2BIIA

Crystal structure of nitrate-reducing fragment of assimilatory nitrate reductase from pichia angusta
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
415
structure length
415
Chain Sequence
PFNSEPPLTKLYDSGFLTPVSLHFVRNHGPVPYVPDENILDWEVSIEGMVETPYKIKLSDIMEQFDIYSTPVTMVCAGNRRKEQNMVKKGAGFNWGAAGTSTSLWTGCMLGDVIGKARPSKRARFVWMEGADNPANGAYGTCIRLSWCMDPERCIMIAYQQNGEWLHPDHGKPLRVVIPGVIGGRSVKWLKKLVVSDRPSENWYHYFDNRVLPTMVTPEMAKSDDRWWKDERYAIYDLNLQTIICKPENQQVIKISEDEYEIAGFGYNGGGVRIGRIEVSLDKGKSWKLADIDYPEDRYREAGYFRLFGGLVNVCDRMSCLCWCFWKLKVPLSELARSKDILIRGMDERMMVQPRTMYWNVTSMLNNWWYRVAIIREGESLRFEHPVVANKPGGWMDRVKAEGGDILDNNWGEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Eukaryotic Nitrate Reduction: Crystal Structures of the Nitrate Reductase Active Site
pubmed doi rcsb
source organism Pichia angusta
molecule tags Oxidoreductase
molecule keywords NITRATE REDUCTASE [NADPH]
total genus 130
structure length 415
sequence length 415
chains with identical sequence B
ec nomenclature ec 1.7.1.3: Nitrate reductase (NADPH).
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2biiA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2biiA01
2A9BA 4PW9A 2BIHA 2XTSA 1SOXA 3R18A 4PW3A 3HBQA 3HBGA 1OGPA 2CA3A 2C9XA 2BPBA 2A9DA 2A9CA 3HC2A 3HBPA 2BLFA 2A9AA 1XDQA 2CA4A 1XDYA 2BIIA 3R19A 2A99A
chains in the Genus database with same CATH superfamily
4JLRA 3S88L 4FP8L 2D3JA 2Q3AA 2UXTA 3GJFK 1KCUH 2RCSH 2YOCA 4R96B 3B7TA 4JL1A 4KJPC 1TSRA 5MHSD 4LBAA 4OLZH 4WWPA 1ACZA 3P9WB 3V5HA 1CQYA 2WBWB 5FHAH 2LLGA 1OIOA 5I26A 4MS6A 4JFDE 4HZ1A 3QHTC 2VXUL 1WA2X 1WIUA 5HYEA 1BVLA 4X4YB 1THAA 4IMKC 4YQXL 2NZIA 1ONQA 5CLWA 3QRGL 1RK1B 4LLDB 3KLDA 4WDIB 3IFPB 4L4VB 3WXWL 3A3YB 5SWSB 5L4JA 3NN8A 4E36A 2PYEE 1A6TB 2R69A 5FGBA 2BHUA 3BSHA 5FR3A 4RIRA 5IVZA 3BH9B 2XKSA 1ECYA 2X1PA 3CCHA 3V0VA 3J7HA 5J5EA 4P3DB 3THML 3U30C 1QNZH 2H8PB 3AS3A 3EBIA 3KPTA 5EEUA 3BAKA 3QWNA 1DBML 5JQ6H 4NNYB 1F56A 4RRPA 3H9HA 2VZ3A 1B4LA 4BK5C 1J9RA 2VLME 4I3RH 3LPFA 1U2HA 4EUPA 2V2TB 3DPBB 2CSPA 5DMIL 3MLWL 4QWWC 1KYAA 4UZGA 1HU8A 4X7EC 4NKOB 4N86A 2MCMA 5GGVY 1JCVA 1DQMH 2EAEA 5A2AA 4R97B 1S7SB 2H2SC 3DOIA 2D7TH 1E5YA 2JVUA 4AGMA 4CJ0A 1SVBA 5J1AA 1U8OB 5TDOB 2R7EB 1BM7A 2SODB 3Q2VA 2ZKYA 3FBKA 3MNWB 3MNMA 2B9BA 2L7JA 3PFUA 3V6FA 2R59A 3N06B 5ANME 1NCTA 1A9VA 4N90E 1JHTB 3F12B 5DK2B 3RWEB 1P4LB 3CXHK 4XN1A 2F53D 1BQSA 2R69H 4EZMA 3FPXA 4IRSD 3G5XA 3QULB 2GJ6E 2OXHB 3LRKA 3PWUA 1UQSB 3V79C 1DQIA 4Y4HB 4YNYA 5G4NA 5IJCC 2E59A 5KSAB 1RP8A 3ZMEA 2DIBA 1LK3L 1QZ1A 1IGFH 3QEQE 4PH8A 4MD5B 1N6UA 5FCUH 2V8LA 3VFGH 3NCBB 2BVOA 3QWRD 5E03A 1OZTG 5C07B 3KJ4C 4JX0A 2B14A 5HYJB 2IH8A 4UQ3B 3ASWA 3GNML 1JF1A 1H6FA 1NL0L 2LR4A 5T3XE 2NSXA 3VFTB 2X28A 1XDTT 2F74B 1KYOJ 3AUVA 2PMZA 3A21A 4C4KT 4WW1B 1XH3B 4LSRH 2R4SL 4JFEA 3LTVA 3HCVA 4L1DA 5C86A 2BS9A 4G43A 4UF7C 5JIDA 5E8OB 2G5UA 1G94A 3S88H 3O6MH 3TBCA 3T4YA 4BIKA 1FCGA 4OQTA 1VHPA 1NGXA 5FO7B 4RGND 4GW5B 2QSTA 1N0XH 3CH1B 4HP5A 3NTCH 4MDJB 5KJ7E 1X6LA 4ZD3H 1E6OH 3RNQA 4KHXH 4Q6IC 5GS0C 2GY7B 3G3LA 5PAZA 1ZA6A 4X99A 2X1XR 5GRZA 4DTGH 5CILH 2V7NB 1PJWA 1TYRA 2IF7A 4HG4J 2P7TA 4PJXA 3NIFF 2ITDB 3RIKA 4NUJA 2AEQH 3R0NA 2X09A 2G9KA 3K71A 2EUXA 3OLIA 3CUPA 4Y1AA 4BK4A 4LVNB 1NC2B 5F7EL 4KOBA 4PJHF 4Y89A 3E2HC 1D5IL 3VFVB 3VGEA 2VXVH 1FLTX 5KEZA 2KZ1B 1AGCB 1BQHB 5D93B 4F7CB 4LLUB 1I1AB 3BW9A 1NJ9A 2EIZA 4JFFD 2DY2A 4NENA 2YBRB 3CPLB 4NPJA 2BRRL 1DJXA 3QI9C 1N18A 4X5XB 2EABA 4DH2A 1GYUA 3REVA 1VGKA 2VMCA 3V0EA 4Y4FC 4J4PD 1B9KA 4PG2C 3MODL 4F3FA 1SYSB 4S1DC 3MLYH 2X4RA 1RULH 4BSWA 5CXPA 5IHZA 5F2FA 5L8LB 4XTRC 3GM8A 4TL5A 5C3TA 1WG3A 3K5SA 3O8XB 2O26U 3I75A 4ZO7A 3ULVD 1SRDA 3CDGA 4S1SL 3T3MF 2GK0B 5DRZB 3R4DA 4KX7A 1UD2A 5EU6B 3S7GA 2ADGA 4ZFFB 3BKJL 4ZMYA 2CGRL 1FVEB 3UIZA 5E5LA 4U05A 2ADGB 1RZPA 3IDYB 3MA9H 3QO1B 4Z5RB 1A1NB 1WAAA 2GFBB 3QT2A 4LL4A 5C0FA 1LL1A 1MIMH 2HKAA 2F19H 4YHIA 2HJKA 