2BIEA

Radiation damage of the schiff base in phosphoserine aminotransferase (structure h)
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
358
structure length
358
Chain Sequence
b'QVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKENA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
publication title Strain Relief at the Active Site of Phosphoserine Aminotransferase Induced by Radiation Damage.
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Transferase
total genus 127
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2bieA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2bieA02
2W7GA 3NNKA 1J32A 4RKDA 3FFRA 3WKRA 1KL2A 2D7ZA 2QLRA 5F9SA 1AICA 4CBSA 4F5LA 4ISYA 1MAQA 4EB7A 2Z9UA 3R4TA 3WLXA 1OATA 3EI9A 2OKJA 2VMRA 4N0WA 2PB2A 2ZSMA 2G6WA 4W1WA 1ASNA 1DJ9A 3GZCA 3E9KA 4ATQA 1BT4A 1ARIA 1CZEA 4P3MA 1ASFA 1CZCA 4XEWA 4PFFA 3AV7A 4ZM4A 3I4JA 1AHFA 1LW5A 3JWAA 2YOBA 3HT4A 2D7YA 2W7LA 1JF9A 3ACZA 1TOJA 1AJRA 4U1TA 2EGYA 1KL1A 2W7HA 2BIGA 1TARA 3GJUA 4ZWMA 5BJ3A 3KE3A 3PPLA 4A6UA 1WYVB 3BN1A 3FVSA 1LKCA 3DU4A 2W7DA 4M2MA 4TV7A 4Y0DA 3GWPA 1JS6A 3HVYA 1G7WA 2VLHA 3GBXA 4ZAHA 1VJOA 4WXBA 1SVVA 1YJSA 3RUYA 4BA4A 3UAKA 2X8UA 3JZLA 3N0LA 3DC1A 3OP7A 4A0FA 5M49A 2OGEA 1AAMA 1M0OA 1QITA 1GC3A 3BCAA 1S07A 4UHMA 3ZRRA 2HORA 2Z20A 1BJOB 3FQAA 3H7FA 4EU1A 1RV4A 2EZ2A 2VI9A 3A2BA 1ASLA 3BWOA 4R5ZA 1LC7A 1QZ9A 5EUEA 1QISA 2W8TA 3E2ZA 1AY8A 5JAYA 1GCKA 1LC5A 1X2AA 2F8JA 2HOXA 3G0TA 3MBBA 3QN6A 1AKAA 2CFBA 1AHYA 2PB0A 3WGCA 5LH9A 1IAXA 2AY2A 1X0MA 2VMUA 5E5IA 2AY8A 4CXRA 1S08A 4KXKA 4RM1A 3ZZKA 1CJ0A 1LK9A 2YCNA 1UU2A 5FT4A 4WYCA 5G0AA 3FVUA 2E7JA 1E5EA 3II0A 3NTJA 1D7UA 1S09A 4J8LA 1SPAA 4IXSA 1WYUB 3LVJA 4HF8A 1MLZA 1YIYA 4W1XA 4WLJA 4E77A 2ZY4A 2C0RA 2YKUA 3MADA 3ATHA 1G7XA 3USFA 4BMKA 1SZKA 2AEVA 3PJ0A 2W7EA 1D2FA 7AATA 3AEMA 4QGRA 3F9TA 4ZDLA 1TOEA 4Y0IA 2VIAA 1IAYA 1O69A 2FN6A 2WKAA 3BV0A 1M4NA 2QB3A 1Y4IA 3PD6B 4MKJA 3R9AA 4MY5A 2JG2A 1RVUA 3B46A 2YCPA 1W23A 2CJDA 2CH2A 3NYTA 2O0RA 3MAUA 3W1HA 3LWSA 3DRDA 1TASA 3WZFA 1OXPA 4MQQA 5G2QA 1AY5A 4PFNA 1AKBA 4XJMA 2V1PA 5EQCA 2OQXA 3QI6A 4F5IA 3FTBA 5E4ZA 4F5MA 4IYOA 4B98A 2QA3A 4R8DA 2EPJA 1TOIA 1ARTA 1GEWA 3NU8A 2E7IA 3GETA 2NMPA 3KGXA 1GD9A 5D5SA 9AATA 4AH3A 4J5UA 3PDBB 4E3QA 2GQNA 2VMSA 3HL2A 3TQXA 4IXOA 1I41A 2OATA 2D66A 2HUFA 4ZWVA 3A9ZA 2BYLA 1BS0A 4WB0A 2GSAA 3PA9A 3L8AA 3PIUA 4O6ZA 3NX3A 2ZC0A 4ATPA 3Q8NA 1BQDA 3BS8A 1AIBA 4JEXA 1ASGA 1W3UA 1AKCA 2Z9XA 3ECDA 1B8GA 1CL2A 2CB1A 2JISA 1M0QA 3AENA 1W7LA 2X3LA 4W5KA 4JEYA 4OC9A 2YRIA 5EFSA 3FZ8A 2AY3A 1ARHA 4JF0A 5M4DA 3NYSA 3HDOA 1JG8A 5IWQA 1ZOBA 1N8PA 1SF2A 2R5CA 1W7NA 3E2YA 4A00A 1CQ6A 1SZUA 1I29A 1OHWA 1AAWA 4UHNA 3NU7A 2D61A 4A0GA 1CL1A 3QM2A 2EH6A 2CTZA 1YAAA 1O62A 2BI1A 3BWNA 3MAFA 2R2NA 2CINA 2BIEA 3RCHA 2HP2A 4KAMA 3VOMA 3EI6A 3UWCA 3MC6A 2FYFA 3KKIA 3GZDC 3E2ZB 5AX8A 3ISLA 1G4XA 4M2JA 2BIAA 3FDDA 4ITXA 3NRAA 1TOGA 3MKJA 4JF1A 2V0YA 3AOVA 4MKKA 3EI8A 2DR1A 2ZSLA 1AHXA 5FT5A 1M6SA 1CS1A 4HVKA 2VMWA 3HLMA 2WK7A 3VAXA 4P7YA 3IF2A 4MQPA 1DJEA 4OTLA 2Z67A 4AO4A 2DGMA 5G4JA 2VGTA 3N5MA 3MEBA 4GDYA 4R5FA 2DGKA 4A6TA 1AMSA 4K2BA 5BJ4A 1WKGA 1AY4A 2JJFA 3WGBA 2GMUA 4AZJA 2Z9VA 2QB2A 2BKWA 3CQ5A 5HDMA 4Y0HA 1QJ5A 2XBNA 4LNLA 3W1JA 1I48A 2D5YA 4I8AA 5DJ1A 5EAVA 3RI6A 3H14A 4WYFA 2CJGA 3TFTA 3IHJA 1BW0A 3RBFA 3BB8A 4L0OA 1S0AA 2FM1A 2BWOA 1MDZA 1UU1A 1M0NA 3LVMA 3AEJA 3BCBA 3EZ1A 3G8MA 4XK1A 3K28A 4K2IA 5DX5A 5HHYA 1WYTB 2C7TA 2TPLA 2Z1YA 4LNJA 4Q31A 4OBUA 5D95A 1V2EA 4CXQA 3DZZA 4CVQA 4Q76A 4KYOA 3PAAA 1OHVA 2AY9A 3BCXA 4LNMA 2BI3A 1N31A 2Z9WA 3AELA 4IYOB 4N0BA 1ASDA 2W8VA 3AEOA 4IW7A 1DJUA 4ADEA 4JEZA 2VGVA 4ZDOA 1SFFA 2YRRA 2VMVA 1GEYA 3LVKA 3NUBA 1EJIA 1BJWA 4A72A 2VMZA 2HUUA 3FRKA 4LW2A 2BWNA 1LS3A 2EZ1A 2HUIA 2QBTA 1D7SA 2HOYA 5FT8A 1DGDA 4MQRA 2ZUKA 4Q6RA 3NDNA 4WB0B 2AY6A 4ADCA 1B4XA 4UHOA 5G2PA 1JS3A 3JW9A 3VK2A 1BQAA 3EI5A 2Z1ZA 4ZSYA 1Z3ZA 5EUDA 4XAUA 3TCMA 2VMXA 2D63A 1ARSA 1C4KA 2VYCA 3AENB 2X5FA 3COGA 1V2FA 1CQ7A 1VP4A 3ELPA 3F0HA 5J8QA 3A8UX 3TATA 3I5TA 1IUGA 1G4VA 2CY8A 2VMQA 3RBLA 3ZRQA 4EFFA 3ZRPA 2O1BA 4NOGA 4RIZA 4RKCA 4A0RA 1V2DA 2GMSA 1U08A 1TOKA 3CBFA 3FFHA 1Z7DA 4GE9A 1CQ8A 4W1VA 5DJ9A 5DB5A 1PMMA 2R5CB 1MLYA 4GE4A 4GEBA 4BQ0A 2YKVA 4DBCA 4M2KA 2AY5A 2W8WA 4BA5A 2ZY2A 4RJYA 3DR4A 4Q75A 1C0NA 2FQ6A 1ASMA 2JGTA 3P6KA 4MSOA 3WCNA 1O61A 5I92A 2JJHA 3AEMC 3WY7A 1YJYA 4A6RA 2W7JA 3QPGA 3MAFB 1E5FA 1QIRA 1TATA 1GBNA 3B1DA 1RV3A 2VGWA 2VMYA 3EIBA 3FZ7A 3JTXA 5EIGA 3DXWA 2BYJA 3VK4A 4CBRA 1B9IA 3N75A 1N2TA 4RAEA 4FFCA 1AJSA 1M0PA 1ECXA 4LW4A 4A0HA 2BI2A 2X5DA 2YKXA 4AZKA 3JWBA 1C7NA 4ZLVA 2OKKA 1V72A 2FNUA 2ZY3A 4F5HA 2D65A 2C81A 3FD0A 1LC8A 3E2FA 1MDXA 2CH1A 2W7KA 4ADBA 1MDOA 1IVRA 4XJOA 2OGAA 1YIZA 3PGYA 1O4SA 1IJIA 2VGSA 4OCAA 3P1TA 2BHXA 2VMTA 1AMRA 1UKJA 3A9XA 3ELEA 3KGWA 1ORDA 2RFVA 1MAPA 1GDEA 4E1OA 4ADDA 4WYAA 3BC8A 1PMOA 3ASAA 4BHDA 1B9HA 3ZZJA 1BJNA 3B8XA 3I16A 1X28A 1RVYA 1J04A 4AOAA 3K7YA 3K40A 4GE7A 1EQBA 2DKJA 2PO3A 4ZDPA 2VLFA 4WP0A 4OBVA 5G4IA 4IX8A 2R5EA 4WXGA 3RQ1A 1IBJA 3PDBA 4MGRA 4DGTA 1M32A 1XEYA 4IXZA 3L44A 5E3KA 1XI9A 4WBTA 3B1CA 3FCRA 1OHYA 3BWNC 1I43A 2Z61A 1C7OA 1H1CA 1SZSA 4LC3A 4ZM3A 2JJEA 1D7VA 3HMUA 3NYUA 3MC6C 2XH1A 2ZYJA 3EZSA 1ZODA 2AY4A 3FZ6A 5M46A 3DXVA 2AY1A 1D7RA 3E77A 5G09A 4JE5D 2VMNA 3CQ6A 4PIWA 4WYDA 2YCTA 3HQTA 3EIAA 2AATA 2WK8A 2FNIA 2YKYA 5FT6A 1ZC9A 4F5KA 3A9YA 1ASBA 3FQ8A 1DFOA 1P3WA 2E54A 3EUCA 2BI5A 3LY1A 4OT8A 4DQ6A 3DR7A 1AIAA 3WCOA 4U2HA 1FG3A 4EB5A 4K2MA 1ASEA 1DTYA 2DOUA 4XJPA 4AO9A 5F8VA 2W8JA 1VEFA 3QGUA 3JU7A 4RLGA 4H51A 5K8BA 1IX8A 3QBOA 4B9BA 3CAIA 1X29A 4R2NA 1EG5A 4WYGA 1PG8A 4PVFA 1KKJA 4XQ2A 2JJGA 4OMAA 4GSAA 4TMRA 1ELQA 2Q7WA 3AOWA 4UQVA 1WYVA 4ZASA 3WX9A 2ZJGA 3EI7A 3G7QA 1GC0A 3TFUA 4W8IA 2HP1A 3AEJC 1GEXA 1PFFA 2EO5A 1ASAA 2W7FA 3DYDA 4WD2A 2C44A 5EIGB 8AATA 2HOZA 2CSTA 4UOYA 2CANA 4RJ0A 1GC4A 2WK9A 1OXOA 2HZPA 1AJSB 1T3IA 4WLHA 4XJLA 1IX7A 2YHKA 3FDBA 3WKSA 4TN4A 1S06A 2BI9A 3FSLA 1YNUA 1QGNA 1FC4A 2GB3A 1ARGA 3F6TA 2W7IA 1BJOA 1M7YA 2DGLA 3T32A 5LHAA 2ORDA 2VIBA 1QJ3A 4ZSWA 1AMQA 1H0CA 2VMPA 5M4BA 2VI8A 1FG7A 4GRXA 2W7MA 2QMAA 4IY7A 2CJHA 4F4EA 3GSBA 5EAAA 3FVXA 2DKBA 4F5FA 1ELUA 1WYTA 3B1EA 4EMYA 3HBXA 1YJZA 3QHXA 4JE5A 3VK3A 1AX4A 1KMKA 2O7CA 1AHEA 3RCHB 1B5OA 5TF5A 2AEUA 2VGZA 1WKHA 3NUIA 3LVLB 3LG0A 1ASCA 2VGUA 3DODA 1LW4A 3AEPA 3LV2A 1WSTA 3FQ7A 2AY7A 1BKGA 4ITGA 2W8UA 1UU0A 2D64A 2ZP7A 3W1IA 1IX6A 1DKAA 1WYUA 3OKSA 2E7UA 1BJ4A 4F5GA 1AMAA 3FKDA 1DGEA 2ZY5A 3AATA 1AHGA 3PDXA 1GC2A 4JEWA 4OYTA 1W7MA 1C7GA 1YOOA 2R0TA 5HXXA 4W91A 4JEVA 1KMJA 3UE8A 4WYEA 3M5UA 4F5JA 3CQ4A 3PD6A 4RITA 2BWPA 5EUNA 3ASBA 3E6GA 3GR9A 3D6KA 3GZDA 5C6UA 4WXFA 3VP6A 4E3RA 1C9CA 1KKPA 1TPLA 1B5PA 2VMOA 4FL0A 1MGVA
