2BIGA

Radiation damage of the schiff base in phosphoserine aminotransferase (structure i)
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
358
structure length
358
Chain Sequence
QVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKENA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
publication title Strain Relief at the Active Site of Phosphoserine Aminotransferase Induced by Radiation Damage.
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Transferase
total genus 127
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2bigA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2bigA02
2X5DA 1O61A 4H51A 2QA3A 3HVYA 1AJSA 1AMAA 1DJEA 3I4JA 2X5FA 4Q75A 5HHYA 1ARGA 2VMYA 3PJ0A 3HMUA 3EIAA 2W8TA 1O69A 1DJUA 1BJOB 3DC1A 1B9HA 1AY4A 2AY9A 3K28A 2VGSA 4A6UA 1GC0A 1BQDA 2O1BA 3L8AA 2E54A 2YCPA 3BCAA 4QGRA 2DR1A 2WKAA 1TOGA 3AOVA 1S07A 1KL1A 3DZZA 4R2NA 3TQXA 2V0YA 4EB7A 4A72A 1E5EA 2CFBA 4IX8A 4Q31A 4EU1A 2QBTA 1S09A 1VP4A 1AJRA 3BWOA 3EIBA 3NNKA 1B4XA 4K2BA 1KKPA 1GDEA 1VEFA 4LC3A 4BMKA 3A2BA 4GDYA 4AO4A 1C4KA 2E7UA 4AZKA 4KAMA 1LS3A 4BA5A 4WYAA 3GWPA 2OQXA 3PD6A 3DYDA 2AY1A 4IW7A 5G2QA 1AIAA 2BIAA 2CANA 2O7CA 2W7FA 2YRIA 1LC5A 1YNUA 1KMJA 3QBOA 5HDMA 1PFFA 2VMUA 3BC8A 3N5MA 2QB3A 4JEZA 1MAQA 4B98A 1C9CA 3BWNA 2VGTA 2YCTA 1ARTA 1BJ4A 3AEMC 3VP6A 3MC6A 1ELQA 5K8BA 1B5OA 1KL2A 1AMRA 2YHKA 1M6SA 1GEXA 2ORDA 4P7YA 3BCBA 2HP2A 5G0AA 3E2ZA 2AY5A 4ISYA 1RV3A 4GE7A 1OHYA 4RKDA 2VI8A 5EUNA 4IYOA 5M4DA 2R2NA 3G8MA 1CL1A 3PAAA 3AV7A 1ASAA 3NTJA 4A0RA 4E3QA 3MAUA 4HF8A 3FKDA 1YAAA 1SFFA 3ASAA 2JJGA 5G2PA 3WCOA 1CQ6A 2EPJA 4ZM3A 3VK4A 2YKXA 4ZDOA 5FT6A 5M4BA 2D7YA 4LNJA 2CJGA 4R8DA 4ZLVA 2CY8A 3WY7A 2VMXA 4NOGA 2Z67A 2D63A 3HBXA 4LW4A 1WYVB 3RUYA 4ZM4A 1G4XA 3TFUA 3EI6A 1W3UA 1BJNA 4WP0A 1J32A 2JISA 2Z9UA 1N2TA 3GZDC 1W23A 3PPLA 1SF2A 1AY8A 3ZRPA 1SZUA 1JG8A 3AENB 3TATA 3QI6A 3E77A 2BWPA 2ZYJA 1CZCA 3HL2A 1ASCA 4OTLA 1B8GA 3NDNA 3FSLA 2YKVA 2G6WA 3FDBA 4IY7A 3E2ZB 1WSTA 2PB2A 4PIWA 2OGAA 1BJOA 3QGUA 2VMWA 5G4IA 3L44A 4ADCA 2ZSMA 4LW2A 4ZASA 5J8QA 3HT4A 1AIBA 3VK3A 3I5TA 2ZY2A 3NRAA 2CSTA 2BI2A 2DKJA 2D65A 3NU8A 5AX8A 2F8JA 2VLFA 1UU2A 2FM1A 3HLMA 4ADDA 1GC2A 1IUGA 1JF9A 1QJ5A 2DGMA 2VMZA 2W7KA 4WXBA 4A6RA 3QM2A 4OBUA 3FZ7A 2Z9VA 3IHJA 4I8AA 4ZDPA 2VYCA 1TPLA 3CQ4A 1ECXA 3VAXA 4OCAA 2TPLA 3COGA 3RBLA 4K2IA 4ITXA 1D7VA 5BJ3A 1N31A 3JWAA 4TN4A 4CBRA 1BT4A 2D61A 3RI6A 3DU4A 3RCHB 3PGYA 2JGTA 2Z9XA 5DX5A 4XAUA 1JS6A 2FN6A 4UHNA 4JEVA 2BI9A 4J5UA 1M32A 5DB5A 4ZDLA 4JEWA 3A9YA 4WYCA 3JW9A 1YJSA 2VMNA 3EI9A 3LVMA 1ASGA 1IJIA 4ZWMA 2FNIA 2HOZA 3H7FA 1B9IA 2W7EA 1LW4A 4LNLA 5M46A 2HZPA 3AEPA 2BI1A 3ATHA 2VMTA 4MSOA 2E7JA 2AY3A 1D2FA 1ARIA 3CQ5A 1C7NA 3OKSA 3NUIA 2HORA 3FQ7A 2OKJA 3FDDA 1ASNA 3ECDA 2HUUA 4ADBA 1QITA 1S08A 2Z1YA 2VMSA 1LC7A 1KKJA 4R5FA 1MDZA 3NU7A 1T3IA 3B1CA 3AELA 3GZCA 1DTYA 1EG5A 3ZZKA 3FQAA 3MBBA 2HUIA 1MLZA 1WYUA 1LC8A 2W7JA 1KMKA 1MGVA 1DKAA 1OATA 2D64A 2VMVA 3JZLA 3PDXA 2VLHA 1GBNA 4WXGA 2AEVA 2DOUA 1CZEA 1WYVA 2OGEA 3JTXA 4RJ0A 5E5IA 3EI7A 4EB5A 3GJUA 2VMOA 1G4VA 4RKCA 3BV0A 5D95A 4N0WA 1OXPA 2ZY5A 1FC4A 3B1EA 3B1DA 1D7RA 1DGEA 2DGLA 3AENA 1I48A 2Z61A 3LVKA 3NYUA 4E3RA 1ASEA 4ITGA 4JEYA 3MKJA 2Q7WA 3F0HA 3NYTA 3WGBA 1P3WA 3LVJA 1CQ8A 3BB8A 4F5LA 3AEJA 3LY1A 3KKIA 1ASMA 1BW0A 2BWOA 1OHVA 1UU0A 1V2DA 2VIAA 1D7UA 2HOXA 4CXRA 4F5IA 1ASLA 1AKBA 4W1WA 4UOYA 1AHGA 5EQCA 4E77A 5I92A 3AATA 3P1TA 1GEWA 5M49A 1YJYA 4MQRA 3E2YA 1DFOA 4XK1A 2X8UA 4W1VA 5EUDA 4MQPA 1QJ3A 4AH3A 2AY7A 3II0A 1DGDA 2CJHA 4DBCA 3KE3A 1IAYA 1UU1A 5EFSA 1N8PA 1WYUB 2WK7A 4WD2A 4W1XA 3W1IA 2C44A 4GE4A 2BIGA 1H1CA 1GC4A 3QPGA 4JE5A 3VOMA 2DKBA 1W7MA 2W8UA 3UWCA 2NMPA 4WYFA 2E7IA 2Z20A 3OP7A 4U2HA 4WYGA 3WX9A 4A0FA 2YKYA 1SZSA 2BKWA 2YKUA 1M4NA 1H0CA 5EAVA 2YCNA 3DR7A 2ZP7A 3RCHA 1BKGA 3F9TA 3UE8A 4PFNA 5EUEA 2GMSA 3GSBA 4AO9A 3FD0A 4MKJA 4EFFA 2AY6A 2R0TA 4JF0A 3KGWA 4PVFA 2Z1ZA 2JJHA 4OMAA 1TATA 3ELPA 4W91A 1GD9A 2EH6A 1FG7A 3W1HA 3BWNC 3DRDA 4U1TA 1AHFA 4KYOA 3KGXA 1AHYA 3MC6C 4J8LA 7AATA 1M7YA 2AEUA 5FT5A 1XI9A 1PMOA 1UKJA 4RAEA 2ZJGA 3MEBA 2ZY3A 5DJ9A 1E5FA 4IXSA 2GMUA 4A00A 1M0NA 4XJMA 4CVQA 1TARA 4M2MA 3ZZJA 3Q8NA 1XEYA 4B9BA 2C0RA 3GBXA 3TFTA 3WLXA 4MY5A 1WYTB 2VGWA 2D66A 4A0HA 2AY2A 4M2KA 1GC3A 1U08A 2QMAA 1CL2A 1W7NA 3F6TA 1AX4A 3B8XA 1LK9A 1AHXA 2XH1A 2W8WA 4IXZA 5HXXA 3FQ8A 5E3KA 1QISA 2O0RA 1FG3A 3BN1A 2DGKA 3EI5A 3FCRA 3DODA 1MDXA 1ARSA 4Y0HA 2VGVA 3WKSA 1C7OA 3VK2A 2W8JA 2ZSLA 3A9ZA 5EIGA 3WKRA 4ZSWA 3LWSA 4ADEA 3MAFA 4BA4A 1IX8A 3BS8A 1V2EA 2FQ6A 1SVVA 1BQAA 1IX7A 2W7MA 3CQ6A 3UAKA 4UQVA 4MKKA 2VIBA 1RVUA 3JU7A 3HDOA 3ZRRA 4TV7A 3PA9A 5E4ZA 4F5MA 1X0MA 2HOYA 3ACZA 3AEMA 2GSAA 3K7YA 3K40A 3M5UA 3E2FA 3MADA 3ISLA 3LV2A 4UHOA 1TOIA 1J04A 4ZAHA 1Y4IA 4XQ2A 4GRXA 1QGNA 2EZ2A 4F5HA 1RV4A 1ASDA 2ZY4A 3QHXA 3FZ8A 4ATQA 3IF2A 1ARHA 1BJWA 3ASBA 3NUBA 4CXQA 2WK8A 2VGUA 3WCNA 2R5CB 2BHXA 2BIEA 2QB2A 1AMQA 1AY5A 1ELUA 2W7DA 1Z7DA 4OT8A 2CINA 3TCMA 5LH9A 1M0QA 4F5FA 3GETA 4ZSYA 1TOKA 4ATPA 5FT8A 3T32A 3EZ1A 1V72A 1SZKA 4L0OA 4Y0IA 4CBSA 1ORDA 1I29A 1ZOBA 1X2AA 2CJDA 4WLHA 4A6TA 3CAIA 5TF5A 4GEBA 3PDBB 2W7IA 2W7LA 2D5YA 1YOOA 3D6KA 2C81A 3LG0A 2PB0A 3JWBA 3E6GA 3PIUA 4Q76A 5EIGB 4W8IA 3DXVA 4UHMA 4OYTA 4EMYA 3MAFB 4KXKA 1EQBA 4WB0B 3FTBA 3R9AA 3RQ1A 3FRKA 3GZDA 3FVXA 3A8UX 4OBVA 2RFVA 3ZRQA 4WBTA 4WYDA 3FFRA 2AY4A 4TMRA 3CBFA 1OXOA 1X28A 3LVLB 4GE9A 4R5ZA 1V2FA 2W7GA 4W5KA 4Q6RA 4K2MA 2W8VA 2CH2A 1GCKA 2EGYA 1ASFA 1AHEA 1AAWA 4Y0DA 3E9KA 3FVSA 1ZODA 2BYLA 1WKGA 3EZSA 1CQ7A 8AATA 1AJSB 1I41A 1WYTA 3DR4A 3P6KA 1YJZA 2BI5A 3WGCA 2FNUA 2VMQA 4AZJA 1TASA 1MDOA 2V1PA 1GEYA 5FT4A 1D7SA 2HP1A 3USFA 3B46A 1B5PA 2CTZA 3FZ6A 2XBNA 1AMSA 5G4JA 5C6UA 2JG2A 1O62A 4AOAA 1ASBA 3W1JA 3WZFA 4F5JA 3NYSA 2AY8A 2VMPA 2AATA 1TOEA 1X29A 5JAYA 2EO5A 1W7LA 1I43A 4WYEA 1AICA 1MAPA 4JEXA 4F4EA 1JS3A 1WKHA 4LNMA 5EAAA 4FFCA 4XEWA 4GSAA 4RIZA 4F5KA 1QIRA 1AKAA 4O6ZA 2C7TA 4F5GA 1EJIA 1CS1A 1O4SA 1PG8A 4RJYA 2CB1A 2BI3A 3QN6A 2YRRA 3GR9A 1QZ9A 3PD6B 1G7WA 3AEJC 4MGRA 2BWNA 1M0OA 2D7ZA 3HQTA 4XJPA 4XJLA 3EUCA 4XJOA 1Z3ZA 4IXOA 5F9SA 4PFFA 1RVYA 1IBJA 1S06A 2ZC0A 4N0BA 4WXFA 1TOJA 2CH1A 1PMMA 1ZC9A 2HUFA 2OKKA 3AEOA 3A9XA 2QLRA 3RBFA 2JJEA 4DGTA 1OHWA 2WK9A 1IAXA 3FVUA 1VJOA 1YIZA 2EZ1A 5IWQA 1S0AA 3ELEA 5G09A 3EI8A 5LHAA 2VMRA 4JF1A 3FFHA 4DQ6A 3I16A 2R5CA 4ZWVA 5D5SA 2PO3A 4RLGA 3AOWA 4IYOB 4BHDA 1IVRA 1C7GA 1M0PA 4JE5D 4OC9A 3N0LA 2GQNA 4FL0A 1YIYA 2VGZA 2YOBA 4RITA 2GB3A 1CJ0A 2R5EA 3BCXA 3G7QA 3N75A 3NX3A 5BJ4A 9AATA 1SPAA 3PDBA 2X3LA 3DXWA 2ZUKA 4E1OA 2FYFA 1DJ9A 1AAMA 1BS0A 4A0GA 1C0NA 5F8VA 2BYJA 2OATA 2VI9A 3R4TA 4WB0A 1G7XA 3H14A 1MLYA 1LKCA 1LW5A 4WLJA 2Z9WA 2W7HA 4M2JA 4RM1A 4P3MA 1IX6A 2JJFA 4MQQA 5DJ1A 4HVKA 4BQ0A 3G0TA 1AKCA