1U8PA 1FYTD 2YARA 2OKMA 1YAIA 1NBYB 2XQ0A 3E6FB 4NWTH 5EN2A 4JW3A 4NSKB 2X12A 1U93A 4LP5A 3HW7A 5IQ9A 5TH2B 4KDWA 4FKEA 1NDGA 3CVHA 4PM1A 5E00B 4YS4A 3UTTB 1KCBA 2EKSB 2EXSA 4HJ1A 4O5LL 1LTXA 5CNHA 4RQQA 2FTAA 1KB5A 2E7LA 4PW4A 1OAXL 3BESR 4OLUL 4XC3H 3SGKC 4DIXA 3RX8A 4PJ5D 1J8RA 1WBXA 2BWDA 4UM8B 1IC4H 4K8RH 4LCCB 5DHEA 2FWOB 2JXMA 2WNXA 4ZO9A 5F7AA 4RDQG 4RRPG 2YPLE 3UJIL 1KWGA 1DQQB 2WLIB 4FQCL 1JYNA 3TT3H 4EOWH 1ULVA 4CC1A 2GI0A 4WW2C 3SDAD 3DVNB 3HG3A 2VR7A 3HC3L 1CDUA 1S7RB 3ZO9A 5HPMA 2YPVL 3O11A 4GKSB 2A9NH 4PJGF 4GLRH 5LDUA 4O2CA 4M9PA 4DVBB 3ZPDA 5DWUH 5JHLH 1D7FA 4HUVA 1C16A 1DSYA 1MUJB 5C0AE 1EO7A 1EAPA 3G6JB 3EFFB 3MJ9A 1E27B 3GBDA 5AOKA 3SQOL 2WWNA 4F7EB 2YXMA 4LAQL 1KOAA 3I2CL 2OYMA 2K6ZA 3VGBA 1UWXK 1WCBB 1HINL 1HXYB 1BJMA 2ILLA 5EF0A 4AQ8A 4TSBH 5JNYA 2ZCHL 4YDIH 3KWTA 5A2CA 5GHWH 3UGXA 5LO7A 1QATA 4N90D 5EZJA 4D2NA 1WA1X 4C83B 2LQRA 1HILB 4P2OC 4UU9B 4DW2H 1YECL 3P3UA 1G6RA 3OKMB 1X9LA 1DHKA 3TWCL 2VAAB 3D6GA 1QI3A 2WP3T 5GHWL 4IU3A 4BZ1H 1S9KC 4S1SH 2OW7A 4HJ0C 5B1BB 5ISZE 3TO4B 2QLYA 3D87B 3D3VE 3GRWH 4UANA 5BV7B 3GIVA 4UQBA 1OCOB 4KI5F 2VLRE 2YAHA 3QZMA 3U30B 2J57A 3O0RH 5F6HI 3E6HB 3PWPA 4AJWA 4Y9EA 1W72B 4V1DE 4KKZA 1EHLL 1QFOA 1HHKA 1VIWA 1DYZA 1NDTA 2XIDA 3ZZSA 3NABH 3CFKB 2G60H 1HOCA 1PG7W 1IKFL 3DJRA 4PRIA 4XGZA 3RKDC 4Y5YC 4LVOC 5CSZB 4IIQA 2O61B 2Y7LA 1DUZA 4XGZB 2NNRA 2Z8VC 1AHKA 1Q9OB 2NSQA 1AHMA 4R5TA 4MAYB 1S3KL 3VRIA 2GEEA 2XDHA 4GG8B 3QSKB 1M1XB 2Z7YA 3MMEA 3NESA 4NNXA 5I6NA 4M5SA 4Z6AT 3PHQB 4NQDE 2P47B 3O4OC 5DI8B 3MLUL 3GSXA 3BLBA 5TE7L 1A7QL 5BZXA 1BPVA 2Q8AH 2JB5L 1MAML 5ACZB 1JN6A 2WVVB 5A7BA 1S7TA 2YMTA 1B2YA 2F5AL 1F02I 4QHUA 2YPLD 1BVLB 3Q1EA 3WKMH 4X4YA 5IWLC 2BS71 1AIFB 1SYVA 4HHWA 2VQUA 1CFNA 5HXMA 4PQXA 1BAGA 4OF0A 4FLSA 1T20A 3ZQWA 3ALXA 4OSUL 1IJ9A 4FI7A 4QNPF 4TLUA 1JGDB 3WY3A 5DLMH 4JR9H 1LE5B 1FGVH 5I1HL 3Q5TA 4LSRL 5CGMA 3PNWB 3IS0X 3GRBA 2BS8A 5FOJA 3WFHA 3A4DA 3KPOB 5AUMA 3ERXA 5EO1A 3MV8D 1V10A 4WI2A 5DEGB 3JT2A 4ZZKA 2I60H 3CGTA 5GZNC 4XC1L 2P8LA 2FQGA 2W81C 1CFQB 4LCVA 2P3YA 4ZDHB 2F9BT 2CCVA 2FD6L 4ZTPL 1QX1A 5HYQB 5F3BA 1YMMA 4Q6IB 3SBQA 3VXNB 1XCTA 5CLYA 3DX9A 4KZ0A 5H4ZA 4BEIA 1R46A 2G4GA 4DN3H 4I0PD 4GSRA 4OZGB 1YMHA 3L5XL 5DC9B 4QOKE 2E7MA 5CZXC 2CHZA 1ZAGA 3DIFA 5T5FA 4H4NA 3S3SA 2HLAA 4XXDB 1FZJA 1H5BC 4K3GA 2N4IA 1OK8A 1CI3M 3JWNE 4LLVB 4R4ND 3U9PL 4BUGA 4NQCA 4CSTA 4ZBJA 1HDMA 3HC4H 1O6SB 4WHDA 1KCVL 1A6ZA 3CU7A 2B2XL 5EOCL 1JOIA 1C08A 1IC1A 4IOIA 4PP2A 4P23A 2R29L 3B6SA 1BEYL 4PV1C 2EDLA 3RUGA 4Z7QE 3S6CA 4L3CB 3SDAB 1UM5H 4BFJA 4N2FA 1DBAH 1YNLH 1T89C 4DUVA 3CWGA 4CRPA 2WUBH 4BYHA 3IFLH 1U8MB 2VERN 1GGCL 1UA3A 2NTFB 3C75A 3FT9A 5DHVA 4HF5L 3SO5A 2OJEB 4EIZC 5LGKA 1NBVH 1SDAB 1TQSA 4O2EA 4TQHA 5IHHA 5LXGL 3VM7A 4TLKA 2Z9TA 3ME0A 4WI0A 2Y6SC 2ITFA 1P84K 5CP7A 1J8HB 4R9HA 1YYMH 4XPTH 1VACB 1RFDH 3WTVA 2V2WB 5I8EB 3MCKA 3RWHA 1T04B 2OK0L 4YBQC 4L3EE 1E2ZA 4HXBL 2WSPA 4O2FB 3SYCA 2IANE 3CFEA 4Z7NF 4KMTH 1A7OH 4IRJC 4U1GB 4X83A 3U0PB 2VLJE 2QQLH 5CP3A 5CGBA 4YK4C 3GTNA 1RMFH 3VSQA 3G7TA 2ZCLH 5IB5B 2L8AA 4JY4A 5T3XL 4Y4FD 4X5WB 2B1AH 5J12B 3BVUA 2RR3A 4LEXL 2NUPA 3HG5A 3BPNB 4OFKA 1JUFA 1W8EA 2C4FT 4WFGE 2D4DA 2MPAL 3EZ8A 3PV6A 5IVXB 1PFCA 2Y0SA 3VI4A 1U8HA 3K6OA 2VXQA 4H8QA 4MRBA 4HPYL 1K4DB 3E1ZA 2EIEA 4IBWA 2R2CA 4RDBA 3L17A 3WD5H 1BX2B 4L3EB 2QPDB 1R3JB 2E8ZA 3QDMD 3ARWA 5L2KD 4GAJL 2XQBL 4PBXA 3VA6A 4J4PA 1CF8H 1QUNB 1SEQH 3V5KB 5IBUB 5BS0B 4KQ3L 5LNDA 1QLFB 2CO1A 1FCCA 3QUKB 3R4RA 5E4EB 1A7NH 2XTLA 4DEWA 4HIIB 4QF1B 4QRQB 2OSLB 2F1EA 3BH9A 3QCUH 2R4RL 3S34L 3LD8C 1AXTH 3CZKA 3DX3A 4HGWB 3WYRA 1TETH 3UFIA 1ILUA 1QFWI 1LLAA 2VO5A 5GS1A 4I7ZC 1LMKA 2QQKL 5AAMC 1ES0A 2CUIA 2F8IA 1NCDH 4HX1B 4P04A 3VH8A 5C0AA 3D39B 5MERB 1HEZB 2Q9OA 5KBPA 1QBML 1LO4H 3L3JB 1L9SA 4OUOA 2EO7A 5GS2D 5BW7A 3HS0C 5DJAA 4RSVA 3IK2A 2AXWA 3L95A 3B3BA 3V52H 1BVZA 2OMVA 1F4HA 4QHLA 1F3JB 1RU9L 2NXYB 1TEGA 2VKWA 3W3BA 2AEWA 