADD A;  4RIZ A;  4A6U A;  1EJI A;  3LVM A;  4KYO A;  5D95 A;  2W7I A;  4OMA A;  4LNM A;  3AEM A;  2VMP A;  1GBN A;  5BJ3 A;  1W23 A;  3CQ6 A;  3ELE A;  1M0O A;  3E2Z B;  1AMR A;  4Y0D A;  3BC8 A;  2YCT A;  2AY3 A;  1UU1 A;  3AOW A;  1YJS A;  1AMQ A;  2XH1 A;  4N0B A;  4UOY A;  4ZDO A;  2W7L A;  4LNL A;  2PO3 A;  2QA3 A;  2D61 A;  2Z61 A;  3N7N A;  2AY1 A;  5J8Q A;  3MC6 A;  3RCH A;  3B1D A;  5M4B A;  1YJZ A;  4WLJ A;  4XEW A;  1O4S A;  2YKU A;  3EIB A;  3EI6 A;  4U2H A;  1AKB A;  4WLH A;  4ZSY A;  5FT8 A;  3E77 A;  2R0T A;  1D7S A;  3FVU A;  3H14 A;  3HLM A;  3OKS A;  2VLH A;  3R4T A;  1QGN A;  3DXV A;  4RIT A;  1PFF A;  3NUI A;  4ZAH A;  2QB3 A;  1CL1 A;  4B98 A;  3BS8 A;  4K05 A;  1LW5 A;  3FD0 A;  4AZK A;  2R5E A;  1Z3Z A;  1J04 A;  2Z9W A;  3W1J A;  1ASE A;  5EIG B;  3EI7 A;  2AY9 A;  3TAT A;  4F5G A;  1DTY A;  4TMR A;  3BV0 A;  2YOB A;  4WP0 A;  3VK3 A;  3NYS A;  2D5Y A;  1AMS A;  2D63 A;  2VGT A;  3L8A A;  2DR1 A;  3FQA A;  1DJU A;  3QN6 A;  2BWN A;  4AO9 A;  4BHD A;  2DKB A;  4A6R A;  4RAE A;  1WKG A;  2FKI A;  2EPJ A;  3MEB A;  4MKJ A;  1AHX A;  2QSR A;  2O1B A;  2R5C B;  3WKR A;  3N4S A;  1IBJ A;  3H7F A;  1OHW A;  3N4R A;  3KGX A;  3ZZK A;  2VMX A;  1AJS B;  2CB1 A;  4L0O A;  2BWP A;  2BIE A;  3WCN A;  3JZL A;  3JWB A;  1ART A;  3AEL A;  2VMZ A;  1EG5 A;  3AAT A;  3G7Q A;  3PAA A;  4Q6R A;  2HOX A;  3FCR A;  3W1I A;  1ASD A;  1M0P A;  2C0R A;  3GZD C;  1CQ7 A;  1TOE A;  2VMS A;  1TOG A;  1S08 A;  3AEP A;  4CXR A;  4AOA A;  2ZYJ A;  2AY6 A;  3N4X A;  4ITG A;  1AX4 A;  2CTZ A;  2BI9 A;  1GC3 A;  2X5D A;  3M5U A;  1GEY A;  3DR4 A;  4E3Q A;  3A9X A;  3FRK A;  4JF0 A;  2QLR A;  2W7D A;  3B1C A;  4U1T A;  1AAM A;  2EGY A;  4K2M A;  3PIU A;  1LC5 A;  4WYF A;  2VI8 A;  1XI9 A;  4Q75 A;  1M4N A;  4FFC A;  1XEY A;  2DKJ A;  2HUI A;  2OKK A;  4R2N A;  1T3I A;  1AKC A;  2V0Y A;  3IF2 A;  2DGM A;  1B5P A;  1C9C A;  3WLX A;  1LC7 A;  1D7R A;  2Z9X A;  3NYU A;  1MLY A;  2Z1Y A;  3QM2 A;  2W7K A;  