chains in the Genus database with same CATH superfamily
2X5DA 1O61A 4H51A 2QA3A 3HVYA 1AJSA 1AMAA 1DJEA 3I4JA 2X5FA 4Q75A 5HHYA 1ARGA 2VMYA 3PJ0A 3HMUA 3EIAA 2W8TA 1O69A 1DJUA 1BJOB 3DC1A 1B9HA 1AY4A 2AY9A 3K28A 2VGSA 4A6UA 1GC0A 1BQDA 2O1BA 3L8AA 2E54A 2YCPA 3BCAA 4QGRA 2DR1A 2WKAA 1TOGA 3AOVA 1S07A 1KL1A 3DZZA 4R2NA 3TQXA 2V0YA 4EB7A 4A72A 1E5EA 2CFBA 4IX8A 4Q31A 4EU1A 2QBTA 1S09A 1VP4A 1AJRA 3BWOA 3EIBA 3NNKA 1B4XA 4K2BA 1KKPA 1GDEA 1VEFA 4LC3A 4BMKA 3A2BA 4GDYA 4AO4A 1C4KA 2E7UA 4AZKA 4KAMA 3N4RA 1LS3A 4BA5A 4WYAA 3GWPA 2OQXA 3PD6A 3DYDA 2AY1A 4IW7A 5G2QA 1AIAA 2BIAA 2CANA 2O7CA 2W7FA 2YRIA 1LC5A 1YNUA 1KMJA 3QBOA 5HDMA 1PFFA 2VMUA 3BC8A 3N5MA 2QB3A 4JEZA 1MAQA 4B98A 1C9CA 3BWNA 3N4SA 2VGTA 2YCTA 1ARTA 1BJ4A 3AEMC 3VP6A 3MC6A 1ELQA 5K8BA 1B5OA 1KL2A 1AMRA 2YHKA 1M6SA 1GEXA 2ORDA 4P7YA 3BCBA 2HP2A 5G0AA 3E2ZA 2AY5A 4ISYA 1RV3A 4GE7A 1OHYA 4RKDA 2VI8A 5EUNA 4IYOA 5M4DA 2R2NA 3G8MA 1CL1A 3PAAA 3AV7A 1ASAA 3NTJA 4A0RA 4E3QA 3MAUA 4HF8A 3FKDA 1YAAA 1SFFA 3ASAA 2JJGA 5G2PA 3WCOA 1CQ6A 2EPJA 4ZM3A 3VK4A 2YKXA 4ZDOA 5FT6A 5M4BA 2D7YA 4LNJA 2CJGA 4R8DA 4ZLVA 2CY8A 3WY7A 2VMXA 4NOGA 2Z67A 2D63A 3HBXA 4LW4A 1WYVB 3RUYA 4ZM4A 1G4XA 3TFUA 3EI6A 1W3UA 1BJNA 4WP0A 1J32A 5KTBA 2JISA 2Z9UA 1N2TA 3GZDC 1W23A 3PPLA 1SF2A 1AY8A 3ZRPA 1SZUA 1JG8A 3AENB 3TATA 3QI6A 3E77A 2BWPA 2ZYJA 1CZCA 3HL2A 1ASCA 4OTLA 1B8GA 3NDNA 3FSLA 2YKVA 2G6WA 3FDBA 4IY7A 3E2ZB 1WSTA 2PB2A 4PIWA 2OGAA 1BJOA 3QGUA 2VMWA 5G4IA 3L44A 4ADCA 2ZSMA 4LW2A 4ZASA 5J8QA 3HT4A 1AIBA 3VK3A 3I5TA 2ZY2A 3NRAA 2CSTA 2BI2A 2DKJA 2D65A 3NU8A 5AX8A 2F8JA 2VLFA 1UU2A 2FM1A 3HLMA 4ADDA 1GC2A 2WB6A 1IUGA 1JF9A 1QJ5A 2DGMA 2VMZA 2W7KA 4WXBA 4A6RA 3QM2A 4OBUA 3FZ7A 2Z9VA 3IHJA 4I8AA 4ZDPA 2VYCA 1TPLA 3CQ4A 1ECXA 3VAXA 4OCAA 2TPLA 3COGA 3RBLA 4K2IA 4ITXA 1D7VA 5BJ3A 1N31A 3JWAA 4TN4A 4CBRA 1BT4A 2D61A 3RI6A 3DU4A 3RCHB 3PGYA 2JGTA 2Z9XA 5DX5A 4XAUA 1JS6A 2FN6A 4UHNA 4JEVA 2BI9A 4J5UA 1M32A 5DB5A 4ZDLA 4JEWA 3A9YA 4WYCA 3JW9A 1YJSA 2VMNA 3EI9A 3LVMA 1ASGA 1IJIA 4ZWMA 2FNIA 2HOZA 3H7FA 1B9IA 2W7EA 1LW4A 4LNLA 5M46A 2HZPA 3AEPA 2BI1A 3ATHA 2VMTA 4MSOA 2E7JA 2AY3A 1D2FA 1ARIA 3CQ5A 1C7NA 3OKSA 3NUIA 2HORA 3FQ7A 2OKJA 3FDDA 1ASNA 3ECDA 2HUUA 4ADBA 1QITA 1S08A 2Z1YA 2VMSA 1LC7A 1KKJA 4R5FA 1MDZA 3NU7A 1T3IA 2G7JA 3B1CA 3AELA 3GZCA 1DTYA 1EG5A 3ZZKA 3FQAA 3MBBA 2HUIA 1MLZA 1WYUA 1LC8A 2W7JA 1KMKA 1MGVA 1DKAA 1OATA 2D64A 2VMVA 3JZLA 3PDXA 2VLHA 1GBNA 4WXGA 2AEVA 2DOUA 1CZEA 1WYVA 2OGEA 3JTXA 4RJ0A 5E5IA 3EI7A 4EB5A 3GJUA 2VMOA 1G4VA 4RKCA 3BV0A 5D95A 4N0WA 1OXPA 2ZY5A 1FC4A 3B1EA 3B1DA 1D7RA 1DGEA 2DGLA 3AENA 1I48A 2Z61A 3LVKA 3NYUA 4E3RA 1ASEA 4ITGA 4JEYA 3MKJA 2Q7WA 3F0HA 3NYTA 3WGBA 1P3WA 3LVJA 1CQ8A 3BB8A 4F5LA 3AEJA 3LY1A 3KKIA 1ASMA 1BW0A 2BWOA 1OHVA 1UU0A 1V2DA 2VIAA 1D7UA 2HOXA 4CXRA 4F5IA 1ASLA 1AKBA 4W1WA 4UOYA 1AHGA 5EQCA 4E77A 5I92A 3AATA 3P1TA 1GEWA 5M49A 1YJYA 4MQRA 3E2YA 1DFOA 4XK1A 2X8UA 4W1VA 5EUDA 4MQPA 1QJ3A 4AH3A 2AY7A 3II0A 1DGDA 2CJHA 4DBCA 3KE3A 1IAYA 1UU1A 5EFSA 1N8PA 1WYUB 2WK7A 4WD2A 4W1XA 3W1IA 2C44A 4GE4A 2BIGA 1H1CA 1GC4A 3QPGA 4JE5A 3VOMA 2DKBA 1W7MA 2W8UA 3UWCA 2NMPA 4WYFA 2E7IA 2Z20A 3OP7A 4U2HA 4WYGA 3WX9A 4A0FA 2YKYA 1SZSA 2BKWA 2YKUA 1M4NA 1H0CA 5EAVA 2YCNA 3DR7A 2ZP7A 3RCHA 1BKGA 3F9TA 3UE8A 4PFNA 5EUEA 2GMSA 3GSBA 4AO9A 3FD0A 3H9XA 4MKJA 4EFFA 2AY6A 2R0TA 4JF0A 3KGWA 4PVFA 2Z1ZA 2JJHA 4K05A 4OMAA 1KAFA 1TATA 3ELPA 4W91A 1GD9A 2EH6A 1FG7A 3W1HA 3BWNC 3DRDA 4U1TA 1AHFA 4KYOA 3KGXA 1AHYA 3MC6C 4J8LA 7AATA 1M7YA 2AEUA 5FT5A 1XI9A 1PMOA 1UKJA 4RAEA 2ZJGA 3MEBA 2ZY3A 5DJ9A 1E5FA 4IXSA 2GMUA 4A00A 1M0NA 4XJMA 4CVQA 1TARA 4M2MA 3ZZJA 3Q8NA 1XEYA 4B9BA 2C0RA 3GBXA 3TFTA 3WLXA 4MY5A 1WYTB 2VGWA 2D66A 4A0HA 2AY2A 4M2KA 1GC3A 1U08A 2QMAA 1CL2A 1W7NA 3F6TA 1AX4A 3B8XA 1LK9A 1AHXA 2XH1A 2W8WA 4IXZA 5HXXA 3FQ8A 5E3KA 2KFPA 1QISA 2O0RA 1FG3A 3BN1A 2DGKA 3EI5A 3FCRA 3DODA 1MDXA 1ARSA 4Y0HA 2VGVA 3WKSA 1C7OA 3VK2A 2W8JA 2ZSLA 3A9ZA 5EIGA 3WKRA 4ZSWA 3LWSA 4ADEA 3MAFA 4BA4A 1IX8A 3BS8A 1V2EA 2FQ6A 1SVVA 1BQAA 1IX7A 2W7MA 3CQ6A 3UAKA 4UQVA 4MKKA 2VIBA 1RVUA 3JU7A 3HDOA 3ZRRA 4TV7A 3PA9A 5E4ZA 4F5MA 1X0MA 2HOYA 3ACZA 3AEMA 2GSAA 3K7YA 3K40A 3M5UA 3E2FA 3MADA 3ISLA 3LV2A 4UHOA 2A1VA 1TOIA 1J04A 4ZAHA 1Y4IA 4XQ2A 4GRXA 1QGNA 2EZ2A 4F5HA 1RV4A 1ASDA 2ZY4A 3QHXA 3FZ8A 4ATQA 3IF2A 1ARHA 1BJWA 3ASBA 3NUBA 4CXQA 2WK8A 2VGUA 3WCNA 2R5CB 2BHXA 2BIEA 2QB2A 1AMQA 1AY5A 1ELUA 2W7DA 1Z7DA 4OT8A 2CINA 3TCMA 5LH9A 1M0QA 4F5FA 3GETA 4ZSYA 1TOKA 4ATPA 5FT8A 3T32A 3EZ1A 1V72A 1SZKA 4L0OA 4Y0IA 4CBSA 1ORDA 1I29A 1ZOBA 1X2AA 2CJDA 4WLHA 4A6TA 3CAIA 3N4XA 5TF5A 4GEBA 3PDBB 2W7IA 2W7LA 2D5YA 1YOOA 3D6KA 2C81A 3LG0A 2PB0A 3JWBA 3E6GA 3PIUA 4Q76A 5EIGB 4W8IA 3DXVA 4UHMA 4OYTA 4EMYA 3MAFB 4KXKA 1EQBA 4WB0B 3FTBA 3R9AA 3RQ1A 3FRKA 3GZDA 3FVXA 3A8UX 4OBVA 2RFVA 3ZRQA 4WBTA 4WYDA 3FFRA 2AY4A 4TMRA 3CBFA 1OXOA 1X28A 3LVLB 4GE9A 4R5ZA 1V2FA 2W7GA 4W5KA 4Q6RA 4K2MA 2W8VA 2CH2A 1GCKA 2EGYA 1ASFA 1AHEA 1AAWA 4Y0DA 3E9KA 3FVSA 1ZODA 2BYLA 1WKGA 3EZSA 1CQ7A 8AATA 1AJSB 1I41A 1WYTA 3DR4A 3P6KA 1YJZA 2BI5A 