1B0GB 1CXEA 4UNVA 3B2DC 2FL5B 3FRPG 3PJLA 1QLRA 3CVBA 2G0LA 3VFNA 3WNMA 4NYLB 5GRUH 5C0FB 4F20A 2JJSC 4KMQA 4WK0B 4L4TE 2ZX7A 5J06A 2I9TA 2WJ7A 1L6ZA 4L9LA 1AXIB 3RHWF 3WY1A 1AKPA 3QWRA 1Z3RA 1QWNA 1TJHL 4GAFB 1HZLA 4GBXA 1SXNA 5ICXB 1GXEA 2LV4A 2BVQB 3X1BA 4PJ9B 1K8IB 4I87A 4MCYA 4ZAKD 1INDH 5D7KE 4UM9D 4LMQI 3TEXA 4A2EA 4WHTB 3PWUB 5F6IB 3CHRA 1NDGB 1O6TA 2Z92B 3TO4C 5BUGA 1LK2B 3MREA 3BGMA 4LHUG 3P0GB 2C1PB 4RWHA 4APQB 4BKLB 1YQVH 4BA8A 4U6XB 1IAIH 3UO1H 1HXMB 2QHLA 3VXRA 1QPPA 5GZOD 4Y5YB 4XNQA 1P7QD 4TNVF 2UVFA 2FECL 4XZ4A 2EACA 4LB8A 4X6CF 4FQ2H 2VE6B 2Z65C 2X88A 4Q9BA 4RA3A 1Z3GH 2ENPA 4NQTA 3V6BR 3UZQB 2IQAA 2ICWI 3TH3T 4EI5C 5GS0H 1E4KC 2BDNL 5DQDL 3O3BB 4PJIB 4ZUUB 5K9OA 4LVOB 3NH7H 5EN3A 2BSTB 2J4WH 1N67A 4FNQA 2ADFH 4K3EH 4UYQA 2N0MA 4HKXB 4XN4A 2IAMC 4PTTA 3Q2NA 4MJIA 1NCAL 3IFNL 2BP5M 2OSXA 2EIKB 1FL3B 2DZEA 1CLOH 5KG9A 2OZ4A 4GEIA 1FH5L 1FNSH 3O2VL 1IBHA 3BUPA 2EP6A 1Z9PA 4PRID 1EWHA 1KB5H 3MV7A 4LCWB 5ELIA 4FZ8L 1WE5A 5ESVA 3CZEA 2Y7QB 3N42F 2V8MA 2F68X 2Y7QA 4XPBH 3T2NL 5IOPB 4ORGB 3DTXB 5KSBB 1L7TL 3APNA 3IDJB 4M48L 4JS7A 2VDNB 4F9PA 2I7OA 3FCSA 3GBML 5L7XL 3WS3B 3O3AA 1TG8A 5CN2A 3K4ZA 1X5LA 5HHXH 4NO5A 3UGUA 2DM7A 4HBCH 3KAAA 4TPRL 3HI5L 3PHAA 5TF1H 3TWCH 4KRPB 1U3NA 4P5KA 1PEZA 1QRNE 2VLRB 1DLHA 1Q8MA 2EDJA 4JFYB 3BP5A 2C5DC 3ATFA 1W0VA 1MCSA 3AM8A 3RB7A 4H8WL 3ZDXF 2X4UA 1LE9A 4HLEA 4TQIA 4XO8A 1PZCA 3BAWA 1Z2KA 5HHOA 3D52A 3O8XA 4BJLA 1JPSH 1EDQA 1AVAA 3UAJD 5DMKB 3BSZA 1JPTH 1MPAL 2QSQA 1F3DJ 3EFOA 5IQ7L 2HRPH 4HJEA 1NCOA 2NYKA 4H88H 5D7LD 3CZNA 5HY9A 1H5BB 4EN3D 5T1LD 3FFDB 3EJCA 4Z0XA 4BH7A 1WFOA 4GW4B 1NEZB 5B38B 5KN5B 3QO1A 4Z5RA 5JXEA 2NX5D 2GAZB 1ZLWK 1E8ZA 4PJCB 2PYFA 5EU4B 5HYIA 4CVXB 25C8L 3GSRB 3PDDA 2XWJB 2TAAA 3HZMA 4PVNA 4Z7OF 3NZSA 4R3SB 4AIXA 4FQJL 5LWYH 4LSPL 3SCMA 1HEJC 2MJWA 4HS6B 1HHJB 1ITCA 3CHOA 1AZNA 4JM2C 3NEOA 2ATPB 5KSBF 1EA9C 3NOIA 4M93B 3K81A 3VXMB 4YDVB 1KENL 2AQQA 3FO2A 1O9ZA 2L3BA 4G80B 4APQD 2J2ZB 4EVNA 3EF7A 5E0FA 7PAZA 1HN1A 1UCBH 4LCWD 4DAGL 1UCBL 3RBGA 4WTXA 1OSYA 2KZKA 5L0QB 3VGAB 3T2OA 3VG0H 4BQ9A 3PWNB 1OD7A 1WIPA 2H0FA 1KGCE 2OLDA 4JRYB 2X1QA 3B9KA 3QIBA 3EO0B 4PHXA 1TR7A 4WNQB 5D7JD 3T2QA 9PCYA 4JRYA 3D85B 4M8QB 4U0QB 3WNOA 2UZXA 4KTEL 3N1QC 1XB6A 4M1DL 1CLVA 1T2QH 3N1PC 4OZHA 3QJUB 4MWFA 4A6YB 5EBLB 4UQ9A 3IJHA 2DQGL 2O6CA 1QG3A 4DPBX 2ZYIA 3JVFC 3SD5A 3RWCB 4XB3A 1A9EA 4Y2OB 1CGWA 1MFBL 3REWB 5EEVA 2FGZA 2V5SA 3US0A 5DMIH 3DXAD 3V0FA 4W9GC 3K3QA 3OAZH 2DB8A 2IH9A 2AK1H 1R3HB 3UP6A 3ARTA 2Z35B 1SHWA 5CP3H 4N0YH 1DQVA 3BWSA 2XZCH 4M6OH 1U8IA 2OZNA 4MD5A 4F8TA 4HOMA 1A6VH 1INEH 4R84A 1IL1B 3DHPA 3FQXA 3MBWA 3N04A 4YXLH 3VFWA 3OKKB 1JWUB 3RTQD 1BFVH 3FMGH 4YL9A 5GJSH 5AD0A 4JFPA 5D5MB 2B08A 4KNUA 1PCSA 3WG7B 5I8CB 4WTWA 3JTTB 1BZ7B 4FTVD 4FKKA 4ZPVB 3PAZA 4Y5VB 2QR0B 2WZ5A 4AQ1A 3HE7A 2YA2A 4J4PC 1AR2A 1BPLB 5DHYA 1G1CA 5F7UA 1G84A 1A9BB 2V7HB 1EZVY 2Z6FA 4Q8BA 5D70L 5KW9L 1IZKA 2A77H 2WQVA 4LLQA 1Q1JH 4FFWD 4WWKB 1T0OA 2XA3A 4NKDA 3T4YB 3MRIA 2JV6A 4NXSA 3SKJL 1XTLA 4WZ9A 5LGJA 2YO3A 5C9JA 1DJHA 3IU3B 3MGTB 2XPZA 3QFJB 4RMSA 4WJ5B 5GJTL 3VX1A 3TEUA 5IBTL 1Z66A 2VLKE 3SDYH 1CL7H 1MRDH 5HHOD 3WNNA 4BFNA 3OZLA 1XGQA 1U58B 4TQPA 5JPMC 1KJ3L 1T3FB 3QXDB 2JJVA 2PPDA 4HXAH 1BSIA 4Y2DB 4DKEH 1T3FA 3QXDA 3EJSA 2BC4A 1YDPB 3GRGA 4O02A 2VLJB 5DZNA 1RK7A 3FT1A 5D1XA 4HWZA 2KDYA 5A7EA 1NSNL 4OZFH 4ZMZA 3M46A 1BIIA 1F5WA 1XV8A 2L0DA 4ZMXA 4K3EL 1IQWL 4M1GH 5K1VA 2CCWA 4H8UA 2R7EA 4YDJB 4LLYA 4Y16B 3GS0A 2XRAH 1G7QB 4GQRA 2O5XL 3E9UA 4U2ZA 3ZHLA 3KYOB 4GUQA 4Z3IA 4QRPD 2O4EA 4X50A 3QUKA 4FQJH 4WGKA 4AJVA 4JMXA 1T7WA 4TVPL 1ORSA 1N59B 2BSED 4MBRA 3V4PH 4LFHG 4XN5A 5EOCJ 2WBXA 1JGUH 1SZNA 2OTWA 2C9QA 2VC2L 4UOJA 5IEKA 4K9EH 2ZWZA 1F8TH 3IJYA 1RIUL 3QIWA 3F7QA 4XAKD 2NZ9D 3CDYA 2Q0ZX 4DKTA 2DKMA 4A2FA 2YRZA 5FYJD 3F01A 2QZ5A 4L8SA 5DD1H 2UY7B 5T3ZH 1NANH 3AW5A 2Y23A 4K5LA 2DWEB 1DVTA 2LFEA 2WXMA 4GXFA 1MAJA 1FO0H 