2BIEA

Radiation damage of the schiff base in phosphoserine aminotransferase (structure h)
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
358
structure length
358
Chain Sequence
QVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKENA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
publication title Strain Relief at the Active Site of Phosphoserine Aminotransferase Induced by Radiation Damage.
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Transferase
total genus 127
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2bieA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2bieA02
2YKVA 3VP6A 1FG3A 1S09A 1TOKA 3HBXA 2TPLA 2YRIA 2HOXA 1JS3A 1MDXA 3BWOA 4KXKA 1DJUA 2CJDA 1GC4A 2CTZA 3FSLA 3KE3A 2VIAA 4A0FA 3FFHA 1B5PA 1BJWA 1VEFA 1V2EA 1IX7A 3FVUA 2ZY4A 5E4ZA 3QM2A 1AJSB 1X29A 1AX4A 1SVVA 3E2ZA 4MKJA 4XQ2A 3G7QA 2QBTA 4UHOA 2Z1ZA 3AENA 1I43A 1AKBA 1ZOBA 3LG0A 4E1OA 3AOWA 3FRKA 1N2TA 4CVQA 1RV3A 4MQPA 1TASA 2JG2A 2R5CB 3CBFA 2JJFA 3ELPA 3F0HA 2OGAA 4GE4A 3FQAA 3B1CA 4QGRA 2ZY3A 3UE8A 1YJZA 2PB0A 4A0HA 2FN6A 4ZM4A 1M4NA 4ZSYA 3KKIA 3MAUA 4A0RA 8AATA 2D7ZA 3W1HA 4BHDA 5M49A 4WYCA 5DB5A 4ZAHA 2C44A 3EI7A 1ARSA 1IX6A 2C0RA 2HUUA 4IYOB 1LKCA 4H51A 2AY4A 3GR9A 1AHFA 1ASMA 1PMOA 2EH6A 2RFVA 3QI6A 2Q7WA 1C7GA 1BQAA 2E54A 1YAAA 4Y0IA 2W7HA 1ASGA 2CSTA 5FT6A 4EU1A 4RLGA 4CBRA 1ZODA 5DJ1A 3ZZJA 2EZ1A 1IBJA 1LW4A 2V1PA 1S06A 1V2DA 4XJMA 2W8VA 3WKSA 4EMYA 1DKAA 1C0NA 1G7XA 1OHVA 5EIGA 4A6RA 4EB5A 1CS1A 1AHXA 2AEVA 2ZJGA 4XEWA 2AY2A 5JAYA 3HMUA 2XH1A 3TFUA 1IVRA 4LNMA 4ZDLA 3NUBA 2ZYJA 1OXPA 1ASAA 2CANA 2ZUKA 3IHJA 4PVFA 1G4VA 2QMAA 2JJHA 1E5FA 3RQ1A 3TCMA 4XK1A 4OC9A 4UHMA 2CFBA 1KKJA 2GMSA 3PD6B 1UU0A 4OTLA 1CQ7A 3VK4A 4GDYA 1JG8A 2JISA 3ACZA 4MQRA 3DRDA 3JWAA 1Z7DA 4F5LA 1TOEA 1WYUA 4F5FA 1W7NA 4I8AA 2OKKA 2VI9A 5HHYA 2BIAA 2XBNA 2BHXA 4LW2A 1TATA 3HDOA 1PMMA 1BJOA 3EIAA 3ECDA 2R5EA 1MLZA 4JEVA 9AATA 1AJRA 1O69A 1LS3A 1AKCA 3A8UX 2X5FA 1S0AA 3AELA 3ZZKA 4E3QA 3CQ6A 1JF9A 4R5FA 5TF5A 3BV0A 1ARIA 2YKXA 3GSBA 1MLYA 3DYDA 3ZRRA 1ASFA 1QISA 3PDBB 3NRAA 2D61A 2VMXA 1ASDA 3OKSA 1AHGA 3DODA 1SZSA 4K2IA 2CH2A 1H1CA 2Z9VA 5DJ9A 1KL1A 1ORDA 1AY5A 3FCRA 4WYAA 3PAAA 1CQ8A 1AKAA 1GC0A 1S07A 1W3UA 2AEUA 3K28A 4RIZA 2W7IA 1VJOA 3WGBA 2EGYA 4RKCA 1ECXA 1TARA 2HP2A 4RAEA 3FDBA 1CJ0A 1G7WA 4WYGA 3GWPA 2R0TA 4WLJA 2X5DA 3UAKA 1AJSA 1YJSA 1BT4A 1PG8A 1B5OA 1DGDA 1MDOA 2EPJA 3BS8A 3KGWA 2NMPA 4UQVA 2GB3A 2WK9A 3T32A 3UWCA 1YJYA 3Q8NA 2W8UA 1WYTB 2VLFA 1BW0A 4XJOA 4Y0HA 3FDDA 3ELEA 1RVUA 5K8BA 3QPGA 1AAMA 4JF1A 2DR1A 5I92A 3FD0A 2R5CA 1MDZA 1EG5A 4Q31A 4AO4A 2W7FA 3WKRA 3F9TA 2VGUA 3A9ZA 2AATA 4M2KA 1D7SA 2VMQA 4Y0DA 4R2NA 2DKBA 3II0A 4F5IA 1W23A 1DJ9A 1M0NA 1X2AA 2HUIA 3DU4A 4Q75A 4WXFA 4ZLVA 4F4EA 1C7OA 4ADEA 2WK8A 4IYOA 1GC3A 4UOYA 1LW5A 3JU7A 5E5IA 3EZSA 3RUYA 3JWBA 1ELQA 1I41A 2DOUA 4F5GA 1KL2A 3P6KA 2QA3A 4GEBA 1BJNA 1J32A 3I16A 2ZSMA 1IUGA 3QBOA 1BJ4A 2YKYA 3FZ8A 2VMYA 4ITGA 3CQ4A 5G2PA 1C7NA 4AOAA 1QIRA 3NU7A 2WK7A 1Y4IA 3QGUA 3E2YA 3GZCA 3M5UA 4FFCA 3NUIA 3AV7A 4WP0A 4WLHA 2C81A 4ATPA 2R2NA 4A6UA 2O7CA 1X28A 1M6SA 2GQNA 4IX8A 3MBBA 2BI5A 1M0OA 3HLMA 4J5UA 2FYFA 5EFSA 3VOMA 2VGZA 3H14A 3ZRPA 2VGTA 4CXQA 4LC3A 4WYFA 3BN1A 3BWNC 2CB1A 3AOVA 4OMAA 3W1JA 2CJHA 2D7YA 5D5SA 1LC8A 1CL2A 4IXZA 5G4IA 3PD6A 3A2BA 4AO9A 3LVJA 2VMWA 1AIBA 4BMKA 1ARGA 1BKGA 4KAMA 2W7JA 3CAIA 5BJ3A 4TN4A 5BJ4A 4JEZA 2DGLA 3ASAA 2D64A 4A00A 3PIUA 1TOGA 2VMUA 2DKJA 3E2FA 1V72A 2O0RA 3COGA 5HDMA 4EFFA 2VIBA 2YRRA 1LC7A 3D6KA 3K40A 1MAPA 3ISLA 3EI6A 3L8AA 5M46A 2JJGA 1WSTA 2FNIA 3JW9A 1CL1A 3FZ7A 4ISYA 3CQ5A 1ZC9A 5G0AA 3KGXA 2JGTA 2BWOA 3MC6C 4ADBA 5HXXA 4BA4A 3PDBA 2BKWA 1M0QA 3GBXA 1GDEA 1OHWA 1IX8A 2WKAA 2YCPA 4K2BA 3R4TA 4AZKA 4WYDA 2W7MA 4P3MA 1WKHA 2E7UA 4O6ZA 2Z61A 4TMRA 1VP4A 1TOIA 1ASLA 3FQ7A 5AX8A 2YOBA 3AEJC 4LNLA 2W7LA 2CINA 4JE5D 1SZKA 2GMUA 1D7RA 3ASBA 3AATA 4GRXA 4PIWA 3LWSA 3EI8A 3WX9A 2BI1A 2Z9UA 1QGNA 4UHNA 2D63A 4ZM3A 5F9SA 1H0CA 1YNUA 1AHYA 3NYSA 4JEXA 1ARTA 3JZLA 3G8MA 2VMSA 1SZUA 4DQ6A 3N0LA 1WYTA 1QJ3A 1B9IA 4ZWMA 2ZP7A 1DFOA 2CY8A 3VK3A 2HOYA 2D66A 2OQXA 3DXWA 1YIZA 2VMZA 3HT4A 4WD2A 1GC2A 5FT8A 2VGWA 2VMOA 3JTXA 2W7DA 3NDNA 4OBVA 4R8DA 5IWQA 3NNKA 3P1TA 4R5ZA 2D65A 1G4XA 1M7YA 1O62A 1RVYA 3BWNA 1B8GA 1GBNA 3BB8A 2BI9A 2AY9A 2YCTA 3DR4A 3BC8A 4OBUA 4PFFA 1P3WA 4XJLA 1IAYA 4GSAA 1OHYA 4CXRA 2AY8A 2X8UA 4MQQA 4F5MA 2ZSLA 1B9HA 4E3RA 2Z9WA 4A72A 3MAFB 3E77A 1PFFA 2BWNA 1UU1A 2X3LA 3W1IA 2VMPA 2JJEA 3GJUA 1E5EA 1YOOA 1AAWA 4ZDOA 2BIEA 1U08A 4ITXA 3EUCA 3AEOA 3PJ0A 4E77A 3E9KA 2W8JA 2BYLA 3QN6A 1SPAA 4F5JA 1O61A 2C7TA 4MKKA 1AHEA 4XAUA 2VMNA 1W7MA 1D7VA 3WCNA 2CJGA 5EQCA 1EJIA 4AH3A 3QHXA 4MGRA 2DGMA 4ZASA 4OCAA 2HZPA 1MGVA 1D2FA 3PA9A 4IW7A 4WB0B 1IAXA 4WXBA 2VMTA 2W7EA 3BCBA 3H7FA 4ADDA 4BQ0A 5LH9A 1BQDA 3LVKA 1QZ9A 4EB7A 4IXSA 1OATA 3GETA 3FZ6A 1W7LA 1O4SA 3PDXA 5EUDA 2VMVA 3EI5A 5DX5A 3BCXA 3RI6A 3VK2A 4FL0A 1GEXA 2AY7A 2Z9XA 3FTBA 3N75A 2BI2A 4WXGA 4N0BA 4KYOA 3DC1A 1ASCA 2AY3A 5FT5A 2W8WA 3MADA 1B4XA 1GEYA 3I4JA 1LC5A 1SFFA 1AY4A 2AY1A 3RCHB 4F5KA 4LW4A 4JEYA 3ATHA 4ATQA 2ZY5A 1CZCA 1XI9A 3L44A 1J04A 2VMRA 4ADCA 3LY1A 3B1DA 2YKUA 4TV7A 2FNUA 3B1EA 4ZSWA 1GEWA 1ASBA 1WYVB 2W7KA 3FVXA 2HORA 1S08A 2YCNA 3K7YA 3EI9A 3PGYA 5G09A 3FVSA 1V2FA 3TATA 3BCAA 2ZY2A 3GZDC 4W1WA 4Q76A 3RBLA 2HP1A 1WKGA 2QB3A 3NU8A 2FQ6A 4W1VA 1ARHA 2FM1A 1GCKA 2QB2A 2W8TA 4A6TA 2Z20A 1M32A 3USFA 2AY6A 2PB2A 3DR7A 1FC4A 1C9CA 2HOZA 3AEMC 4P7YA 3NX3A 4BA5A 1CQ6A 4CBSA 2DGKA 2YHKA 4GE7A 5F8VA 4M2JA 5EAAA 2D5YA 2VI8A 3E2ZB 4OYTA 1ASNA 3NYUA 4IXOA 5EUNA 3RBFA 3AENB 2G6WA 5E3KA 1DGEA 1XEYA 5G4JA 1I29A 3IF2A 2EO5A 5EAVA 3MKJA 3A9YA 3R9AA 3TFTA 1QITA 4RJYA 1IJIA 3HVYA 5C6UA 1OXOA 3N5MA 3LV2A 2BI3A 4GE9A 4AZJA 4W1XA 2ZC0A 1N8PA 4Q6RA 4LNJA 1SF2A 1DJEA 2OATA 2CH1A 4JEWA 4U1TA 1DTYA 5EUEA 2OGEA 3FKDA 1YIYA 1ASEA 3OP7A 4RKDA 4ZDPA 3FFRA 3EIBA 2PO3A 3B8XA 1QJ5A 2VGVA 1AIAA 3DZZA 3VAXA 5G2QA 4DBCA 5J8QA 4K2MA 2Z67A 4RJ0A 2E7JA 4B9BA 3PPLA 3A9XA 2BYJA 1JS6A 4JE5A 1AMAA 3I5TA 3MAFA 4MY5A 3LVMA 4IY7A 1MAQA 1X0MA 2EZ2A 3DXVA 2GSAA 3TQXA 2VLHA 3NTJA 3EZ1A 1ELUA 5EIGB 5M4DA 4OT8A 4WBTA 2Z1YA 3G0TA 3MEBA 2F8JA 4MSOA 1N31A 1AY8A 1EQBA 4RM1A 4NOGA 1CZEA 3GZDA 2BIGA 3WY7A 2HUFA 1C4KA 1AMRA 1TPLA 4PFNA 4U2HA 5FT4A 1BS0A 1D7UA 3B46A 1Z3ZA 4W5KA 1AICA 3F6TA 4WB0A 2VYCA 2AY5A 5LHAA 4W8IA 3AEMA 1M0PA 1WYUB 1UU2A 1UKJA 2W7GA 3LVLB 4J8LA 5M4BA 4DGTA 1LK9A 4RITA 4M2MA 4W91A 1RV4A 1KKPA 1BJOB 2E7IA 4A0GA 7AATA 1KMKA 4B98A 3HL2A 4XJPA 3HQTA 3ZRQA 1GD9A 3NYTA 4WYEA 2VGSA 2ORDA 3E6GA 4JF0A 4N0WA 3MC6A 3RCHA 3FQ8A 4HF8A 4ZWVA 5D95A 1AMQA 4F5HA 3WCOA 3AEPA 4HVKA 2QLRA 1KMJA 2V0YA 1T3IA 3WGCA 2O1BA 4L0OA 1FG7A 1I48A 3WZFA 1WYVA 2OKJA 1TOJA 3AEJA 3WLXA 2BWPA 1AMSA