chains in the Genus database with same CATH superfamily
2W7GA 3NNKA 1J32A 4RKDA 3FFRA 3WKRA 1KL2A 2D7ZA 2QLRA 5F9SA 1AICA 4CBSA 4F5LA 4ISYA 1MAQA 4EB7A 2Z9UA 3R4TA 3WLXA 1OATA 3EI9A 2OKJA 2VMRA 4N0WA 2PB2A 2ZSMA 2G6WA 4W1WA 1ASNA 1DJ9A 2QSRA 3GZCA 3E9KA 4ATQA 1BT4A 1ARIA 1CZEA 4P3MA 1ASFA 1CZCA 4XEWA 4PFFA 3AV7A 4ZM4A 3I4JA 1AHFA 1LW5A 3JWAA 2YOBA 3HT4A 2D7YA 2W7LA 1JF9A 3ACZA 1TOJA 1AJRA 4U1TA 2EGYA 1KL1A 2W7HA 2BIGA 1TARA 3GJUA 4ZWMA 2FKIA 5BJ3A 3KE3A 3PPLA 4A6UA 1WYVB 3BN1A 3FVSA 1LKCA 3DU4A 2W7DA 4M2MA 4TV7A 4Y0DA 3GWPA 1JS6A 3HVYA 1G7WA 2VLHA 3GBXA 4ZAHA 1VJOA 4WXBA 1SVVA 1YJSA 3RUYA 4BA4A 3UAKA 2X8UA 3JZLA 3N0LA 3DC1A 3OP7A 4A0FA 5M49A 2OGEA 1AAMA 1M0OA 1QITA 1GC3A 3BCAA 1S07A 4UHMA 2EYQA 3ZRRA 2HORA 2Z20A 1BJOB 3FQAA 3H7FA 4EU1A 1RV4A 2EZ2A 2VI9A 3A2BA 1ASLA 3BWOA 4R5ZA 1LC7A 1QZ9A 5EUEA 1QISA 2W8TA 3E2ZA 1AY8A 5JAYA 1GCKA 1LC5A 1X2AA 2F8JA 2HOXA 3G0TA 3MBBA 3QN6A 1AKAA 2CFBA 1AHYA 2PB0A 3WGCA 5LH9A 1IAXA 2AY2A 1X0MA 2VMUA 5E5IA 2AY8A 4CXRA 1S08A 4KXKA 4RM1A 3ZZKA 1CJ0A 1LK9A 2YCNA 1UU2A 5FT4A 4WYCA 3N4SA 5G0AA 3FVUA 2E7JA 1E5EA 3II0A 3NTJA 1D7UA 1S09A 4J8LA 1SPAA 4IXSA 1WYUB 3LVJA 4HF8A 1MLZA 1YIYA 4W1XA 4WLJA 4E77A 2ZY4A 2C0RA 2YKUA 3MADA 3ATHA 1G7XA 3USFA 4BMKA 1SZKA 2AEVA 3PJ0A 2W7EA 1D2FA 3N7NA 7AATA 3AEMA 4QGRA 3F9TA 4ZDLA 1TOEA 4Y0IA 2VIAA 1IAYA 1O69A 2FN6A 2WKAA 3BV0A 1M4NA 1KAFA 2QB3A 1Y4IA 3PD6B 4MKJA 3R9AA 4MY5A 2JG2A 1RVUA 3B46A 2YCPA 1W23A 2CJDA 2CH2A 3NYTA 2O0RA 3MAUA 3W1HA 3LWSA 3DRDA 1TASA 3WZFA 1OXPA 4MQQA 5G2QA 1AY5A 4PFNA 1AKBA 4XJMA 2V1PA 5EQCA 2OQXA 3QI6A 4F5IA 3FTBA 5E4ZA 4F5MA 4IYOA 4B98A 2QA3A 4R8DA 2EPJA 1TOIA 1ARTA 1GEWA 3NU8A 2E7IA 3GETA 2NMPA 3KGXA 1GD9A 5D5SA 9AATA 4AH3A 4J5UA 3PDBB 4E3QA 2GQNA 2VMSA 3HL2A 3TQXA 4IXOA 1I41A 2OATA 2D66A 2HUFA 4ZWVA 3A9ZA 2BYLA 1BS0A 4WB0A 2GSAA 3PA9A 3L8AA 3PIUA 4O6ZA 3NX3A 2ZC0A 4ATPA 3Q8NA 1BQDA 3BS8A 1AIBA 4JEXA 1ASGA 1W3UA 1AKCA 2Z9XA 3ECDA 1B8GA 1CL2A 2CB1A 2JISA 1M0QA 3AENA 1W7LA 2X3LA 4W5KA 4JEYA 4OC9A 2YRIA 5EFSA 3FZ8A 2AY3A 1ARHA 4JF0A 5M4DA 3NYSA 3HDOA 1JG8A 5IWQA 1ZOBA 1N8PA 1SF2A 2R5CA 1W7NA 3E2YA 4A00A 1CQ6A 1SZUA 1I29A 1OHWA 1AAWA 4UHNA 3NU7A 2D61A 4A0GA 1CL1A 3QM2A 2EH6A 2CTZA 1YAAA 1O62A 2BI1A 3BWNA 3MAFA 2R2NA 2CINA 2BIEA 3RCHA 2HP2A 4KAMA 3VOMA 3EI6A 3UWCA 3MC6A 2FYFA 3KKIA 3GZDC 3E2ZB 5AX8A 3ISLA 1G4XA 4M2JA 2BIAA 3FDDA 4ITXA 3NRAA 1TOGA 3MKJA 4JF1A 2V0YA 3AOVA 4MKKA 3EI8A 2DR1A 2ZSLA 1AHXA 5FT5A 1M6SA 1CS1A 4HVKA 2VMWA 3HLMA 2WK7A 3VAXA 4P7YA 3IF2A 4MQPA 1DJEA 4OTLA 2Z67A 4AO4A 2DGMA 5G4JA 2VGTA 3N5MA 3MEBA 4GDYA 4R5FA 2DGKA 4A6TA 1AMSA 4K2BA 5BJ4A 1WKGA 1AY4A 2JJFA 3WGBA 2GMUA 4AZJA 2Z9VA 2QB2A 2BKWA 3CQ5A 5HDMA 4Y0HA 1QJ5A 2XBNA 4LNLA 3W1JA 1I48A 2D5YA 4I8AA 5DJ1A 5EAVA 3RI6A 3H14A 4WYFA 2CJGA 3TFTA 3IHJA 1BW0A 3RBFA 3BB8A 4L0OA 1S0AA 2FM1A 2BWOA 1MDZA 1UU1A 1M0NA 3LVMA 3AEJA 3BCBA 3EZ1A 3G8MA 4XK1A 3K28A 4K2IA 5DX5A 5HHYA 1WYTB 2G7JA 2C7TA 2TPLA 2Z1YA 4LNJA 4Q31A 4OBUA 5D95A 1V2EA 4CXQA 3DZZA 4CVQA 4Q76A 4KYOA 3PAAA 1OHVA 2AY9A 3BCXA 4LNMA 2BI3A 1N31A 2Z9WA 3AELA 4IYOB 4N0BA 1ASDA 2W8VA 3AEOA 4IW7A 1DJUA 4ADEA 4JEZA 2VGVA 4ZDOA 1SFFA 2YRRA 2VMVA 1GEYA 3LVKA 3NUBA 1EJIA 1BJWA 4A72A 2VMZA 2HUUA 3FRKA 4LW2A 2BWNA 1LS3A 2EZ1A 2HUIA 2QBTA 5KTBA 1D7SA 2HOYA 5FT8A 3N4RA 1DGDA 4MQRA 2ZUKA 4Q6RA 3NDNA 4WB0B 2AY6A 4ADCA 1B4XA 4UHOA 5G2PA 1JS3A 3JW9A 3VK2A 1BQAA 3EI5A 2Z1ZA 4ZSYA 1Z3ZA 5EUDA 4XAUA 3TCMA 2VMXA 2D63A 1ARSA 1C4KA 2VYCA 3AENB 2X5FA 3COGA 1V2FA 1CQ7A 1VP4A 3ELPA 3F0HA 5J8QA 3A8UX 3TATA 3I5TA 1IUGA 1G4VA 2CY8A 2VMQA 3RBLA 3ZRQA 4EFFA 3ZRPA 2O1BA 4NOGA 4RIZA 4RKCA 4A0RA 1V2DA 2GMSA 1U08A 4H63Q 1TOKA 3CBFA 3FFHA 1Z7DA 4GE9A 1CQ8A 4W1VA 5DJ9A 5DB5A 1PMMA 2R5CB 1MLYA 4GE4A 4GEBA 4BQ0A 2WB6A 2YKVA 4DBCA 4M2KA 2AY5A 2W8WA 4BA5A 2ZY2A 4RJYA 3DR4A 4Q75A 1C0NA 2FQ6A 1ASMA 2JGTA 3P6KA 4MSOA 3WCNA 1O61A 5I92A 3H9XA 2JJHA 3AEMC 3WY7A 1YJYA 4A6RA 2W7JA 3QPGA 3MAFB 1E5FA 1QIRA 1TATA 1GBNA 3B1DA 1RV3A 2VGWA 2VMYA 3EIBA 3FZ7A 3JTXA 5EIGA 3DXWA 2BYJA 3VK4A 4CBRA 1B9IA 3N75A 1N2TA 4RAEA 4FFCA 1AJSA 1M0PA 1ECXA 4LW4A 4A0HA 2BI2A 2X5DA 2YKXA 4AZKA 3JWBA 1C7NA 4ZLVA 2OKKA 1V72A 2FNUA 2ZY3A 4F5HA 2D65A 2C81A 3FD0A 1LC8A 3E2FA 1MDXA 2CH1A 2W7KA 4ADBA 1MDOA 1IVRA 4XJOA 2OGAA 1YIZA 3PGYA 1O4SA 1IJIA 2VGSA 4OCAA 3P1TA 2BHXA 2VMTA 1AMRA 1UKJA 3A9XA 3ELEA 3KGWA 1ORDA 2RFVA 1MAPA 1GDEA 4E1OA 4ADDA 4WYAA 3BC8A 1PMOA 3ASAA 4BHDA 1B9HA 3ZZJA 1BJNA 3B8XA 3I16A 1X28A 2A1VA 1RVYA 1J04A 4AOAA 3K7YA 3K40A 4GE7A 1EQBA 2DKJA 2PO3A 4ZDPA 2VLFA 4WP0A 4OBVA 5G4IA 4IX8A 2R5EA 4WXGA 3RQ1A 1IBJA 3PDBA 4MGRA 4DGTA 1M32A 1XEYA 4IXZA 3L44A 5E3KA 1XI9A 4WBTA 3B1CA 3FCRA 1OHYA 3BWNC 1I43A 2Z61A 1C7OA 1H1CA 1SZSA 4LC3A 4ZM3A 2JJEA 1D7VA 3HMUA 3NYUA 3MC6C 2XH1A 2ZYJA 3EZSA 1ZODA 2AY4A 3FZ6A 5M46A 3DXVA 2AY1A 1D7RA 3E77A 5G09A 4JE5D 2VMNA 3CQ6A 4PIWA 4WYDA 2YCTA 3HQTA 3EIAA 2AATA 2WK8A 2FNIA 2YKYA 5FT6A 1ZC9A 4F5KA 3A9YA 1ASBA 3FQ8A 1DFOA 1P3WA 2E54A 3EUCA 2BI5A 3LY1A 4OT8A 4DQ6A 3DR7A 1AIAA 3WCOA 4U2HA 1FG3A 4EB5A 4K2MA 1ASEA 1DTYA 2DOUA 4XJPA 4AO9A 5F8VA 2W8JA 1VEFA 3QGUA 