1KPRB 2GJZB 3NIDB 2NPLX 3VDCA 1M2VA 2Y07H 4TUOB 1AZZC 4HUKB 4NO3A 5AKSA 4AE1A 4O58L 3SE8H 1LEGB 4EI0A 3FT4A 2DQIH 1TZHA 3B56A 5F1SA 5HGGS 1U4EA 3U4BH 3LIZA 1O7DC 3C8KA 4EN3C 3I9GH 4UV7L 5FECA 4KXBA 1CE6A 4BFGA 4ZMTA 1FSKB 5DR5L 4QEGA 1FVDB 4QOKB 3SKOA 4KUCD 1DQJA 2AV1A 3DDGA 4A66A 1PZ5A 2P5WE 3HS8A 5IGXL 2ZWSA 2D0FA 5FGCB 2NW2B 3RVUD 2IADA 4HOWA 2D7QA 3KLHC 4MNQE 3EOTL 2AERT 5LNEA 2AHIA 2Y36L 12E8L 1ASQA 2VUYA 3PGCA 1DLFH 3CMGA 4N68A 4FFYA 4HIHB 4NDMB 3VA2C 1T66C 2GUOA 3VFMB 4YHOL 5AVRB 3RUGB 4HU8A 8FABA 2XA8L 4FQXC 4PD4K 5KYYB 4HJJL 2KL6A 2V7NA 2ZUUA 2RAMA 2KUTA 2OQJA 4HUUB 4OZIE 1RZFL 3SEPA 1GRWA 1J0KA 1ILSA 2F54B 2XPYA 2DJUA 4H8PA 4NT6A 4E0RA 5CR1A 5JO5A 4PRDB 1IGTB 3TCLA 1T4WA 4M5ZH 1F4XL 4M7LT 4G7VL 4AITA 1SY6A 4MA3B 5IWLA 3K91A 3ILQD 3JYBA 5B1AB 4L8DB 3T0WA 4LHQB 1RJLB 1V54B 4XCNB 2G30A 3DNKA 3KM1A 1G7JB 2X7LA 4ZQKB 2BPBA 3IAPA 5A6IA 3UTSB 3ARPA 3BQUA 4FNRA 3HE7D 4Q14A 2NR6A 1OSPH 1GZQB 5KSUB 5DZVA 5HHPA 1Q9WB 3CFTA 3OKLB 5IHUL 3OMIB 2WN3A 4NKMA 5D7IA 4DESA 4JQXC 5I1EL 1KBWA 4I88A 2EXYD 3P3YA 4MDIA 4F2ME 2NCEA 4PLOB 5HDWA 3K74B 5JIPA 3IETA 4NO2A 5I1EH 3QPKA 3K8MA 4LOVA 3K2MC 2W9EH 4JRYD 2CJUL 2PR9A 5EPMB 4JM0A 2DIAA 1L5GB 3QXAA 3JUYA 3NJGA 3DV6B 3SQBA 5I0ZA 5ABDE 1HHIA 4WFHE 4AC2A 1FIEA 4NZUH 2B59B 5DQJB 4ZW8A 5TE4L 5BQDA 1MCNA 1K5NB 2FHFA 1GSKA 1K72A 5DYOA 4YHKL 3B9VA 3MRPB 3MRDA 5DEFA 2XJKA 3GMLA 5I1AA 1X5MA 1D7DA 1FRGL 5DD5H 5INDA 3TJHC 2PP8A 4RVBA 3S35X 3VD4A 3TWYA 3HPLA 4HKBB 1LJMA 1KTDB 3CSYB 1FLRL 3IDYC 3I6GA 4OLXL 1DDHB 1GPOH 1AS6A 2J8UA 3KM2A 3CSPA 4XPFL 1RCYA 4QLWA 3L16A 4NIYE 2VXVL 5D2LF 1AXSB 1PNDA 5FF6B 2E46A 3UTQA 2J6EA 3DETC 1AOZA 4MXVE 2VXTH 5EWIH 4IMLA 2LT9A 4B9YA 4HHAA 5IMKB 2VDRH 1OLZA 3B9KD 1U92A 2HH0L 3TYFB 1CXFA 2QQQA 1OGTB 1S7UA 3U0WH 3N1FC 2Q1EA 4XOEA 4PTUB 3CC5A 2YN3A 1EFXB 3DX4A 4I0PA 1B0RB 3NIFE 2Z31A 2VJ8A 1PQZB 1AIFA 1SYVB 3WIHL 3FUMA 3OR7B 4GIAA 4LCCC 3GO1H 4RMQA 4Z7UB 3GMMA 5EUKA 1LEKA 2A6JB 3N3EA 1ZEAL 2R29A 2WNKA 1HHJA 3FS9A 4GSXA 4N9OB 5J7CC 5J1SC 2WLZA 3ECBA 2ZWLT 4N2KA 4PJEF 5JQHC 4H44C 1CXKA 1OP9A 1J1PL 4PRHE 1TQWA 1GSMA 3BKJH 5F1KC 1UM5L 4H1LA 3S97C 5D7KD 1AAJA 2GSGB 2XV3A 4XMXA 4AQAA 4U6TA 1W80A 4TQ8A 1PLGL 4D9LL 3LH9A 3P1VA 3HPJA 5KSVB 3TZVC 3B2PA 2MKWA 1OPOA 2Y6SD 2AAVA 2OTPA 3E3QE 4XNMA 2B2XH 1QSZA 2AFNA 2FT7A 2ZCLL 3BFOA 3CC1A 1R3IH 3GMNB 3L4UA 4NCC1 4YPGA 1QSFE 4LAJH 5LBSL 1KFGA 2NY6D 3GMRB 4QIRA 1R47A 1TTGA 3VXOB 3O3BA 5C6WH 4NZFA 1J0JA 3LXCA 4FEMA 4X7CC 3S48A 3V9CA 3HR5A 1MCBA 5BV7C 1OW0A 5DUPH 2CO2A 4ZOBA 3SGJC 3PWPB 2AGJH 4Z8FL 1W72A 2VC2H 2X2IA 1C7SA 4ATWA 4YJZL 3VXSA 3LQZA 1QRKA 3DRTA 3D06A 1IBDA 1SFHA 1MELA 1P9MA 4NRYB 4WHYG 2YD6A 3HG0A 1IEHA 3U46A 1T22A 1UXSA 3CVIL 3ULSB 2OMYA 3VSTA 2GBVA 1T22B 3FB7A 1FNFA 4YGAB 3QI9B 1BW8A 1GKOA 3DURA 5F3HA 3QZOA 1JHKL 4TVPD 2QVMA 4MS8C 2ITEA 3GLEA 3LKOB 3MRCB 3OC8A 1QP1A 1UACH 2EE0A 2X4OB 4UILL 2EVFA 4WJG3 3QQ3B 2WINB 4AWJC 2G2PA 4WV1A 5HHNB 3ZDYB 2VAJA 1Q9KA 1EMTH 5FYJL 2AQNA 1JTPA 2H0EA 4YSPA 9CGTA 5I17A 2KI6A 3QP3A 4NFBA 5E2WL 1WBZB 1G1KA 3EFDH 4I4WA 1FAKT 3CDFA 2G9HA 3POHA 2ERJB 5GJTH 5AW4B 4EQ2A 2ZZUT 4FYQA 5EEWA 1E65A 2BIQA 1BD2E 3QVAA 5T5NF 4Z95H 1XH3A 3PAYA 4B41A 2R4SH 4F2EA 4F57H 1BZEA 3DGCR 3L3OB 3PHSA 5INCB 3ULUH 2GB2A 2F58H 4FERA 4PWGA 4F15B 4RIRB 5IVZB 3MLUH 5MENA 5I0XA 4EDWL 5JYLA 5T3XH 3IJ7A 3TFKD 2E8YA 4J8QA 1PZUB 1J0IA 2D03L 3H3BC 3VI4E 3OF6A 2AJXL 4DN4L 3DUHA 1THCA 2AJXH 3QFDB 3P4MA 4DN4H 4HK0B 4YXKL 2AQPA 3NACH 1UH4A 1BFVL 3FMGL 4TNFA 1F4YL 4F1ZA 1BQLL 4TSCH 2NUPB 2V33A 5I6MA 2FEEL 1PDKB 5TE6L 3HN3A 2ZOWA 5G5DA 4FZEH 4UQIM 5JHLL 4L8BA 1KZYA 1XR8A 2G60L 2VLJA 3ARFC 4LQFL 2RMNA 2CDFB 1QEWA 5D71L 1E9QB 1DEEB 2IANA 1HHHA 3FB6B 2W65A 4L3EA 1S9VA 4G6JH 1Z9SA 3BYTA 3NCYS 5I18H 1KTLA 1F45A 4KK8D 2IQ9H 2FX7H 3LXUX 1BLNB 3RX7A 3MNWA 1T0MB 1XZ0B 1RZKC 3C60B 3NRPA 4ZOEA 3ZLQC 1PX8A 4TVSa 4OI7A 5CIPB 4BFIA 4BGLA 4FQXB 2NUTB 3CN3A 4J3OG 4NPKA 2E3VA 2YEZA 3MOQA 3R19A 