chains in the Genus database with same CATH superfamily
2YKVA 3VP6A 1FG3A 1S09A 1TOKA 3HBXA 2TPLA 2YRIA 2HOXA 1JS3A 1MDXA 3BWOA 4KXKA 1DJUA 2CJDA 1GC4A 2CTZA 3FSLA 3KE3A 2VIAA 4A0FA 3FFHA 1B5PA 3N4SA 1BJWA 1VEFA 1V2EA 1IX7A 3FVUA 2ZY4A 5E4ZA 3QM2A 1AJSB 1X29A 1AX4A 1SVVA 3E2ZA 4MKJA 4XQ2A 3G7QA 2QBTA 4UHOA 2Z1ZA 3AENA 1I43A 1AKBA 1ZOBA 3LG0A 4E1OA 3AOWA 3FRKA 1N2TA 4CVQA 1RV3A 4MQPA 1TASA 2JG2A 2R5CB 3CBFA 2JJFA 3ELPA 3F0HA 2OGAA 4GE4A 3FQAA 3B1CA 4QGRA 2ZY3A 3UE8A 1YJZA 2PB0A 4A0HA 2FN6A 4ZM4A 1M4NA 4ZSYA 3KKIA 3MAUA 4A0RA 8AATA 2D7ZA 3W1HA 3N4RA 4BHDA 5M49A 4WYCA 5DB5A 4ZAHA 2C44A 3EI7A 1ARSA 1IX6A 2C0RA 2HUUA 4IYOB 1LKCA 4H51A 2AY4A 3GR9A 1AHFA 1ASMA 1PMOA 2EH6A 2RFVA 3QI6A 2Q7WA 1C7GA 1BQAA 4H63Q 2E54A 1YAAA 4Y0IA 2W7HA 1ASGA 2CSTA 5FT6A 4EU1A 4RLGA 4CBRA 1ZODA 5DJ1A 3ZZJA 2EZ1A 1IBJA 1LW4A 2V1PA 1S06A 1V2DA 4XJMA 2W8VA 3WKSA 4EMYA 1DKAA 1C0NA 1G7XA 1OHVA 5EIGA 4A6RA 4EB5A 1CS1A 1AHXA 2AEVA 2ZJGA 4XEWA 2AY2A 5JAYA 3HMUA 2XH1A 3TFUA 1IVRA 4LNMA 4ZDLA 3NUBA 2ZYJA 1OXPA 1ASAA 2CANA 2ZUKA 3IHJA 4PVFA 5KTBA 1G4VA 2QMAA 2JJHA 1E5FA 2G7JA 3RQ1A 3TCMA 4XK1A 4OC9A 4UHMA 2CFBA 1KKJA 2GMSA 3PD6B 1UU0A 4OTLA 1CQ7A 3VK4A 4GDYA 1JG8A 2JISA 3ACZA 4MQRA 3DRDA 3JWAA 1Z7DA 4F5LA 1TOEA 1WYUA 4F5FA 1W7NA 4I8AA 2OKKA 2VI9A 5HHYA 2BIAA 2XBNA 2BHXA 4LW2A 1TATA 3HDOA 1PMMA 1BJOA 3EIAA 3ECDA 2R5EA 1MLZA 4JEVA 9AATA 1AJRA 1O69A 1LS3A 1AKCA 3A8UX 2X5FA 1S0AA 3AELA 3ZZKA 4E3QA 3CQ6A 2FKIA 1JF9A 4R5FA 5TF5A 3BV0A 1ARIA 2YKXA 3GSBA 1MLYA 3DYDA 3ZRRA 1ASFA 1QISA 3PDBB 3NRAA 2D61A 2VMXA 1ASDA 3OKSA 1AHGA 3DODA 1SZSA 4K2IA 2CH2A 1H1CA 2Z9VA 5DJ9A 1KL1A 1ORDA 1AY5A 3FCRA 4WYAA 3PAAA 1CQ8A 1AKAA 1GC0A 1S07A 1W3UA 2AEUA 3K28A 4RIZA 2W7IA 1VJOA 3WGBA 2EGYA 4RKCA 1ECXA 1TARA 2HP2A 4RAEA 3FDBA 1CJ0A 1G7WA 4WYGA 3GWPA 2R0TA 4WLJA 2X5DA 3UAKA 1AJSA 1YJSA 1BT4A 1PG8A 1B5OA 1DGDA 1MDOA 2EPJA 3BS8A 3KGWA 2NMPA 4UQVA 2GB3A 2WK9A 3T32A 3UWCA 1YJYA 3Q8NA 2W8UA 1WYTB 2VLFA 1BW0A 4XJOA 4Y0HA 3FDDA 3ELEA 1RVUA 5K8BA 3QPGA 1AAMA 4JF1A 2DR1A 5I92A 3H9XA 3FD0A 2R5CA 1MDZA 1EG5A 4Q31A 4AO4A 2W7FA 3WKRA 3F9TA 2VGUA 3A9ZA 2AATA 4M2KA 1D7SA 2VMQA 4Y0DA 4R2NA 2DKBA 3II0A 4F5IA 1W23A 1DJ9A 1M0NA 1X2AA 2HUIA 3DU4A 4Q75A 4WXFA 4ZLVA 4F4EA 1C7OA 4ADEA 2WK8A 4IYOA 1GC3A 4UOYA 1LW5A 3JU7A 5E5IA 3EZSA 3RUYA 3JWBA 1ELQA 1I41A 2DOUA 4F5GA 1KL2A 3P6KA 2QA3A 4GEBA 1BJNA 1J32A 2QSRA 3I16A 2ZSMA 1IUGA 3QBOA 1BJ4A 2YKYA 3FZ8A 2VMYA 4ITGA 3CQ4A 5G2PA 1C7NA 4AOAA 1QIRA 3NU7A 2WK7A 1Y4IA 3QGUA 3E2YA 3GZCA 3M5UA 4FFCA 3NUIA 3AV7A 4WP0A 4WLHA 2C81A 4ATPA 2R2NA 4A6UA 2O7CA 1X28A 1M6SA 2GQNA 4IX8A 3MBBA 2BI5A 1M0OA 3HLMA 4J5UA 2FYFA 5EFSA 3VOMA 2VGZA 3H14A 3ZRPA 2VGTA 4CXQA 4LC3A 4WYFA 3BN1A 3BWNC 2CB1A 3AOVA 4OMAA 3W1JA 2CJHA 2D7YA 5D5SA 1LC8A 1CL2A 4IXZA 5G4IA 3PD6A 3A2BA 4AO9A 3LVJA 2VMWA 1AIBA 4BMKA 1ARGA 1BKGA 4KAMA 2W7JA 3CAIA 5BJ3A 4TN4A 5BJ4A 4JEZA 2DGLA 3ASAA 2D64A 4A00A 3PIUA 1TOGA 2VMUA 2DKJA 3E2FA 1V72A 2O0RA 3COGA 5HDMA 4EFFA 2VIBA 2YRRA 1LC7A 3D6KA 3K40A 1MAPA 3ISLA 3EI6A 3L8AA 5M46A 2JJGA 1WSTA 2FNIA 3JW9A 1CL1A 3FZ7A 4ISYA 3CQ5A 1ZC9A 5G0AA 3KGXA 2JGTA 2BWOA 3MC6C 4ADBA 5HXXA 4BA4A 3PDBA 2BKWA 1M0QA 3GBXA 1GDEA 1OHWA 1IX8A 2WKAA 2YCPA 4K2BA 3R4TA 4AZKA 4WYDA 2W7MA 4P3MA 1WKHA 2E7UA 4O6ZA 2Z61A 4TMRA 1VP4A 1TOIA 1ASLA 3FQ7A 5AX8A 2YOBA 3AEJC 4LNLA 2W7LA 2CINA 4JE5D 1SZKA 2GMUA 1D7RA 3ASBA 3AATA 4GRXA 4PIWA 3LWSA 3EI8A 3WX9A 2BI1A 2Z9UA 1QGNA 4UHNA 2D63A 4ZM3A 5F9SA 1H0CA 1YNUA 1AHYA 3NYSA 4JEXA 1ARTA 3JZLA 3G8MA 2VMSA 1SZUA 4DQ6A 3N0LA 1WYTA 1QJ3A 1B9IA 4ZWMA 2ZP7A 1DFOA 2CY8A 3VK3A 2HOYA 2D66A 2OQXA 3DXWA 1YIZA 2VMZA 3HT4A 4WD2A 1GC2A 5FT8A 2VGWA 2VMOA 3JTXA 2W7DA 3NDNA 4OBVA 4R8DA 5IWQA 3NNKA 3P1TA 4R5ZA 2D65A 1G4XA 1M7YA 1O62A 1RVYA 3BWNA 1B8GA 1GBNA 3BB8A 2BI9A 2AY9A 2YCTA 3DR4A 3BC8A 4OBUA 4PFFA 1P3WA 4XJLA 1IAYA 4GSAA 1OHYA 4CXRA 2AY8A 2X8UA 4MQQA 4F5MA 2ZSLA 1B9HA 4E3RA 2Z9WA 4A72A 3MAFB 3E77A 1PFFA 2BWNA 1UU1A 2X3LA 3W1IA 2VMPA 2JJEA 3GJUA 1E5EA 1YOOA 1AAWA 4ZDOA 2BIEA 1U08A 4ITXA 3EUCA 3AEOA 3PJ0A 4E77A 3E9KA 2W8JA 2BYLA 3QN6A 1SPAA 4F5JA 1O61A 2C7TA 4MKKA 1AHEA 4XAUA 2VMNA 1W7MA 1D7VA 3WCNA 2CJGA 5EQCA 1EJIA 4AH3A 3QHXA 4MGRA 2DGMA 4ZASA 4OCAA 2HZPA 1MGVA 1D2FA 3PA9A 4IW7A 2KFPA 4WB0B 1IAXA 4WXBA 2VMTA 2W7EA 3BCBA 3H7FA 4ADDA 4BQ0A 5LH9A 1BQDA 3LVKA 1QZ9A 4EB7A 4IXSA 1OATA 3GETA 3FZ6A 1W7LA 1O4SA 3PDXA 5EUDA 2VMVA 3EI5A 5DX5A 3BCXA 3RI6A 3VK2A 4FL0A 1GEXA 2AY7A 2Z9XA 3FTBA 3N75A 2BI2A 4WXGA 4N0BA 4KYOA 3DC1A 1ASCA 2AY3A 5FT5A 2W8WA 3MADA 1B4XA 1GEYA 3I4JA 1LC5A 1SFFA 1AY4A 2AY1A 3RCHB 4F5KA 4LW4A 4JEYA 3ATHA 4ATQA 2ZY5A 1CZCA 1XI9A 3L44A 1J04A 2VMRA 4ADCA 3LY1A 3B1DA 2YKUA 4TV7A 2FNUA 3B1EA 4ZSWA 1GEWA 1ASBA 1WYVB 2W7KA 3FVXA 3N4XA 2HORA 1S08A 2YCNA 3K7YA 3EI9A 3PGYA 5G09A 3FVSA 1V2FA 3TATA 3BCAA 2ZY2A 3GZDC 4W1WA 4Q76A 3RBLA 2HP1A 1WKGA 2QB3A 3NU8A 2FQ6A 4W1VA 1ARHA 2FM1A 1GCKA 2QB2A 2W8TA 4A6TA 2Z20A 4K05A 1M32A 3USFA 3N7NA 2AY6A 2PB2A 3DR7A 1FC4A 1C9CA 2HOZA 3AEMC 4P7YA 3NX3A 4BA5A 1CQ6A 4CBSA 2DGKA 2YHKA 4GE7A 5F8VA 4M2JA 5EAAA 2D5YA 2VI8A 3E2ZB 4OYTA 1ASNA 