3WGCA 2FNUA 2VMQA 4AZJA 1TASA 1MDOA 2V1PA 1GEYA 5FT4A 1D7SA 2HP1A 3USFA 3B46A 1B5PA 2CTZA 3FZ6A 2XBNA 1AMSA 4H63Q 5G4JA 5C6UA 2JG2A 1O62A 4AOAA 1ASBA 3W1JA 3WZFA 4F5JA 3NYSA 2AY8A 2VMPA 2AATA 1TOEA 1X29A 5JAYA 2EO5A 1W7LA 1I43A 4WYEA 1AICA 1MAPA 4JEXA 4F4EA 1JS3A 1WKHA 4LNMA 5EAAA 4FFCA 4XEWA 4GSAA 4RIZA 4F5KA 1QIRA 1AKAA 4O6ZA 2C7TA 4F5GA 1EJIA 1CS1A 1O4SA 1PG8A 4RJYA 2QSRA 2CB1A 2BI3A 3QN6A 2YRRA 3GR9A 1QZ9A 3PD6B 1G7WA 3AEJC 4MGRA 2BWNA 1M0OA 2D7ZA 3HQTA 4XJPA 4XJLA 3EUCA 4XJOA 1Z3ZA 4IXOA 5F9SA 4PFFA 1RVYA 1IBJA 1S06A 2ZC0A 4N0BA 4WXFA 1TOJA 2CH1A 1PMMA 1ZC9A 2HUFA 2OKKA 3AEOA 3N7NA 3A9XA 2QLRA 3RBFA 2JJEA 4DGTA 1OHWA 2WK9A 1IAXA 3FVUA 2EYQA 1VJOA 1YIZA 2EZ1A 5IWQA 1S0AA 3ELEA 5G09A 3EI8A 5LHAA 2VMRA 4JF1A 3FFHA 4DQ6A 3I16A 2R5CA 4ZWVA 5D5SA 2PO3A 4RLGA 3AOWA 4IYOB 4BHDA 1IVRA 1C7GA 1M0PA 4JE5D 4OC9A 3N0LA 2GQNA 4FL0A 1YIYA 2VGZA 2YOBA 2FKIA 4RITA 2GB3A 1CJ0A 2R5EA 3BCXA 3G7QA 3N75A 3NX3A 5BJ4A 9AATA 1SPAA 3PDBA 2X3LA 3DXWA 2ZUKA 4E1OA 2FYFA 1DJ9A 1AAMA 1BS0A 4A0GA 1C0NA 5F8VA 2BYJA 2OATA 2VI9A 3R4TA 4WB0A 1G7XA 3H14A 1MLYA 1LKCA 1LW5A 4WLJA 2Z9WA 2W7HA 4M2JA 4RM1A 4P3MA 1IX6A 2JJFA 4MQQA 5DJ1A 4HVKA 4BQ0A 3G0TA 1AKCA
chains in the Genus database with same CATH topology
2X5DA 1O61A 4H51A 2QA3A 3HVYA 1AJSA 1AMAA 1DJEA 3I4JA 2X5FA 4Q75A 5HHYA 1ARGA 2VMYA 3PJ0A 3HMUA 3EIAA 2W8TA 1O69A 1DJUA 1BJOB 3DC1A 1B9HA 1AY4A 2AY9A 3K28A 2VGSA 4A6UA 1GC0A 1BQDA 2O1BA 3L8AA 2E54A 2YCPA 3BCAA 4QGRA 2DR1A 2WKAA 1TOGA 3AOVA 1S07A 1KL1A 3DZZA 4R2NA 3TQXA 2V0YA 4EB7A 4A72A 1E5EA 2CFBA 4IX8A 4Q31A 4EU1A 2QBTA 1S09A 1VP4A 1AJRA 3BWOA 3EIBA 3NNKA 1B4XA 4K2BA 1KKPA 1GDEA 1VEFA 4LC3A 4BMKA 3A2BA 4GDYA 4AO4A 1C4KA 2E7UA 4AZKA 4KAMA 3N4RA 1LS3A 4BA5A 4WYAA 3GWPA 2OQXA 3PD6A 3DYDA 2AY1A 4IW7A 5G2QA 1AIAA 2BIAA 2CANA 2O7CA 2W7FA 2YRIA 1LC5A 1YNUA 1KMJA 3QBOA 5HDMA 1PFFA 2VMUA 3BC8A 3N5MA 2QB3A 4JEZA 1MAQA 4B98A 1C9CA 3BWNA 3N4SA 2VGTA 2YCTA 1ARTA 1BJ4A 3AEMC 3VP6A 3MC6A 1ELQA 5K8BA 1B5OA 1KL2A 1AMRA 2YHKA 1M6SA 1GEXA 2ORDA 4P7YA 3BCBA 2HP2A 5G0AA 3E2ZA 2AY5A 4ISYA 1RV3A 4GE7A 1OHYA 4RKDA 2VI8A 5EUNA 4IYOA 5M4DA 2R2NA 3G8MA 1CL1A 3PAAA 3AV7A 1ASAA 3NTJA 4A0RA 4E3QA 3MAUA 4HF8A 3FKDA 1YAAA 1SFFA 3ASAA 2JJGA 5G2PA 3WCOA 1CQ6A 2EPJA 4ZM3A 3VK4A 2YKXA 4ZDOA 5FT6A 5M4BA 2D7YA 4LNJA 2CJGA 4R8DA 4ZLVA 2CY8A 3WY7A 2VMXA 4NOGA 2Z67A 2D63A 3HBXA 4LW4A 1WYVB 3RUYA 4ZM4A 1G4XA 3TFUA 3EI6A 1W3UA 1BJNA 4WP0A 1J32A 5KTBA 2JISA 2Z9UA 1N2TA 3GZDC 1W23A 3PPLA 1SF2A 1AY8A 3ZRPA 1SZUA 1JG8A 3AENB 3TATA 3QI6A 3E77A 2BWPA 2ZYJA 1CZCA 3HL2A 1ASCA 4OTLA 1B8GA 3NDNA 3FSLA 2YKVA 2G6WA 3FDBA 4IY7A 3E2ZB 1WSTA 2PB2A 4PIWA 2OGAA 1BJOA 3QGUA 2VMWA 5G4IA 3L44A 4ADCA 2ZSMA 4LW2A 4ZASA 5J8QA 3HT4A 1AIBA 3VK3A 3I5TA 2ZY2A 3NRAA 2CSTA 2BI2A 2DKJA 2D65A 3NU8A 5AX8A 2F8JA 2VLFA 1UU2A 2FM1A 3HLMA 4ADDA 1GC2A 2WB6A 1IUGA 1JF9A 1QJ5A 2DGMA 2VMZA 2W7KA 4WXBA 4A6RA 3QM2A 4OBUA 3FZ7A 2Z9VA 3IHJA 4I8AA 4ZDPA 2VYCA 1TPLA 3CQ4A 1ECXA 3VAXA 4OCAA 2TPLA 3COGA 3RBLA 4K2IA 4ITXA 1D7VA 5BJ3A 1N31A 3JWAA 4TN4A 4CBRA 1BT4A 2D61A 3RI6A 3DU4A 3RCHB 3PGYA 2JGTA 2Z9XA 5DX5A 4XAUA 1JS6A 2FN6A 4UHNA 4JEVA 2BI9A 4J5UA 1M32A 5DB5A 4ZDLA 4JEWA 3A9YA 4WYCA 3JW9A 1YJSA 2VMNA 3EI9A 3LVMA 1ASGA 1IJIA 4ZWMA 2FNIA 2HOZA 3H7FA 1B9IA 2W7EA 1LW4A 4LNLA 5M46A 2HZPA 3AEPA 2BI1A 3ATHA 2VMTA 4MSOA 2E7JA 2AY3A 1D2FA 1ARIA 3CQ5A 1C7NA 3OKSA 3NUIA 2HORA 3FQ7A 2OKJA 3FDDA 1ASNA 3ECDA 2HUUA 4ADBA 1QITA 1S08A 2Z1YA 2VMSA 1LC7A 1KKJA 4R5FA 1MDZA 3NU7A 1T3IA 2G7JA 3B1CA 3AELA 3GZCA 1DTYA 1EG5A 3ZZKA 3FQAA 3MBBA 2HUIA 1MLZA 1WYUA 1LC8A 2W7JA 1KMKA 1MGVA 1DKAA 1OATA 2D64A 2VMVA 3JZLA 3PDXA 2VLHA 1GBNA 4WXGA 2AEVA 2DOUA 1CZEA 1WYVA 2OGEA 3JTXA 4RJ0A 5E5IA 3EI7A 4EB5A 3GJUA 2VMOA 1G4VA 4RKCA 3BV0A 5D95A 4N0WA 1OXPA 2ZY5A 1FC4A 3B1EA 3B1DA 1D7RA 1DGEA 2DGLA 3AENA 1I48A 2Z61A 3LVKA 3NYUA 4E3RA 1ASEA 4ITGA 4JEYA 3MKJA 2Q7WA 3F0HA 3NYTA 3WGBA 1P3WA 3LVJA 1CQ8A 3BB8A 4F5LA 3AEJA 3LY1A 3KKIA 1ASMA 1BW0A 2BWOA 1OHVA 1UU0A 1V2DA 2VIAA 1D7UA 2HOXA 4CXRA 4F5IA 1ASLA 1AKBA 4W1WA 4UOYA 1AHGA 5EQCA 4E77A 5I92A 3AATA 3P1TA 1GEWA 5M49A 1YJYA 4MQRA 3E2YA 1DFOA 4XK1A 2X8UA 4W1VA 5EUDA 4MQPA 1QJ3A 4AH3A 2AY7A 3II0A 1DGDA 2CJHA 4DBCA 3KE3A 1IAYA 1UU1A 5EFSA 1N8PA 1WYUB 2WK7A 4WD2A 4W1XA 3W1IA 2C44A 4GE4A 2BIGA 1H1CA 1GC4A 3QPGA 4JE5A 3VOMA 2DKBA 1W7MA 2W8UA 3UWCA 2NMPA 4WYFA 2E7IA 2Z20A 3OP7A 4U2HA 4WYGA 3WX9A 4A0FA 2YKYA 1SZSA 2BKWA 2YKUA 1M4NA 1H0CA 5EAVA 2YCNA 3DR7A 2ZP7A 3RCHA 1BKGA 3F9TA 3UE8A 4PFNA 5EUEA 2GMSA 3GSBA 4AO9A 3FD0A 3H9XA 4MKJA 4EFFA 2AY6A 2R0TA 4JF0A 3KGWA 4PVFA 2Z1ZA 2JJHA 4K05A 4OMAA 1TATA 3ELPA 4W91A 1GD9A 2EH6A 1FG7A 3W1HA 3BWNC 3DRDA 4U1TA 1AHFA 4KYOA 3KGXA 1AHYA 3MC6C 4J8LA 7AATA 1M7YA 2AEUA 5FT5A 1XI9A 1PMOA 1UKJA 4RAEA 2ZJGA 3MEBA 2ZY3A 5DJ9A 1E5FA 4IXSA 2GMUA 4A00A 1M0NA 4XJMA 4CVQA 1TARA 4M2MA 3ZZJA 3Q8NA 1XEYA 4B9BA 2C0RA 3GBXA 3TFTA 3WLXA 4MY5A 1WYTB 2VGWA 2D66A 4A0HA 2AY2A 4M2KA 1GC3A 1U08A 2QMAA 1CL2A 1W7NA 3F6TA 1AX4A 3B8XA 1LK9A 1AHXA 2XH1A 2W8WA 4IXZA 5HXXA 3FQ8A 5E3KA 2KFPA 1QISA 2O0RA 1FG3A 3BN1A 2DGKA 3EI5A 3FCRA 3DODA 1MDXA 1ARSA 4Y0HA 2VGVA 3WKSA 1C7OA 3VK2A 2W8JA 2ZSLA 3A9ZA 5EIGA 3WKRA 4ZSWA 3LWSA 4ADEA 3MAFA 4BA4A 1IX8A 3BS8A 1V2EA 2FQ6A 1SVVA 1BQAA 1IX7A 2W7MA 3CQ6A 3UAKA 4UQVA 4MKKA 2VIBA 1RVUA 3JU7A 3HDOA 3ZRRA 4TV7A 3PA9A 5E4ZA 4F5MA 1X0MA 2HOYA 3ACZA 3AEMA 2GSAA 3K7YA 3K40A 3M5UA 3E2FA 3MADA 3ISLA 3LV2A 4UHOA 2A1VA 1TOIA 1J04A 4ZAHA 1Y4IA 4XQ2A 4GRXA 1QGNA 2EZ2A 4F5HA 1RV4A 1ASDA 2ZY4A 3QHXA 3FZ8A 4ATQA 3IF2A 1ARHA 1BJWA 3ASBA 3NUBA 4CXQA 2WK8A 2VGUA 3WCNA 2R5CB 2BHXA 2BIEA 2QB2A 1AMQA 1AY5A 1ELUA 2W7DA 1Z7DA 4OT8A 2CINA 3TCMA 5LH9A 1M0QA 4F5FA 3GETA 4ZSYA 1TOKA 4ATPA 5FT8A 3T32A 3EZ1A 1V72A 1SZKA 4L0OA 4Y0IA 4CBSA 1ORDA 1I29A 1ZOBA 1X2AA 2CJDA 4WLHA 4A6TA 3CAIA 3N4XA 5TF5A 4GEBA 3PDBB 2W7IA 2W7LA 2D5YA 1YOOA 3D6KA 2C81A 3LG0A 2PB0A 3JWBA 3E6GA 3PIUA 4Q76A 5EIGB 4W8IA 3DXVA 4UHMA 