1GCK A;  1W3U A;  2DGL A;  2FNU A;  3PPL A;  4WD2 A;  2QBT A;  2YKY A;  3PDB B;  4GSA A;  1LS3 A;  3GZC A;  3HDO A;  4WYC A;  1Z7D A;  1V2F A;  4LNJ A;  1KMJ A;  1CZE A;  1WYV A;  1OXO A;  1X28 A;  2FN6 A;  4JEW A;  2W7J A;  2W7E A;  5EIG A;  3NTJ A;  1GC2 A;  1M7Y A;  3QBO A;  4A0R A;  4CBS A;  3ATH A;  4ADE A;  2Z67 A;  3FVX A;  4JE5 A;  1TPL A;  3T32 A;  2BI1 A;  2CST A;  4IYO A;  4LW2 A;  2ZP7 A;  3EI9 A;  4LW4 A;  3EZ1 A;  1OHV A;  3I5T A;  2NMP A;  1D7V A;  1AIC A;  1PMM A;  1X2A A;  2VMQ A;  3N5M A;  4ZLV A;  3DU4 A;  2R5C A;  4WYG A;  4JE5 D;  1MLZ A;  2VGV A;  4MQR A;  2BYJ A;  8AAT A;  1CS1 A;  3PGY A;  3FTB A;  1TOJ A;  5G2Q A;  1BJO A;  3R9A A;  1AIA A;  2VMY A;  1ZC9 A;  3FVS A;  2W8V A;  3JWA A;  1M0Q A;  2AY7 A;  2HOY A;  3RQ1 A;  2BIG A;  3AEO A;  3NU7 A;  4WBT A;  3FDD A;  2VMN A;  3LY1 A;  1BS0 A;  4FL0 A;  3EI5 A;  4ADB A;  4WB0 B;  4EMY A;  3E2Y A;  2E54 A;  1SF2 A;  3KE3 A;  3DC1 A;  1C0N A;  4Y0H A;  1ASL A;  1OXP A;  1EQB A;  1SZU A;  1V2E A;  3BWO A;  4QGR A;  2KFP A;  3UWC A;  1ELQ A;  3VK4 A;  4IX8 A;  4ZDL A;  5LHA A;  1E5F A;  2BKW A;  2OAT A;  4MGR A;  1IJI A;  1O61 A;  1V2D A;  1BJO B;  1I43 A;  4B9B A;  1O69 A;  1DKA A;  4E3R A;  3HQT A;  2PB2 A;  1TAS A;  3E9K A;  4F5F A;  5LH9 A;  1BJ4 A;  2HUF A;  1BJW A;  3CQ4 A;  2W8W A;  4BMK A;  3MAU A;  3WGC A;  1V72 A;  3KKI A;  3G0T A;  4Q76 A;  1W7L A;  3GZD A;  4OBU A;  4RLG A;  3VAX A;  1GC4 A;  4Y0I A;  3MC6 C;  2A1V A;  1S09 A;  1ZOD A;  4MQP A;  1WYV B;  1SZK A;  3ISL A;  3LVL B;  2JJH A;  3FQ8 A;  2DOU A;  4JEX A;  3WX9 A;  5EAV A;  4A0G A;  4RKC A;  4A0H A;  1AMA A;  1C4K A;  3BCA A;  3CBF A;  2OGA A;  3COG A;  4M2M A;  4XK1 A;  5D5S A;  2BWO A;  3RBL A;  1IAY A;  3WGB A;  1N2T A;  5E5I A;  2YHK A;  2W8T A;  3G8M A;  2YRR A;  1G7W A;  2OGE A;  2ZY2 A;  4CVQ A;  4EB7 A;  2JJF A;  3Q8N A;  1YNU A;  4H63 Q;  1G4V A;  4I8A A;  4ZDP A;  2E7J A;  5EUN A;  2E7U A;  3HVY A;  2VGU A;  4PIW A;  4HVK A;  1MGV A;  1ELU A;  1WKH