3NYUA 4IXOA 5EUNA 3RBFA 3AENB 2G6WA 5E3KA 1DGEA 1XEYA 5G4JA 1I29A 3IF2A 2EO5A 5EAVA 3MKJA 3A9YA 3R9AA 3TFTA 1QITA 4RJYA 1IJIA 3HVYA 5C6UA 1OXOA 3N5MA 3LV2A 2BI3A 4GE9A 4AZJA 4W1XA 2ZC0A 1N8PA 4Q6RA 4LNJA 1SF2A 1DJEA 2OATA 2CH1A 4JEWA 4U1TA 1DTYA 5EUEA 2OGEA 3FKDA 1YIYA 1ASEA 3OP7A 4RKDA 4ZDPA 3FFRA 3EIBA 2PO3A 3B8XA 1QJ5A 2VGVA 1AIAA 3DZZA 3VAXA 5G2QA 4DBCA 5J8QA 4K2MA 2A1VA 2Z67A 4RJ0A 2E7JA 4B9BA 3PPLA 3A9XA 2WB6A 2BYJA 1JS6A 4JE5A 1AMAA 3I5TA 3MAFA 4MY5A 3LVMA 4IY7A 1MAQA 1X0MA 2EZ2A 3DXVA 2GSAA 3TQXA 2VLHA 3NTJA 3EZ1A 1ELUA 5EIGB 5M4DA 4OT8A 4WBTA 2Z1YA 3G0TA 3MEBA 2F8JA 4MSOA 1N31A 1AY8A 1EQBA 4RM1A 4NOGA 1CZEA 3GZDA 2BIGA 3WY7A 2HUFA 1C4KA 1AMRA 1TPLA 4PFNA 4U2HA 5FT4A 1BS0A 1D7UA 3B46A 1Z3ZA 4W5KA 1KAFA 1AICA 3F6TA 4WB0A 2VYCA 2AY5A 5LHAA 2EYQA 4W8IA 3AEMA 1M0PA 1WYUB 1UU2A 1UKJA 2W7GA 3LVLB 4J8LA 5M4BA 4DGTA 1LK9A 4RITA 4M2MA 4W91A 1RV4A 1KKPA 1BJOB 2E7IA 4A0GA 7AATA 1KMKA 4B98A 3HL2A 4XJPA 3HQTA 3ZRQA 1GD9A 3NYTA 4WYEA 2VGSA 2ORDA 3E6GA 4JF0A 4N0WA 3MC6A 3RCHA 3FQ8A 4HF8A 4ZWVA 5D95A 1AMQA 4F5HA 3WCOA 3AEPA 4HVKA 2QLRA 1KMJA 2V0YA 1T3IA 3WGCA 2O1BA 4L0OA 1FG7A 1I48A 3WZFA 1WYVA 2OKJA 1TOJA 3AEJA 3WLXA 2BWPA 1AMSA
chains in the Genus database with same CATH topology
2YKVA 3VP6A 1FG3A 1S09A 1TOKA 3HBXA 2TPLA 2YRIA 2HOXA 1JS3A 1MDXA 3BWOA 4KXKA 1DJUA 2CJDA 1GC4A 2CTZA 3FSLA 3KE3A 2VIAA 4A0FA 3FFHA 1B5PA 3N4SA 1BJWA 1VEFA 1V2EA 1IX7A 3FVUA 2ZY4A 5E4ZA 3QM2A 1AJSB 1X29A 1AX4A 1SVVA 3E2ZA 4MKJA 4XQ2A 3G7QA 2QBTA 4UHOA 2Z1ZA 3AENA 1I43A 1AKBA 1ZOBA 3LG0A 4E1OA 3AOWA 3FRKA 1N2TA 4CVQA 1RV3A 4MQPA 1TASA 2JG2A 2R5CB 3CBFA 2JJFA 3ELPA 3F0HA 2OGAA 4GE4A 3FQAA 3B1CA 4QGRA 2ZY3A 3UE8A 1YJZA 2PB0A 4A0HA 2FN6A 4ZM4A 1M4NA 4ZSYA 3KKIA 3MAUA 4A0RA 8AATA 2D7ZA 3W1HA 3N4RA 4BHDA 5M49A 4WYCA 5DB5A 4ZAHA 2C44A 3EI7A 1ARSA 1IX6A 2C0RA 2HUUA 4IYOB 1LKCA 4H51A 2AY4A 3GR9A 1AHFA 1ASMA 1PMOA 2EH6A 2RFVA 3QI6A 2Q7WA 1C7GA 1BQAA 4H63Q 2E54A 1YAAA 4Y0IA 2W7HA 1ASGA 2CSTA 5FT6A 4EU1A 4RLGA 4CBRA 1ZODA 5DJ1A 3ZZJA 2EZ1A 1IBJA 1LW4A 2V1PA 1S06A 1V2DA 4XJMA 2W8VA 3WKSA 4EMYA 1DKAA 1C0NA 1G7XA 1OHVA 5EIGA 4A6RA 4EB5A 1CS1A 1AHXA 2AEVA 2ZJGA 4XEWA 2AY2A 5JAYA 3HMUA 2XH1A 3TFUA 1IVRA 4LNMA 4ZDLA 3NUBA 2ZYJA 1OXPA 1ASAA 2CANA 2ZUKA 3IHJA 4PVFA 5KTBA 1G4VA 2QMAA 2JJHA 1E5FA 2G7JA 3RQ1A 3TCMA 4XK1A 4OC9A 4UHMA 2CFBA 1KKJA 2GMSA 3PD6B 1UU0A 4OTLA 1CQ7A 3VK4A 4GDYA 1JG8A 2JISA 3ACZA 4MQRA 3DRDA 3JWAA 1Z7DA 4F5LA 1TOEA 1WYUA 4F5FA 1W7NA 4I8AA 2OKKA 2VI9A 5HHYA 2BIAA 2XBNA 2BHXA 4LW2A 1TATA 3HDOA 1PMMA 1BJOA 3EIAA 3ECDA 2R5EA 1MLZA 4JEVA 9AATA 1AJRA 1O69A 1LS3A 1AKCA 3A8UX 2X5FA 1S0AA 3AELA 3ZZKA 4E3QA 3CQ6A 2FKIA 1JF9A 4R5FA 5TF5A 3BV0A 1ARIA 2YKXA 3GSBA 1MLYA 3DYDA 3ZRRA 1ASFA 1QISA 3PDBB 3NRAA 2D61A 2VMXA 1ASDA 3OKSA 1AHGA 3DODA 1SZSA 4K2IA 2CH2A 1H1CA 2Z9VA 5DJ9A 1KL1A 1ORDA 1AY5A 3FCRA 4WYAA 3PAAA 1CQ8A 1AKAA 1GC0A 1S07A 1W3UA 2AEUA 3K28A 4RIZA 2W7IA 1VJOA 3WGBA 2EGYA 4RKCA 1ECXA 1TARA 2HP2A 4RAEA 3FDBA 1CJ0A 1G7WA 4WYGA 3GWPA 2R0TA 4WLJA 2X5DA 3UAKA 1AJSA 1YJSA 1BT4A 1PG8A 1B5OA 1DGDA 1MDOA 2EPJA 3BS8A 3KGWA 2NMPA 4UQVA 2GB3A 2WK9A 3T32A 3UWCA 1YJYA 3Q8NA 2W8UA 1WYTB 2VLFA 1BW0A 4XJOA 4Y0HA 3FDDA 3ELEA 1RVUA 5K8BA 3QPGA 1AAMA 4JF1A 2DR1A 5I92A 3H9XA 3FD0A 2R5CA 1MDZA 1EG5A 4Q31A 4AO4A 2W7FA 3WKRA 3F9TA 2VGUA 3A9ZA 2AATA 4M2KA 1D7SA 2VMQA 4Y0DA 4R2NA 2DKBA 3II0A 4F5IA 1W23A 1DJ9A 1M0NA 1X2AA 2HUIA 3DU4A 4Q75A 4WXFA 4ZLVA 4F4EA 1C7OA 4ADEA 2WK8A 4IYOA 1GC3A 4UOYA 1LW5A 3JU7A 5E5IA 3EZSA 3RUYA 3JWBA 1ELQA 1I41A 2DOUA 4F5GA 1KL2A 3P6KA 2QA3A 4GEBA 1BJNA 1J32A 2QSRA 3I16A 2ZSMA 1IUGA 3QBOA 1BJ4A 2YKYA 3FZ8A 2VMYA 4ITGA 3CQ4A 5G2PA 1C7NA 4AOAA 1QIRA 3NU7A 2WK7A 1Y4IA 3QGUA 3E2YA 3GZCA 3M5UA 4FFCA 3NUIA 3AV7A 4WP0A 4WLHA 2C81A 4ATPA 2R2NA 4A6UA 2O7CA 1X28A 1M6SA 2GQNA 4IX8A 3MBBA 2BI5A 1M0OA 3HLMA 4J5UA 2FYFA 5EFSA 3VOMA 2VGZA 3H14A 3ZRPA 2VGTA 4CXQA 4LC3A 4WYFA 3BN1A 3BWNC 2CB1A 3AOVA 4OMAA 3W1JA 2CJHA 2D7YA 5D5SA 1LC8A 1CL2A 4IXZA 5G4IA 3PD6A 3A2BA 4AO9A 3LVJA 2VMWA 1AIBA 4BMKA 1ARGA 1BKGA 4KAMA 2W7JA 3CAIA 5BJ3A 4TN4A 5BJ4A 4JEZA 2DGLA 3ASAA 2D64A 4A00A 3PIUA 1TOGA 2VMUA 2DKJA 3E2FA 1V72A 2O0RA 3COGA 5HDMA 4EFFA 2VIBA 2YRRA 1LC7A 3D6KA 3K40A 1MAPA 3ISLA 3EI6A 3L8AA 5M46A 2JJGA 1WSTA 2FNIA 3JW9A 1CL1A 3FZ7A 4ISYA 3CQ5A 1ZC9A 5G0AA 3KGXA 2JGTA 2BWOA 3MC6C 4ADBA 5HXXA 4BA4A 3PDBA 2BKWA 1M0QA 3GBXA 1GDEA 1OHWA 1IX8A 2WKAA 2YCPA 4K2BA 3R4TA 4AZKA 4WYDA 2W7MA 4P3MA 1WKHA 2E7UA 4O6ZA 2Z61A 4TMRA 1VP4A 1TOIA 1ASLA 3FQ7A 5AX8A 2YOBA 3AEJC 4LNLA 2W7LA 2CINA 4JE5D 1SZKA 2GMUA 1D7RA 3ASBA 3AATA 4GRXA 4PIWA 3LWSA 3EI8A 3WX9A 2BI1A 2Z9UA 1QGNA 4UHNA 2D63A 4ZM3A 5F9SA 1H0CA 1YNUA 1AHYA 3NYSA 4JEXA 1ARTA 3JZLA 3G8MA 2VMSA 1SZUA 4DQ6A 3N0LA 1WYTA 1QJ3A 1B9IA 4ZWMA 2ZP7A 1DFOA 2CY8A 3VK3A 2HOYA 2D66A 2OQXA 3DXWA 1YIZA 2VMZA 3HT4A 4WD2A 1GC2A 5FT8A 2VGWA 2VMOA 3JTXA 2W7DA 3NDNA 4OBVA 4R8DA 5IWQA 3NNKA 3P1TA 4R5ZA 2D65A 1G4XA 1M7YA 1O62A 1RVYA 3BWNA 1B8GA 1GBNA 3BB8A 2BI9A 2AY9A 2YCTA 3DR4A 3BC8A 4OBUA 4PFFA 1P3WA 4XJLA 1IAYA 4GSAA 1OHYA 4CXRA 2AY8A 2X8UA 4MQQA 4F5MA 2ZSLA 1B9HA 4E3RA 2Z9WA 4A72A 3MAFB 3E77A 1PFFA 2BWNA 1UU1A 2X3LA 3W1IA 2VMPA 2JJEA 3GJUA 1E5EA 1YOOA 1AAWA 4ZDOA 2BIEA 1U08A 4ITXA 3EUCA 3AEOA 3PJ0A 4E77A 3E9KA 2W8JA 2BYLA 3QN6A 1SPAA 4F5JA 1O61A 2C7TA 4MKKA 1AHEA 4XAUA 2VMNA 1W7MA 1D7VA 3WCNA 2CJGA 5EQCA 1EJIA 4AH3A 3QHXA 4MGRA 2DGMA 4ZASA 4OCAA 2HZPA 1MGVA 1D2FA 3PA9A 4IW7A 2KFPA 4WB0B 1IAXA 4WXBA 2VMTA 2W7EA 3BCBA 3H7FA 4ADDA 4BQ0A 5LH9A 1BQDA 3LVKA 1QZ9A 4EB7A 4IXSA 1OATA 3GETA 3FZ6A 1W7LA 1O4SA 3PDXA 5EUDA 2VMVA 3EI5A 5DX5A 3BCXA 3RI6A 3VK2A 4FL0A 1GEXA 2AY7A 2Z9XA 3FTBA 3N75A 2BI2A 4WXGA 4N0BA 4KYOA 3DC1A 1ASCA 2AY3A 5FT5A 2W8WA 3MADA 1B4XA 1GEYA 3I4JA 1LC5A 1SFFA 1AY4A 2AY1A 3RCHB 4F5KA 4LW4A 4JEYA 3ATHA 4ATQA 2ZY5A 1CZCA 1XI9A 3L44A 1J04A 2VMRA 4ADCA 3LY1A 3B1DA 2YKUA 4TV7A 2FNUA 3B1EA 4ZSWA 1GEWA 1ASBA 1WYVB 2W7KA 3FVXA 3N4XA 