4OYTA 4EMYA 3MAFB 4KXKA 1EQBA 4WB0B 3FTBA 3R9AA 3RQ1A 3FRKA 3GZDA 3FVXA 3A8UX 4OBVA 2RFVA 3ZRQA 4WBTA 4WYDA 3FFRA 2AY4A 4TMRA 3CBFA 1OXOA 1X28A 3LVLB 4GE9A 4R5ZA 1V2FA 2W7GA 4W5KA 4Q6RA 4K2MA 2W8VA 2CH2A 1GCKA 2EGYA 1ASFA 1AHEA 1AAWA 4Y0DA 3E9KA 3FVSA 1ZODA 2BYLA 1WKGA 3EZSA 1CQ7A 8AATA 1AJSB 1I41A 1WYTA 3DR4A 3P6KA 1YJZA 2BI5A 3WGCA 2FNUA 2VMQA 4AZJA 1TASA 1MDOA 2V1PA 1GEYA 5FT4A 1D7SA 2HP1A 3USFA 3B46A 1B5PA 2CTZA 3FZ6A 2XBNA 1AMSA 4H63Q 5G4JA 5C6UA 2JG2A 1O62A 4AOAA 1ASBA 3W1JA 3WZFA 4F5JA 3NYSA 2AY8A 2VMPA 2AATA 1TOEA 1X29A 5JAYA 2EO5A 1W7LA 1I43A 4WYEA 1AICA 1MAPA 4JEXA 4F4EA 1JS3A 1WKHA 4LNMA 5EAAA 4FFCA 4XEWA 4GSAA 4RIZA 4F5KA 1QIRA 1AKAA 4O6ZA 2C7TA 4F5GA 1EJIA 1CS1A 1O4SA 1PG8A 4RJYA 2QSRA 2CB1A 2BI3A 3QN6A 2YRRA 3GR9A 1QZ9A 3PD6B 1G7WA 3AEJC 4MGRA 2BWNA 1M0OA 2D7ZA 3HQTA 4XJPA 4XJLA 3EUCA 4XJOA 1Z3ZA 4IXOA 5F9SA 4PFFA 1RVYA 1IBJA 1S06A 2ZC0A 4N0BA 4WXFA 1TOJA 2CH1A 1PMMA 1ZC9A 2HUFA 2OKKA 3AEOA 3N7NA 3A9XA 2QLRA 3RBFA 2JJEA 4DGTA 1OHWA 2WK9A 1IAXA 3FVUA 2EYQA 1VJOA 1YIZA 2EZ1A 5IWQA 1S0AA 3ELEA 5G09A 3EI8A 5LHAA 2VMRA 4JF1A 3FFHA 4DQ6A 3I16A 2R5CA 4ZWVA 5D5SA 2PO3A 4RLGA 3AOWA 4IYOB 4BHDA 1IVRA 1C7GA 1M0PA 4JE5D 4OC9A 3N0LA 2GQNA 4FL0A 1YIYA 2VGZA 2YOBA 2FKIA 4RITA 2GB3A 1CJ0A 2R5EA 3BCXA 3G7QA 3N75A 3NX3A 5BJ4A 9AATA 1SPAA 3PDBA 2X3LA 3DXWA 2ZUKA 4E1OA 2FYFA 1DJ9A 1AAMA 1BS0A 4A0GA 1C0NA 5F8VA 2BYJA 2OATA 2VI9A 3R4TA 4WB0A 1G7XA 3H14A 1MLYA 1LKCA 1LW5A 4WLJA 2Z9WA 2W7HA 4M2JA 4RM1A 4P3MA 1IX6A 2JJFA 4MQQA 5DJ1A 4HVKA 4BQ0A 3G0TA 1AKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X5D A;  1O61 A;  4H51 A;  2QA3 A;  3HVY A;  1AJS A;  1AMA A;  1DJE A;  3I4J A;  2X5F A;  4Q75 A;  5HHY A;  1ARG A;  2VMY A;  3PJ0 A;  3HMU A;  3EIA A;  2W8T A;  1O69 A;  1DJU A;  1BJO B;  3DC1 A;  1B9H A;  1AY4 A;  2AY9 A;  3K28 A;  2VGS A;  4A6U A;  1GC0 A;  1BQD A;  2O1B A;  3L8A A;  2E54 A;  2YCP A;  3BCA A;  4QGR A;  2DR1 A;  2WKA A;  1TOG A;  3AOV A;  1S07 A;  1KL1 A;  3DZZ A;  4R2N A;  3TQX A;  2V0Y A;  4EB7 A;  4A72 A;  1E5E A;  2CFB A;  4IX8 A;  4Q31 A;  4EU1 A;  2QBT A;  1S09 A;  1VP4 A;  1AJR A;  3BWO A;  3EIB A;  3NNK A;  1B4X A;  4K2B A;  1KKP A;  1GDE A;  1VEF A;  4LC3 A;  4BMK A;  3A2B A;  4GDY A;  4AO4 A;  1C4K A;  2E7U A;  4AZK A;  4KAM A;  1LS3 A;  4BA5 A;  4WYA A;  3GWP A;  2OQX A;  3PD6 A;  3DYD A;  2AY1 A;  4IW7 A;  5G2Q A;  1AIA A;  2BIA A;  2CAN A;  2O7C A;  2W7F A;  2YRI A;  1LC5 A;  1YNU A;  1KMJ A;  3QBO A;  5HDM A;  1PFF A;  2VMU A;  3BC8 A;  3N5M A;  2QB3 A;  4JEZ A;  1MAQ A;  4B98 A;  1C9C A;  3BWN A;  2VGT A;  2YCT A;  1ART A;  1BJ4 A;  3AEM C;  3VP6 A;  3MC6 A;  1ELQ A;  5K8B A;  1B5O A;  1KL2 A;  1AMR A;  2YHK A;  1M6S A;  1GEX A;  2ORD A;  4P7Y A;  3BCB A;  2HP2 A;  5G0A A;  3E2Z A;  2AY5 A;  4ISY A;  1RV3 A;  4GE7 A;  1OHY A;  4RKD A;  2VI8 A;  5EUN A;  4IYO A;  5M4D A;  2R2N A;  3G8M A;  1CL1 A;  3PAA A;  3AV7 A;  1ASA A;  3NTJ A;  4A0R A;  4E3Q A;  3MAU A;  4HF8 A;  3FKD A;  1YAA A;  1SFF A;  3ASA A;  2JJG A;  5G2P A;  3WCO A;  1CQ6 A;  2EPJ A;  4ZM3 A;  3VK4 A;  2YKX A;  4ZDO A;  5FT6 A;  5M4B A;  2D7Y A;  4LNJ A;  2CJG A;  4R8D A;  4ZLV A;  2CY8 A;  3WY7 A;  2VMX A;  4NOG A;  2Z67 A;  2D63 A;  3HBX A;  4LW4 A;  1WYV B;  3RUY A;  4ZM4 A;  1G4X A;  3TFU A;  3EI6 A;  1W3U A;  1BJN A;  4WP0 A;  1J32 A;  2JIS A;  2Z9U A;  1N2T A;  3GZD C;  1W23 A;  3PPL A;  1SF2 A;  1AY8 A;  3ZRP A;  1SZU A;  1JG8 A;  3AEN B;  3TAT A;  3QI6 A;  3E77 A;  2BWP A;  2ZYJ A;  1CZC A;  3HL2 A;  1ASC A;  4OTL A;  1B8G A;  3NDN A;  3FSL A;  2YKV A;  2G6W A;  3FDB A;  4IY7 A;  3E2Z B;  1WST A;  2PB2 A;  4PIW A;  2OGA A;  1BJO A;  3QGU A;  2VMW A;  5G4I A;  3L44 A;  4ADC A;  2ZSM A;  4LW2 A;  4ZAS A;  5J8Q A;  3HT4 A;  1AIB A;  3VK3 A;  3I5T A;  2ZY2 A;  3NRA A;  2CST A;  2BI2 A;  2DKJ A;  2D65 A;  3NU8 A;  5AX8 A;  2F8J A;  2VLF A;  1UU2 A;  2FM1 A;  3HLM A;  4ADD A;  1GC2 A;  1IUG A;  1JF9 A;  1QJ5 A;  2DGM A;  2VMZ A;  2W7K A;  4WXB A;  4A6R A;  3QM2 A;  4OBU A;  3FZ7 A;  2Z9V A;  3IHJ A;  4I8A A;  4ZDP A;  2VYC A;  1TPL A;  3CQ4 A;  1ECX A;  3VAX A;  4OCA A;  2TPL A;  3COG A;  3RBL A;  4K2I A;  4ITX A;  1D7V A;  5BJ3 A;  1N31 A;  3JWA A;  4TN4 A;  4CBR A;  1BT4 A;  2D61 A;  3RI6 A;  3DU4 A;  3RCH B;  3PGY A;  2JGT A;  2Z9X A;  5DX5 A;  4XAU A;  1JS6 A;  2FN6 A;  4UHN A;  4JEV A;  2BI9 A;  4J5U A;  1M32 A;  5DB5 A;  4ZDL A;  4JEW A;  3A9Y A;  4WYC A;  3JW9 A;  1YJS A;  2VMN A;  3EI9 A;  3LVM A;  1ASG A;  1IJI A;  4ZWM A;  2FNI A;  2HOZ A;  3H7F A;  1B9I A;  2W7E A;  1LW4 A;  4LNL A;  5M46 A;  2HZP A;  3AEP A;  2BI1 A;  3ATH A;  2VMT A;  4MSO A;  2E7J A;  2AY3 A;  1D2F A;  1ARI A;  3CQ5 A;  1C7N A;  3OKS A;  3NUI A;  2HOR A;  3FQ7 A;  2OKJ A;  3FDD A;  1ASN A;  3ECD A;  2HUU A;  4ADB A;  1QIT A;  1S08 A;  2Z1Y A;  2VMS A;  1LC7 A;  1KKJ A;  4R5F A;  1MDZ A;  3NU7 A;  1T3I A;  3B1C A;  3AEL A;  3GZC A;  1DTY A;  1EG5 A;  3ZZK A;  3FQA A;  3MBB A;  2HUI A;  1MLZ A;  1WYU A;  1LC8 A;  2W7J A;  1KMK A;  1MGV A;  1DKA A;  1OAT A;  2D64 A;  2VMV A;  3JZL A;  3PDX A;  2VLH A;  1GBN A;  4WXG A;  2AEV A;  2DOU A;  1CZE A;  1WYV A;  2OGE A;  3JTX A;  4RJ0 A;  5E5I A;  3EI7 A;  4EB5 A;  3GJU A;  2VMO A;  1G4V A;  4RKC A;  3BV0 A;  5D95 A;  4N0W A;  1OXP A;  2ZY5 A;  1FC4 A;  3B1E A;  3B1D A;  1D7R A;  1DGE A;  2DGL A;  3AEN A;  1I48 A;  2Z61 A;  3LVK A;  3NYU A;  4E3R A;  1ASE A;  4ITG A;  4JEY A;  3MKJ A;  2Q7W A;  3F0H A;  3NYT A;  3WGB A;  1P3W A;  3LVJ A;  1CQ8 A;  3BB8 A;  4F5L A;  3AEJ A;  3LY1 A;  3KKI A;  1ASM A;  1BW0 A;  2BWO A;  1OHV A;  1UU0 A;  1V2D A;  2VIA A;  1D7U A;  2HOX A;  4CXR A;  4F5I A;  1ASL A;  1AKB A;  4W1W A;  4UOY A;  1AHG A;  5EQC A;  4E77 A;  5I92 A;  3AAT A;  3P1T A;  1GEW A;  5M49 A;  1YJY A;  4MQR A;  3E2Y A;  1DFO A;  4XK1 A;  2X8U A;  4W1V A;  5EUD A;  4MQP A;  1QJ3 A;  4AH3 