3JU7A 4RLGA 4H51A 5K8BA 1IX8A 3QBOA 4B9BA 3CAIA 1X29A 4R2NA 1EG5A 4WYGA 1PG8A 4PVFA 1KKJA 4XQ2A 2JJGA 4OMAA 4GSAA 4TMRA 1ELQA 2Q7WA 3AOWA 4UQVA 1WYVA 4ZASA 3WX9A 2ZJGA 3EI7A 3G7QA 1GC0A 3TFUA 4W8IA 2HP1A 3AEJC 1GEXA 1PFFA 2EO5A 1ASAA 2W7FA 3DYDA 4WD2A 2C44A 5EIGB 8AATA 2HOZA 2CSTA 4UOYA 2CANA 4RJ0A 1GC4A 2WK9A 1OXOA 2HZPA 1AJSB 1T3IA 4WLHA 4XJLA 1IX7A 2YHKA 3FDBA 4K05A 3WKSA 4TN4A 1S06A 2BI9A 3FSLA 1YNUA 1QGNA 1FC4A 2GB3A 1ARGA 3F6TA 2W7IA 1BJOA 1M7YA 3N4XA 2DGLA 3T32A 5LHAA 2ORDA 2VIBA 1QJ3A 4ZSWA 1AMQA 1H0CA 2VMPA 5M4BA 2VI8A 1FG7A 4GRXA 2W7MA 2QMAA 4IY7A 2CJHA 4F4EA 3GSBA 5EAAA 3FVXA 2DKBA 4F5FA 1ELUA 1WYTA 3B1EA 4EMYA 3HBXA 1YJZA 3QHXA 4JE5A 3VK3A 1AX4A 1KMKA 2O7CA 1AHEA 3RCHB 1B5OA 5TF5A 2AEUA 2VGZA 1WKHA 3NUIA 3LVLB 3LG0A 1ASCA 2VGUA 3DODA 1LW4A 3AEPA 3LV2A 1WSTA 3FQ7A 2AY7A 1BKGA 4ITGA 2W8UA 1UU0A 2D64A 2ZP7A 3W1IA 1IX6A 1DKAA 1WYUA 3OKSA 2E7UA 1BJ4A 4F5GA 1AMAA 3FKDA 1DGEA 2ZY5A 3AATA 1AHGA 3PDXA 1GC2A 4JEWA 4OYTA 1W7MA 1C7GA 1YOOA 2R0TA 5HXXA 4W91A 4JEVA 1KMJA 3UE8A 2KFPA 4WYEA 3M5UA 4F5JA 3CQ4A 3PD6A 4RITA 2BWPA 5EUNA 3ASBA 3E6GA 3GR9A 3D6KA 3GZDA 5C6UA 4WXFA 3VP6A 4E3RA 1C9CA 1KKPA 1TPLA 1B5PA 2VMOA 4FL0A 1MGVA
chains in the Genus database with same CATH topology
2W7GA 3NNKA 1J32A 4RKDA 3FFRA 3WKRA 1KL2A 2D7ZA 2QLRA 5F9SA 1AICA 4CBSA 4F5LA 4ISYA 1MAQA 4EB7A 2Z9UA 3R4TA 3WLXA 1OATA 3EI9A 2OKJA 2VMRA 4N0WA 2PB2A 2ZSMA 2G6WA 4W1WA 1ASNA 1DJ9A 2QSRA 3GZCA 3E9KA 4ATQA 1BT4A 1ARIA 1CZEA 4P3MA 1ASFA 1CZCA 4XEWA 4PFFA 3AV7A 4ZM4A 3I4JA 1AHFA 1LW5A 3JWAA 2YOBA 3HT4A 2D7YA 2W7LA 1JF9A 3ACZA 1TOJA 1AJRA 4U1TA 2EGYA 1KL1A 2W7HA 2BIGA 1TARA 3GJUA 4ZWMA 2FKIA 5BJ3A 3KE3A 3PPLA 4A6UA 1WYVB 3BN1A 3FVSA 1LKCA 3DU4A 2W7DA 4M2MA 4TV7A 4Y0DA 3GWPA 1JS6A 3HVYA 1G7WA 2VLHA 3GBXA 4ZAHA 1VJOA 4WXBA 1SVVA 1YJSA 3RUYA 4BA4A 3UAKA 2X8UA 3JZLA 3N0LA 3DC1A 3OP7A 4A0FA 5M49A 2OGEA 1AAMA 1M0OA 1QITA 1GC3A 3BCAA 1S07A 4UHMA 2EYQA 3ZRRA 2HORA 2Z20A 1BJOB 3FQAA 3H7FA 4EU1A 1RV4A 2EZ2A 2VI9A 3A2BA 1ASLA 3BWOA 4R5ZA 1LC7A 1QZ9A 5EUEA 1QISA 2W8TA 3E2ZA 1AY8A 5JAYA 1GCKA 1LC5A 1X2AA 2F8JA 2HOXA 3G0TA 3MBBA 3QN6A 1AKAA 2CFBA 1AHYA 2PB0A 3WGCA 5LH9A 1IAXA 2AY2A 1X0MA 2VMUA 5E5IA 2AY8A 4CXRA 1S08A 4KXKA 4RM1A 3ZZKA 1CJ0A 1LK9A 2YCNA 1UU2A 5FT4A 4WYCA 3N4SA 5G0AA 3FVUA 2E7JA 1E5EA 3II0A 3NTJA 1D7UA 1S09A 4J8LA 1SPAA 4IXSA 1WYUB 3LVJA 4HF8A 1MLZA 1YIYA 4W1XA 4WLJA 4E77A 2ZY4A 2C0RA 2YKUA 3MADA 3ATHA 1G7XA 3USFA 4BMKA 1SZKA 2AEVA 3PJ0A 2W7EA 1D2FA 3N7NA 7AATA 3AEMA 4QGRA 3F9TA 4ZDLA 1TOEA 4Y0IA 2VIAA 1IAYA 1O69A 2FN6A 2WKAA 3BV0A 1M4NA 2QB3A 1Y4IA 3PD6B 4MKJA 3R9AA 4MY5A 2JG2A 1RVUA 3B46A 2YCPA 1W23A 2CJDA 2CH2A 3NYTA 2O0RA 3MAUA 3W1HA 3LWSA 3DRDA 1TASA 3WZFA 1OXPA 4MQQA 5G2QA 1AY5A 4PFNA 1AKBA 4XJMA 2V1PA 5EQCA 2OQXA 3QI6A 4F5IA 3FTBA 5E4ZA 4F5MA 4IYOA 4B98A 2QA3A 4R8DA 2EPJA 1TOIA 1ARTA 1GEWA 3NU8A 2E7IA 3GETA 2NMPA 3KGXA 1GD9A 5D5SA 9AATA 4AH3A 4J5UA 3PDBB 4E3QA 2GQNA 2VMSA 3HL2A 3TQXA 4IXOA 1I41A 2OATA 2D66A 2HUFA 4ZWVA 3A9ZA 2BYLA 1BS0A 4WB0A 2GSAA 3PA9A 3L8AA 3PIUA 4O6ZA 3NX3A 2ZC0A 4ATPA 3Q8NA 1BQDA 3BS8A 1AIBA 4JEXA 1ASGA 1W3UA 1AKCA 2Z9XA 3ECDA 1B8GA 1CL2A 2CB1A 2JISA 1M0QA 3AENA 1W7LA 2X3LA 4W5KA 4JEYA 4OC9A 2YRIA 5EFSA 3FZ8A 2AY3A 1ARHA 4JF0A 5M4DA 3NYSA 3HDOA 1JG8A 5IWQA 1ZOBA 1N8PA 1SF2A 2R5CA 1W7NA 3E2YA 4A00A 1CQ6A 1SZUA 1I29A 1OHWA 1AAWA 4UHNA 3NU7A 2D61A 4A0GA 1CL1A 3QM2A 2EH6A 2CTZA 1YAAA 1O62A 2BI1A 3BWNA 3MAFA 2R2NA 2CINA 2BIEA 3RCHA 2HP2A 4KAMA 3VOMA 3EI6A 3UWCA 3MC6A 2FYFA 3KKIA 3GZDC 3E2ZB 5AX8A 3ISLA 1G4XA 4M2JA 2BIAA 3FDDA 4ITXA 3NRAA 1TOGA 3MKJA 4JF1A 2V0YA 3AOVA 4MKKA 3EI8A 2DR1A 2ZSLA 1AHXA 5FT5A 1M6SA 1CS1A 4HVKA 2VMWA 3HLMA 2WK7A 3VAXA 4P7YA 3IF2A 4MQPA 1DJEA 4OTLA 2Z67A 4AO4A 2DGMA 5G4JA 2VGTA 3N5MA 3MEBA 4GDYA 4R5FA 2DGKA 4A6TA 1AMSA 4K2BA 5BJ4A 1WKGA 1AY4A 2JJFA 3WGBA 2GMUA 4AZJA 2Z9VA 2QB2A 2BKWA 3CQ5A 5HDMA 4Y0HA 1QJ5A 2XBNA 4LNLA 3W1JA 1I48A 2D5YA 4I8AA 5DJ1A 5EAVA 3RI6A 3H14A 4WYFA 2CJGA 3TFTA 3IHJA 1BW0A 3RBFA 3BB8A 4L0OA 1S0AA 2FM1A 2BWOA 1MDZA 1UU1A 1M0NA 3LVMA 3AEJA 3BCBA 3EZ1A 3G8MA 4XK1A 3K28A 4K2IA 5DX5A 5HHYA 1WYTB 2G7JA 2C7TA 2TPLA 2Z1YA 4LNJA 4Q31A 4OBUA 5D95A 1V2EA 4CXQA 3DZZA 4CVQA 4Q76A 4KYOA 3PAAA 1OHVA 2AY9A 3BCXA 4LNMA 2BI3A 1N31A 2Z9WA 3AELA 4IYOB 4N0BA 1ASDA 2W8VA 3AEOA 4IW7A 1DJUA 4ADEA 4JEZA 2VGVA 4ZDOA 1SFFA 2YRRA 2VMVA 1GEYA 3LVKA 3NUBA 1EJIA 1BJWA 4A72A 2VMZA 2HUUA 3FRKA 4LW2A 2BWNA 1LS3A 2EZ1A 2HUIA 2QBTA 5KTBA 1D7SA 2HOYA 5FT8A 3N4RA 1DGDA 4MQRA 2ZUKA 4Q6RA 3NDNA 4WB0B 2AY6A 4ADCA 1B4XA 4UHOA 5G2PA 1JS3A 3JW9A 3VK2A 1BQAA 3EI5A 2Z1ZA 4ZSYA 1Z3ZA 5EUDA 4XAUA 3TCMA 2VMXA 2D63A 1ARSA 1C4KA 2VYCA 3AENB 2X5FA 3COGA 1V2FA 1CQ7A 1VP4A 3ELPA 3F0HA 5J8QA 3A8UX 3TATA 3I5TA 1IUGA 1G4VA 2CY8A 2VMQA 3RBLA 3ZRQA 4EFFA 3ZRPA 2O1BA 4NOGA 4RIZA 4RKCA 4A0RA 1V2DA 2GMSA 1U08A 4H63Q 1TOKA 3CBFA 3FFHA 1Z7DA 4GE9A 1CQ8A 4W1VA 5DJ9A 5DB5A 1PMMA 2R5CB 1MLYA 4GE4A 4GEBA 4BQ0A 2WB6A 2YKVA 4DBCA 4M2KA 2AY5A 2W8WA 4BA5A 2ZY2A 4RJYA 3DR4A 4Q75A 1C0NA 2FQ6A 1ASMA 2JGTA 3P6KA 4MSOA 3WCNA 1O61A 5I92A 3H9XA 2JJHA 3AEMC 3WY7A 1YJYA 4A6RA 2W7JA 3QPGA 3MAFB 1E5FA 1QIRA 1TATA 1GBNA 3B1DA 1RV3A 2VGWA 2VMYA 3EIBA 3FZ7A 3JTXA 5EIGA 3DXWA 2BYJA 3VK4A 4CBRA 1B9IA 3N75A 1N2TA 4RAEA 4FFCA 1AJSA 1M0PA 1ECXA 4LW4A 4A0HA 2BI2A 2X5DA 2YKXA 4AZKA 3JWBA 1C7NA 4ZLVA 2OKKA 1V72A 2FNUA 2ZY3A 4F5HA 2D65A 2C81A 3FD0A 1LC8A 3E2FA 1MDXA 2CH1A 2W7KA 4ADBA 1MDOA 1IVRA 4XJOA 2OGAA 1YIZA 3PGYA 1O4SA 1IJIA 2VGSA 4OCAA 3P1TA 2BHXA 2VMTA 1AMRA 1UKJA 3A9XA 3ELEA 3KGWA 1ORDA 2RFVA 1MAPA 1GDEA 4E1OA 4ADDA 4WYAA 3BC8A 1PMOA 3ASAA 4BHDA 1B9HA 3ZZJA 1BJNA 3B8XA 3I16A 1X28A 2A1VA 1RVYA 1J04A 4AOAA 3K7YA 3K40A 4GE7A 1EQBA 2DKJA 2PO3A 4ZDPA 2VLFA 4WP0A 4OBVA 5G4IA 4IX8A 2R5EA 4WXGA 3RQ1A 1IBJA 3PDBA 4MGRA 4DGTA 1M32A 1XEYA 4IXZA 3L44A 5E3KA 1XI9A 4WBTA 3B1CA 3FCRA 1OHYA 3BWNC 1I43A 2Z61A 1C7OA 1H1CA 1SZSA 4LC3A 4ZM3A 2JJEA 1D7VA 3HMUA 3NYUA 