2HORA 1S08A 2YCNA 3K7YA 3EI9A 3PGYA 5G09A 3FVSA 1V2FA 3TATA 3BCAA 2ZY2A 3GZDC 4W1WA 4Q76A 3RBLA 2HP1A 1WKGA 2QB3A 3NU8A 2FQ6A 4W1VA 1ARHA 2FM1A 1GCKA 2QB2A 2W8TA 4A6TA 2Z20A 4K05A 1M32A 3USFA 3N7NA 2AY6A 2PB2A 3DR7A 1FC4A 1C9CA 2HOZA 3AEMC 4P7YA 3NX3A 4BA5A 1CQ6A 4CBSA 2DGKA 2YHKA 4GE7A 5F8VA 4M2JA 5EAAA 2D5YA 2VI8A 3E2ZB 4OYTA 1ASNA 3NYUA 4IXOA 5EUNA 3RBFA 3AENB 2G6WA 5E3KA 1DGEA 1XEYA 5G4JA 1I29A 3IF2A 2EO5A 5EAVA 3MKJA 3A9YA 3R9AA 3TFTA 1QITA 4RJYA 1IJIA 3HVYA 5C6UA 1OXOA 3N5MA 3LV2A 2BI3A 4GE9A 4AZJA 4W1XA 2ZC0A 1N8PA 4Q6RA 4LNJA 1SF2A 1DJEA 2OATA 2CH1A 4JEWA 4U1TA 1DTYA 5EUEA 2OGEA 3FKDA 1YIYA 1ASEA 3OP7A 4RKDA 4ZDPA 3FFRA 3EIBA 2PO3A 3B8XA 1QJ5A 2VGVA 1AIAA 3DZZA 3VAXA 5G2QA 4DBCA 5J8QA 4K2MA 2A1VA 2Z67A 4RJ0A 2E7JA 4B9BA 3PPLA 3A9XA 2WB6A 2BYJA 1JS6A 4JE5A 1AMAA 3I5TA 3MAFA 4MY5A 3LVMA 4IY7A 1MAQA 1X0MA 2EZ2A 3DXVA 2GSAA 3TQXA 2VLHA 3NTJA 3EZ1A 1ELUA 5EIGB 5M4DA 4OT8A 4WBTA 2Z1YA 3G0TA 3MEBA 2F8JA 4MSOA 1N31A 1AY8A 1EQBA 4RM1A 4NOGA 1CZEA 3GZDA 2BIGA 3WY7A 2HUFA 1C4KA 1AMRA 1TPLA 4PFNA 4U2HA 5FT4A 1BS0A 1D7UA 3B46A 1Z3ZA 4W5KA 1AICA 3F6TA 4WB0A 2VYCA 2AY5A 5LHAA 2EYQA 4W8IA 3AEMA 1M0PA 1WYUB 1UU2A 1UKJA 2W7GA 3LVLB 4J8LA 5M4BA 4DGTA 1LK9A 4RITA 4M2MA 4W91A 1RV4A 1KKPA 1BJOB 2E7IA 4A0GA 7AATA 1KMKA 4B98A 3HL2A 4XJPA 3HQTA 3ZRQA 1GD9A 3NYTA 4WYEA 2VGSA 2ORDA 3E6GA 4JF0A 4N0WA 3MC6A 3RCHA 3FQ8A 4HF8A 4ZWVA 5D95A 1AMQA 4F5HA 3WCOA 3AEPA 4HVKA 2QLRA 1KMJA 2V0YA 1T3IA 3WGCA 2O1BA 4L0OA 1FG7A 1I48A 3WZFA 1WYVA 2OKJA 1TOJA 3AEJA 3WLXA 2BWPA 1AMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKV A;  3VP6 A;  1FG3 A;  1S09 A;  1TOK A;  3HBX A;  2TPL A;  2YRI A;  2HOX A;  1JS3 A;  1MDX A;  3BWO A;  4KXK A;  1DJU A;  2CJD A;  1GC4 A;  2CTZ A;  3FSL A;  3KE3 A;  2VIA A;  4A0F A;  3FFH A;  1B5P A;  1BJW A;  1VEF A;  1V2E A;  1IX7 A;  3FVU A;  2ZY4 A;  5E4Z A;  3QM2 A;  1AJS B;  1X29 A;  1AX4 A;  1SVV A;  3E2Z A;  4MKJ A;  4XQ2 A;  3G7Q A;  2QBT A;  4UHO A;  2Z1Z A;  3AEN A;  1I43 A;  1AKB A;  1ZOB A;  3LG0 A;  4E1O A;  3AOW A;  3FRK A;  1N2T A;  4CVQ A;  1RV3 A;  4MQP A;  1TAS A;  2JG2 A;  2R5C B;  3CBF A;  2JJF A;  3ELP A;  3F0H A;  2OGA A;  4GE4 A;  3FQA A;  3B1C A;  4QGR A;  2ZY3 A;  3UE8 A;  1YJZ A;  2PB0 A;  4A0H A;  2FN6 A;  4ZM4 A;  1M4N A;  4ZSY A;  3KKI A;  3MAU A;  4A0R A;  8AAT A;  2D7Z A;  3W1H A;  4BHD A;  5M49 A;  4WYC A;  5DB5 A;  4ZAH A;  2C44 A;  3EI7 A;  1ARS A;  1IX6 A;  2C0R A;  2HUU A;  4IYO B;  1LKC A;  4H51 A;  2AY4 A;  3GR9 A;  1AHF A;  1ASM A;  1PMO A;  2EH6 A;  2RFV A;  3QI6 A;  2Q7W A;  1C7G A;  1BQA A;  2E54 A;  1YAA A;  4Y0I A;  2W7H A;  1ASG A;  2CST A;  5FT6 A;  4EU1 A;  4RLG A;  4CBR A;  1ZOD A;  5DJ1 A;  3ZZJ A;  2EZ1 A;  1IBJ A;  1LW4 A;  2V1P A;  1S06 A;  1V2D A;  4XJM A;  2W8V A;  3WKS A;  4EMY A;  1DKA A;  1C0N A;  1G7X A;  1OHV A;  5EIG A;  4A6R A;  4EB5 A;  1CS1 A;  1AHX A;  2AEV A;  2ZJG A;  4XEW A;  2AY2 A;  5JAY A;  3HMU A;  2XH1 A;  3TFU A;  1IVR A;  4LNM A;  4ZDL A;  3NUB A;  2ZYJ A;  1OXP A;  1ASA A;  2CAN A;  2ZUK A;  3IHJ A;  4PVF A;  1G4V A;  2QMA A;  2JJH A;  1E5F A;  3RQ1 A;  3TCM A;  4XK1 A;  4OC9 A;  4UHM A;  2CFB A;  1KKJ A;  2GMS A;  3PD6 B;  1UU0 A;  4OTL A;  1CQ7 A;  3VK4 A;  4GDY A;  1JG8 A;  2JIS A;  3ACZ A;  4MQR A;  3DRD A;  3JWA A;  1Z7D A;  4F5L A;  1TOE A;  1WYU A;  4F5F A;  1W7N A;  4I8A A;  2OKK A;  2VI9 A;  5HHY A;  2BIA A;  2XBN A;  2BHX A;  4LW2 A;  1TAT A;  3HDO A;  1PMM A;  1BJO A;  3EIA A;  3ECD A;  2R5E A;  1MLZ A;  4JEV A;  9AAT A;  1AJR A;  1O69 A;  1LS3 A;  1AKC A;  3A8U X;  2X5F A;  1S0A A;  3AEL A;  3ZZK A;  4E3Q A;  3CQ6 A;  1JF9 A;  4R5F A;  5TF5 A;  3BV0 A;  1ARI A;  2YKX A;  3GSB A;  1MLY A;  3DYD A;  3ZRR A;  1ASF A;  1QIS A;  3PDB B;  3NRA A;  2D61 A;  2VMX A;  1ASD A;  3OKS A;  1AHG A;  3DOD A;  1SZS A;  4K2I A;  2CH2 A;  1H1C A;  2Z9V A;  5DJ9 A;  1KL1 A;  1ORD A;  1AY5 A;  3FCR A;  4WYA A;  3PAA A;  1CQ8 A;  1AKA A;  1GC0 A;  1S07 A;  1W3U A;  2AEU A;  3K28 A;  4RIZ A;  2W7I A;  1VJO A;  3WGB A;  2EGY A;  4RKC A;  1ECX A;  1TAR A;  2HP2 A;  4RAE A;  3FDB A;  1CJ0 A;  1G7W A;  4WYG A;  3GWP A;  2R0T A;  4WLJ A;  2X5D A;  3UAK A;  1AJS A;  1YJS A;  1BT4 A;  1PG8 A;  1B5O A;  1DGD A;  1MDO A;  2EPJ A;  3BS8 A;  3KGW A;  2NMP A;  4UQV A;  2GB3 A;  2WK9 A;  3T32 A;  3UWC A;  1YJY A;  3Q8N A;  2W8U A;  1WYT B;  2VLF A;  1BW0 A;  4XJO A;  4Y0H A;  3FDD A;  3ELE A;  1RVU A;  5K8B A;  3QPG A;  1AAM A;  4JF1 A;  2DR1 A;  5I92 A;  3FD0 A;  2R5C A;  1MDZ A;  1EG5 A;  4Q31 A;  4AO4 A;  2W7F A;  3WKR A;  3F9T A;  2VGU A;  3A9Z A;  2AAT A;  4M2K A;  1D7S A;  2VMQ A;  4Y0D A;  4R2N A;  2DKB A;  3II0 A;  4F5I A;  1W23 A;  1DJ9 A;  1M0N A;  1X2A A;  2HUI A;  3DU4 A;  4Q75 A;  4WXF A;  4ZLV A;  4F4E A;  1C7O A;  4ADE A;  2WK8 A;  4IYO A;  1GC3 A;  4UOY A;  1LW5 A;  3JU7 A;  5E5I A;  3EZS A;  3RUY A;  3JWB A;  1ELQ A;  1I41 A;  2DOU A;  4F5G A;  1KL2 A;  3P6K A;  2QA3 A;  4GEB A;  1BJN A;  1J32 A;  3I16 A;  2ZSM A;  1IUG A;  3QBO A;  1BJ4 A;  2YKY A;  3FZ8 A;  2VMY A;  4ITG A;  3CQ4 A;  5G2P A;  1C7N A;  4AOA A;  1QIR A;  3NU7 A;  2WK7 A;  1Y4I A;  3QGU A;  3E2Y A;  3GZC A;  3M5U A;  4FFC A;  3NUI A;  3AV7 A;  4WP0 A;  4WLH A;  2C81 A;  4ATP A;  2R2N A;  4A6U A;  2O7C A;  1X28 A;  1M6S A;  2GQN A;  4IX8 A;  3MBB A;  2BI5 A;  1M0O A;  3HLM A;  4J5U A;  2FYF A;  5EFS A;  3VOM A;  2VGZ A;  3H14 A;  3ZRP A;  2VGT A;  4CXQ A;  4LC3 A;  4WYF A;  3BN1 A;  3BWN C;  2CB1 A;  3AOV A;  4OMA A;  3W1J A;  2CJH A;  2D7Y A;  5D5S A;  1LC8 A;  1CL2 A;  4IXZ A;  5G4I A;  3PD6 A;  3A2B A;  4AO9 A;  3LVJ A;  2VMW A;  1AIB A;  4BMK A;  1ARG A;  1BKG A;  4KAM A;  2W7J A;  3CAI A;  5BJ3 A;  4TN4 A;  5BJ4 A;  4JEZ A;  2DGL A;  3ASA A;  2D64 A;  4A00 A;  3PIU A;  1TOG A;  2VMU A;  2DKJ A;  3E2F A;  1V72 A;  2O0R A;  3COG A;  5HDM A;  4EFF A;  2VIB A;  2YRR A;  