A;  2AY7 A;  3II0 A;  1DGD A;  2CJH A;  4DBC A;  3KE3 A;  1IAY A;  1UU1 A;  5EFS A;  1N8P A;  1WYU B;  2WK7 A;  4WD2 A;  4W1X A;  3W1I A;  2C44 A;  4GE4 A;  2BIG A;  1H1C A;  1GC4 A;  3QPG A;  4JE5 A;  3VOM A;  2DKB A;  1W7M A;  2W8U A;  3UWC A;  2NMP A;  4WYF A;  2E7I A;  2Z20 A;  3OP7 A;  4U2H A;  4WYG A;  3WX9 A;  4A0F A;  2YKY A;  1SZS A;  2BKW A;  2YKU A;  1M4N A;  1H0C A;  5EAV A;  2YCN A;  3DR7 A;  2ZP7 A;  3RCH A;  1BKG A;  3F9T A;  3UE8 A;  4PFN A;  5EUE A;  2GMS A;  3GSB A;  4AO9 A;  3FD0 A;  4MKJ A;  4EFF A;  2AY6 A;  2R0T A;  4JF0 A;  3KGW A;  4PVF A;  2Z1Z A;  2JJH A;  4OMA A;  1TAT A;  3ELP A;  4W91 A;  1GD9 A;  2EH6 A;  1FG7 A;  3W1H A;  3BWN C;  3DRD A;  4U1T A;  1AHF A;  4KYO A;  3KGX A;  1AHY A;  3MC6 C;  4J8L A;  7AAT A;  1M7Y A;  2AEU A;  5FT5 A;  1XI9 A;  1PMO A;  1UKJ A;  4RAE A;  2ZJG A;  3MEB A;  2ZY3 A;  5DJ9 A;  1E5F A;  4IXS A;  2GMU A;  4A00 A;  1M0N A;  4XJM A;  4CVQ A;  1TAR A;  4M2M A;  3ZZJ A;  3Q8N A;  1XEY A;  4B9B A;  2C0R A;  3GBX A;  3TFT A;  3WLX A;  4MY5 A;  1WYT B;  2VGW A;  2D66 A;  4A0H A;  2AY2 A;  4M2K A;  1GC3 A;  1U08 A;  2QMA A;  1CL2 A;  1W7N A;  3F6T A;  1AX4 A;  3B8X A;  1LK9 A;  1AHX A;  2XH1 A;  2W8W A;  4IXZ A;  5HXX A;  3FQ8 A;  5E3K A;  1QIS A;  2O0R A;  1FG3 A;  3BN1 A;  2DGK A;  3EI5 A;  3FCR A;  3DOD A;  1MDX A;  1ARS A;  4Y0H A;  2VGV A;  3WKS A;  1C7O A;  3VK2 A;  2W8J A;  2ZSL A;  3A9Z A;  5EIG A;  3WKR A;  4ZSW A;  3LWS A;  4ADE A;  3MAF A;  4BA4 A;  1IX8 A;  3BS8 A;  1V2E A;  2FQ6 A;  1SVV A;  1BQA A;  1IX7 A;  2W7M A;  3CQ6 A;  3UAK A;  4UQV A;  4MKK A;  2VIB A;  1RVU A;  3JU7 A;  3HDO A;  3ZRR A;  4TV7 A;  3PA9 A;  5E4Z A;  4F5M A;  1X0M A;  2HOY A;  3ACZ A;  3AEM A;  2GSA A;  3K7Y A;  3K40 A;  3M5U A;  3E2F A;  3MAD A;  3ISL A;  3LV2 A;  4UHO A;  1TOI A;  1J04 A;  4ZAH A;  1Y4I A;  4XQ2 A;  4GRX A;  1QGN A;  2EZ2 A;  4F5H A;  1RV4 A;  1ASD A;  2ZY4 A;  3QHX A;  3FZ8 A;  4ATQ A;  3IF2 A;  1ARH A;  1BJW A;  3ASB A;  3NUB A;  4CXQ A;  2WK8 A;  2VGU A;  3WCN A;  2R5C B;  2BHX A;  2BIE A;  2QB2 A;  1AMQ A;  1AY5 A;  1ELU A;  2W7D A;  1Z7D A;  4OT8 A;  2CIN A;  3TCM A;  5LH9 A;  1M0Q A;  4F5F A;  3GET A;  4ZSY A;  1TOK A;  4ATP A;  5FT8 A;  3T32 A;  3EZ1 A;  1V72 A;  1SZK A;  4L0O A;  4Y0I A;  4CBS A;  1ORD A;  1I29 A;  1ZOB A;  1X2A A;  2CJD A;  4WLH A;  4A6T A;  3CAI A;  5TF5 A;  4GEB A;  3PDB B;  2W7I A;  2W7L A;  2D5Y A;  1YOO A;  3D6K A;  2C81 A;  3LG0 A;  2PB0 A;  3JWB A;  3E6G A;  3PIU A;  4Q76 A;  5EIG B;  4W8I A;  3DXV A;  4UHM A;  4OYT A;  4EMY A;  3MAF B;  4KXK A;  1EQB A;  4WB0 B;  3FTB A;  3R9A A;  3RQ1 A;  3FRK A;  3GZD A;  3FVX A;  3A8U X;  4OBV A;  2RFV A;  3ZRQ A;  4WBT A;  4WYD A;  3FFR A;  2AY4 A;  4TMR A;  3CBF A;  1OXO A;  1X28 A;  3LVL B;  4GE9 A;  4R5Z A;  1V2F A;  2W7G A;  4W5K A;  4Q6R A;  4K2M A;  2W8V A;  2CH2 A;  1GCK A;  2EGY A;  1ASF A;  1AHE A;  1AAW A;  4Y0D A;  3E9K A;  3FVS A;  1ZOD A;  2BYL A;  1WKG A;  3EZS A;  1CQ7 A;  8AAT A;  1AJS B;  1I41 A;  1WYT A;  3DR4 A;  3P6K A;  1YJZ A;  2BI5 A;  3WGC A;  2FNU A;  2VMQ A;  4AZJ A;  1TAS A;  1MDO A;  2V1P A;  1GEY A;  5FT4 A;  1D7S A;  2HP1 A;  3USF A;  3B46 A;  1B5P A;  2CTZ A;  3FZ6 A;  2XBN A;  1AMS A;  5G4J A;  5C6U A;  2JG2 A;  1O62 A;  4AOA A;  1ASB A;  3W1J A;  3WZF A;  4F5J A;  3NYS A;  2AY8 A;  2VMP A;  2AAT A;  1TOE A;  1X29 A;  5JAY A;  2EO5 A;  1W7L A;  1I43 A;  4WYE A;  1AIC A;  1MAP A;  4JEX A;  4F4E A;  1JS3 A;  1WKH A;  4LNM A;  5EAA A;  4FFC A;  4XEW A;  4GSA A;  4RIZ A;  4F5K A;  1QIR A;  1AKA A;  4O6Z A;  2C7T A;  4F5G A;  1EJI A;  1CS1 A;  1O4S A;  1PG8 A;  4RJY A;  2CB1 A;  2BI3 A;  3QN6 A;  2YRR A;  3GR9 A;  1QZ9 A;  3PD6 B;  1G7W A;  3AEJ C;  4MGR A;  2BWN A;  1M0O A;  2D7Z A;  3HQT A;  4XJP A;  4XJL A;  3EUC A;  4XJO A;  1Z3Z A;  4IXO A;  5F9S A;  4PFF A;  1RVY A;  1IBJ A;  1S06 A;  2ZC0 A;  4N0B A;  4WXF A;  1TOJ A;  2CH1 A;  1PMM A;  1ZC9 A;  2HUF A;  2OKK A;  3AEO A;  3A9X A;  2QLR A;  3RBF A;  2JJE A;  4DGT A;  1OHW A;  2WK9 A;  1IAX A;  3FVU A;  1VJO A;  1YIZ A;  2EZ1 A;  5IWQ A;  1S0A A;  3ELE A;  5G09 A;  3EI8 A;  5LHA A;  2VMR A;  4JF1 A;  3FFH A;  4DQ6 A;  3I16 A;  2R5C A;  4ZWV A;  5D5S A;  2PO3 A;  4RLG A;  3AOW A;  4IYO B;  4BHD A;  1IVR A;  1C7G A;  1M0P A;  4JE5 D;  4OC9 A;  3N0L A;  2GQN A;  4FL0 A;  1YIY A;  2VGZ A;  2YOB A;  4RIT A;  2GB3 A;  1CJ0 A;  2R5E A;  3BCX A;  3G7Q A;  3N75 A;  3NX3 A;  5BJ4 A;  9AAT A;  1SPA A;  3PDB A;  2X3L A;  3DXW A;  2ZUK A;  4E1O A;  2FYF A;  1DJ9 A;  1AAM A;  1BS0 A;  4A0G A;  1C0N A;  5F8V A;  2BYJ A;  2OAT A;  2VI9 A;  3R4T A;  4WB0 A;  1G7X A;  3H14 A;  1MLY A;  1LKC A;  1LW5 A;  4WLJ A;  2Z9W A;  2W7H A;  4M2J A;  4RM1 A;  4P3M A;  1IX6 A;  2JJF A;  4MQQ A;  5DJ1 A;  4HVK A;  4BQ0 A;  3G0T A;  1AKC A; 
#chains in the Genus database with same CATH topology
 2X5D A;  1O61 A;  4H51 A;  2QA3 A;  3HVY A;  1AJS A;  1AMA A;  1DJE A;  3I4J A;  2X5F A;  4Q75 A;  5HHY A;  1ARG A;  2VMY A;  3PJ0 A;  3HMU A;  3EIA A;  2W8T A;  1O69 A;  1DJU A;  1BJO B;  3DC1 A;  1B9H A;  1AY4 A;  2AY9 A;  3K28 A;  2VGS A;  4A6U A;  1GC0 A;  1BQD A;  2O1B A;  3L8A A;  2E54 A;  2YCP A;  3BCA A;  4QGR A;  2DR1 A;  2WKA A;  1TOG A;  3AOV A;  1S07 A;  1KL1 A;  3DZZ A;  4R2N A;  3TQX A;  2V0Y A;  4EB7 A;  4A72 A;  1E5E A;  2CFB A;  4IX8 A;  4Q31 A;  4EU1 A;  2QBT A;  1S09 A;  1VP4 A;  1AJR A;  3BWO A;  3EIB A;  3NNK A;  1B4X A;  4K2B A;  1KKP A;  1GDE A;  1VEF A;  4LC3 A;  4BMK A;  3A2B A;  4GDY A;  4AO4 A;  1C4K A;  2E7U A;  4AZK A;  4KAM A;  3N4R A;  1LS3 A;  4BA5 A;  4WYA A;  3GWP A;  2OQX A;  3PD6 A;  3DYD A;  2AY1 A;  4IW7 A;  5G2Q A;  1AIA A;  2BIA A;  2CAN A;  2O7C A;  2W7F A;  2YRI A;  1LC5 A;  1YNU A;  1KMJ A;  3QBO A;  5HDM A;  1PFF A;  2VMU A;  3BC8 A;  3N5M A;  2QB3 A;  4JEZ A;  1MAQ A;  4B98 A;  1C9C A;  