3MC6C 2XH1A 2ZYJA 3EZSA 1ZODA 2AY4A 3FZ6A 5M46A 3DXVA 2AY1A 1D7RA 3E77A 5G09A 4JE5D 2VMNA 3CQ6A 4PIWA 4WYDA 2YCTA 3HQTA 3EIAA 2AATA 2WK8A 2FNIA 2YKYA 5FT6A 1ZC9A 4F5KA 3A9YA 1ASBA 3FQ8A 1DFOA 1P3WA 2E54A 3EUCA 2BI5A 3LY1A 4OT8A 4DQ6A 3DR7A 1AIAA 3WCOA 4U2HA 1FG3A 4EB5A 4K2MA 1ASEA 1DTYA 2DOUA 4XJPA 4AO9A 5F8VA 2W8JA 1VEFA 3QGUA 3JU7A 4RLGA 4H51A 5K8BA 1IX8A 3QBOA 4B9BA 3CAIA 1X29A 4R2NA 1EG5A 4WYGA 1PG8A 4PVFA 1KKJA 4XQ2A 2JJGA 4OMAA 4GSAA 4TMRA 1ELQA 2Q7WA 3AOWA 4UQVA 1WYVA 4ZASA 3WX9A 2ZJGA 3EI7A 3G7QA 1GC0A 3TFUA 4W8IA 2HP1A 3AEJC 1GEXA 1PFFA 2EO5A 1ASAA 2W7FA 3DYDA 4WD2A 2C44A 5EIGB 8AATA 2HOZA 2CSTA 4UOYA 2CANA 4RJ0A 1GC4A 2WK9A 1OXOA 2HZPA 1AJSB 1T3IA 4WLHA 4XJLA 1IX7A 2YHKA 3FDBA 4K05A 3WKSA 4TN4A 1S06A 2BI9A 3FSLA 1YNUA 1QGNA 1FC4A 2GB3A 1ARGA 3F6TA 2W7IA 1BJOA 1M7YA 3N4XA 2DGLA 3T32A 5LHAA 2ORDA 2VIBA 1QJ3A 4ZSWA 1AMQA 1H0CA 2VMPA 5M4BA 2VI8A 1FG7A 4GRXA 2W7MA 2QMAA 4IY7A 2CJHA 4F4EA 3GSBA 5EAAA 3FVXA 2DKBA 4F5FA 1ELUA 1WYTA 3B1EA 4EMYA 3HBXA 1YJZA 3QHXA 4JE5A 3VK3A 1AX4A 1KMKA 2O7CA 1AHEA 3RCHB 1B5OA 5TF5A 2AEUA 2VGZA 1WKHA 3NUIA 3LVLB 3LG0A 1ASCA 2VGUA 3DODA 1LW4A 3AEPA 3LV2A 1WSTA 3FQ7A 2AY7A 1BKGA 4ITGA 2W8UA 1UU0A 2D64A 2ZP7A 3W1IA 1IX6A 1DKAA 1WYUA 3OKSA 2E7UA 1BJ4A 4F5GA 1AMAA 3FKDA 1DGEA 2ZY5A 3AATA 1AHGA 3PDXA 1GC2A 4JEWA 4OYTA 1W7MA 1C7GA 1YOOA 2R0TA 5HXXA 4W91A 4JEVA 1KMJA 3UE8A 2KFPA 4WYEA 3M5UA 4F5JA 3CQ4A 3PD6A 4RITA 2BWPA 5EUNA 3ASBA 3E6GA 3GR9A 3D6KA 3GZDA 5C6UA 4WXFA 3VP6A 4E3RA 1C9CA 1KKPA 1TPLA 1B5PA 2VMOA 4FL0A 1MGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W7G A;  3NNK A;  1J32 A;  4RKD A;  3FFR A;  3WKR A;  1KL2 A;  2D7Z A;  2QLR A;  5F9S A;  1AIC A;  4CBS A;  4F5L A;  4ISY A;  1MAQ A;  4EB7 A;  2Z9U A;  3R4T A;  3WLX A;  1OAT A;  3EI9 A;  2OKJ A;  2VMR A;  4N0W A;  2PB2 A;  2ZSM A;  2G6W A;  4W1W A;  1ASN A;  1DJ9 A;  3GZC A;  3E9K A;  4ATQ A;  1BT4 A;  1ARI A;  1CZE A;  4P3M A;  1ASF A;  1CZC A;  4XEW A;  4PFF A;  3AV7 A;  4ZM4 A;  3I4J A;  1AHF A;  1LW5 A;  3JWA A;  2YOB A;  3HT4 A;  2D7Y A;  2W7L A;  1JF9 A;  3ACZ A;  1TOJ A;  1AJR A;  4U1T A;  2EGY A;  1KL1 A;  2W7H A;  2BIG A;  1TAR A;  3GJU A;  4ZWM A;  5BJ3 A;  3KE3 A;  3PPL A;  4A6U A;  1WYV B;  3BN1 A;  3FVS A;  1LKC A;  3DU4 A;  2W7D A;  4M2M A;  4TV7 A;  4Y0D A;  3GWP A;  1JS6 A;  3HVY A;  1G7W A;  2VLH A;  3GBX A;  4ZAH A;  1VJO A;  4WXB A;  1SVV A;  1YJS A;  3RUY A;  4BA4 A;  3UAK A;  2X8U A;  3JZL A;  3N0L A;  3DC1 A;  3OP7 A;  4A0F A;  5M49 A;  2OGE A;  1AAM A;  1M0O A;  1QIT A;  1GC3 A;  3BCA A;  1S07 A;  4UHM A;  3ZRR A;  2HOR A;  2Z20 A;  1BJO B;  3FQA A;  3H7F A;  4EU1 A;  1RV4 A;  2EZ2 A;  2VI9 A;  3A2B A;  1ASL A;  3BWO A;  4R5Z A;  1LC7 A;  1QZ9 A;  5EUE A;  1QIS A;  2W8T A;  3E2Z A;  1AY8 A;  5JAY A;  1GCK A;  1LC5 A;  1X2A A;  2F8J A;  2HOX A;  3G0T A;  3MBB A;  3QN6 A;  1AKA A;  2CFB A;  1AHY A;  2PB0 A;  3WGC A;  5LH9 A;  1IAX A;  2AY2 A;  1X0M A;  2VMU A;  5E5I A;  2AY8 A;  4CXR A;  1S08 A;  4KXK A;  4RM1 A;  3ZZK A;  1CJ0 A;  1LK9 A;  2YCN A;  1UU2 A;  5FT4 A;  4WYC A;  5G0A A;  3FVU A;  2E7J A;  1E5E A;  3II0 A;  3NTJ A;  1D7U A;  1S09 A;  4J8L A;  1SPA A;  4IXS A;  1WYU B;  3LVJ A;  4HF8 A;  1MLZ A;  1YIY A;  4W1X A;  4WLJ A;  4E77 A;  2ZY4 A;  2C0R A;  2YKU A;  3MAD A;  3ATH A;  1G7X A;  3USF A;  4BMK A;  1SZK A;  2AEV A;  3PJ0 A;  2W7E A;  1D2F A;  7AAT A;  3AEM A;  4QGR A;  3F9T A;  4ZDL A;  1TOE A;  4Y0I A;  2VIA A;  1IAY A;  1O69 A;  2FN6 A;  2WKA A;  3BV0 A;  1M4N A;  2QB3 A;  1Y4I A;  3PD6 B;  4MKJ A;  3R9A A;  4MY5 A;  2JG2 A;  1RVU A;  3B46 A;  2YCP A;  1W23 A;  2CJD A;  2CH2 A;  3NYT A;  2O0R A;  3MAU A;  3W1H A;  3LWS A;  3DRD A;  1TAS A;  3WZF A;  1OXP A;  4MQQ A;  5G2Q A;  1AY5 A;  4PFN A;  1AKB A;  4XJM A;  2V1P A;  5EQC A;  2OQX A;  3QI6 A;  4F5I A;  3FTB A;  5E4Z A;  4F5M A;  4IYO A;  4B98 A;  2QA3 A;  4R8D A;  2EPJ A;  1TOI A;  1ART A;  1GEW A;  3NU8 A;  2E7I A;  3GET A;  2NMP A;  3KGX A;  1GD9 A;  5D5S A;  9AAT A;  4AH3 A;  4J5U A;  3PDB B;  4E3Q A;  2GQN A;  2VMS A;  3HL2 A;  3TQX A;  4IXO A;  1I41 A;  2OAT A;  2D66 A;  2HUF A;  4ZWV A;  3A9Z A;  2BYL A;  1BS0 A;  4WB0 A;  2GSA A;  3PA9 A;  3L8A A;  3PIU A;  4O6Z A;  3NX3 A;  2ZC0 A;  4ATP A;  3Q8N A;  1BQD A;  3BS8 A;  1AIB A;  4JEX A;  1ASG A;  1W3U A;  1AKC A;  2Z9X A;  3ECD A;  1B8G A;  1CL2 A;  2CB1 A;  2JIS A;  1M0Q A;  3AEN A;  1W7L A;  2X3L A;  4W5K A;  4JEY A;  4OC9 A;  2YRI A;  5EFS A;  3FZ8 A;  2AY3 A;  1ARH A;  4JF0 A;  5M4D A;  3NYS A;  3HDO A;  1JG8 A;  5IWQ A;  1ZOB A;  1N8P A;  1SF2 A;  2R5C A;  1W7N A;  3E2Y A;  4A00 A;  1CQ6 A;  1SZU A;  1I29 A;  1OHW A;  1AAW A;  4UHN A;  3NU7 A;  2D61 A;  4A0G A;  1CL1 A;  3QM2 A;  2EH6 A;  2CTZ A;  1YAA A;  1O62 A;  2BI1 A;  3BWN A;  3MAF A;  2R2N A;  2CIN A;  2BIE A;  3RCH A;  2HP2 A;  4KAM A;  3VOM A;  3EI6 A;  3UWC A;  3MC6 A;  2FYF A;  3KKI A;  3GZD C;  3E2Z B;  5AX8 A;  3ISL A;  1G4X A;  4M2J A;  2BIA A;  3FDD A;  4ITX A;  3NRA A;  1TOG A;  3MKJ A;  4JF1 A;  2V0Y A;  3AOV A;  4MKK A;  3EI8 A;  2DR1 A;  2ZSL A;  1AHX A;  5FT5 A;  1M6S A;  1CS1 A;  4HVK A;  2VMW A;  3HLM A;  2WK7 A;  3VAX A;  4P7Y A;  3IF2 A;  4MQP A;  1DJE A;  4OTL A;  2Z67 A;  4AO4 A;  2DGM A;  5G4J A;  2VGT A;  3N5M A;  3MEB A;  4GDY A;  4R5F A;  2DGK A;  4A6T A;  1AMS A;  4K2B A;  5BJ4 A;  1WKG A;  1AY4 A;  2JJF A;  3WGB A;  2GMU A;  4AZJ A;  2Z9V A;  2QB2 A;  2BKW A;  3CQ5 A;  5HDM A;  4Y0H A;  1QJ5 A;  2XBN A;  4LNL A;  3W1J A;  1I48 A;  2D5Y A;  4I8A A;  5DJ1 A;  5EAV A;  3RI6 A;  3H14 A;  4WYF A;  2CJG A;  3TFT A;  3IHJ A;  1BW0 A;  3RBF A;  3BB8 A;  4L0O A;  1S0A A;  2FM1 A;  2BWO A;  1MDZ A;  1UU1 A;  1M0N A;  3LVM A;  3AEJ A;  3BCB A;  3EZ1 A;  3G8M A;  4XK1 A;  3K28 A;  4K2I A;  5DX5 A;  5HHY A;  1WYT B;  2C7T A;  2TPL A;  2Z1Y A;  4LNJ A;  4Q31 A;  4OBU A;  5D95 A;  1V2E