1LC7 A;  3D6K A;  3K40 A;  1MAP A;  3ISL A;  3EI6 A;  3L8A A;  5M46 A;  2JJG A;  1WST A;  2FNI A;  3JW9 A;  1CL1 A;  3FZ7 A;  4ISY A;  3CQ5 A;  1ZC9 A;  5G0A A;  3KGX A;  2JGT A;  2BWO A;  3MC6 C;  4ADB A;  5HXX A;  4BA4 A;  3PDB A;  2BKW A;  1M0Q A;  3GBX A;  1GDE A;  1OHW A;  1IX8 A;  2WKA A;  2YCP A;  4K2B A;  3R4T A;  4AZK A;  4WYD A;  2W7M A;  4P3M A;  1WKH A;  2E7U A;  4O6Z A;  2Z61 A;  4TMR A;  1VP4 A;  1TOI A;  1ASL A;  3FQ7 A;  5AX8 A;  2YOB A;  3AEJ C;  4LNL A;  2W7L A;  2CIN A;  4JE5 D;  1SZK A;  2GMU A;  1D7R A;  3ASB A;  3AAT A;  4GRX A;  4PIW A;  3LWS A;  3EI8 A;  3WX9 A;  2BI1 A;  2Z9U A;  1QGN A;  4UHN A;  2D63 A;  4ZM3 A;  5F9S A;  1H0C A;  1YNU A;  1AHY A;  3NYS A;  4JEX A;  1ART A;  3JZL A;  3G8M A;  2VMS A;  1SZU A;  4DQ6 A;  3N0L A;  1WYT A;  1QJ3 A;  1B9I A;  4ZWM A;  2ZP7 A;  1DFO A;  2CY8 A;  3VK3 A;  2HOY A;  2D66 A;  2OQX A;  3DXW A;  1YIZ A;  2VMZ A;  3HT4 A;  4WD2 A;  1GC2 A;  5FT8 A;  2VGW A;  2VMO A;  3JTX A;  2W7D A;  3NDN A;  4OBV A;  4R8D A;  5IWQ A;  3NNK A;  3P1T A;  4R5Z A;  2D65 A;  1G4X A;  1M7Y A;  1O62 A;  1RVY A;  3BWN A;  1B8G A;  1GBN A;  3BB8 A;  2BI9 A;  2AY9 A;  2YCT A;  3DR4 A;  3BC8 A;  4OBU A;  4PFF A;  1P3W A;  4XJL A;  1IAY A;  4GSA A;  1OHY A;  4CXR A;  2AY8 A;  2X8U A;  4MQQ A;  4F5M A;  2ZSL A;  1B9H A;  4E3R A;  2Z9W A;  4A72 A;  3MAF B;  3E77 A;  1PFF A;  2BWN A;  1UU1 A;  2X3L A;  3W1I A;  2VMP A;  2JJE A;  3GJU A;  1E5E A;  1YOO A;  1AAW A;  4ZDO A;  2BIE A;  1U08 A;  4ITX A;  3EUC A;  3AEO A;  3PJ0 A;  4E77 A;  3E9K A;  2W8J A;  2BYL A;  3QN6 A;  1SPA A;  4F5J A;  1O61 A;  2C7T A;  4MKK A;  1AHE A;  4XAU A;  2VMN A;  1W7M A;  1D7V A;  3WCN A;  2CJG A;  5EQC A;  1EJI A;  4AH3 A;  3QHX A;  4MGR A;  2DGM A;  4ZAS A;  4OCA A;  2HZP A;  1MGV A;  1D2F A;  3PA9 A;  4IW7 A;  4WB0 B;  1IAX A;  4WXB A;  2VMT A;  2W7E A;  3BCB A;  3H7F A;  4ADD A;  4BQ0 A;  5LH9 A;  1BQD A;  3LVK A;  1QZ9 A;  4EB7 A;  4IXS A;  1OAT A;  3GET A;  3FZ6 A;  1W7L A;  1O4S A;  3PDX A;  5EUD A;  2VMV A;  3EI5 A;  5DX5 A;  3BCX A;  3RI6 A;  3VK2 A;  4FL0 A;  1GEX A;  2AY7 A;  2Z9X A;  3FTB A;  3N75 A;  2BI2 A;  4WXG A;  4N0B A;  4KYO A;  3DC1 A;  1ASC A;  2AY3 A;  5FT5 A;  2W8W A;  3MAD A;  1B4X A;  1GEY A;  3I4J A;  1LC5 A;  1SFF A;  1AY4 A;  2AY1 A;  3RCH B;  4F5K A;  4LW4 A;  4JEY A;  3ATH A;  4ATQ A;  2ZY5 A;  1CZC A;  1XI9 A;  3L44 A;  1J04 A;  2VMR A;  4ADC A;  3LY1 A;  3B1D A;  2YKU A;  4TV7 A;  2FNU A;  3B1E A;  4ZSW A;  1GEW A;  1ASB A;  1WYV B;  2W7K A;  3FVX A;  2HOR A;  1S08 A;  2YCN A;  3K7Y A;  3EI9 A;  3PGY A;  5G09 A;  3FVS A;  1V2F A;  3TAT A;  3BCA A;  2ZY2 A;  3GZD C;  4W1W A;  4Q76 A;  3RBL A;  2HP1 A;  1WKG A;  2QB3 A;  3NU8 A;  2FQ6 A;  4W1V A;  1ARH A;  2FM1 A;  1GCK A;  2QB2 A;  2W8T A;  4A6T A;  2Z20 A;  1M32 A;  3USF A;  2AY6 A;  2PB2 A;  3DR7 A;  1FC4 A;  1C9C A;  2HOZ A;  3AEM C;  4P7Y A;  3NX3 A;  4BA5 A;  1CQ6 A;  4CBS A;  2DGK A;  2YHK A;  4GE7 A;  5F8V A;  4M2J A;  5EAA A;  2D5Y A;  2VI8 A;  3E2Z B;  4OYT A;  1ASN A;  3NYU A;  4IXO A;  5EUN A;  3RBF A;  3AEN B;  2G6W A;  5E3K A;  1DGE A;  1XEY A;  5G4J A;  1I29 A;  3IF2 A;  2EO5 A;  5EAV A;  3MKJ A;  3A9Y A;  3R9A A;  3TFT A;  1QIT A;  4RJY A;  1IJI A;  3HVY A;  5C6U A;  1OXO A;  3N5M A;  3LV2 A;  2BI3 A;  4GE9 A;  4AZJ A;  4W1X A;  2ZC0 A;  1N8P A;  4Q6R A;  4LNJ A;  1SF2 A;  1DJE A;  2OAT A;  2CH1 A;  4JEW A;  4U1T A;  1DTY A;  5EUE A;  2OGE A;  3FKD A;  1YIY A;  1ASE A;  3OP7 A;  4RKD A;  4ZDP A;  3FFR A;  3EIB A;  2PO3 A;  3B8X A;  1QJ5 A;  2VGV A;  1AIA A;  3DZZ A;  3VAX A;  5G2Q A;  4DBC A;  5J8Q A;  4K2M A;  2Z67 A;  4RJ0 A;  2E7J A;  4B9B A;  3PPL A;  3A9X A;  2BYJ A;  1JS6 A;  4JE5 A;  1AMA A;  3I5T A;  3MAF A;  4MY5 A;  3LVM A;  4IY7 A;  1MAQ A;  1X0M A;  2EZ2 A;  3DXV A;  2GSA A;  3TQX A;  2VLH A;  3NTJ A;  3EZ1 A;  1ELU A;  5EIG B;  5M4D A;  4OT8 A;  4WBT A;  2Z1Y A;  3G0T A;  3MEB A;  2F8J A;  4MSO A;  1N31 A;  1AY8 A;  1EQB A;  4RM1 A;  4NOG A;  1CZE A;  3GZD A;  2BIG A;  3WY7 A;  2HUF A;  1C4K A;  1AMR A;  1TPL A;  4PFN A;  4U2H A;  5FT4 A;  1BS0 A;  1D7U A;  3B46 A;  1Z3Z A;  4W5K A;  1AIC A;  3F6T A;  4WB0 A;  2VYC A;  2AY5 A;  5LHA A;  4W8I A;  3AEM A;  1M0P A;  1WYU B;  1UU2 A;  1UKJ A;  2W7G A;  3LVL B;  4J8L A;  5M4B A;  4DGT A;  1LK9 A;  4RIT A;  4M2M A;  4W91 A;  1RV4 A;  1KKP A;  1BJO B;  2E7I A;  4A0G A;  7AAT A;  1KMK A;  4B98 A;  3HL2 A;  4XJP A;  3HQT A;  3ZRQ A;  1GD9 A;  3NYT A;  4WYE A;  2VGS A;  2ORD A;  3E6G A;  4JF0 A;  4N0W A;  3MC6 A;  3RCH A;  3FQ8 A;  4HF8 A;  4ZWV A;  5D95 A;  1AMQ A;  4F5H A;  3WCO A;  3AEP A;  4HVK A;  2QLR A;  1KMJ A;  2V0Y A;  1T3I A;  3WGC A;  2O1B A;  4L0O A;  1FG7 A;  1I48 A;  3WZF A;  1WYV A;  2OKJ A;  1TOJ A;  3AEJ A;  3WLX A;  2BWP A;  1AMS A; 
#chains in the Genus database with same CATH topology
 2YKV A;  3VP6 A;  1FG3 A;  1S09 A;  1TOK A;  3HBX A;  2TPL A;  2YRI A;  2HOX A;  1JS3 A;  1MDX A;  3BWO A;  4KXK A;  1DJU A;  2CJD A;  1GC4 A;  2CTZ A;  3FSL A;  3KE3 A;  2VIA A;  4A0F A;  3FFH A;  1B5P A;  3N4S A;  1BJW A;  1VEF A;  1V2E A;  1IX7 A;  3FVU A;  2ZY4 A;  5E4Z A;  3QM2 A;  1AJS B;  1X29 A;  1AX4 A;  1SVV A;  3E2Z A;  4MKJ A;  4XQ2 A;  3G7Q A;  2QBT A;  4UHO A;  2Z1Z A;  3AEN A;  1I43 A;  1AKB A;  1ZOB A;  3LG0 A;  4E1O A;  3AOW A;  3FRK A;  1N2T A;  4CVQ A;  1RV3 A;  4MQP A;  1TAS A;  2JG2 A;  2R5C B;  3CBF A;  2JJF A;  3ELP A;  3F0H A;  2OGA A;  4GE4 A;  3FQA A;  3B1C A;  4QGR A;  2ZY3 A;  3UE8 A;  1YJZ A;  2PB0 A;  4A0H A;  2FN6 A;  4ZM4 A;  1M4N A;  4ZSY A;  3KKI A;  3MAU A;  4A0R A;  8AAT A;  2D7Z A;  3W1H A;  3N4R A;  4BHD A;  5M49 A;  4WYC A;  5DB5 A;  4ZAH A;  2C44 A;  3EI7 A;  1ARS A;  1IX6 A;  2C0R A;  2HUU A;  4IYO B;  1LKC A;  4H51 A;  2AY4 A;  3GR9 A;  1AHF A;  1ASM A;  1PMO A;  2EH6 A;  2RFV A;  3QI6 A;  