3BWN A;  3N4S A;  2VGT A;  2YCT A;  1ART A;  1BJ4 A;  3AEM C;  3VP6 A;  3MC6 A;  1ELQ A;  5K8B A;  1B5O A;  1KL2 A;  1AMR A;  2YHK A;  1M6S A;  1GEX A;  2ORD A;  4P7Y A;  3BCB A;  2HP2 A;  5G0A A;  3E2Z A;  2AY5 A;  4ISY A;  1RV3 A;  4GE7 A;  1OHY A;  4RKD A;  2VI8 A;  5EUN A;  4IYO A;  5M4D A;  2R2N A;  3G8M A;  1CL1 A;  3PAA A;  3AV7 A;  1ASA A;  3NTJ A;  4A0R A;  4E3Q A;  3MAU A;  4HF8 A;  3FKD A;  1YAA A;  1SFF A;  3ASA A;  2JJG A;  5G2P A;  3WCO A;  1CQ6 A;  2EPJ A;  4ZM3 A;  3VK4 A;  2YKX A;  4ZDO A;  5FT6 A;  5M4B A;  2D7Y A;  4LNJ A;  2CJG A;  4R8D A;  4ZLV A;  2CY8 A;  3WY7 A;  2VMX A;  4NOG A;  2Z67 A;  2D63 A;  3HBX A;  4LW4 A;  1WYV B;  3RUY A;  4ZM4 A;  1G4X A;  3TFU A;  3EI6 A;  1W3U A;  1BJN A;  4WP0 A;  1J32 A;  5KTB A;  2JIS A;  2Z9U A;  1N2T A;  3GZD C;  1W23 A;  3PPL A;  1SF2 A;  1AY8 A;  3ZRP A;  1SZU A;  1JG8 A;  3AEN B;  3TAT A;  3QI6 A;  3E77 A;  2BWP A;  2ZYJ A;  1CZC A;  3HL2 A;  1ASC A;  4OTL A;  1B8G A;  3NDN A;  3FSL A;  2YKV A;  2G6W A;  3FDB A;  4IY7 A;  3E2Z B;  1WST A;  2PB2 A;  4PIW A;  2OGA A;  1BJO A;  3QGU A;  2VMW A;  5G4I A;  3L44 A;  4ADC A;  2ZSM A;  4LW2 A;  4ZAS A;  5J8Q A;  3HT4 A;  1AIB A;  3VK3 A;  3I5T A;  2ZY2 A;  3NRA A;  2CST A;  2BI2 A;  2DKJ A;  2D65 A;  3NU8 A;  5AX8 A;  2F8J A;  2VLF A;  1UU2 A;  2FM1 A;  3HLM A;  4ADD A;  1GC2 A;  2WB6 A;  1IUG A;  1JF9 A;  1QJ5 A;  2DGM A;  2VMZ A;  2W7K A;  4WXB A;  4A6R A;  3QM2 A;  4OBU A;  3FZ7 A;  2Z9V A;  3IHJ A;  4I8A A;  4ZDP A;  2VYC A;  1TPL A;  3CQ4 A;  1ECX A;  3VAX A;  4OCA A;  2TPL A;  3COG A;  3RBL A;  4K2I A;  4ITX A;  1D7V A;  5BJ3 A;  1N31 A;  3JWA A;  4TN4 A;  4CBR A;  1BT4 A;  2D61 A;  3RI6 A;  3DU4 A;  3RCH B;  3PGY A;  2JGT A;  2Z9X A;  5DX5 A;  4XAU A;  1JS6 A;  2FN6 A;  4UHN A;  4JEV A;  2BI9 A;  4J5U A;  1M32 A;  5DB5 A;  4ZDL A;  4JEW A;  3A9Y A;  4WYC A;  3JW9 A;  1YJS A;  2VMN A;  3EI9 A;  3LVM A;  1ASG A;  1IJI A;  4ZWM A;  2FNI A;  2HOZ A;  3H7F A;  1B9I A;  2W7E A;  1LW4 A;  4LNL A;  5M46 A;  2HZP A;  3AEP A;  2BI1 A;  3ATH A;  2VMT A;  4MSO A;  2E7J A;  2AY3 A;  1D2F A;  1ARI A;  3CQ5 A;  1C7N A;  3OKS A;  3NUI A;  2HOR A;  3FQ7 A;  2OKJ A;  3FDD A;  1ASN A;  3ECD A;  2HUU A;  4ADB A;  1QIT A;  1S08 A;  2Z1Y A;  2VMS A;  1LC7 A;  1KKJ A;  4R5F A;  1MDZ A;  3NU7 A;  1T3I A;  2G7J A;  3B1C A;  3AEL A;  3GZC A;  1DTY A;  1EG5 A;  3ZZK A;  3FQA A;  3MBB A;  2HUI A;  1MLZ A;  1WYU A;  1LC8 A;  2W7J A;  1KMK A;  1MGV A;  1DKA A;  1OAT A;  2D64 A;  2VMV A;  3JZL A;  3PDX A;  2VLH A;  1GBN A;  4WXG A;  2AEV A;  2DOU A;  1CZE A;  1WYV A;  2OGE A;  3JTX A;  4RJ0 A;  5E5I A;  3EI7 A;  4EB5 A;  3GJU A;  2VMO A;  1G4V A;  4RKC A;  3BV0 A;  5D95 A;  4N0W A;  1OXP A;  2ZY5 A;  1FC4 A;  3B1E A;  3B1D A;  1D7R A;  1DGE A;  2DGL A;  3AEN A;  1I48 A;  2Z61 A;  3LVK A;  3NYU A;  4E3R A;  1ASE A;  4ITG A;  4JEY A;  3MKJ A;  2Q7W A;  3F0H A;  3NYT A;  3WGB A;  1P3W A;  3LVJ A;  1CQ8 A;  3BB8 A;  4F5L A;  3AEJ A;  3LY1 A;  3KKI A;  1ASM A;  1BW0 A;  2BWO A;  1OHV A;  1UU0 A;  1V2D A;  2VIA A;  1D7U A;  2HOX A;  4CXR A;  4F5I A;  1ASL A;  1AKB A;  4W1W A;  4UOY A;  1AHG A;  5EQC A;  4E77 A;  5I92 A;  3AAT A;  3P1T A;  1GEW A;  5M49 A;  1YJY A;  4MQR A;  3E2Y A;  1DFO A;  4XK1 A;  2X8U A;  4W1V A;  5EUD A;  4MQP A;  1QJ3 A;  4AH3 A;  2AY7 A;  3II0 A;  1DGD A;  2CJH A;  4DBC A;  3KE3 A;  1IAY A;  1UU1 A;  5EFS A;  1N8P A;  1WYU B;  2WK7 A;  4WD2 A;  4W1X A;  3W1I A;  2C44 A;  4GE4 A;  2BIG A;  1H1C A;  1GC4 A;  3QPG A;  4JE5 A;  3VOM A;  2DKB A;  1W7M A;  2W8U A;  3UWC A;  2NMP A;  4WYF A;  2E7I A;  2Z20 A;  3OP7 A;  4U2H A;  4WYG A;  3WX9 A;  4A0F A;  2YKY A;  1SZS A;  2BKW A;  2YKU A;  1M4N A;  1H0C A;  5EAV A;  2YCN A;  3DR7 A;  2ZP7 A;  3RCH A;  1BKG A;  3F9T A;  3UE8 A;  4PFN A;  5EUE A;  2GMS A;  3GSB A;  4AO9 A;  3FD0 A;  3H9X A;  4MKJ A;  4EFF A;  2AY6 A;  2R0T A;  4JF0 A;  3KGW A;  4PVF A;  2Z1Z A;  2JJH A;  4K05 A;  4OMA A;  1KAF A;  1TAT A;  3ELP A;  4W91 A;  1GD9 A;  2EH6 A;  1FG7 A;  3W1H A;  3BWN C;  3DRD A;  4U1T A;  1AHF A;  4KYO A;  3KGX A;  1AHY A;  3MC6 C;  4J8L A;  7AAT A;  1M7Y A;  2AEU A;  5FT5 A;  1XI9 A;  1PMO A;  1UKJ A;  4RAE A;  2ZJG A;  3MEB A;  2ZY3 A;  5DJ9 A;  1E5F A;  4IXS A;  2GMU A;  4A00 A;  1M0N A;  4XJM A;  4CVQ A;  1TAR A;  4M2M A;  3ZZJ A;  3Q8N A;  1XEY A;  4B9B A;  2C0R A;  3GBX A;  3TFT A;  3WLX A;  4MY5 A;  1WYT B;  2VGW A;  2D66 A;  4A0H A;  2AY2 A;  4M2K A;  1GC3 A;  1U08 A;  2QMA A;  1CL2 A;  1W7N A;  3F6T A;  1AX4 A;  3B8X A;  1LK9 A;  1AHX A;  2XH1 A;  2W8W A;  4IXZ A;  5HXX A;  3FQ8 A;  5E3K A;  2KFP A;  1QIS A;  2O0R A;  1FG3 A;  3BN1 A;  2DGK A;  3EI5 A;  3FCR A;  3DOD A;  1MDX A;  1ARS A;  4Y0H A;  2VGV A;  3WKS A;  1C7O A;  3VK2 A;  2W8J A;  2ZSL A;  3A9Z A;  5EIG A;  3WKR A;  4ZSW A;  3LWS A;  4ADE A;  3MAF A;  4BA4 A;  1IX8 A;  3BS8 A;  1V2E A;  2FQ6 A;  1SVV A;  1BQA A;  1IX7 A;  2W7M A;  3CQ6 A;  3UAK A;  4UQV A;  4MKK A;  2VIB A;  1RVU A;  3JU7 A;  3HDO A;  3ZRR A;  4TV7 A;  3PA9 A;  5E4Z A;  4F5M A;  1X0M A;  2HOY A;  3ACZ A;  3AEM A;  2GSA A;  3K7Y A;  3K40 A;  3M5U A;  3E2F A;  3MAD A;  3ISL A;  3LV2 A;  4UHO A;  2A1V A;  1TOI A;  1J04 A;  4ZAH A;  1Y4I A;  4XQ2 A;  4GRX A;  1QGN A;  2EZ2 A;  4F5H A;  1RV4 A;  1ASD A;  2ZY4 A;  3QHX A;  3FZ8 A;  4ATQ A;  3IF2 A;  1ARH A;  1BJW A;  3ASB A;  3NUB A;  4CXQ A;  2WK8 A;  2VGU A;  3WCN A;  2R5C B;  2BHX A;  2BIE A;  2QB2 A;  1AMQ A;  1AY5 A;  1ELU A;  2W7D A;  1Z7D A;  4OT8 A;  2CIN A;  3TCM A;  5LH9 A;  1M0Q A;  4F5F A;  3GET A;  4ZSY A;  1TOK A;  4ATP A;  5FT8 A;  3T32 A;  3EZ1 A;  1V72 A;  1SZK A;  4L0O A;  4Y0I A;  4CBS A;  1ORD A;  1I29 A;  1ZOB A;  1X2A A;  2CJD A;  4WLH A;  4A6T A;  3CAI A;  3N4X A;  5TF5 A;  4GEB A;  3PDB B;  2W7I A;  2W7L A;  2D5Y A;  1YOO A;  3D6K A;  2C81 A;  3LG0 A;  2PB0 