A;  4CXQ A;  3DZZ A;  4CVQ A;  4Q76 A;  4KYO A;  3PAA A;  1OHV A;  2AY9 A;  3BCX A;  4LNM A;  2BI3 A;  1N31 A;  2Z9W A;  3AEL A;  4IYO B;  4N0B A;  1ASD A;  2W8V A;  3AEO A;  4IW7 A;  1DJU A;  4ADE A;  4JEZ A;  2VGV A;  4ZDO A;  1SFF A;  2YRR A;  2VMV A;  1GEY A;  3LVK A;  3NUB A;  1EJI A;  1BJW A;  4A72 A;  2VMZ A;  2HUU A;  3FRK A;  4LW2 A;  2BWN A;  1LS3 A;  2EZ1 A;  2HUI A;  2QBT A;  1D7S A;  2HOY A;  5FT8 A;  1DGD A;  4MQR A;  2ZUK A;  4Q6R A;  3NDN A;  4WB0 B;  2AY6 A;  4ADC A;  1B4X A;  4UHO A;  5G2P A;  1JS3 A;  3JW9 A;  3VK2 A;  1BQA A;  3EI5 A;  2Z1Z A;  4ZSY A;  1Z3Z A;  5EUD A;  4XAU A;  3TCM A;  2VMX A;  2D63 A;  1ARS A;  1C4K A;  2VYC A;  3AEN B;  2X5F A;  3COG A;  1V2F A;  1CQ7 A;  1VP4 A;  3ELP A;  3F0H A;  5J8Q A;  3A8U X;  3TAT A;  3I5T A;  1IUG A;  1G4V A;  2CY8 A;  2VMQ A;  3RBL A;  3ZRQ A;  4EFF A;  3ZRP A;  2O1B A;  4NOG A;  4RIZ A;  4RKC A;  4A0R A;  1V2D A;  2GMS A;  1U08 A;  1TOK A;  3CBF A;  3FFH A;  1Z7D A;  4GE9 A;  1CQ8 A;  4W1V A;  5DJ9 A;  5DB5 A;  1PMM A;  2R5C B;  1MLY A;  4GE4 A;  4GEB A;  4BQ0 A;  2YKV A;  4DBC A;  4M2K A;  2AY5 A;  2W8W A;  4BA5 A;  2ZY2 A;  4RJY A;  3DR4 A;  4Q75 A;  1C0N A;  2FQ6 A;  1ASM A;  2JGT A;  3P6K A;  4MSO A;  3WCN A;  1O61 A;  5I92 A;  2JJH A;  3AEM C;  3WY7 A;  1YJY A;  4A6R A;  2W7J A;  3QPG A;  3MAF B;  1E5F A;  1QIR A;  1TAT A;  1GBN A;  3B1D A;  1RV3 A;  2VGW A;  2VMY A;  3EIB A;  3FZ7 A;  3JTX A;  5EIG A;  3DXW A;  2BYJ A;  3VK4 A;  4CBR A;  1B9I A;  3N75 A;  1N2T A;  4RAE A;  4FFC A;  1AJS A;  1M0P A;  1ECX A;  4LW4 A;  4A0H A;  2BI2 A;  2X5D A;  2YKX A;  4AZK A;  3JWB A;  1C7N A;  4ZLV A;  2OKK A;  1V72 A;  2FNU A;  2ZY3 A;  4F5H A;  2D65 A;  2C81 A;  3FD0 A;  1LC8 A;  3E2F A;  1MDX A;  2CH1 A;  2W7K A;  4ADB A;  1MDO A;  1IVR A;  4XJO A;  2OGA A;  1YIZ A;  3PGY A;  1O4S A;  1IJI A;  2VGS A;  4OCA A;  3P1T A;  2BHX A;  2VMT A;  1AMR A;  1UKJ A;  3A9X A;  3ELE A;  3KGW A;  1ORD A;  2RFV A;  1MAP A;  1GDE A;  4E1O A;  4ADD A;  4WYA A;  3BC8 A;  1PMO A;  3ASA A;  4BHD A;  1B9H A;  3ZZJ A;  1BJN A;  3B8X A;  3I16 A;  1X28 A;  1RVY A;  1J04 A;  4AOA A;  3K7Y A;  3K40 A;  4GE7 A;  1EQB A;  2DKJ A;  2PO3 A;  4ZDP A;  2VLF A;  4WP0 A;  4OBV A;  5G4I A;  4IX8 A;  2R5E A;  4WXG A;  3RQ1 A;  1IBJ A;  3PDB A;  4MGR A;  4DGT A;  1M32 A;  1XEY A;  4IXZ A;  3L44 A;  5E3K A;  1XI9 A;  4WBT A;  3B1C A;  3FCR A;  1OHY A;  3BWN C;  1I43 A;  2Z61 A;  1C7O A;  1H1C A;  1SZS A;  4LC3 A;  4ZM3 A;  2JJE A;  1D7V A;  3HMU A;  3NYU A;  3MC6 C;  2XH1 A;  2ZYJ A;  3EZS A;  1ZOD A;  2AY4 A;  3FZ6 A;  5M46 A;  3DXV A;  2AY1 A;  1D7R A;  3E77 A;  5G09 A;  4JE5 D;  2VMN A;  3CQ6 A;  4PIW A;  4WYD A;  2YCT A;  3HQT A;  3EIA A;  2AAT A;  2WK8 A;  2FNI A;  2YKY A;  5FT6 A;  1ZC9 A;  4F5K A;  3A9Y A;  1ASB A;  3FQ8 A;  1DFO A;  1P3W A;  2E54 A;  3EUC A;  2BI5 A;  3LY1 A;  4OT8 A;  4DQ6 A;  3DR7 A;  1AIA A;  3WCO A;  4U2H A;  1FG3 A;  4EB5 A;  4K2M A;  1ASE A;  1DTY A;  2DOU A;  4XJP A;  4AO9 A;  5F8V A;  2W8J A;  1VEF A;  3QGU A;  3JU7 A;  4RLG A;  4H51 A;  5K8B A;  1IX8 A;  3QBO A;  4B9B A;  3CAI A;  1X29 A;  4R2N A;  1EG5 A;  4WYG A;  1PG8 A;  4PVF A;  1KKJ A;  4XQ2 A;  2JJG A;  4OMA A;  4GSA A;  4TMR A;  1ELQ A;  2Q7W A;  3AOW A;  4UQV A;  1WYV A;  4ZAS A;  3WX9 A;  2ZJG A;  3EI7 A;  3G7Q A;  1GC0 A;  3TFU A;  4W8I A;  2HP1 A;  3AEJ C;  1GEX A;  1PFF A;  2EO5 A;  1ASA A;  2W7F A;  3DYD A;  4WD2 A;  2C44 A;  5EIG B;  8AAT A;  2HOZ A;  2CST A;  4UOY A;  2CAN A;  4RJ0 A;  1GC4 A;  2WK9 A;  1OXO A;  2HZP A;  1AJS B;  1T3I A;  4WLH A;  4XJL A;  1IX7 A;  2YHK A;  3FDB A;  3WKS A;  4TN4 A;  1S06 A;  2BI9 A;  3FSL A;  1YNU A;  1QGN A;  1FC4 A;  2GB3 A;  1ARG A;  3F6T A;  2W7I A;  1BJO A;  1M7Y A;  2DGL A;  3T32 A;  5LHA A;  2ORD A;  2VIB A;  1QJ3 A;  4ZSW A;  1AMQ A;  1H0C A;  2VMP A;  5M4B A;  2VI8 A;  1FG7 A;  4GRX A;  2W7M A;  2QMA A;  4IY7 A;  2CJH A;  4F4E A;  3GSB A;  5EAA A;  3FVX A;  2DKB A;  4F5F A;  1ELU A;  1WYT A;  3B1E A;  4EMY A;  3HBX A;  1YJZ A;  3QHX A;  4JE5 A;  3VK3 A;  1AX4 A;  1KMK A;  2O7C A;  1AHE A;  3RCH B;  1B5O A;  5TF5 A;  2AEU A;  2VGZ A;  1WKH A;  3NUI A;  3LVL B;  3LG0 A;  1ASC A;  2VGU A;  3DOD A;  1LW4 A;  3AEP A;  3LV2 A;  1WST A;  3FQ7 A;  2AY7 A;  1BKG A;  4ITG A;  2W8U A;  1UU0 A;  2D64 A;  2ZP7 A;  3W1I A;  1IX6 A;  1DKA A;  1WYU A;  3OKS A;  2E7U A;  1BJ4 A;  4F5G A;  1AMA A;  3FKD A;  1DGE A;  2ZY5 A;  3AAT A;  1AHG A;  3PDX A;  1GC2 A;  4JEW A;  4OYT A;  1W7M A;  1C7G A;  1YOO A;  2R0T A;  5HXX A;  4W91 A;  4JEV A;  1KMJ A;  3UE8 A;  4WYE A;  3M5U A;  4F5J A;  3CQ4 A;  3PD6 A;  4RIT A;  2BWP A;  5EUN A;  3ASB A;  3E6G A;  3GR9 A;  3D6K A;  3GZD A;  5C6U A;  4WXF A;  3VP6 A;  4E3R A;  1C9C A;  1KKP A;  1TPL A;  1B5P A;  2VMO A;  4FL0 A;  1MGV A; 
#chains in the Genus database with same CATH topology
 2W7G A;  3NNK A;  1J32 A;  4RKD A;  3FFR A;  3WKR A;  1KL2 A;  2D7Z A;  2QLR A;  5F9S A;  1AIC A;  4CBS A;  4F5L A;  4ISY A;  1MAQ A;  4EB7 A;  2Z9U A;  3R4T A;  3WLX A;  1OAT A;  3EI9 A;  2OKJ A;  2VMR A;  4N0W A;  2PB2 A;  2ZSM A;  2G6W A;  4W1W A;  1ASN A;  1DJ9 A;  2QSR A;  3GZC A;  3E9K A;  4ATQ A;  1BT4 A;  1ARI A;  1CZE A;  4P3M A;  1ASF A;  1CZC A;  4XEW A;  4PFF A;  3AV7 A;  4ZM4 A;  3I4J A;  1AHF A;  1LW5 A;  3JWA A;  2YOB A;  3HT4 A;  2D7Y A;  2W7L A;  1JF9 A;  3ACZ A;  1TOJ A;  1AJR A;  4U1T A;  2EGY A;  1KL1 A;  2W7H A;  2BIG A;  1TAR A;  3GJU A;  4ZWM A;  2FKI A;  5BJ3 A;  3KE3 A;  3PPL A;  4A6U A;  1WYV B;  3BN1 A;  3FVS A;  1LKC A;  3DU4 A;  2W7D A;  4M2M A;  4TV7 A;  4Y0D A;  3GWP A;  1JS6 A;  3HVY A;  1G7W A;  2VLH A;  3GBX A;  4ZAH A;  1VJO A;  4WXB A;  1SVV A;  1YJS A;  3RUY A;  4BA4 A;  3UAK A;  2X8U A;  3JZL A;  3N0L A;  3DC1 A;  3OP7 A;  4A0F A;  5M49 A;  2OGE A;  1AAM A;  1M0O A;  1QIT A;  1GC3 A;  3BCA A;  