2Q7W A;  1C7G A;  1BQA A;  4H63 Q;  2E54 A;  1YAA A;  4Y0I A;  2W7H A;  1ASG A;  2CST A;  5FT6 A;  4EU1 A;  4RLG A;  4CBR A;  1ZOD A;  5DJ1 A;  3ZZJ A;  2EZ1 A;  1IBJ A;  1LW4 A;  2V1P A;  1S06 A;  1V2D A;  4XJM A;  2W8V A;  3WKS A;  4EMY A;  1DKA A;  1C0N A;  1G7X A;  1OHV A;  5EIG A;  4A6R A;  4EB5 A;  1CS1 A;  1AHX A;  2AEV A;  2ZJG A;  4XEW A;  2AY2 A;  5JAY A;  3HMU A;  2XH1 A;  3TFU A;  1IVR A;  4LNM A;  4ZDL A;  3NUB A;  2ZYJ A;  1OXP A;  1ASA A;  2CAN A;  2ZUK A;  3IHJ A;  4PVF A;  5KTB A;  1G4V A;  2QMA A;  2JJH A;  1E5F A;  2G7J A;  3RQ1 A;  3TCM A;  4XK1 A;  4OC9 A;  4UHM A;  2CFB A;  1KKJ A;  2GMS A;  3PD6 B;  1UU0 A;  4OTL A;  1CQ7 A;  3VK4 A;  4GDY A;  1JG8 A;  2JIS A;  3ACZ A;  4MQR A;  3DRD A;  3JWA A;  1Z7D A;  4F5L A;  1TOE A;  1WYU A;  4F5F A;  1W7N A;  4I8A A;  2OKK A;  2VI9 A;  5HHY A;  2BIA A;  2XBN A;  2BHX A;  4LW2 A;  1TAT A;  3HDO A;  1PMM A;  1BJO A;  3EIA A;  3ECD A;  2R5E A;  1MLZ A;  4JEV A;  9AAT A;  1AJR A;  1O69 A;  1LS3 A;  1AKC A;  3A8U X;  2X5F A;  1S0A A;  3AEL A;  3ZZK A;  4E3Q A;  3CQ6 A;  2FKI A;  1JF9 A;  4R5F A;  5TF5 A;  3BV0 A;  1ARI A;  2YKX A;  3GSB A;  1MLY A;  3DYD A;  3ZRR A;  1ASF A;  1QIS A;  3PDB B;  3NRA A;  2D61 A;  2VMX A;  1ASD A;  3OKS A;  1AHG A;  3DOD A;  1SZS A;  4K2I A;  2CH2 A;  1H1C A;  2Z9V A;  5DJ9 A;  1KL1 A;  1ORD A;  1AY5 A;  3FCR A;  4WYA A;  3PAA A;  1CQ8 A;  1AKA A;  1GC0 A;  1S07 A;  1W3U A;  2AEU A;  3K28 A;  4RIZ A;  2W7I A;  1VJO A;  3WGB A;  2EGY A;  4RKC A;  1ECX A;  1TAR A;  2HP2 A;  4RAE A;  3FDB A;  1CJ0 A;  1G7W A;  4WYG A;  3GWP A;  2R0T A;  4WLJ A;  2X5D A;  3UAK A;  1AJS A;  1YJS A;  1BT4 A;  1PG8 A;  1B5O A;  1DGD A;  1MDO A;  2EPJ A;  3BS8 A;  3KGW A;  2NMP A;  4UQV A;  2GB3 A;  2WK9 A;  3T32 A;  3UWC A;  1YJY A;  3Q8N A;  2W8U A;  1WYT B;  2VLF A;  1BW0 A;  4XJO A;  4Y0H A;  3FDD A;  3ELE A;  1RVU A;  5K8B A;  3QPG A;  1AAM A;  4JF1 A;  2DR1 A;  5I92 A;  3H9X A;  3FD0 A;  2R5C A;  1MDZ A;  1EG5 A;  4Q31 A;  4AO4 A;  2W7F A;  3WKR A;  3F9T A;  2VGU A;  3A9Z A;  2AAT A;  4M2K A;  1D7S A;  2VMQ A;  4Y0D A;  4R2N A;  2DKB A;  3II0 A;  4F5I A;  1W23 A;  1DJ9 A;  1M0N A;  1X2A A;  2HUI A;  3DU4 A;  4Q75 A;  4WXF A;  4ZLV A;  4F4E A;  1C7O A;  4ADE A;  2WK8 A;  4IYO A;  1GC3 A;  4UOY A;  1LW5 A;  3JU7 A;  5E5I A;  3EZS A;  3RUY A;  3JWB A;  1ELQ A;  1I41 A;  2DOU A;  4F5G A;  1KL2 A;  3P6K A;  2QA3 A;  4GEB A;  1BJN A;  1J32 A;  2QSR A;  3I16 A;  2ZSM A;  1IUG A;  3QBO A;  1BJ4 A;  2YKY A;  3FZ8 A;  2VMY A;  4ITG A;  3CQ4 A;  5G2P A;  1C7N A;  4AOA A;  1QIR A;  3NU7 A;  2WK7 A;  1Y4I A;  3QGU A;  3E2Y A;  3GZC A;  3M5U A;  4FFC A;  3NUI A;  3AV7 A;  4WP0 A;  4WLH A;  2C81 A;  4ATP A;  2R2N A;  4A6U A;  2O7C A;  1X28 A;  1M6S A;  2GQN A;  4IX8 A;  3MBB A;  2BI5 A;  1M0O A;  3HLM A;  4J5U A;  2FYF A;  5EFS A;  3VOM A;  2VGZ A;  3H14 A;  3ZRP A;  2VGT A;  4CXQ A;  4LC3 A;  4WYF A;  3BN1 A;  3BWN C;  2CB1 A;  3AOV A;  4OMA A;  3W1J A;  2CJH A;  2D7Y A;  5D5S A;  1LC8 A;  1CL2 A;  4IXZ A;  5G4I A;  3PD6 A;  3A2B A;  4AO9 A;  3LVJ A;  2VMW A;  1AIB A;  4BMK A;  1ARG A;  1BKG A;  4KAM A;  2W7J A;  3CAI A;  5BJ3 A;  4TN4 A;  5BJ4 A;  4JEZ A;  2DGL A;  3ASA A;  2D64 A;  4A00 A;  3PIU A;  1TOG A;  2VMU A;  2DKJ A;  3E2F A;  1V72 A;  2O0R A;  3COG A;  5HDM A;  4EFF A;  2VIB A;  2YRR A;  1LC7 A;  3D6K A;  3K40 A;  1MAP A;  3ISL A;  3EI6 A;  3L8A A;  5M46 A;  2JJG A;  1WST A;  2FNI A;  3JW9 A;  1CL1 A;  3FZ7 A;  4ISY A;  3CQ5 A;  1ZC9 A;  5G0A A;  3KGX A;  2JGT A;  2BWO A;  3MC6 C;  4ADB A;  5HXX A;  4BA4 A;  3PDB A;  2BKW A;  1M0Q A;  3GBX A;  1GDE A;  1OHW A;  1IX8 A;  2WKA A;  2YCP A;  4K2B A;  3R4T A;  4AZK A;  4WYD A;  2W7M A;  4P3M A;  1WKH A;  2E7U A;  4O6Z A;  2Z61 A;  4TMR A;  1VP4 A;  1TOI A;  1ASL A;  3FQ7 A;  5AX8 A;  2YOB A;  3AEJ C;  4LNL A;  2W7L A;  2CIN A;  4JE5 D;  1SZK A;  2GMU A;  1D7R A;  3ASB A;  3AAT A;  4GRX A;  4PIW A;  3LWS A;  3EI8 A;  3WX9 A;  2BI1 A;  2Z9U A;  1QGN A;  4UHN A;  2D63 A;  4ZM3 A;  5F9S A;  1H0C A;  1YNU A;  1AHY A;  3NYS A;  4JEX A;  1ART A;  3JZL A;  3G8M A;  2VMS A;  1SZU A;  4DQ6 A;  3N0L A;  1WYT A;  1QJ3 A;  1B9I A;  4ZWM A;  2ZP7 A;  1DFO A;  2CY8 A;  3VK3 A;  2HOY A;  2D66 A;  2OQX A;  3DXW A;  1YIZ A;  2VMZ A;  3HT4 A;  4WD2 A;  1GC2 A;  5FT8 A;  2VGW A;  2VMO A;  3JTX A;  2W7D A;  3NDN A;  4OBV A;  4R8D A;  5IWQ A;  3NNK A;  3P1T A;  4R5Z A;  2D65 A;  1G4X A;  1M7Y A;  1O62 A;  1RVY A;  3BWN A;  1B8G A;  1GBN A;  3BB8 A;  2BI9 A;  2AY9 A;  2YCT A;  3DR4 A;  3BC8 A;  4OBU A;  4PFF A;  1P3W A;  4XJL A;  1IAY A;  4GSA A;  1OHY A;  4CXR A;  2AY8 A;  2X8U A;  4MQQ A;  4F5M A;  2ZSL A;  1B9H A;  4E3R A;  2Z9W A;  4A72 A;  3MAF B;  3E77 A;  1PFF A;  2BWN A;  1UU1 A;  2X3L A;  3W1I A;  2VMP A;  2JJE A;  3GJU A;  1E5E A;  1YOO A;  1AAW A;  4ZDO A;  2BIE A;  1U08 A;  4ITX A;  3EUC A;  3AEO A;  3PJ0 A;  4E77 A;  3E9K A;  2W8J A;  2BYL A;  3QN6 A;  1SPA A;  4F5J A;  1O61 A;  2C7T A;  4MKK A;  1AHE A;  4XAU A;  2VMN A;  1W7M A;  1D7V A;  3WCN A;  2CJG A;  5EQC A;  1EJI A;  4AH3 A;  3QHX A;  4MGR A;  2DGM A;  4ZAS A;  4OCA A;  2HZP A;  1MGV A;  1D2F A;  3PA9 A;  4IW7 A;  2KFP A;  4WB0 B;  1IAX A;  4WXB A;  2VMT A;  2W7E A;  3BCB A;  3H7F A;  4ADD A;  4BQ0 A;  5LH9 A;  1BQD A;  3LVK A;  1QZ9 A;  4EB7 A;  4IXS A;  1OAT A;  3GET A;  3FZ6 A;  1W7L A;  1O4S A;  3PDX A;  5EUD A;  2VMV A;  3EI5 A;  5DX5 A;  3BCX A;  3RI6 A;  3VK2 A;  4FL0 A;  1GEX A;  2AY7 A;  2Z9X A;  3FTB A;  3N75 A;  2BI2 A;  4WXG A;  4N0B A;  4KYO A;  3DC1 A;  1ASC A;  2AY3 A;  5FT5 A;  2W8W A;  3MAD A;  1B4X A;  1GEY A;  3I4J A;  1LC5 A;  1SFF A;  1AY4 A;  2AY1 A;  3RCH B;  4F5K A;  4LW4 A;  4JEY A;  3ATH A;  4ATQ A;  2ZY5 A;  1CZC A;  1XI9 A;  3L44 A;  1J04 A;  2VMR A;  4ADC A;  3LY1 A;  3B1D A;  2YKU A;  4TV7 A;  2FNU A;  3B1E