A;  3JWB A;  3E6G A;  3PIU A;  4Q76 A;  5EIG B;  4W8I A;  3DXV A;  4UHM A;  4OYT A;  4EMY A;  3MAF B;  4KXK A;  1EQB A;  4WB0 B;  3FTB A;  3R9A A;  3RQ1 A;  3FRK A;  3GZD A;  3FVX A;  3A8U X;  4OBV A;  2RFV A;  3ZRQ A;  4WBT A;  4WYD A;  3FFR A;  2AY4 A;  4TMR A;  3CBF A;  1OXO A;  1X28 A;  3LVL B;  4GE9 A;  4R5Z A;  1V2F A;  2W7G A;  4W5K A;  4Q6R A;  4K2M A;  2W8V A;  2CH2 A;  1GCK A;  2EGY A;  1ASF A;  1AHE A;  1AAW A;  4Y0D A;  3E9K A;  3FVS A;  1ZOD A;  2BYL A;  1WKG A;  3EZS A;  1CQ7 A;  8AAT A;  1AJS B;  1I41 A;  1WYT A;  3DR4 A;  3P6K A;  1YJZ A;  2BI5 A;  3WGC A;  2FNU A;  2VMQ A;  4AZJ A;  1TAS A;  1MDO A;  2V1P A;  1GEY A;  5FT4 A;  1D7S A;  2HP1 A;  3USF A;  3B46 A;  1B5P A;  2CTZ A;  3FZ6 A;  2XBN A;  1AMS A;  4H63 Q;  5G4J A;  5C6U A;  2JG2 A;  1O62 A;  4AOA A;  1ASB A;  3W1J A;  3WZF A;  4F5J A;  3NYS A;  2AY8 A;  2VMP A;  2AAT A;  1TOE A;  1X29 A;  5JAY A;  2EO5 A;  1W7L A;  1I43 A;  4WYE A;  1AIC A;  1MAP A;  4JEX A;  4F4E A;  1JS3 A;  1WKH A;  4LNM A;  5EAA A;  4FFC A;  4XEW A;  4GSA A;  4RIZ A;  4F5K A;  1QIR A;  1AKA A;  4O6Z A;  2C7T A;  4F5G A;  1EJI A;  1CS1 A;  1O4S A;  1PG8 A;  4RJY A;  2QSR A;  2CB1 A;  2BI3 A;  3QN6 A;  2YRR A;  3GR9 A;  1QZ9 A;  3PD6 B;  1G7W A;  3AEJ C;  4MGR A;  2BWN A;  1M0O A;  2D7Z A;  3HQT A;  4XJP A;  4XJL A;  3EUC A;  4XJO A;  1Z3Z A;  4IXO A;  5F9S A;  4PFF A;  1RVY A;  1IBJ A;  1S06 A;  2ZC0 A;  4N0B A;  4WXF A;  1TOJ A;  2CH1 A;  1PMM A;  1ZC9 A;  2HUF A;  2OKK A;  3AEO A;  3N7N A;  3A9X A;  2QLR A;  3RBF A;  2JJE A;  4DGT A;  1OHW A;  2WK9 A;  1IAX A;  3FVU A;  2EYQ A;  1VJO A;  1YIZ A;  2EZ1 A;  5IWQ A;  1S0A A;  3ELE A;  5G09 A;  3EI8 A;  5LHA A;  2VMR A;  4JF1 A;  3FFH A;  4DQ6 A;  3I16 A;  2R5C A;  4ZWV A;  5D5S A;  2PO3 A;  4RLG A;  3AOW A;  4IYO B;  4BHD A;  1IVR A;  1C7G A;  1M0P A;  4JE5 D;  4OC9 A;  3N0L A;  2GQN A;  4FL0 A;  1YIY A;  2VGZ A;  2YOB A;  2FKI A;  4RIT A;  2GB3 A;  1CJ0 A;  2R5E A;  3BCX A;  3G7Q A;  3N75 A;  3NX3 A;  5BJ4 A;  9AAT A;  1SPA A;  3PDB A;  2X3L A;  3DXW A;  2ZUK A;  4E1O A;  2FYF A;  1DJ9 A;  1AAM A;  1BS0 A;  4A0G A;  1C0N A;  5F8V A;  2BYJ A;  2OAT A;  2VI9 A;  3R4T A;  4WB0 A;  1G7X A;  3H14 A;  1MLY A;  1LKC A;  1LW5 A;  4WLJ A;  2Z9W A;  2W7H A;  4M2J A;  4RM1 A;  4P3M A;  1IX6 A;  2JJF A;  4MQQ A;  5DJ1 A;  4HVK A;  4BQ0 A;  3G0T A;  1AKC A; 
#chains in the Genus database with same CATH homology
 2X5D A;  1O61 A;  4H51 A;  2QA3 A;  3HVY A;  1AJS A;  1AMA A;  1DJE A;  3I4J A;  2X5F A;  4Q75 A;  5HHY A;  1ARG A;  2VMY A;  3PJ0 A;  3HMU A;  3EIA A;  2W8T A;  1O69 A;  1DJU A;  1BJO B;  3DC1 A;  1B9H A;  1AY4 A;  2AY9 A;  3K28 A;  2VGS A;  4A6U A;  1GC0 A;  1BQD A;  2O1B A;  3L8A A;  2E54 A;  2YCP A;  3BCA A;  4QGR A;  2DR1 A;  2WKA A;  1TOG A;  3AOV A;  1S07 A;  1KL1 A;  3DZZ A;  4R2N A;  3TQX A;  2V0Y A;  4EB7 A;  4A72 A;  1E5E A;  2CFB A;  4IX8 A;  4Q31 A;  4EU1 A;  2QBT A;  1S09 A;  1VP4 A;  1AJR A;  3BWO A;  3EIB A;  3NNK A;  1B4X A;  4K2B A;  1KKP A;  1GDE A;  1VEF A;  4LC3 A;  4BMK A;  3A2B A;  4GDY A;  4AO4 A;  1C4K A;  2E7U A;  4AZK A;  4KAM A;  3N4R A;  1LS3 A;  4BA5 A;  4WYA A;  3GWP A;  2OQX A;  3PD6 A;  3DYD A;  2AY1 A;  4IW7 A;  5G2Q A;  1AIA A;  2BIA A;  2CAN A;  2O7C A;  2W7F A;  2YRI A;  1LC5 A;  1YNU A;  1KMJ A;  3QBO A;  5HDM A;  1PFF A;  2VMU A;  3BC8 A;  3N5M A;  2QB3 A;  4JEZ A;  1MAQ A;  4B98 A;  1C9C A;  3BWN A;  3N4S A;  2VGT A;  2YCT A;  1ART A;  1BJ4 A;  3AEM C;  3VP6 A;  3MC6 A;  1ELQ A;  5K8B A;  1B5O A;  1KL2 A;  1AMR A;  2YHK A;  1M6S A;  1GEX A;  2ORD A;  4P7Y A;  3BCB A;  2HP2 A;  5G0A A;  3E2Z A;  2AY5 A;  4ISY A;  1RV3 A;  4GE7 A;  1OHY A;  4RKD A;  2VI8 A;  5EUN A;  4IYO A;  5M4D A;  2R2N A;  3G8M A;  1CL1 A;  3PAA A;  3AV7 A;  1ASA A;  3NTJ A;  4A0R A;  4E3Q A;  3MAU A;  4HF8 A;  3FKD A;  1YAA A;  1SFF A;  3ASA A;  2JJG A;  5G2P A;  3WCO A;  1CQ6 A;  2EPJ A;  4ZM3 A;  3VK4 A;  2YKX A;  4ZDO A;  5FT6 A;  5M4B A;  2D7Y A;  4LNJ A;  2CJG A;  4R8D A;  4ZLV A;  2CY8 A;  3WY7 A;  2VMX A;  4NOG A;  2Z67 A;  2D63 A;  3HBX A;  4LW4 A;  1WYV B;  3RUY A;  4ZM4 A;  1G4X A;  3TFU A;  3EI6 A;  1W3U A;  1BJN A;  4WP0 A;  1J32 A;  5KTB A;  2JIS A;  2Z9U A;  1N2T A;  3GZD C;  1W23 A;  3PPL A;  1SF2 A;  1AY8 A;  3ZRP A;  1SZU A;  1JG8 A;  3AEN B;  3TAT A;  3QI6 A;  3E77 A;  2BWP A;  2ZYJ A;  1CZC A;  3HL2 A;  1ASC A;  4OTL A;  1B8G A;  3NDN A;  3FSL A;  2YKV A;  2G6W A;  3FDB A;  4IY7 A;  3E2Z B;  1WST A;  2PB2 A;  4PIW A;  2OGA A;  1BJO A;  3QGU A;  2VMW A;  5G4I A;  3L44 A;  4ADC A;  2ZSM A;  4LW2 A;  4ZAS A;  5J8Q A;  3HT4 A;  1AIB A;  3VK3 A;  3I5T A;  2ZY2 A;  3NRA A;  2CST A;  2BI2 A;  2DKJ A;  2D65 A;  3NU8 A;  5AX8 A;  2F8J A;  2VLF A;  1UU2 A;  2FM1 A;  3HLM A;  4ADD A;  1GC2 A;  2WB6 A;  1IUG A;  1JF9 A;  1QJ5 A;  2DGM A;  2VMZ A;  2W7K A;  4WXB A;  4A6R A;  3QM2 A;  4OBU A;  3FZ7 A;  2Z9V A;  3IHJ A;  4I8A A;  4ZDP A;  2VYC A;  1TPL A;  3CQ4 A;  1ECX A;  3VAX A;  4OCA A;  2TPL A;  3COG A;  3RBL A;  4K2I A;  4ITX A;  1D7V A;  5BJ3 A;  1N31 A;  3JWA A;  4TN4 A;  4CBR A;  1BT4 A;  2D61 A;  3RI6 A;  3DU4 A;  3RCH B;  3PGY A;  2JGT A;  2Z9X A;  5DX5 A;  4XAU A;  1JS6 A;  2FN6 A;  4UHN A;  4JEV A;  2BI9 A;  4J5U A;  1M32 A;  5DB5 A;  4ZDL A;  4JEW A;  3A9Y A;  4WYC A;  3JW9 A;  1YJS A;  2VMN A;  3EI9 A;  3LVM A;  1ASG A;  1IJI A;  4ZWM A;  2FNI A;  2HOZ A;  3H7F A;  1B9I A;  2W7E A;  1LW4 A;  4LNL A;  5M46 A;  2HZP A;  3AEP A;  2BI1 A;  3ATH A;  2VMT A;  4MSO A;  2E7J A;  2AY3 A;  1D2F A;  1ARI A;  3CQ5 A;  1C7N A;  3OKS A;  3NUI A;  2HOR A;  3FQ7 A;  2OKJ A;  3FDD A;  1ASN A;  3ECD A;  2HUU A;  4ADB A;  1QIT A;  1S08 A;  2Z1Y A;  2VMS A;  1LC7 A;  1KKJ A;  4R5F A;  1MDZ A;  3NU7 A;  1T3I A;  2G7J A;  3B1C A;  3AEL A;  3GZC A;  1DTY A;  1EG5 A;  3ZZK A;  3FQA A;  3MBB A;  2HUI A;  