1S07 A;  4UHM A;  2EYQ A;  3ZRR A;  2HOR A;  2Z20 A;  1BJO B;  3FQA A;  3H7F A;  4EU1 A;  1RV4 A;  2EZ2 A;  2VI9 A;  3A2B A;  1ASL A;  3BWO A;  4R5Z A;  1LC7 A;  1QZ9 A;  5EUE A;  1QIS A;  2W8T A;  3E2Z A;  1AY8 A;  5JAY A;  1GCK A;  1LC5 A;  1X2A A;  2F8J A;  2HOX A;  3G0T A;  3MBB A;  3QN6 A;  1AKA A;  2CFB A;  1AHY A;  2PB0 A;  3WGC A;  5LH9 A;  1IAX A;  2AY2 A;  1X0M A;  2VMU A;  5E5I A;  2AY8 A;  4CXR A;  1S08 A;  4KXK A;  4RM1 A;  3ZZK A;  1CJ0 A;  1LK9 A;  2YCN A;  1UU2 A;  5FT4 A;  4WYC A;  3N4S A;  5G0A A;  3FVU A;  2E7J A;  1E5E A;  3II0 A;  3NTJ A;  1D7U A;  1S09 A;  4J8L A;  1SPA A;  4IXS A;  1WYU B;  3LVJ A;  4HF8 A;  1MLZ A;  1YIY A;  4W1X A;  4WLJ A;  4E77 A;  2ZY4 A;  2C0R A;  2YKU A;  3MAD A;  3ATH A;  1G7X A;  3USF A;  4BMK A;  1SZK A;  2AEV A;  3PJ0 A;  2W7E A;  1D2F A;  3N7N A;  7AAT A;  3AEM A;  4QGR A;  3F9T A;  4ZDL A;  1TOE A;  4Y0I A;  2VIA A;  1IAY A;  1O69 A;  2FN6 A;  2WKA A;  3BV0 A;  1M4N A;  1KAF A;  2QB3 A;  1Y4I A;  3PD6 B;  4MKJ A;  3R9A A;  4MY5 A;  2JG2 A;  1RVU A;  3B46 A;  2YCP A;  1W23 A;  2CJD A;  2CH2 A;  3NYT A;  2O0R A;  3MAU A;  3W1H A;  3LWS A;  3DRD A;  1TAS A;  3WZF A;  1OXP A;  4MQQ A;  5G2Q A;  1AY5 A;  4PFN A;  1AKB A;  4XJM A;  2V1P A;  5EQC A;  2OQX A;  3QI6 A;  4F5I A;  3FTB A;  5E4Z A;  4F5M A;  4IYO A;  4B98 A;  2QA3 A;  4R8D A;  2EPJ A;  1TOI A;  1ART A;  1GEW A;  3NU8 A;  2E7I A;  3GET A;  2NMP A;  3KGX A;  1GD9 A;  5D5S A;  9AAT A;  4AH3 A;  4J5U A;  3PDB B;  4E3Q A;  2GQN A;  2VMS A;  3HL2 A;  3TQX A;  4IXO A;  1I41 A;  2OAT A;  2D66 A;  2HUF A;  4ZWV A;  3A9Z A;  2BYL A;  1BS0 A;  4WB0 A;  2GSA A;  3PA9 A;  3L8A A;  3PIU A;  4O6Z A;  3NX3 A;  2ZC0 A;  4ATP A;  3Q8N A;  1BQD A;  3BS8 A;  1AIB A;  4JEX A;  1ASG A;  1W3U A;  1AKC A;  2Z9X A;  3ECD A;  1B8G A;  1CL2 A;  2CB1 A;  2JIS A;  1M0Q A;  3AEN A;  1W7L A;  2X3L A;  4W5K A;  4JEY A;  4OC9 A;  2YRI A;  5EFS A;  3FZ8 A;  2AY3 A;  1ARH A;  4JF0 A;  5M4D A;  3NYS A;  3HDO A;  1JG8 A;  5IWQ A;  1ZOB A;  1N8P A;  1SF2 A;  2R5C A;  1W7N A;  3E2Y A;  4A00 A;  1CQ6 A;  1SZU A;  1I29 A;  1OHW A;  1AAW A;  4UHN A;  3NU7 A;  2D61 A;  4A0G A;  1CL1 A;  3QM2 A;  2EH6 A;  2CTZ A;  1YAA A;  1O62 A;  2BI1 A;  3BWN A;  3MAF A;  2R2N A;  2CIN A;  2BIE A;  3RCH A;  2HP2 A;  4KAM A;  3VOM A;  3EI6 A;  3UWC A;  3MC6 A;  2FYF A;  3KKI A;  3GZD C;  3E2Z B;  5AX8 A;  3ISL A;  1G4X A;  4M2J A;  2BIA A;  3FDD A;  4ITX A;  3NRA A;  1TOG A;  3MKJ A;  4JF1 A;  2V0Y A;  3AOV A;  4MKK A;  3EI8 A;  2DR1 A;  2ZSL A;  1AHX A;  5FT5 A;  1M6S A;  1CS1 A;  4HVK A;  2VMW A;  3HLM A;  2WK7 A;  3VAX A;  4P7Y A;  3IF2 A;  4MQP A;  1DJE A;  4OTL A;  2Z67 A;  4AO4 A;  2DGM A;  5G4J A;  2VGT A;  3N5M A;  3MEB A;  4GDY A;  4R5F A;  2DGK A;  4A6T A;  1AMS A;  4K2B A;  5BJ4 A;  1WKG A;  1AY4 A;  2JJF A;  3WGB A;  2GMU A;  4AZJ A;  2Z9V A;  2QB2 A;  2BKW A;  3CQ5 A;  5HDM A;  4Y0H A;  1QJ5 A;  2XBN A;  4LNL A;  3W1J A;  1I48 A;  2D5Y A;  4I8A A;  5DJ1 A;  5EAV A;  3RI6 A;  3H14 A;  4WYF A;  2CJG A;  3TFT A;  3IHJ A;  1BW0 A;  3RBF A;  3BB8 A;  4L0O A;  1S0A A;  2FM1 A;  2BWO A;  1MDZ A;  1UU1 A;  1M0N A;  3LVM A;  3AEJ A;  3BCB A;  3EZ1 A;  3G8M A;  4XK1 A;  3K28 A;  4K2I A;  5DX5 A;  5HHY A;  1WYT B;  2G7J A;  2C7T A;  2TPL A;  2Z1Y A;  4LNJ A;  4Q31 A;  4OBU A;  5D95 A;  1V2E A;  4CXQ A;  3DZZ A;  4CVQ A;  4Q76 A;  4KYO A;  3PAA A;  1OHV A;  2AY9 A;  3BCX A;  4LNM A;  2BI3 A;  1N31 A;  2Z9W A;  3AEL A;  4IYO B;  4N0B A;  1ASD A;  2W8V A;  3AEO A;  4IW7 A;  1DJU A;  4ADE A;  4JEZ A;  2VGV A;  4ZDO A;  1SFF A;  2YRR A;  2VMV A;  1GEY A;  3LVK A;  3NUB A;  1EJI A;  1BJW A;  4A72 A;  2VMZ A;  2HUU A;  3FRK A;  4LW2 A;  2BWN A;  1LS3 A;  2EZ1 A;  2HUI A;  2QBT A;  5KTB A;  1D7S A;  2HOY A;  5FT8 A;  3N4R A;  1DGD A;  4MQR A;  2ZUK A;  4Q6R A;  3NDN A;  4WB0 B;  2AY6 A;  4ADC A;  1B4X A;  4UHO A;  5G2P A;  1JS3 A;  3JW9 A;  3VK2 A;  1BQA A;  3EI5 A;  2Z1Z A;  4ZSY A;  1Z3Z A;  5EUD A;  4XAU A;  3TCM A;  2VMX A;  2D63 A;  1ARS A;  1C4K A;  2VYC A;  3AEN B;  2X5F A;  3COG A;  1V2F A;  1CQ7 A;  1VP4 A;  3ELP A;  3F0H A;  5J8Q A;  3A8U X;  3TAT A;  3I5T A;  1IUG A;  1G4V A;  2CY8 A;  2VMQ A;  3RBL A;  3ZRQ A;  4EFF A;  3ZRP A;  2O1B A;  4NOG A;  4RIZ A;  4RKC A;  4A0R A;  1V2D A;  2GMS A;  1U08 A;  4H63 Q;  1TOK A;  3CBF A;  3FFH A;  1Z7D A;  4GE9 A;  1CQ8 A;  4W1V A;  5DJ9 A;  5DB5 A;  1PMM A;  2R5C B;  1MLY A;  4GE4 A;  4GEB A;  4BQ0 A;  2WB6 A;  2YKV A;  4DBC A;  4M2K A;  2AY5 A;  2W8W A;  4BA5 A;  2ZY2 A;  4RJY A;  3DR4 A;  4Q75 A;  1C0N A;  2FQ6 A;  1ASM A;  2JGT A;  3P6K A;  4MSO A;  3WCN A;  1O61 A;  5I92 A;  3H9X A;  2JJH A;  3AEM C;  3WY7 A;  1YJY A;  4A6R A;  2W7J A;  3QPG A;  3MAF B;  1E5F A;  1QIR A;  1TAT A;  1GBN A;  3B1D A;  1RV3 A;  2VGW A;  2VMY A;  3EIB A;  3FZ7 A;  3JTX A;  5EIG A;  3DXW A;  2BYJ A;  3VK4 A;  4CBR A;  1B9I A;  3N75 A;  1N2T A;  4RAE A;  4FFC A;  1AJS A;  1M0P A;  1ECX A;  4LW4 A;  4A0H A;  2BI2 A;  2X5D A;  2YKX A;  4AZK A;  3JWB A;  1C7N A;  4ZLV A;  2OKK A;  1V72 A;  2FNU A;  2ZY3 A;  4F5H A;  2D65 A;  2C81 A;  3FD0 A;  1LC8 A;  3E2F A;  1MDX A;  2CH1 A;  2W7K A;  4ADB A;  1MDO A;  1IVR A;  4XJO A;  2OGA A;  1YIZ A;  3PGY A;  1O4S A;  1IJI A;  2VGS A;  4OCA A;  3P1T A;  2BHX A;  2VMT A;  1AMR A;  1UKJ A;  3A9X A;  3ELE A;  3KGW A;  1ORD A;  2RFV A;  1MAP A;  1GDE A;  4E1O A;  4ADD A;  4WYA A;  3BC8 A;  1PMO A;  3ASA A;  4BHD A;  1B9H A;  3ZZJ A;  1BJN A;  3B8X A;  3I16 A;  1X28 A;  2A1V A;  1RVY A;  1J04 A;  4AOA A;  3K7Y A;  3K40 A;  4GE7 A;  1EQB A;  2DKJ A;  2PO3 A;  4ZDP A;  2VLF A;  4WP0 A;  4OBV A;  5G4I A;  4IX8 A;  2R5E A;  4WXG A;  3RQ1 A;  1IBJ A;  3PDB A;  4MGR A;  4DGT A;  1M32 A;  1XEY A;  4IXZ A;  3L44 A;  5E3K A;  1XI9 A;  4WBT A;  3B1C A;  3FCR A;  1OHY A;  3BWN C;  1I43 A;  2Z61 A;  1C7O