3RVVD 4OCSH 1OWRM 1J0YA 2UZYA 4B7LA 2EEDA 3Q2LA 5JR1L 3GXMA 4P4RA 1GC1L 1BZQK 2DTML 3PXLA 4CN1A 1MFNA 1SOKA 2E6JA 4JG0L 1RUAH 1S7WB 3QDHA 3QUYA 1J1XH 2YXVA 1MCHA 4WK4B 1HTYA 2D7NA 4RGMB 3IJEA 4PV9B 2YSSB 3H3PL 5C0EA 1SLUA 4PJBF 5DUML 3P73A 4BCXA 4N20A 4OFQA 3SQOH 4PR5A 4RZCB 5IB2A 5L7XH 3I6LD 2QFRA 3IT8D 1U9KA 1N5AB 1VPOL 4LCYA 2AP2A 1QLRB 2PPAA 3WJJA 4F2MA 4NYLA 3B2UD 2NY7L 3ETSA 5DHMC 2DLFL 1AI1L 2AF2A 4NN6B 3GC3A 5J6SA 4JHUA 15C8L 5KYXA 1VKXB 3G04A 3UJIH 1JPGA 4PAZA 4WKZB 1VF5C 4XBPB 3FXIC 5GGQL 2WYTA 2CJUH 2D31B 2N56A 1XF5A 1P53A 2JELH 2B15A 3O3EA 4Y4HD 3UJJL 1UVQB 1MEXL 2H32A 8FABB 4JGJA 4GRWE 2XIBA 5DLML 4NDMA 1IVLA 4F92B 4JG5A 4N0CC 3EYUH 5BQ7B 5GSRA 2JCCA 4J3OC 3VI4F 5LXVA 2JTDA 3QIBD 3JTTA 2IDTA 4NUJB 4X5PA 5JUEL 3LIZH 5IB4B 3CXDH 5I1CH 5JZ7D 4XH2A 4ZPVA 3CXDL 3QNYA 5DK0A 4O4YL 4QHKJ 4WUUE 1B0IA 2EZ0C 3RDTA 1AYRA 1M42A 3L6FB 4IMKA 3LZFH 3T9WA 2OR7A 2IDQA 4FTVE 4P2QA 3L3HB 3CPLA 1KPVA 1JGIA 2ZNXA 4MDRA 4HULB 4GW1A 2HPTA 2C9RA 3TBYA 5F9WC 4D8PA 4LF3B 5EZIH 2HVBA 1OP3H 1Y7VA 1FJ1A 2CLVA 1FORH 1Y18A 2JI1A 3NZUA 2WBJA 5H35B 1HJCA 1KELH 4Y4FA 5GRVL 3MV7B 4GQZA 3FOLB 3QZWA 3MTRA 5E2UL 4O00A 2V9QA 2AXGB 5KVDL 3WBDA 1X9QA 4LLWA 4OCNC 5GRUL 1IGJB 4K9EC 4PLKC 1OKEA 1WZLA 4L48A 2X6MA 5JPNC 3SIKA 2WXFA 1HQ4B 1XMWA 1DFXA 2ZOUA 4UDUA 1L6PA 3HJEA 5IMOA 2F54E 4JG9A 1MJJB 3LPPA 4JFOA 3QXAB 5HDRA 1BBDL 1S4IA 5FCSH 3FB8B 3X13A 1A1NA 5LAXA 4HZLB 3QC6X 3VSVA 1NLDH 5E5UB 3PWPE 2PABA 1L9QA 1A5FL 3Q7JA 2Y7NA 3WJMA 3ETBJ 3MLTA 4X98B 1VSCA 1SJVA 5G55A 4RNRB 5TTRA 2VN3A 3SODB 5C2BL 1ZT7B 2V2XA 2VLRA 3BKML 4XNYH 1OANA 4A2GA 3TBVB 3UYRH 2CO6B 5D7JC 2WMPB 1JZ2A 3A4EA 4AEIL 5C09D 4AVKA 1LO0L 4YHPB 2BWQA 1P7KA 2JELL 1KLGA 2MNWA 5SX5K 2BSRB 3F85A 5CSZA 1BF5A 1MDAA 2FDBP 4BSWB 3X17A 2I9LB 4KZDH 2DQMA 2VGLM 1JF5A 4MA8H 5AL0A 4HMDA 3BAIA 4RISH 3EKCA 4EUPG 1M1XA 1ZVSB 4W9FC 4A63A 5K39B 3Q6GL 2GK0A 2VSCA 5DRZA 4U7SA 4N0FB 1M6OA 5KN5A 3QEUA 4N22A 2DS4A 3HIZA 1TQBC 1B0RA 3TGXA 3FUHA 4X6BB 5D1XE 2PCPA 2ICES 5D7SH 5L8JB 1JZHA 3HNSL 3VXQA 2YJQA 4U1SA 4DKFH 4DVBA 1NM9A 4D9RE 3C5SB 4YSCA 3WY4A 4B50A 1FL3A 2BSDA 2PPFA 3GBNL 1JERA 3TYGH 3P2TA 4NC2B 5IREA 3GJEA 3LS5H 3P3RA 4ZTOH 1FFPB 4AVHA 3U1SH 5DGQA 2LVCA 5EU6E 3SOBL 1JTTA 5JNYB 2YPLA 3FN0H 4KV5F 4IRJA 2EDEA 3IN0A 3LXAA 4MNQD 3WS6C 3ZHFA 2J88L 4KKLC 3LH2L 3FTYA 1YEWA 2DICA 4X80L 1GC1C 2JJUA 2YMOA 1XGYL 3ZE2B 2HSIA 4ADJA 5BNXD 2G5BB 4YPGB 1AO7E 2E76C 3QQ9D 1CL7L 3U83A 1JMXA 1ZHBA 3BP7B 1MCWM 4EUPH 3MLXH 2YS4A 3VQMA 4YFDB 3E8UH 3LKNA 4HF5H 5D9SB 1NCJA 2TRHA 3AQZA 2QT6A 1J88A 3CDCA 3CV5A 3H0TA 2HLFD 3VXUA 3GHBL 4IIZA 2IH1A 3MGOA 2VH5H 4AJ0A 1WAAE 2D2OA 35C8H 2ZOLA 2VM4A 3BP5B 5IJKC 4MQXD 1NGPH 4UTBL 4POZC 1SEBB 3EO1B 4FFYL 3MLYL 4AM0Q 4P9HC 1OEZW 3MOBH 4P8QA 4ZFOB 5JIKA 5D2LA 3VFGL 3OKDA 4HGMA 5EZOH 4CVZB 4OCYH 3L4WA 3QXWA 4QXUH 1Q0XH 5E8DL 4PBDA 3QJHA 4K9EL 4PUBL 1MFAH 2NXZD 2WWOA 4BSVB 5JW3H 1YO4A 3KPNA 1TMQA 3SDDD 3WHE0 2BIHA 3OWEA 4Z95L 5GGVL 4IU3B 4BKSC 1T5WA 2YMXL 4Y5XA 4DVRH 3PP4L 3NIGB 4GAGH 4N2LA 4NQEE 3TLRA 1IJNA 5E8DH 4WV1B 2R69L 1J5HA 1WS7A 2VXTL 1C5DB 5JPNA 3ZTNL 1CVRA 1IEAA 1XXDC 3A47A 3K7UA 4M43H 1LWRA 3WUWB 4C58B 3TESA 5DJ2A 5T1KA 4ETYA 3EJYD 3SPCA 2ETWA 4ONFL 3MJ8B 1I7TA 4WW1A 4TF4A 5HVHB 1FLRH 2NY3D 3VD5A 2LTQC 4Z3EA 3BT2H 1A65A 4MJJA 3P11L 4WUUD 4Y1AE 5H37H 3CSBA 2ZG1A 4JM2B 2OMXB 4DZBA 2E27H 4ACTA 3QC5X 1FL5A 2BCMA 4S2SB 3ZKNC 3T1FA 5C0CD 1CGYA 2XG4A 1SHXA 4P2RE 2Y4SA 1AXSA 4IU2B 1NC4A 1NFIA 3VVVA 4LKXB 1B4RA 1CYWA 3LNIA 4K3DL 2OAAA 4B97A 4N2HA 2J20A 4IMLB 3SGEH 4IHOA 1NPUA 1DBBL 2G2RA 4HCRA 1F1GA 1TIUA 3THMH 3V4VA 3P77A 3PV6B 4FFZA 2EVJA 1JYVA 1JDCA 1A4AA 2FIKB 1NIFA 1NGYA 2MNUA 3VI3B 5GZOA 2P48B 1URZA 3WUZA 2DEWX 3VQ1C 2P7TB 4PJXB 5I1JL 1TNMA 2YWZA 3MRMA 1R24B 1ETJA 2FNWA 2V4LA 3U0TA 4BDVA 4DGYH 1WISA 2DN7A 1TVHA 4H20L 4X5LA 2I5YL 5TFSH 5EBWA 4E9VA 3RGVB 4L0YA 3ZYZA 2F54D 3DYMA 2DF3A 1I1FA 1M7DB 1V7NH 5CWSA 4FXKB 1OAZH 2CHXA 