A;  1B8G A;  1S06 A;  2ZY3 A;  1TAT A;  1O62 A;  3EZS A;  3BB8 A;  3EI8 A;  1X0M A;  2Z9V A;  3MAD A;  4F5H A;  3TFT A;  2BHX A;  4KXK A;  3K28 A;  3FKD A;  2WK7 A;  1AJR A;  3DR7 A;  4UQV A;  2W7F A;  5DB5 A;  2VMW A;  4F5I A;  2BYL A;  3GWP A;  1UU0 A;  4XJM A;  2JGT A;  4KAM A;  3ASA A;  4WB0 A;  1IVR A;  2EH6 A;  5E3K A;  4W1V A;  2OKJ A;  3FSL A;  3OP7 A;  4IXO A;  2AAT A;  2VMO A;  4WXB A;  2G6W A;  4JEV A;  1GD9 A;  1RVU A;  1JF9 A;  3K7Y A;  4E1O A;  1M32 A;  4OT8 A;  1ASB A;  2JJE A;  1B5O A;  1DGD A;  2D7Z A;  2VIA A;  3RI6 A;  3N75 A;  1WST A;  1GEW A;  3N0L A;  3FQ7 A;  3GR9 A;  3F0H A;  3DXW A;  9AAT A;  2W7G A;  5JAY A;  2GSA A;  4DGT A;  2QB2 A;  4XJO A;  1KL1 A;  4HF8 A;  4P7Y A;  1RVY A;  2VI9 A;  3HMU A;  3A9Z A;  3JTX A;  1QIS A;  3HL2 A;  3B46 A;  1MAQ A;  2VMT A;  3USF A;  1P3W A;  2PB0 A;  2WKA A;  2AY5 A;  3A8U X;  3IHJ A;  2C81 A;  4GE9 A;  1OHY A;  4IXZ A;  4MKK A;  3WZF A;  1IX8 A;  3TQX A;  5DJ1 A;  3NUB A;  3PDB A;  1SPA A;  3I16 A;  1UU2 A;  3FZ8 A;  3B1E A;  2ZY5 A;  4AO4 A;  3UAK A;  1MDO A;  3KGW A;  3MBB A;  2Z20 A;  1H1C A;  3FZ6 A;  5IWQ A;  2FYF A;  1WYT B;  1BKG A;  1ARI A;  7AAT A;  2CJG A;  3NU8 A;  3BWN A;  1BQA A;  1C7N A;  4IY7 A;  4JEZ A;  4Q31 A;  4TV7 A;  1I29 A;  2HP1 A;  4MSO A;  3LVK A;  3BWN C;  3VOM A;  1G4X A;  1DJE A;  1BT4 A;  4GDY A;  4R5F A;  1YAA A;  2VGS A;  4W91 A;  2ZY4 A;  1CQ6 A;  1QJ3 A;  2FQ6 A;  3LG0 A;  2BI5 A;  4RM1 A;  4F5L A;  5KTB A;  1ZOB A;  3MKJ A;  5EQC A;  4DQ6 A;  5FT5 A;  5HHY A;  1H0C A;  1MDZ A;  1KMK A;  2O0R A;  3ASB A;  3QI6 A;  4M2J A;  1UKJ A;  1D7U A;  2ORD A;  3D6K A;  3ELP A;  1QIR A;  4AZJ A;  3B8X A;  3JU7 A;  1CL2 A;  1VP4 A;  3E2F A;  3PDX A;  1PMO A;  4WXF A;  2W7H A;  3A2B A;  3RBF A;  4UHM A;  1GEX A;  1SVV A;  1C7G A;  1YJY A;  5HDM A;  1AHF A;  2CY8 A;  5K8B A;  4OCA A;  5EUE A;  3WY7 A;  4E77 A;  5C6U A;  4XAU A;  2D64 A;  4ZWM A;  2Q7W A;  2RFV A;  4PFN A;  2W7M A;  1ASM A;  2BI2 A;  5E4Z A;  4K2I