A;  1H1C A;  1SZS A;  4LC3 A;  4ZM3 A;  2JJE A;  1D7V A;  3HMU A;  3NYU A;  3MC6 C;  2XH1 A;  2ZYJ A;  3EZS A;  1ZOD A;  2AY4 A;  3FZ6 A;  5M46 A;  3DXV A;  2AY1 A;  1D7R A;  3E77 A;  5G09 A;  4JE5 D;  2VMN A;  3CQ6 A;  4PIW A;  4WYD A;  2YCT A;  3HQT A;  3EIA A;  2AAT A;  2WK8 A;  2FNI A;  2YKY A;  5FT6 A;  1ZC9 A;  4F5K A;  3A9Y A;  1ASB A;  3FQ8 A;  1DFO A;  1P3W A;  2E54 A;  3EUC A;  2BI5 A;  3LY1 A;  4OT8 A;  4DQ6 A;  3DR7 A;  1AIA A;  3WCO A;  4U2H A;  1FG3 A;  4EB5 A;  4K2M A;  1ASE A;  1DTY A;  2DOU A;  4XJP A;  4AO9 A;  5F8V A;  2W8J A;  1VEF A;  3QGU A;  3JU7 A;  4RLG A;  4H51 A;  5K8B A;  1IX8 A;  3QBO A;  4B9B A;  3CAI A;  1X29 A;  4R2N A;  1EG5 A;  4WYG A;  1PG8 A;  4PVF A;  1KKJ A;  4XQ2 A;  2JJG A;  4OMA A;  4GSA A;  4TMR A;  1ELQ A;  2Q7W A;  3AOW A;  4UQV A;  1WYV A;  4ZAS A;  3WX9 A;  2ZJG A;  3EI7 A;  3G7Q A;  1GC0 A;  3TFU A;  4W8I A;  2HP1 A;  3AEJ C;  1GEX A;  1PFF A;  2EO5 A;  1ASA A;  2W7F A;  3DYD A;  4WD2 A;  2C44 A;  5EIG B;  8AAT A;  2HOZ A;  2CST A;  4UOY A;  2CAN A;  4RJ0 A;  1GC4 A;  2WK9 A;  1OXO A;  2HZP A;  1AJS B;  1T3I A;  4WLH A;  4XJL A;  1IX7 A;  2YHK A;  3FDB A;  4K05 A;  3WKS A;  4TN4 A;  1S06 A;  2BI9 A;  3FSL A;  1YNU A;  1QGN A;  1FC4 A;  2GB3 A;  1ARG A;  3F6T A;  2W7I A;  1BJO A;  1M7Y A;  3N4X A;  2DGL A;  3T32 A;  5LHA A;  2ORD A;  2VIB A;  1QJ3 A;  4ZSW A;  1AMQ A;  1H0C A;  2VMP A;  5M4B A;  2VI8 A;  1FG7 A;  4GRX A;  2W7M A;  2QMA A;  4IY7 A;  2CJH A;  4F4E A;  3GSB A;  5EAA A;  3FVX A;  2DKB A;  4F5F A;  1ELU A;  1WYT A;  3B1E A;  4EMY A;  3HBX A;  1YJZ A;  3QHX A;  4JE5 A;  3VK3 A;  1AX4 A;  1KMK A;  2O7C A;  1AHE A;  3RCH B;  1B5O A;  5TF5 A;  2AEU A;  2VGZ A;  1WKH A;  3NUI A;  3LVL B;  3LG0 A;  1ASC A;  2VGU A;  3DOD A;  1LW4 A;  3AEP A;  3LV2 A;  1WST A;  3FQ7 A;  2AY7 A;  1BKG A;  4ITG A;  2W8U A;  1UU0 A;  2D64 A;  2ZP7 A;  3W1I A;  1IX6 A;  1DKA A;  1WYU A;  3OKS A;  2E7U A;  1BJ4 A;  4F5G A;  1AMA A;  3FKD A;  1DGE A;  2ZY5 A;  3AAT A;  1AHG A;  3PDX A;  1GC2 A;  4JEW A;  4OYT A;  1W7M A;  1C7G A;  1YOO A;  2R0T A;  5HXX A;  4W91 A;  4JEV A;  1KMJ A;  3UE8 A;  2KFP A;  4WYE A;  3M5U A;  4F5J A;  3CQ4 A;  3PD6 A;  4RIT A;  2BWP A;  5EUN A;  3ASB A;  3E6G A;  3GR9 A;  3D6K A;  3GZD A;  5C6U A;  4WXF A;  3VP6 A;  4E3R A;  1C9C A;  1KKP A;  1TPL A;  1B5P A;  2VMO A;  4FL0 A;  1MGV A; 
#chains in the Genus database with same CATH homology
 2W7G A;  3NNK A;  1J32 A;  4RKD A;  3FFR A;  3WKR A;  1KL2 A;  2D7Z A;  2QLR A;  5F9S A;  1AIC A;  4CBS A;  4F5L A;  4ISY A;  1MAQ A;  4EB7 A;  2Z9U A;  3R4T A;  3WLX A;  1OAT A;  3EI9 A;  2OKJ A;  2VMR A;  4N0W A;  2PB2 A;  2ZSM A;  2G6W A;  4W1W A;  1ASN A;  1DJ9 A;  2QSR A;  3GZC A;  3E9K A;  4ATQ A;  1BT4 A;  1ARI A;  1CZE A;  4P3M A;  1ASF A;  1CZC A;  4XEW A;  4PFF A;  3AV7 A;  4ZM4 A;  3I4J A;  1AHF A;  1LW5 A;  3JWA A;  2YOB A;  3HT4 A;  2D7Y A;  2W7L A;  1JF9 A;  3ACZ A;  1TOJ A;  1AJR A;  4U1T A;  2EGY A;  1KL1 A;  2W7H A;  2BIG A;  1TAR A;  3GJU A;  4ZWM A;  2FKI A;  5BJ3 A;  3KE3 A;  3PPL A;  4A6U A;  1WYV B;  3BN1 A;  3FVS A;  1LKC A;  3DU4 A;  2W7D A;  4M2M A;  4TV7 A;  4Y0D A;  3GWP A;  1JS6 A;  3HVY A;  1G7W A;  2VLH A;  3GBX A;  4ZAH A;  1VJO A;  4WXB A;  1SVV A;  1YJS A;  3RUY A;  4BA4 A;  3UAK A;  2X8U A;  3JZL A;  3N0L A;  3DC1 A;  3OP7 A;  4A0F A;  5M49 A;  2OGE A;  1AAM A;  1M0O A;  1QIT A;  1GC3 A;  3BCA A;  1S07 A;  4UHM A;  2EYQ A;  3ZRR A;  2HOR A;  2Z20 A;  1BJO B;  3FQA A;  3H7F A;  4EU1 A;  1RV4 A;  2EZ2 A;  2VI9 A;  3A2B A;  1ASL A;  3BWO A;  4R5Z A;  1LC7 A;  1QZ9 A;  5EUE A;  1QIS A;  2W8T A;  3E2Z A;  1AY8 A;  5JAY A;  1GCK A;  1LC5 A;  1X2A A;  2F8J A;  2HOX A;  3G0T A;  3MBB A;  3QN6 A;  1AKA A;  2CFB A;  1AHY A;  2PB0 A;  3WGC A;  5LH9 A;  1IAX A;  2AY2 A;  1X0M A;  2VMU A;  5E5I A;  2AY8 A;  4CXR A;  1S08 A;  4KXK A;  4RM1 A;  3ZZK A;  1CJ0 A;  1LK9 A;  2YCN A;  1UU2 A;  5FT4 A;  4WYC A;  3N4S A;  5G0A A;  3FVU A;  2E7J A;  1E5E A;  3II0 A;  3NTJ A;  1D7U A;  1S09 A;  4J8L A;  1SPA A;  4IXS A;  1WYU B;  3LVJ A;  4HF8 A;  1MLZ A;  1YIY A;  4W1X A;  4WLJ A;  4E77 A;  2ZY4 A;  2C0R A;  2YKU A;  3MAD A;  3ATH A;  1G7X A;  3USF A;  4BMK A;  1SZK A;  2AEV A;  3PJ0 A;  2W7E A;  1D2F A;  3N7N A;  7AAT A;  3AEM A;  4QGR A;  3F9T A;  4ZDL A;  1TOE A;  4Y0I A;  2VIA A;  1IAY A;  1O69 A;  2FN6 A;  2WKA A;  3BV0 A;  1M4N A;  2QB3 A;  1Y4I A;  3PD6 B;  4MKJ A;  3R9A A;  4MY5 A;  2JG2 A;  1RVU A;  3B46 A;  2YCP A;  1W23 A;  2CJD A;  2CH2 A;  3NYT A;  2O0R A;  3MAU A;  3W1H A;  3LWS A;  3DRD A;  1TAS A;  3WZF A;  1OXP A;  4MQQ A;  5G2Q A;  1AY5 A;  4PFN A;  1AKB A;  4XJM A;  2V1P A;  5EQC A;  2OQX A;  3QI6 A;  4F5I A;  3FTB A;  5E4Z A;  4F5M A;  4IYO A;  4B98 A;  2QA3 A;  4R8D A;  2EPJ A;  1TOI A;  1ART A;  1GEW A;  3NU8 A;  2E7I A;  3GET A;  2NMP A;  3KGX A;  1GD9 A;  5D5S A;  9AAT A;  4AH3 A;  4J5U A;  3PDB B;  4E3Q A;  2GQN A;  2VMS A;  3HL2 A;  3TQX A;  4IXO A;  1I41 A;  2OAT A;  2D66 A;  2HUF A;  4ZWV A;  3A9Z A;  2BYL A;  1BS0 A;  4WB0 A;  2GSA A;  3PA9 A;  3L8A A;  3PIU A;  4O6Z A;  3NX3 A;  2ZC0 A;  4ATP A;  3Q8N A;  1BQD A;  3BS8 A;  1AIB A;  4JEX A;  1ASG A;  1W3U A;  1AKC A;  2Z9X A;  3ECD A;  1B8G A;  1CL2 A;  2CB1 A;  2JIS A;  1M0Q A;  3AEN A;  1W7L A;  2X3L A;  4W5K A;  4JEY A;  4OC9 A;  2YRI A;  5EFS A;  3FZ8 A;  2AY3 A;  1ARH A;  4JF0 A;  5M4D A;  3NYS A;  3HDO A;  1JG8 A;  5IWQ A;  1ZOB A;  1N8P A;  1SF2 A;  2R5C A;  1W7N A;  3E2Y A;  4A00 A;  1CQ6 A;  1SZU A;  1I29 A;  1OHW A;  1AAW A;  4UHN A;  3NU7 A;  2D61 A;  4A0G A;  1CL1 A;  3QM2 A;  2EH6 A;  2CTZ A;  1YAA A;  1O62 A;  2BI1 A;  3BWN A;  3MAF A;  2R2N A;  2CIN A;  2BIE A;  3RCH A;  2HP2 A;  4KAM A;  3VOM A;  3EI6 A;  3UWC A;  3MC6 A;  2FYF A;  3KKI A;  3GZD C;  3E2Z B;  5AX8 A;  3ISL A;  1G4X A;  4M2J A;  2BIA A;  