3ECBB 1BAFL 2Z8RA 5FHAL 5BVPL 4LDLB 3CQQA 4PY7A 4AEHL 1SUJA 3UTPD 4OB5L 5I6XC 4Q0XH 4ANXA 3P0YH 4IRJD 1G7HB 2HUEA 4ZX4A 5IHLB 2FUQA 4L8SB 1SOQA 5CHNB 4NWUH 3RYMA 1TXKA 4YC2B 3WLWD 1DP0A 5F1OB 3B9KB 1S7WA 4DQOH 3A67L 1W8OA 2KMWA 4Q9QH 3OKKA 4DERA 4GS7C 4LBEA 3PABB 1U8MA 5HYQA 3L95B 3SSGA 5DHXB 3V4VH 5LLIC 3WE6B 3D4CA 2NY0D 3SJVA 2GKIA 4GIOA 2IOMA 3F7RA 3BKYL 1T4KA 4IGBC 1A4CA 1Q72L 3D3VB 3MKGA 4A6YA 4BUHA 2QLVB 3HFML 4JY6A 4NPYA 5DJYA 2VDLL 4M61A 4NZTL 1A25A 3RQ3A 1K6QH 3EUDA 1B4TA 1MREL 2VR9A 3O2WL 1RP9A 1KT2A 3PUCA 1ZHKA 4KU1A 1JXFA 1D5MB 2ZCHH 1URIA 4YDIL 1EPFA 4DP4X 3U6RB 3OLEA 1INQB 1AQMA 4NJ9H 4WKZA 1FBIH 3TNMB 3MXVH 1K2DA 1E7VA 1FBIL 1GGIL 7TAAA 1QEXA 4ODTH 5C08D 3RIFF 3TNMA 4AQ8C 3G5XB 4F93B 3WDJA 4MQXC 1Q1PA 4GQPH 3MJ7B 2MEJB 4APQA 5LCVA 1YEEL 4HS8L 1V7ML 1NANI 1FF5A 5C0CE 2D9QB 3U4BL 5I6LA 1ZPUA 3NAAL 4D7BA 3HEIB 3IGAA 1HZHL 5JHMA 1U8HB 3BT2L 3SDXB 4WY7L 5FDYA 1KY6A 1F4XH 1FGNL 3B9EA 3FT2A 1RUPL 5D7JA 5L9DH 5LWYL 2DMKA 4GI6A 5D7JB 4XPAH 4I18C 4QRPB 3AU1A 2XTJD 2XWTB 3NPSB 3HE7B 4HFWB 4LSSH 4Y88A 3VFVA 5IFHL 4LLDA 4WDIA 1CJYA 4ELMB 3L3HA 4PJ7B 2YXFA 2KH2B 2ADFL 3LDBB 4ELMA 3W38A 4GG6A 2W91A 2ENSA 4P46B 4F1SA 1QVOA 1BXUA 3BEVA 3MRFA 3WDIA 3U48A 1GY2A 3RHWK 3TF4A 4U1JA 3BQUB 4WJ5A 3EJYC 4JAMA 1ZGLP 4A7QA 3B5TA 4HDIB 4KGLA 3QUHA 5ESQB 4I77L 5D2NB 2HWZL 3VJ6B 1JVLA 4HISA 2XTJB 2QGEA 4I13B 2VERA 5K1JA 3EGSA 3AACA 1CT8B 2MNJB 5DJCA 3U2JA 2GJZA 2ZUQC 5DVMA 1DCLA 1TKWB 2D03H 5KSBE 2UWEF 2HVKA 4GMSH 4AL8H 2XX1A 5IIEB 3DA0A 1BEXA 3MV8B 4MHHG 5IMOB 3QYMA 1IILE 1OCZB 5K33A 2O93L 1CD9B 2A0LD 2FLBT 2W9DH 4JREC 1I7ZA 4MNGA 3T4AA 2MCG1 2FUTA 1KNOB 2YD0A 32C2A 4RFEA 5HHXL 3KYKL 2VMEA 1MHHB 1WIOA 3FU6A 2WUCL 5T5FL 1YYCA 4Z7VE 4YDKH 4TLTA 2QGBA 1NAMA 2VL5B 3TV3L 3KLLA 3UTOA 1NAMB 2NY7H 4HKJA 5C97A 1H8OA 1HEHC 5CEZE 2AJUH 3H9SD 4JKKA 4PJ8D 4D0CA 1DN0A 1MCDA 1UOLA 5CO1A 4F37K 1NPJA 3AREC 1M7IA 5HTSA 2BNRE 1S8DA 2BY3A 3SBWA 4JKMA 3U4KA 4PRAB 4BHUI 5AW7B 2IGTA 2EE2A 2C9AA 1UB6A 2R1XA 4XNQB 4G7QB 1XIWC 2WIIA 2IOIA 1AHWA 3EGXA 5DZ9A 1BVNT 3MJ6A 1J0ZA 5CLZA 3QIWC 2V3FA 4K3JL 3BVTA 5GISH 1J48A 4Y2NA 2OS7A 2A1WL 2I69A 4JRXA 1N5AA 3H42L 2ARWA 4E9QA 3RE0A 2YLHA 4QAWA 3I6LE 3R1GH 3ZT7A 1R19A 3I9IA 4BXVA 4Q6KA 4JFQB 4EBQL 4V1DB 4OGYL 4O02L 5GXBB 3FO1B 1A7NL 1NOAA 4P59H 1FE8L 3UBFA 3IAGC 2OL3B 4P2AA 4LVHC 5GGRB 4S1QH 2C1OB 2VM3A 2JI3A 4XBPA 3WN6A 5I16A 3ARGD 1NBYA 1U3ZA 3E6FA 1QFWH 1P5UB 4C56A 1XCWA 4L29B 1KIUB 4HCGA 3FO2B 3MREB 4PS4L 5SV4A 4FYSA 4Z7OB 2VDOH 4ZUSB 3ABLB 1QFWM 3K1KC 5FAAA 2EE6A 2W1NA 5HD8C 3T0AA 3CSFA 1WZMA 5MP6H 3JXAA 1VA9A 2WP3O 2BW4A 5FUOL 3EO0A 4OD1L 1U41A 2FBOJ 4WNQA 5HVHC 2EYTA 3JZYA 5EA0H 4ZZFA 3T5WA 1JNNL 3ESMA 1O7VA 5E9DA 5AW8B 1XF2B 3SO3B 5CKGA 3RDTB 2RFXB 4YVNA 5BRPA 4JPIA 4PREB 2VXSH 3KXFA 1C1EL 1S7QB 4FG2A 5KTEH 1T03L 1FYTE 1XGYH 4J6RH 1ML0A 4KDVA 4Y16C 3X1GA 2UYLB 3UTSD 2GITB 3MCLH 3WFCL 3ZHDA 5KBLA 4ZAKC 1G7JA 4B60A 4N8PA 5KTEL 2OMWB 3LYRA 2X40A 1UM6L 4GKZB 2KPWA 5KVEH 2VDRL 4MX7B 3KLAB 4PG9B 2WB1A 4HWBA 5FUZL 2YK1L 2H45A 1LE9B 1LO4L 5DCCA 5D72H 1LNUA 5CUSH 4MMYA 4OLWL 4CSZA 5GZOC 1A6WH 2CLZB 5EULV 4AZ8B 2K3TA 3SPGA 3UYPB 4XWOD 2NY5C 1R3LB 4YK4B 1BBJA 4MHHI 3DGDA 3L48A 3I9AA 3L7FA 2UV3A 4KZCA 4YL4A 5JA8B 3FQXB 3GRWA 4WIQA 2BSEA 2X4NB 3AY2A 1L9RA 3GS4A 3OX8B 4G6KH 3EYOB 1U8CA 2DYPA 2I27N 1V3JA 2AJYH 4I4WB 3RVVC 3SGKA 4CL7A 1CN4A 4M8RA 4A67A 3OPZL 3BAJA 4LU5H 3BC9A 2VR5A 3OZ9H 3PL6B 3MLZH 4G8IA 3MYJA 4PJHB 2A4CA 3OHMB 4HPYH 4Y8AA 3QYCA 4Z3JA 5KOVC 2P80A 1TDQA 1NUGA 4WO4A 3BUBA 3KR3H 1SQMA 3Q01A 2PETA 3ZUNC 2XT1B 4ZG1A 2VDQL 1O5PA 2H9GB 2N1KA 2JF1A 2BOCB 1RK0A 1BQLH 4TSCL 1NC4B 1NFIB 2XQYK 4I48A 3DROB 4G72B 5T33H 2JIXA 2KKQA 4LGRB 4EI6B 1HNYA 5B3NA 5JXAL 1A66A 1MI5B 1QI5A 3QCVL 4HIXL 4MFHA 4Y0GA 2Y2TA 3QUMB 5FA4B 5C0IA 4UMSA 2ENJA 5IUCA 2NDFA 1QBAA 3BLPX 4M4PA 4E9LA 5EUOE 4WWID 4ODUB 1LO2L 4RAUB 5FYKH 1F3DH 1UG9A 2QMKA 5JHAA 5B1JC 5HVWA 3ULVH 4JKNA 4KTEH 4NQDA 