A;  4ZSW A;  1GEW A;  1ASB A;  1WYV B;  2W7K A;  3FVX A;  3N4X A;  2HOR A;  1S08 A;  2YCN A;  3K7Y A;  3EI9 A;  3PGY A;  5G09 A;  3FVS A;  1V2F A;  3TAT A;  3BCA A;  2ZY2 A;  3GZD C;  4W1W A;  4Q76 A;  3RBL A;  2HP1 A;  1WKG A;  2QB3 A;  3NU8 A;  2FQ6 A;  4W1V A;  1ARH A;  2FM1 A;  1GCK A;  2QB2 A;  2W8T A;  4A6T A;  2Z20 A;  4K05 A;  1M32 A;  3USF A;  3N7N A;  2AY6 A;  2PB2 A;  3DR7 A;  1FC4 A;  1C9C A;  2HOZ A;  3AEM C;  4P7Y A;  3NX3 A;  4BA5 A;  1CQ6 A;  4CBS A;  2DGK A;  2YHK A;  4GE7 A;  5F8V A;  4M2J A;  5EAA A;  2D5Y A;  2VI8 A;  3E2Z B;  4OYT A;  1ASN A;  3NYU A;  4IXO A;  5EUN A;  3RBF A;  3AEN B;  2G6W A;  5E3K A;  1DGE A;  1XEY A;  5G4J A;  1I29 A;  3IF2 A;  2EO5 A;  5EAV A;  3MKJ A;  3A9Y A;  3R9A A;  3TFT A;  1QIT A;  4RJY A;  1IJI A;  3HVY A;  5C6U A;  1OXO A;  3N5M A;  3LV2 A;  2BI3 A;  4GE9 A;  4AZJ A;  4W1X A;  2ZC0 A;  1N8P A;  4Q6R A;  4LNJ A;  1SF2 A;  1DJE A;  2OAT A;  2CH1 A;  4JEW A;  4U1T A;  1DTY A;  5EUE A;  2OGE A;  3FKD A;  1YIY A;  1ASE A;  3OP7 A;  4RKD A;  4ZDP A;  3FFR A;  3EIB A;  2PO3 A;  3B8X A;  1QJ5 A;  2VGV A;  1AIA A;  3DZZ A;  3VAX A;  5G2Q A;  4DBC A;  5J8Q A;  4K2M A;  2A1V A;  2Z67 A;  4RJ0 A;  2E7J A;  4B9B A;  3PPL A;  3A9X A;  2WB6 A;  2BYJ A;  1JS6 A;  4JE5 A;  1AMA A;  3I5T A;  3MAF A;  4MY5 A;  3LVM A;  4IY7 A;  1MAQ A;  1X0M A;  2EZ2 A;  3DXV A;  2GSA A;  3TQX A;  2VLH A;  3NTJ A;  3EZ1 A;  1ELU A;  5EIG B;  5M4D A;  4OT8 A;  4WBT A;  2Z1Y A;  3G0T A;  3MEB A;  2F8J A;  4MSO A;  1N31 A;  1AY8 A;  1EQB A;  4RM1 A;  4NOG A;  1CZE A;  3GZD A;  2BIG A;  3WY7 A;  2HUF A;  1C4K A;  1AMR A;  1TPL A;  4PFN A;  4U2H A;  5FT4 A;  1BS0 A;  1D7U A;  3B46 A;  1Z3Z A;  4W5K A;  1KAF A;  1AIC A;  3F6T A;  4WB0 A;  2VYC A;  2AY5 A;  5LHA A;  2EYQ A;  4W8I A;  3AEM A;  1M0P A;  1WYU B;  1UU2 A;  1UKJ A;  2W7G A;  3LVL B;  4J8L A;  5M4B A;  4DGT A;  1LK9 A;  4RIT A;  4M2M A;  4W91 A;  1RV4 A;  1KKP A;  1BJO B;  2E7I A;  4A0G A;  7AAT A;  1KMK A;  4B98 A;  3HL2 A;  4XJP A;  3HQT A;  3ZRQ A;  1GD9 A;  3NYT A;  4WYE A;  2VGS A;  2ORD A;  3E6G A;  4JF0 A;  4N0W A;  3MC6 A;  3RCH A;  3FQ8 A;  4HF8 A;  4ZWV A;  5D95 A;  1AMQ A;  4F5H A;  3WCO A;  3AEP A;  4HVK A;  2QLR A;  1KMJ A;  2V0Y A;  1T3I A;  3WGC A;  2O1B A;  4L0O A;  1FG7 A;  1I48 A;  3WZF A;  1WYV A;  2OKJ A;  1TOJ A;  3AEJ A;  3WLX A;  2BWP A;  1AMS A; 
#chains in the Genus database with same CATH homology
 2YKV A;  3VP6 A;  1FG3 A;  1S09 A;  1TOK A;  3HBX A;  2TPL A;  2YRI A;  2HOX A;  1JS3 A;  1MDX A;  3BWO A;  4KXK A;  1DJU A;  2CJD A;  1GC4 A;  2CTZ A;  3FSL A;  3KE3 A;  2VIA A;  4A0F A;  3FFH A;  1B5P A;  3N4S A;  1BJW A;  1VEF A;  1V2E A;  1IX7 A;  3FVU A;  2ZY4 A;  5E4Z A;  3QM2 A;  1AJS B;  1X29 A;  1AX4 A;  1SVV A;  3E2Z A;  4MKJ A;  4XQ2 A;  3G7Q A;  2QBT A;  4UHO A;  2Z1Z A;  3AEN A;  1I43 A;  1AKB A;  1ZOB A;  3LG0 A;  4E1O A;  3AOW A;  3FRK A;  1N2T A;  4CVQ A;  1RV3 A;  4MQP A;  1TAS A;  2JG2 A;  2R5C B;  3CBF A;  2JJF A;  3ELP A;  3F0H A;  2OGA A;  4GE4 A;  3FQA A;  3B1C A;  4QGR A;  2ZY3 A;  3UE8 A;  1YJZ A;  2PB0 A;  4A0H A;  2FN6 A;  4ZM4 A;  1M4N A;  4ZSY A;  3KKI A;  3MAU A;  4A0R A;  8AAT A;  2D7Z A;  3W1H A;  3N4R A;  4BHD A;  5M49 A;  4WYC A;  5DB5 A;  4ZAH A;  2C44 A;  3EI7 A;  1ARS A;  1IX6 A;  2C0R A;  2HUU A;  4IYO B;  1LKC A;  4H51 A;  2AY4 A;  3GR9 A;  1AHF A;  1ASM A;  1PMO A;  2EH6 A;  2RFV A;  3QI6 A;  2Q7W A;  1C7G A;  1BQA A;  4H63 Q;  2E54 A;  1YAA A;  4Y0I A;  2W7H A;  1ASG A;  2CST A;  5FT6 A;  4EU1 A;  4RLG A;  4CBR A;  1ZOD A;  5DJ1 A;  3ZZJ A;  2EZ1 A;  1IBJ A;  1LW4 A;  2V1P A;  1S06 A;  1V2D A;  4XJM A;  2W8V A;  3WKS A;  4EMY A;  1DKA A;  1C0N A;  1G7X A;  1OHV A;  5EIG A;  4A6R A;  4EB5 A;  1CS1 A;  1AHX A;  2AEV A;  2ZJG A;  4XEW A;  2AY2 A;  5JAY A;  3HMU A;  2XH1 A;  3TFU A;  1IVR A;  4LNM A;  4ZDL A;  3NUB A;  2ZYJ A;  1OXP A;  1ASA A;  2CAN A;  2ZUK A;  3IHJ A;  4PVF A;  5KTB A;  1G4V A;  2QMA A;  2JJH A;  1E5F A;  2G7J A;  3RQ1 A;  3TCM A;  4XK1 A;  4OC9 A;  4UHM A;  2CFB A;  1KKJ A;  2GMS A;  3PD6 B;  1UU0 A;  4OTL A;  1CQ7 A;  3VK4 A;  4GDY A;  1JG8 A;  2JIS A;  3ACZ A;  4MQR A;  3DRD A;  3JWA A;  1Z7D A;  4F5L A;  1TOE A;  1WYU A;  4F5F A;  1W7N A;  4I8A A;  2OKK A;  2VI9 A;  5HHY A;  2BIA A;  2XBN A;  2BHX A;  4LW2 A;  1TAT A;  3HDO A;  1PMM A;  1BJO A;  3EIA A;  3ECD A;  2R5E A;  1MLZ A;  4JEV A;  9AAT A;  1AJR A;  1O69 A;  1LS3 A;  1AKC A;  3A8U X;  2X5F A;  1S0A A;  3AEL A;  3ZZK A;  4E3Q A;  3CQ6 A;  2FKI A;  1JF9 A;  4R5F A;  5TF5 A;  3BV0 A;  1ARI A;  2YKX A;  3GSB A;  1MLY A;  3DYD A;  3ZRR A;  1ASF A;  1QIS A;  3PDB B;  3NRA A;  2D61 A;  2VMX A;  1ASD A;  3OKS A;  1AHG A;  3DOD A;  1SZS A;  4K2I A;  2CH2 A;  1H1C A;  2Z9V A;  5DJ9 A;  1KL1 A;  1ORD A;  1AY5 A;  3FCR A;  4WYA A;  3PAA A;  1CQ8 A;  1AKA A;  1GC0 A;  1S07 A;  1W3U A;  2AEU A;  3K28 A;  4RIZ A;  2W7I A;  1VJO A;  3WGB A;  2EGY A;  4RKC A;  1ECX A;  1TAR A;  2HP2 A;  4RAE A;  3FDB A;  1CJ0 A;  1G7W A;  4WYG A;  3GWP A;  2R0T A;  4WLJ A;  2X5D A;  3UAK A;  1AJS A;  1YJS A;  1BT4 A;  1PG8 A;  1B5O A;  1DGD A;  1MDO A;  2EPJ A;  3BS8 A;  3KGW A;  2NMP A;  4UQV A;  2GB3 A;  2WK9 A;  3T32 A;  3UWC A;  1YJY A;  3Q8N A;  2W8U A;  1WYT B;  2VLF A;  1BW0 A;  4XJO A;  4Y0H A;  3FDD A;  3ELE A;  1RVU A;  5K8B A;  3QPG A;  1AAM A;  4JF1 A;  2DR1 A;  5I92 A;  3H9X A;  3FD0 A;  2R5C A;  1MDZ A;  1EG5 A;  4Q31 A;  4AO4 A;  2W7F A;  3WKR A;  3F9T A;  2VGU A;  3A9Z A;  2AAT A;  4M2K A;  1D7S A;  2VMQ A;  4Y0D A;  4R2N A;  2DKB A;  3II0 A;  4F5I A;  1W23 A;  1DJ9 A;  1M0N A;  1X2A A;  2HUI A;  3DU4 A;  4Q75 A;  4WXF A;  4ZLV A;  4F4E A;  1C7O A;  4ADE A;  2WK8 A;  4IYO A;  1GC3 A;  4UOY A;  1LW5 A;  3JU7 A;  5E5I A;  3EZS A;  3RUY A;  3JWB A;  1ELQ A;  1I41 A;  2DOU A;  4F5G A;  1KL2 A;  3P6K A;  2QA3 A;  