A;  4OTL A;  5G4J A;  2WK9 A;  3H9X A;  3AEJ C;  5M49 A;  2HP2 A;  3FDB A;  2VIB A;  2O7C A;  4IYO B;  2JG2 A;  3RCH B;  3PD6 A;  1E5E A;  1QZ9 A;  4OBV A;  1OAT A;  1ARH A;  2HZP A;  1TAR A;  4F5K A;  1MDX A;  3AEM C;  5G2P A;  4EB5 A;  1ECX A;  2EO5 A;  2EZ2 A;  1IAX A;  4M2K A;  1AHE A;  4ATQ A;  2WK8 A;  4K2B A;  3I4J A;  4R5Z A;  1B4X A;  4GRX A;  5HXX A;  4EFF A;  1DGE A;  3PA9 A;  4NOG A;  4GE4 A;  4ADC A;  5BJ4 A;  2HOR A;  2CH2 A;  2CH1 A;  1WYT A;  2F8J A;  1RV3 A;  4MQQ A;  2VLF A;  2D7Y A;  1B9H A;  3P6K A;  4A6T A;  3LWS A;  1Y4I A;  4W1W A;  3PD6 B;  1YOO A;  4ZWV A;  3F6T A;  4A0F A;  1QJ5 A;  1JS3 A;  3E2Z A;  5TF5 A;  1ARS A;  2JIS A;  1LW4 A;  2DGK A;  2ZUK A;  4CBR A;  1PG8 A;  2YKX A;  2G7J A;  1AHY A;  2GB3 A;  3HT4 A;  5FT4 A;  2ZSL A;  4WYE A;  2CJH A;  1AJS A;  2D65 A;  4H51 A;  4IXS A;  2BI3 A;  4LC3 A;  3W1H A;  3NYT A;  1AKA A;  4ITX A;  2X8U A;  3ZRQ A;  4TN4 A;  5M46 A;  2Z1Z A;  1AIB A;  1YIY A;  3GET A;  4ZM3 A;  1CJ0 A;  3DZZ A;  1M6S A;  1G7X A;  2FM1 A;  1YIZ A;  3QHX A;  5I92 A;  2VGW A;  3RUY A;  4O6Z A;  4OC9 A;  1JG8 A;  3WKS A;  1VEF A;  2BIA A;  3II0 A;  4BA4 A;  1BQD A;  4A00 A;  1W7N A;  4RJY A;  1BJN A;  3GJU A;  2FNI A;  3BCB A;  1ASA A;  1ARG A;  3E6G A;  3NNK A;  4XJP A;  1BW0 A;  2HUU A;  3CAI A;  5EFS A;  2R2N A;  3BCX A;  2EZ1 A;  3TCM A;  1SFF A;  2CFB A;  2CAN A;  1ASF A;  1IUG A;  3FZ7 A;  4AH3 A;  2VYC A;  1AY4 A;  2JJG A;  2Z9U A;  4N0W A;  4J5U A;  3TFU A;  3QPG A;  3P1T A;  4ZM4 A;  1DJ9 A;  2ZSM A;  5G0A A;  3VP6 A;  3BN1 A;  1D2F A;  3A9Y A;  1ORD A;  2C7T A;  4F5J A;  3DYD A;  3CQ5 A;  2AEU A;  3F9T A;  3ECD A;  2C44 A;  1AY8 A;  1X29 A;  5G09 A;  4F4E A;  4XQ2 A;  1TOK A;  5FT6 A;  4CXQ A;  3AEN A;  1AAW A;  1N31 A;  1S0A A;  1WYU B;  3L44 A;  4RKD A;  2AY8 A;  1ASG A;  1FC4 A;  4P3M A;  1J32 A;  1B9I A;  1FG7 A;  1GC0 A;  2CIN A;  2YRI A;  5G4I A;  2GMS A;  3HBX A;  5EUD A;  1LKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...