5FUCE 4LLYB 3LY6A 2WLJA 1EFQA 1ZTXL 1U8OA 2E7CA 4KVNL 3E8UL 2VZ1A 5IMMA 2A6JA 4PYGA 4UQAA 4FHJA 5IJKA 4XXWA 4ZRGA 4BZ2A 3ZL1A 2DWTA 2ZCZA 4S1RH 5D4IA 1YNLL 4OUUB 2FQEA 1ZMYA 5I66A 4H8WH 2BJML 4OFYA 4H1LB 1MY5A 4PRIE 4D0DB 1QLEL 1M05A 1AR1D 3ARUA 4ZXBA 1KCLA 1NCBL 4F7KA 1KMGA 2MCAA 1SOSA 4C83A 3FFCE 2H8PA 2XHNA 3WNPA 4HX1A 1SJHB 2UY7A 4B9IA 1GYVA 3U9PH 3HI5H 3C2SA 3Q1SL 5TF1L 3UMNA 5E6ID 1A6UH 3PHOB 1U95A 3MLWH 2WXIA 4U4BA 3WI9A 4ZX5A 4XPFH 3TJEL 1EAJA 3ZZ1A 3QJSB 2QTEA 3WO3B 4LSUH 2AQRA 1T6WA 4KY1L 4XWGL 3WNIA 4Z7VF 4TNVK 3KWVA 3QUZC 4DOHB 3CDZB 2ERJC 1G7PB 1KCSH 5J3HD 3H1ZA 4KXDA 2XTJC 3NDZE 1W2KT 3G6AA 5C0JB 4U49A 1GJUA 1E3FA 5F9AC 1K3IA 1OARH 2BXZA 3BZDA 3BMVA 3OMZA 3SDCD 2NNXA 3Q2WA 4JFFA 5I71C 4F7PB 3TH4T 3VDBA 5HGDB 2Y5QA 4JO1H 5L9DL 4NBXB 2DJ4A 3GMQA 2B3RA 5LVEA 5E6SB 3I9PA 1JF6A 3AQXA 4K7PH 2IPKA 5MI0C 3G6DL 3BGMB 4K7PY 5J12C 4H0GA 4B0MB 5G5DB 2W07A 3QUYD 4UIMA 1U3HC 2C9PA 2BCKA 3EJJX 2GJ6D 3VFWB 5J8OA 1UEYA 2P4AB 4FQQA 2F5BL 4M7LL 2FJFB 2YWYA 2WXLA 5E8PB 2A74C 1DQLL 4Y7OC 4GG6F 1IVTA 4NQED 4XWOC 4K4KA 1CBVL 3QR1A 1FNEA 2AKRA 2GT9B 5I1DB 4HFWA 3PWJB 4I77H 5CMAA 4QYAA 4LU5L 1TZAA 1JGLH 1FC1A 5EUOF 1EJOL 4ZFQA 2CQVA 3KWUA 4CGTA 2GEQA 3SPVA 4ZSOE 2E5EA 3EJQA 4LPCA 4MCMA 5DJDB 2YZ8A 3DUSA 5FYLL 3CPUA 1WP6A 2DW5A 3OWRA 4FZ8H 5CILL 2CK0L 2DQFA 1QVOB 2C3VB 5FYJU 1A3LL 2WQ8A 3U0PA 3CZUB 3LHAA 3L3IA 3JWDL 4LVHB 1AS8A 3U79A 1XGQB 1CF8L 2RALA 3ARED 1QTYT 5H94A 4OD2A 3SDYL 2YKLL 1CQKA 4DPRA 1IC7L 2H32H 3H6AA 4JQIH 3QNXB 4DGUA 1JI2A 2YK1H 3GTVA 5AAPA 5EC1B 2FBJH 2UWEA 1OP5H 3DSFH 4WI4A 5EC1A 4NM4H 1V3MA 1HHHB 2OJZH 1PKQE 1EX0A 4HZAA 3WFCH 3DVGB 4QRPE 3ZVVA 4QRBA 4KTYA 1R9FA 1H8SA 1OAKL 2DQTH 5TDPA 1JNHB 1BAFH 3MC0A 4WFED 2Z0UA 4P3WA 1FV1A 2F19L 3WN5A 4GNKB 3H8NA 1NC2A 1KPUA 2A38A 3SBRA 2CBOA 1F4YH 3KYNA 4HQQL 4N0UA 4XBMA 3I02A 4X4ME 2VJ0A 5IBLC 1K5NA 1ORSB 4CMMB 3NGBB 1YEKL 4KRNA 4N0UB 5KVMC 1B3JA 4ETQA 2WNWA 1ZT7A 3F12A 3ESPA 2BVQA 1H3VA 4FA6A 1ZHLA 4HEPA 3O2WH 3DX1A 4P4RB 4PJCE 5FYJE 3T65A 3SQRA 2R23A 5E1HB 2P8MB 4IJ3C 5DRWA 5D2NE 1KBKA 1M57B 5CD3A 1JDAA 3S4SB 3T0XA 4CADB 5EUOA 5ITFB 3VTMA 4CN4A 1ETA1 3K1DA 5J13B 2NX5B 3DMMC 3AAZB 1TLKA 3T3PE 2J72A 5B3JF 4LAQH 4XVJL 1G9NH 1SGKA 1TJHH 4WSJA 1AY1H 1EO8H 2QDVA 3EJZC 3ISYA 2ENQA 2IALB 2I24N 1YEHH 4GRLA 3OPZH 4PJ7E 2IPTH 3OBAA 1UATA 2FWUA 2H7WA 4N8VA 1AE6H 4OY9A 3WMQA 2X9WA 1WPCA 3PGFL 5J9PA 3S8GB 3A6BH 1D6EB 1TZHB 3MV11 4W1TA 5LB1A 4UTBA 1DJYA 4PJIA 4ZUUA 4R96A 3EJPA 1CLYL 1MHEB 4JO2H 4U1HB 3GJFB 2ZWNA 1RZ8A 4ODWB 1CK0L 3QRFM 5AW5B 5B1KA 5BV7H 3KBPA 1B3IA 3UOAB 3KMDA 4ICXA 4Q9CA 3FO1A 2FEEI 3FQRA 4AEHH 1Z7JA 4GRWB 3PP3H 1A22B 1ROCA 2EDOA 4FGMA 4I5BB 5AW2B 3D8MA 4JRXD 5EUKB 5DUMH 3OHXA 4M43L 2HB0A 3T3PB 2QADC 2W92A 3IKKA 2Y25A 3BQVA 3CH1A 1W72H 5SWZE 4OM1H 3P3TA 3PAVA 5TF0A 5T3ZD 1OAXH 4G42B 1G9MH 2Q7YA 2JMRA 2XN9A 1KXTA 3NSJA 3F05A 4RFNC 4URTB 3RWGB 1I8LC 4FLOA 4OFVA 1JZ6A 1MQKH 3LCYA 4LLWB 4DVRL 1F58H 1S7VB 3RDJA 5D7IB 2CRZA 5FM5O 4QTFA 4R4NC 1L9PA 1SXBA 4KNQA 5TGBB 3WY2A 4XHJC 1WUZA 1HT6A 4JFWA 4LCCA 4CW1A 2FD6H 2XQBH 4KRMB 3VFOB 3I3BA 4M8QA 5LBSH 1L5GA 3UPCA 3VFRA 3CX5J 3QUYC 3WMPA 1W15A 2ADIA 3TYGL 3LKPA 3Q9QA 5IKCA 1R4XA 4JL2A 3QR0A 3ZBMA 1YMHB 1KN4H 1U33A 1ADQL 3TIDA 1I1AA 4RGNC 4JRFA 3V7AG 3ESOA 4QRQA 3P4NA 3FTVA 2Q2EB 2WXKA 5I1AB 1FGVL 3NSFA 4OZ4B 3SGEI 3U6XA 3TEYA 3AWEA 2GITA 1RIVH 3FT3B 4P5TC 3QPXL 1U2CA 1BOGA 4AK2A 4F80A 1I9IH 5JORA 4YBHA 2B4CL 1JHTA 2O6DA 4FXGC 5DK2A 3RWDB 3RWEA 3V4LA 5J11B 1IIKA 3OKDB 5ANMA 2M2DA 2HRGA 5EV7A 4GY4A 4P23C 4NBZB 5IR1A 1L9NA 1TNNA 1TVDA 3Q6FB 1MXDA 1I9JL 2R1YA 1HKFA 5K39A 4GG8A 3CDGB 4AI7A 3MUUA 2FZ3B 2WB7A 1QUPA 2IWGA 3F8UB 3RY4A 4JHBA 4P2QD 2XN0A 5D55A 2FT8A 5FV2A 4OU3A 4JMNA 5I1IL 2WTRB 4C56E 3GIVB 2DD8H 4ZXBC 4G7VH 2G9HB 4K3JH 4XN7A 2WTRA 5MHSE 3EYOA 4WFFD 4LSSL 3QI9D 1H3XA 3MLRH 4FQ1H 5DS2A 3MLTB 4E9YA 2OXGA 1T20B 1NA8A 2D73A 3F6JA 3N5AA 3O9WD 4ABUA 3UP1A 4Q4IA 4YWGL 