3FDD A;  4ITX A;  3NRA A;  1TOG A;  3MKJ A;  4JF1 A;  2V0Y A;  3AOV A;  4MKK A;  3EI8 A;  2DR1 A;  2ZSL A;  1AHX A;  5FT5 A;  1M6S A;  1CS1 A;  4HVK A;  2VMW A;  3HLM A;  2WK7 A;  3VAX A;  4P7Y A;  3IF2 A;  4MQP A;  1DJE A;  4OTL A;  2Z67 A;  4AO4 A;  2DGM A;  5G4J A;  2VGT A;  3N5M A;  3MEB A;  4GDY A;  4R5F A;  2DGK A;  4A6T A;  1AMS A;  4K2B A;  5BJ4 A;  1WKG A;  1AY4 A;  2JJF A;  3WGB A;  2GMU A;  4AZJ A;  2Z9V A;  2QB2 A;  2BKW A;  3CQ5 A;  5HDM A;  4Y0H A;  1QJ5 A;  2XBN A;  4LNL A;  3W1J A;  1I48 A;  2D5Y A;  4I8A A;  5DJ1 A;  5EAV A;  3RI6 A;  3H14 A;  4WYF A;  2CJG A;  3TFT A;  3IHJ A;  1BW0 A;  3RBF A;  3BB8 A;  4L0O A;  1S0A A;  2FM1 A;  2BWO A;  1MDZ A;  1UU1 A;  1M0N A;  3LVM A;  3AEJ A;  3BCB A;  3EZ1 A;  3G8M A;  4XK1 A;  3K28 A;  4K2I A;  5DX5 A;  5HHY A;  1WYT B;  2G7J A;  2C7T A;  2TPL A;  2Z1Y A;  4LNJ A;  4Q31 A;  4OBU A;  5D95 A;  1V2E A;  4CXQ A;  3DZZ A;  4CVQ A;  4Q76 A;  4KYO A;  3PAA A;  1OHV A;  2AY9 A;  3BCX A;  4LNM A;  2BI3 A;  1N31 A;  2Z9W A;  3AEL A;  4IYO B;  4N0B A;  1ASD A;  2W8V A;  3AEO A;  4IW7 A;  1DJU A;  4ADE A;  4JEZ A;  2VGV A;  4ZDO A;  1SFF A;  2YRR A;  2VMV A;  1GEY A;  3LVK A;  3NUB A;  1EJI A;  1BJW A;  4A72 A;  2VMZ A;  2HUU A;  3FRK A;  4LW2 A;  2BWN A;  1LS3 A;  2EZ1 A;  2HUI A;  2QBT A;  5KTB A;  1D7S A;  2HOY A;  5FT8 A;  3N4R A;  1DGD A;  4MQR A;  2ZUK A;  4Q6R A;  3NDN A;  4WB0 B;  2AY6 A;  4ADC A;  1B4X A;  4UHO A;  5G2P A;  1JS3 A;  3JW9 A;  3VK2 A;  1BQA A;  3EI5 A;  2Z1Z A;  4ZSY A;  1Z3Z A;  5EUD A;  4XAU A;  3TCM A;  2VMX A;  2D63 A;  1ARS A;  1C4K A;  2VYC A;  3AEN B;  2X5F A;  3COG A;  1V2F A;  1CQ7 A;  1VP4 A;  3ELP A;  3F0H A;  5J8Q A;  3A8U X;  3TAT A;  3I5T A;  1IUG A;  1G4V A;  2CY8 A;  2VMQ A;  3RBL A;  3ZRQ A;  4EFF A;  3ZRP A;  2O1B A;  4NOG A;  4RIZ A;  4RKC A;  4A0R A;  1V2D A;  2GMS A;  1U08 A;  4H63 Q;  1TOK A;  3CBF A;  3FFH A;  1Z7D A;  4GE9 A;  1CQ8 A;  4W1V A;  5DJ9 A;  5DB5 A;  1PMM A;  2R5C B;  1MLY A;  4GE4 A;  4GEB A;  4BQ0 A;  2WB6 A;  2YKV A;  4DBC A;  4M2K A;  2AY5 A;  2W8W A;  4BA5 A;  2ZY2 A;  4RJY A;  3DR4 A;  4Q75 A;  1C0N A;  2FQ6 A;  1ASM A;  2JGT A;  3P6K A;  4MSO A;  3WCN A;  1O61 A;  5I92 A;  3H9X A;  2JJH A;  3AEM C;  3WY7 A;  1YJY A;  4A6R A;  2W7J A;  3QPG A;  3MAF B;  1E5F A;  1QIR A;  1TAT A;  1GBN A;  3B1D A;  1RV3 A;  2VGW A;  2VMY A;  3EIB A;  3FZ7 A;  3JTX A;  5EIG A;  3DXW A;  2BYJ A;  3VK4 A;  4CBR A;  1B9I A;  3N75 A;  1N2T A;  4RAE A;  4FFC A;  1AJS A;  1M0P A;  1ECX A;  4LW4 A;  4A0H A;  2BI2 A;  2X5D A;  2YKX A;  4AZK A;  3JWB A;  1C7N A;  4ZLV A;  2OKK A;  1V72 A;  2FNU A;  2ZY3 A;  4F5H A;  2D65 A;  2C81 A;  3FD0 A;  1LC8 A;  3E2F A;  1MDX A;  2CH1 A;  2W7K A;  4ADB A;  1MDO A;  1IVR A;  4XJO A;  2OGA A;  1YIZ A;  3PGY A;  1O4S A;  1IJI A;  2VGS A;  4OCA A;  3P1T A;  2BHX A;  2VMT A;  1AMR A;  1UKJ A;  3A9X A;  3ELE A;  3KGW A;  1ORD A;  2RFV A;  1MAP A;  1GDE A;  4E1O A;  4ADD A;  4WYA A;  3BC8 A;  1PMO A;  3ASA A;  4BHD A;  1B9H A;  3ZZJ A;  1BJN A;  3B8X A;  3I16 A;  1X28 A;  2A1V A;  1RVY A;  1J04 A;  4AOA A;  3K7Y A;  3K40 A;  4GE7 A;  1EQB A;  2DKJ A;  2PO3 A;  4ZDP A;  2VLF A;  4WP0 A;  4OBV A;  5G4I A;  4IX8 A;  2R5E A;  4WXG A;  3RQ1 A;  1IBJ A;  3PDB A;  4MGR A;  4DGT A;  1M32 A;  1XEY A;  4IXZ A;  3L44 A;  5E3K A;  1XI9 A;  4WBT A;  3B1C A;  3FCR A;  1OHY A;  3BWN C;  1I43 A;  2Z61 A;  1C7O A;  1H1C A;  1SZS A;  4LC3 A;  4ZM3 A;  2JJE A;  1D7V A;  3HMU A;  3NYU A;  3MC6 C;  2XH1 A;  2ZYJ A;  3EZS A;  1ZOD A;  2AY4 A;  3FZ6 A;  5M46 A;  3DXV A;  2AY1 A;  1D7R A;  3E77 A;  5G09 A;  4JE5 D;  2VMN A;  3CQ6 A;  4PIW A;  4WYD A;  2YCT A;  3HQT A;  3EIA A;  2AAT A;  2WK8 A;  2FNI A;  2YKY A;  5FT6 A;  1ZC9 A;  4F5K A;  3A9Y A;  1ASB A;  3FQ8 A;  1DFO A;  1P3W A;  2E54 A;  3EUC A;  2BI5 A;  3LY1 A;  4OT8 A;  4DQ6 A;  3DR7 A;  1AIA A;  3WCO A;  4U2H A;  1FG3 A;  4EB5 A;  4K2M A;  1ASE A;  1DTY A;  2DOU A;  4XJP A;  4AO9 A;  5F8V A;  2W8J A;  1VEF A;  3QGU A;  3JU7 A;  4RLG A;  4H51 A;  5K8B A;  1IX8 A;  3QBO A;  4B9B A;  3CAI A;  1X29 A;  4R2N A;  1EG5 A;  4WYG A;  1PG8 A;  4PVF A;  1KKJ A;  4XQ2 A;  2JJG A;  4OMA A;  4GSA A;  4TMR A;  1ELQ A;  2Q7W A;  3AOW A;  4UQV A;  1WYV A;  4ZAS A;  3WX9 A;  2ZJG A;  3EI7 A;  3G7Q A;  1GC0 A;  3TFU A;  4W8I A;  2HP1 A;  3AEJ C;  1GEX A;  1PFF A;  2EO5 A;  1ASA A;  2W7F A;  3DYD A;  4WD2 A;  2C44 A;  5EIG B;  8AAT A;  2HOZ A;  2CST A;  4UOY A;  2CAN A;  4RJ0 A;  1GC4 A;  2WK9 A;  1OXO A;  2HZP A;  1AJS B;  1T3I A;  4WLH A;  4XJL A;  1IX7 A;  2YHK A;  3FDB A;  4K05 A;  3WKS A;  4TN4 A;  1S06 A;  2BI9 A;  3FSL A;  1YNU A;  1QGN A;  1FC4 A;  2GB3 A;  1ARG A;  3F6T A;  2W7I A;  1BJO A;  1M7Y A;  3N4X A;  2DGL A;  3T32 A;  5LHA A;  2ORD A;  2VIB A;  1QJ3 A;  4ZSW A;  1AMQ A;  1H0C A;  2VMP A;  5M4B A;  2VI8 A;  1FG7 A;  4GRX A;  2W7M A;  2QMA A;  4IY7 A;  2CJH A;  4F4E A;  3GSB A;  5EAA A;  3FVX A;  2DKB A;  4F5F A;  1ELU A;  1WYT A;  3B1E A;  4EMY A;  3HBX A;  1YJZ A;  3QHX A;  4JE5 A;  3VK3 A;  1AX4 A;  1KMK A;  2O7C A;  1AHE A;  3RCH B;  1B5O A;  5TF5 A;  2AEU A;  2VGZ A;  1WKH A;  3NUI A;  3LVL B;  3LG0 A;  1ASC A;  2VGU A;  3DOD A;  1LW4 A;  3AEP A;  3LV2 A;  1WST A;  3FQ7 A;  2AY7 A;  1BKG A;  4ITG A;  2W8U A;  1UU0 A;  2D64 A;  2ZP7 A;  3W1I A;  1IX6 A;  1DKA A;  1WYU A;  3OKS A;  2E7U A;  1BJ4 A;  4F5G A;  1AMA A;  3FKD A;  1DGE A;  2ZY5 A;  3AAT A;  1AHG A;  3PDX A;  1GC2 A;  4JEW A;  4OYT A;  1W7M A;  1C7G A;  1YOO A;  2R0T A;  5HXX A;  4W91 A;  4JEV A;  1KMJ A;  3UE8 A;  2KFP A;  4WYE A;  3M5U A;  4F5J A;  3CQ4 A;  3PD6 A;  4RIT A;  2BWP A;  5EUN A;  3ASB A;  3E6G A;  3GR9 A;  3D6K A;  3GZD A;  5C6U A;  4WXF A;  3VP6 A;  4E3R A;  1C9C A;  1KKP A;  1TPL A;  1B5P A;  2VMO A;  4FL0 A;  1MGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...