1MLZ A;  1WYU A;  1LC8 A;  2W7J A;  1KMK A;  1MGV A;  1DKA A;  1OAT A;  2D64 A;  2VMV A;  3JZL A;  3PDX A;  2VLH A;  1GBN A;  4WXG A;  2AEV A;  2DOU A;  1CZE A;  1WYV A;  2OGE A;  3JTX A;  4RJ0 A;  5E5I A;  3EI7 A;  4EB5 A;  3GJU A;  2VMO A;  1G4V A;  4RKC A;  3BV0 A;  5D95 A;  4N0W A;  1OXP A;  2ZY5 A;  1FC4 A;  3B1E A;  3B1D A;  1D7R A;  1DGE A;  2DGL A;  3AEN A;  1I48 A;  2Z61 A;  3LVK A;  3NYU A;  4E3R A;  1ASE A;  4ITG A;  4JEY A;  3MKJ A;  2Q7W A;  3F0H A;  3NYT A;  3WGB A;  1P3W A;  3LVJ A;  1CQ8 A;  3BB8 A;  4F5L A;  3AEJ A;  3LY1 A;  3KKI A;  1ASM A;  1BW0 A;  2BWO A;  1OHV A;  1UU0 A;  1V2D A;  2VIA A;  1D7U A;  2HOX A;  4CXR A;  4F5I A;  1ASL A;  1AKB A;  4W1W A;  4UOY A;  1AHG A;  5EQC A;  4E77 A;  5I92 A;  3AAT A;  3P1T A;  1GEW A;  5M49 A;  1YJY A;  4MQR A;  3E2Y A;  1DFO A;  4XK1 A;  2X8U A;  4W1V A;  5EUD A;  4MQP A;  1QJ3 A;  4AH3 A;  2AY7 A;  3II0 A;  1DGD A;  2CJH A;  4DBC A;  3KE3 A;  1IAY A;  1UU1 A;  5EFS A;  1N8P A;  1WYU B;  2WK7 A;  4WD2 A;  4W1X A;  3W1I A;  2C44 A;  4GE4 A;  2BIG A;  1H1C A;  1GC4 A;  3QPG A;  4JE5 A;  3VOM A;  2DKB A;  1W7M A;  2W8U A;  3UWC A;  2NMP A;  4WYF A;  2E7I A;  2Z20 A;  3OP7 A;  4U2H A;  4WYG A;  3WX9 A;  4A0F A;  2YKY A;  1SZS A;  2BKW A;  2YKU A;  1M4N A;  1H0C A;  5EAV A;  2YCN A;  3DR7 A;  2ZP7 A;  3RCH A;  1BKG A;  3F9T A;  3UE8 A;  4PFN A;  5EUE A;  2GMS A;  3GSB A;  4AO9 A;  3FD0 A;  3H9X A;  4MKJ A;  4EFF A;  2AY6 A;  2R0T A;  4JF0 A;  3KGW A;  4PVF A;  2Z1Z A;  2JJH A;  4K05 A;  4OMA A;  1TAT A;  3ELP A;  4W91 A;  1GD9 A;  2EH6 A;  1FG7 A;  3W1H A;  3BWN C;  3DRD A;  4U1T A;  1AHF A;  4KYO A;  3KGX A;  1AHY A;  3MC6 C;  4J8L A;  7AAT A;  1M7Y A;  2AEU A;  5FT5 A;  1XI9 A;  1PMO A;  1UKJ A;  4RAE A;  2ZJG A;  3MEB A;  2ZY3 A;  5DJ9 A;  1E5F A;  4IXS A;  2GMU A;  4A00 A;  1M0N A;  4XJM A;  4CVQ A;  1TAR A;  4M2M A;  3ZZJ A;  3Q8N A;  1XEY A;  4B9B A;  2C0R A;  3GBX A;  3TFT A;  3WLX A;  4MY5 A;  1WYT B;  2VGW A;  2D66 A;  4A0H A;  2AY2 A;  4M2K A;  1GC3 A;  1U08 A;  2QMA A;  1CL2 A;  1W7N A;  3F6T A;  1AX4 A;  3B8X A;  1LK9 A;  1AHX A;  2XH1 A;  2W8W A;  4IXZ A;  5HXX A;  3FQ8 A;  5E3K A;  2KFP A;  1QIS A;  2O0R A;  1FG3 A;  3BN1 A;  2DGK A;  3EI5 A;  3FCR A;  3DOD A;  1MDX A;  1ARS A;  4Y0H A;  2VGV A;  3WKS A;  1C7O A;  3VK2 A;  2W8J A;  2ZSL A;  3A9Z A;  5EIG A;  3WKR A;  4ZSW A;  3LWS A;  4ADE A;  3MAF A;  4BA4 A;  1IX8 A;  3BS8 A;  1V2E A;  2FQ6 A;  1SVV A;  1BQA A;  1IX7 A;  2W7M A;  3CQ6 A;  3UAK A;  4UQV A;  4MKK A;  2VIB A;  1RVU A;  3JU7 A;  3HDO A;  3ZRR A;  4TV7 A;  3PA9 A;  5E4Z A;  4F5M A;  1X0M A;  2HOY A;  3ACZ A;  3AEM A;  2GSA A;  3K7Y A;  3K40 A;  3M5U A;  3E2F A;  3MAD A;  3ISL A;  3LV2 A;  4UHO A;  2A1V A;  1TOI A;  1J04 A;  4ZAH A;  1Y4I A;  4XQ2 A;  4GRX A;  1QGN A;  2EZ2 A;  4F5H A;  1RV4 A;  1ASD A;  2ZY4 A;  3QHX A;  3FZ8 A;  4ATQ A;  3IF2 A;  1ARH A;  1BJW A;  3ASB A;  3NUB A;  4CXQ A;  2WK8 A;  2VGU A;  3WCN A;  2R5C B;  2BHX A;  2BIE A;  2QB2 A;  1AMQ A;  1AY5 A;  1ELU A;  2W7D A;  1Z7D A;  4OT8 A;  2CIN A;  3TCM A;  5LH9 A;  1M0Q A;  4F5F A;  3GET A;  4ZSY A;  1TOK A;  4ATP A;  5FT8 A;  3T32 A;  3EZ1 A;  1V72 A;  1SZK A;  4L0O A;  4Y0I A;  4CBS A;  1ORD A;  1I29 A;  1ZOB A;  1X2A A;  2CJD A;  4WLH A;  4A6T A;  3CAI A;  3N4X A;  5TF5 A;  4GEB A;  3PDB B;  2W7I A;  2W7L A;  2D5Y A;  1YOO A;  3D6K A;  2C81 A;  3LG0 A;  2PB0 A;  3JWB A;  3E6G A;  3PIU A;  4Q76 A;  5EIG B;  4W8I A;  3DXV A;  4UHM A;  4OYT A;  4EMY A;  3MAF B;  4KXK A;  1EQB A;  4WB0 B;  3FTB A;  3R9A A;  3RQ1 A;  3FRK A;  3GZD A;  3FVX A;  3A8U X;  4OBV A;  2RFV A;  3ZRQ A;  4WBT A;  4WYD A;  3FFR A;  2AY4 A;  4TMR A;  3CBF A;  1OXO A;  1X28 A;  3LVL B;  4GE9 A;  4R5Z A;  1V2F A;  2W7G A;  4W5K A;  4Q6R A;  4K2M A;  2W8V A;  2CH2 A;  1GCK A;  2EGY A;  1ASF A;  1AHE A;  1AAW A;  4Y0D A;  3E9K A;  3FVS A;  1ZOD A;  2BYL A;  1WKG A;  3EZS A;  1CQ7 A;  8AAT A;  1AJS B;  1I41 A;  1WYT A;  3DR4 A;  3P6K A;  1YJZ A;  2BI5 A;  3WGC A;  2FNU A;  2VMQ A;  4AZJ A;  1TAS A;  1MDO A;  2V1P A;  1GEY A;  5FT4 A;  1D7S A;  2HP1 A;  3USF A;  3B46 A;  1B5P A;  2CTZ A;  3FZ6 A;  2XBN A;  1AMS A;  4H63 Q;  5G4J A;  5C6U A;  2JG2 A;  1O62 A;  4AOA A;  1ASB A;  3W1J A;  3WZF A;  4F5J A;  3NYS A;  2AY8 A;  2VMP A;  2AAT A;  1TOE A;  1X29 A;  5JAY A;  2EO5 A;  1W7L A;  1I43 A;  4WYE A;  1AIC A;  1MAP A;  4JEX A;  4F4E A;  1JS3 A;  1WKH A;  4LNM A;  5EAA A;  4FFC A;  4XEW A;  4GSA A;  4RIZ A;  4F5K A;  1QIR A;  1AKA A;  4O6Z A;  2C7T A;  4F5G A;  1EJI A;  1CS1 A;  1O4S A;  1PG8 A;  4RJY A;  2QSR A;  2CB1 A;  2BI3 A;  3QN6 A;  2YRR A;  3GR9 A;  1QZ9 A;  3PD6 B;  1G7W A;  3AEJ C;  4MGR A;  2BWN A;  1M0O A;  2D7Z A;  3HQT A;  4XJP A;  4XJL A;  3EUC A;  4XJO A;  1Z3Z A;  4IXO A;  5F9S A;  4PFF A;  1RVY A;  1IBJ A;  1S06 A;  2ZC0 A;  4N0B A;  4WXF A;  1TOJ A;  2CH1 A;  1PMM A;  1ZC9 A;  2HUF A;  2OKK A;  3AEO A;  3N7N A;  3A9X A;  2QLR A;  3RBF A;  2JJE A;  4DGT A;  1OHW A;  2WK9 A;  1IAX A;  3FVU A;  2EYQ A;  1VJO A;  1YIZ A;  2EZ1 A;  5IWQ A;  1S0A A;  3ELE A;  5G09 A;  3EI8 A;  5LHA A;  2VMR A;  4JF1 A;  3FFH A;  4DQ6 A;  3I16 A;  2R5C A;  4ZWV A;  5D5S A;  2PO3 A;  4RLG A;  3AOW A;  4IYO B;  4BHD A;  1IVR A;  1C7G A;  1M0P A;  4JE5 D;  4OC9 A;  3N0L A;  2GQN A;  4FL0 A;  1YIY A;  2VGZ A;  2YOB A;  2FKI A;  4RIT A;  2GB3 A;  1CJ0 A;  2R5E A;  3BCX A;  3G7Q A;  3N75 A;  3NX3 A;  5BJ4 A;  9AAT A;  1SPA A;  3PDB A;  2X3L A;  3DXW A;  2ZUK A;  4E1O A;  2FYF A;  1DJ9 A;  1AAM A;  1BS0 A;  4A0G A;  1C0N A;  5F8V A;  2BYJ A;  2OAT A;  2VI9 A;  3R4T A;  4WB0 A;  1G7X A;  3H14 A;  1MLY A;  1LKC A;  1LW5 A;  4WLJ A;  2Z9W A;  2W7H A;  4M2J A;  4RM1 A;  4P3M A;  1IX6 A;  2JJF A;  4MQQ A;  5DJ1 A;  4HVK A;  4BQ0 A;  3G0T A;  1AKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...