4GEB A;  1BJN A;  1J32 A;  2QSR A;  3I16 A;  2ZSM A;  1IUG A;  3QBO A;  1BJ4 A;  2YKY A;  3FZ8 A;  2VMY A;  4ITG A;  3CQ4 A;  5G2P A;  1C7N A;  4AOA A;  1QIR A;  3NU7 A;  2WK7 A;  1Y4I A;  3QGU A;  3E2Y A;  3GZC A;  3M5U A;  4FFC A;  3NUI A;  3AV7 A;  4WP0 A;  4WLH A;  2C81 A;  4ATP A;  2R2N A;  4A6U A;  2O7C A;  1X28 A;  1M6S A;  2GQN A;  4IX8 A;  3MBB A;  2BI5 A;  1M0O A;  3HLM A;  4J5U A;  2FYF A;  5EFS A;  3VOM A;  2VGZ A;  3H14 A;  3ZRP A;  2VGT A;  4CXQ A;  4LC3 A;  4WYF A;  3BN1 A;  3BWN C;  2CB1 A;  3AOV A;  4OMA A;  3W1J A;  2CJH A;  2D7Y A;  5D5S A;  1LC8 A;  1CL2 A;  4IXZ A;  5G4I A;  3PD6 A;  3A2B A;  4AO9 A;  3LVJ A;  2VMW A;  1AIB A;  4BMK A;  1ARG A;  1BKG A;  4KAM A;  2W7J A;  3CAI A;  5BJ3 A;  4TN4 A;  5BJ4 A;  4JEZ A;  2DGL A;  3ASA A;  2D64 A;  4A00 A;  3PIU A;  1TOG A;  2VMU A;  2DKJ A;  3E2F A;  1V72 A;  2O0R A;  3COG A;  5HDM A;  4EFF A;  2VIB A;  2YRR A;  1LC7 A;  3D6K A;  3K40 A;  1MAP A;  3ISL A;  3EI6 A;  3L8A A;  5M46 A;  2JJG A;  1WST A;  2FNI A;  3JW9 A;  1CL1 A;  3FZ7 A;  4ISY A;  3CQ5 A;  1ZC9 A;  5G0A A;  3KGX A;  2JGT A;  2BWO A;  3MC6 C;  4ADB A;  5HXX A;  4BA4 A;  3PDB A;  2BKW A;  1M0Q A;  3GBX A;  1GDE A;  1OHW A;  1IX8 A;  2WKA A;  2YCP A;  4K2B A;  3R4T A;  4AZK A;  4WYD A;  2W7M A;  4P3M A;  1WKH A;  2E7U A;  4O6Z A;  2Z61 A;  4TMR A;  1VP4 A;  1TOI A;  1ASL A;  3FQ7 A;  5AX8 A;  2YOB A;  3AEJ C;  4LNL A;  2W7L A;  2CIN A;  4JE5 D;  1SZK A;  2GMU A;  1D7R A;  3ASB A;  3AAT A;  4GRX A;  4PIW A;  3LWS A;  3EI8 A;  3WX9 A;  2BI1 A;  2Z9U A;  1QGN A;  4UHN A;  2D63 A;  4ZM3 A;  5F9S A;  1H0C A;  1YNU A;  1AHY A;  3NYS A;  4JEX A;  1ART A;  3JZL A;  3G8M A;  2VMS A;  1SZU A;  4DQ6 A;  3N0L A;  1WYT A;  1QJ3 A;  1B9I A;  4ZWM A;  2ZP7 A;  1DFO A;  2CY8 A;  3VK3 A;  2HOY A;  2D66 A;  2OQX A;  3DXW A;  1YIZ A;  2VMZ A;  3HT4 A;  4WD2 A;  1GC2 A;  5FT8 A;  2VGW A;  2VMO A;  3JTX A;  2W7D A;  3NDN A;  4OBV A;  4R8D A;  5IWQ A;  3NNK A;  3P1T A;  4R5Z A;  2D65 A;  1G4X A;  1M7Y A;  1O62 A;  1RVY A;  3BWN A;  1B8G A;  1GBN A;  3BB8 A;  2BI9 A;  2AY9 A;  2YCT A;  3DR4 A;  3BC8 A;  4OBU A;  4PFF A;  1P3W A;  4XJL A;  1IAY A;  4GSA A;  1OHY A;  4CXR A;  2AY8 A;  2X8U A;  4MQQ A;  4F5M A;  2ZSL A;  1B9H A;  4E3R A;  2Z9W A;  4A72 A;  3MAF B;  3E77 A;  1PFF A;  2BWN A;  1UU1 A;  2X3L A;  3W1I A;  2VMP A;  2JJE A;  3GJU A;  1E5E A;  1YOO A;  1AAW A;  4ZDO A;  2BIE A;  1U08 A;  4ITX A;  3EUC A;  3AEO A;  3PJ0 A;  4E77 A;  3E9K A;  2W8J A;  2BYL A;  3QN6 A;  1SPA A;  4F5J A;  1O61 A;  2C7T A;  4MKK A;  1AHE A;  4XAU A;  2VMN A;  1W7M A;  1D7V A;  3WCN A;  2CJG A;  5EQC A;  1EJI A;  4AH3 A;  3QHX A;  4MGR A;  2DGM A;  4ZAS A;  4OCA A;  2HZP A;  1MGV A;  1D2F A;  3PA9 A;  4IW7 A;  2KFP A;  4WB0 B;  1IAX A;  4WXB A;  2VMT A;  2W7E A;  3BCB A;  3H7F A;  4ADD A;  4BQ0 A;  5LH9 A;  1BQD A;  3LVK A;  1QZ9 A;  4EB7 A;  4IXS A;  1OAT A;  3GET A;  3FZ6 A;  1W7L A;  1O4S A;  3PDX A;  5EUD A;  2VMV A;  3EI5 A;  5DX5 A;  3BCX A;  3RI6 A;  3VK2 A;  4FL0 A;  1GEX A;  2AY7 A;  2Z9X A;  3FTB A;  3N75 A;  2BI2 A;  4WXG A;  4N0B A;  4KYO A;  3DC1 A;  1ASC A;  2AY3 A;  5FT5 A;  2W8W A;  3MAD A;  1B4X A;  1GEY A;  3I4J A;  1LC5 A;  1SFF A;  1AY4 A;  2AY1 A;  3RCH B;  4F5K A;  4LW4 A;  4JEY A;  3ATH A;  4ATQ A;  2ZY5 A;  1CZC A;  1XI9 A;  3L44 A;  1J04 A;  2VMR A;  4ADC A;  3LY1 A;  3B1D A;  2YKU A;  4TV7 A;  2FNU A;  3B1E A;  4ZSW A;  1GEW A;  1ASB A;  1WYV B;  2W7K A;  3FVX A;  3N4X A;  2HOR A;  1S08 A;  2YCN A;  3K7Y A;  3EI9 A;  3PGY A;  5G09 A;  3FVS A;  1V2F A;  3TAT A;  3BCA A;  2ZY2 A;  3GZD C;  4W1W A;  4Q76 A;  3RBL A;  2HP1 A;  1WKG A;  2QB3 A;  3NU8 A;  2FQ6 A;  4W1V A;  1ARH A;  2FM1 A;  1GCK A;  2QB2 A;  2W8T A;  4A6T A;  2Z20 A;  4K05 A;  1M32 A;  3USF A;  3N7N A;  2AY6 A;  2PB2 A;  3DR7 A;  1FC4 A;  1C9C A;  2HOZ A;  3AEM C;  4P7Y A;  3NX3 A;  4BA5 A;  1CQ6 A;  4CBS A;  2DGK A;  2YHK A;  4GE7 A;  5F8V A;  4M2J A;  5EAA A;  2D5Y A;  2VI8 A;  3E2Z B;  4OYT A;  1ASN A;  3NYU A;  4IXO A;  5EUN A;  3RBF A;  3AEN B;  2G6W A;  5E3K A;  1DGE A;  1XEY A;  5G4J A;  1I29 A;  3IF2 A;  2EO5 A;  5EAV A;  3MKJ A;  3A9Y A;  3R9A A;  3TFT A;  1QIT A;  4RJY A;  1IJI A;  3HVY A;  5C6U A;  1OXO A;  3N5M A;  3LV2 A;  2BI3 A;  4GE9 A;  4AZJ A;  4W1X A;  2ZC0 A;  1N8P A;  4Q6R A;  4LNJ A;  1SF2 A;  1DJE A;  2OAT A;  2CH1 A;  4JEW A;  4U1T A;  1DTY A;  5EUE A;  2OGE A;  3FKD A;  1YIY A;  1ASE A;  3OP7 A;  4RKD A;  4ZDP A;  3FFR A;  3EIB A;  2PO3 A;  3B8X A;  1QJ5 A;  2VGV A;  1AIA A;  3DZZ A;  3VAX A;  5G2Q A;  4DBC A;  5J8Q A;  4K2M A;  2A1V A;  2Z67 A;  4RJ0 A;  2E7J A;  4B9B A;  3PPL A;  3A9X A;  2WB6 A;  2BYJ A;  1JS6 A;  4JE5 A;  1AMA A;  3I5T A;  3MAF A;  4MY5 A;  3LVM A;  4IY7 A;  1MAQ A;  1X0M A;  2EZ2 A;  3DXV A;  2GSA A;  3TQX A;  2VLH A;  3NTJ A;  3EZ1 A;  1ELU A;  5EIG B;  5M4D A;  4OT8 A;  4WBT A;  2Z1Y A;  3G0T A;  3MEB A;  2F8J A;  4MSO A;  1N31 A;  1AY8 A;  1EQB A;  4RM1 A;  4NOG A;  1CZE A;  3GZD A;  2BIG A;  3WY7 A;  2HUF A;  1C4K A;  1AMR A;  1TPL A;  4PFN A;  4U2H A;  5FT4 A;  1BS0 A;  1D7U A;  3B46 A;  1Z3Z A;  4W5K A;  1AIC A;  3F6T A;  4WB0 A;  2VYC A;  2AY5 A;  5LHA A;  2EYQ A;  4W8I A;  3AEM A;  1M0P A;  1WYU B;  1UU2 A;  1UKJ A;  2W7G A;  3LVL B;  4J8L A;  5M4B A;  4DGT A;  1LK9 A;  4RIT A;  4M2M A;  4W91 A;  1RV4 A;  1KKP A;  1BJO B;  2E7I A;  4A0G A;  7AAT A;  1KMK A;  4B98 A;  3HL2 A;  4XJP A;  3HQT A;  3ZRQ A;  1GD9 A;  3NYT A;  4WYE A;  2VGS A;  2ORD A;  3E6G A;  4JF0 A;  4N0W A;  3MC6 A;  3RCH A;  3FQ8 A;  4HF8 A;  4ZWV A;  5D95 A;  1AMQ A;  4F5H A;  3WCO A;  3AEP A;  4HVK A;  2QLR A;  1KMJ A;  2V0Y A;  1T3I A;  3WGC A;  2O1B A;  4L0O A;  1FG7 A;  1I48 A;  3WZF A;  1WYV A;  2OKJ A;  1TOJ A;  3AEJ A;  3WLX A;  2BWP A;  1AMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...