1QNIA 1BQ5A 4HW6A 3HZYA 2BMKB 5FA3B 4JRXE 2IFFH 5HYSB 2PYEA 5D7IF 1CDYA 1OCRB 1UEMA 3IPFA 5A40E 3VGAC 3WNJA 5AWNH 2CR6A 1IM9A 1JRHL 4MXWH 4KHTH 3P0VL 3RU8H 1U58A 1EO8L 4WI8A 3KG5A 1Y07A 1XD0A 5JHDA 5AENA 4U6HA 3AVEA 2PWHA 3VW3L 1E7UA 4G83A 1TZIB 1OPGH 1DZ0A 1I4FA 1M6OB 4RZKA 3S3BB 3MRRB 3UC2A 1XBRA 1TQCB 3CNKA 1FN4B 4R4BB 1FNGB 3BPCA 3DV4B 1GS6X 2CBPA 4LEBA 3BKMH 4CKQA 3VRLE 3N40F 1WICA 4LFHD 4NP9A 1PX4A 3U2SA 1HCFX 1OTUC 2VM9A 1IV8A 2DPKA 4MSWB 5C0NC 2XBTA 4N2CA 3CHQA 3GMMB 3MZGB 3SHSA 1DQDH 4KFMA 4OF3A 5I0YA 1ONQB 1FZJB 1VCBC 2HTLD 4D7PA 1OAUH 1ZTMA 2V6HA 3EH5B 2GBUA 1FSKC 4ICWA 2H26B 3UBGA 1WFJA 3GD1C 4G80A 4DQOL 4Z0BL 5I1HH 2GSGA 5I66B 3QA3B 4HCRL 4M29A 2FWLB 2XUWA 3GSVA 2YPVH 1G4MA 2CKNA 2B8OT 4TSAL 3DTXA 5C0AB 5KSBA 5J6HB 2VAAA 4Y9GA 3TF7C 1EZUA 2H1LM 5DEGA 5FIEA 3VRJB 3LX9A 3WKPA 4YFLF 2BVEA 1A21A 1U8JA 2GJPA 3D39E 3S96B 3GSNB 4RZCA 4H5SB 3D0LB 1CWVA 4FFZH 2DIJA 4O02H 4Q2ZA 2A73B 1ET7A 4WFHD 3LZLA 1WAAF 3VXUB 4WY7H 3FUDA 1DJWA 1OAYL 2FL5A 2BM3A 2WQUA 5D7LA 2OCCB 1YECH 1EK3A 1KBGL 4HGKC 1MI5E 1HESA 3MCKB 4HWNA 3RWHB 2E6QA 2LTQB 5F93C 1C12A 5FS5A 3OKEB 3WUWG 5I9QC 4JPWL 3PUUA 4OAWA 5I1GL 1FA4A 4HIPA 1NEUA 1NH6A 5F8RC 2X87A 4KJQC 1D2PA 1NIBA 4F7MA 2XVLA 1JRHH 3MRCA 3IGFA 4MXWL 4ALAC 4JY4B 5DD3H 4QKTA 2W88A 3ILPB 3APDA 5D4HA 4ODBD 1HCYA 3NA9H 1YDPA 2D4FA 1MJUH 1CICD 3EBAA 4GIPD 3DYPA 5B38A 4HJGA 1M7UA 1QEWB 4XT1C 4YHNA 3TBWA 4TLSA 1GL4B 1A14L 3ZRFC 1K8DA 5BZDA 3BKYH 5A16A 3NVQA 4D8OA 4IRZH 4QRRA 1U21A 5LBVA 3BN9D 4QJ3B 1NKOA 4HC1A 2FLRT 3QHZL 2HKFL 5D6CA 4RAVA 2V5MA 5A2IH 4HS6A 2VTFA 1H3WM 3HG2A 2PCYA 1QPXA 1BQUA 3QNFA 3RGVC 3UZEC 1MH5A 5I6OA 4DW2L 3HNVL 1SMOA 2RB8A 3DTDA 3ES6A 2IH3B 1AGDB 1QPKA 1UB5B 4N1HB 2IH3A 3CVHL 5FHBH 3SYQA 3EHBD 4Z0BH 1VGEH 2WD0A 3ZE1F 4HG4K 2BSBA 5GS3A 4OT1L 5F7FA 4NS0A 1YLBB 4WVRA 2BLFA 3KYMA 2A6KA 4MZIA 1VLXA 1CGSL 4FCAA 5DSCA 2A6KB 1T21B 2FB4L 3M1BA 1CDJA 4G9FA 2B4CC 2YJLA 3EXLA 2EYSB 1ZA6B 4X99B 1HILA 1ETZB 3MO1A 4UU9A 2F15A 3MRLA 1WTLA 5IJDC 3ARSA 5GGSB 4KKNA 2UWEB 2QADB 1K4DA 4PJBA 4C47A 4UAOC 3PLYA 1NGWB 4PLJD 1XGZA 5FKAB 1WLHA 3WKNA 3AREA 2VOTA 5I73C 3QIUD 4YSAA 3DIFB 5KANI 4B9CA 3K71B 3P9MA 3GT6A 4U1IB 4AIOA 1A1MA 2X3AA 2Y2WA 5CWSB 4EO5A 1G0DA 2AV1B 2EIBA 3QG6B 4AKPA 2NW3A 4M56A 2APBA 3PWLB 3ZIYA 3EIFA 1OTUD 1PEWA 4TTDD 1OAQL 3CXHJ 2X0UA 4OQTH 2XN9E 4XP5H 4MMZC 5LAPA 5IOKA 5I8KL 5ISZB 3CQFA 4P9ML 1X4XA 3QUYB 3FOMB 2B77A 3CHXA 2QTVA 4I85A 2TSAA 2N1TE 5CR8A 1EANA 2LW3A 5C71A 3GXDA 1LO5A 1R6VA 4YAQB 3QISA 4GUPA 3QXVA 4URKA 5HDBE 3E7JA 1CLZH 3I75B 4PJIE 2E9WA 3PXJA 2ZKWA 1S6NA 4NP4H 2K9UA 5DVPA 2CGRH 4ZO6A 4XODA 1IGTA 2X2UA 3TCLB 3IXTA 1F97A 1HSBA 3NPSC 2AABL 4QO1B 3WELA 1RZ7H 4XO9A 2CUMA 1XAUA 2WK2A 5DT1L 1VACA 1JN6B 1QFUL 2BINA 2Z1KA 3HCVB 1ZT4B 2WC7A 1INQA 2JKWA 5GGRA 1AGFA 3BQUD 3MPCA 2X7LB 4KPHL 2Y24A 1KGYE 4LL9A 2ED6A 3D0VB 4ZQKA 5FYLE 4MCYB 4U6VL 2ZUYA 3RWFB 4HUWA 4KI5C 1PL3A 4W81A 1N0XL 3RPBA 4OLEA 2EDXA 4HJ0D 2DJSA 3ZRCC 1EZVX 4IDLA 3R7QA 5JYMA 4Y19E 1HL8A 1H6UA 1KIRB 2P24A 4NRZB 1ZHNB 1CDCA 4YWGH 5AYUH 5HPOA 1YY9C 4AYMC 1CMOA 4U6XA 2W95A 1U0QA 3H4HA 1V3LA 5T1DH 4QNPE 4FJZA 1X7TA 5KSVA 2E47A 5B39A 3N40P 4RMWA 4K7PX 4XNMB 1OAZL 2XWCA 1TYJA 3TN0D 1SMDA 3GKWL 5KOMC 2R0ZH 2MQGA 3LKSA 1BX2A 3GYRA 3O3AB 1T66D 3B43A 5KBKA 3B4NA 1ZJAA 3S3DB 3LEVL 4AGLA 1IGMH 2R1WA 2UWEE 4YBQD 1ACYL 3EYVA 1ETB1 5I5MA 3BP6B 4RFOL 1YEGL 3IAQA 2OTUB 4B6ZA 3HKFA 3MRFB 1NBCA 3T0EA 3PG2A 1P7KB 2DQUL 4Y4HC 3W2DH 3L9RB 4PLNC 1U8QB 1EAQA 3SPHA 4Y2OA 3F2LA 3TA3B 3WU1A 4L37A 1HK6A 4ZFOA 2XY2A 1JNNH 1E4XL 2EDMA 3DURB 1TJIL 5F3HB 1MFEH 4NQVB 3SYAA 1AS7A 2N0KA 4ZSOA 1HCZA 4JFZH 1E9OA 1XGRA 3FRPA 2C3WA 3JWDC 5J1TC 4W4NA 3KE0A 2Y3NA 5DS8B 5DZAA 3DC0A 4NO3B 4RWYL 3P11H 1V27A 4XP9H 3KPLA 4M6NH 3LS4L 5E2VL 2IDCA 4DO6A 1KC5L 2H3NA 2ZAHA 1JK8B 4JKPL 3N0AA 1X5IA 3PHQA 4GS7B 3GSXB 5F89A 1KCVH 3Q44A 3AMKA 3AXLB 3C12A 4PB0H 1D5BA 1T7YA 2DBJA 4JPKH 5GSVB 3TA4D 5CEXA 3UPRA 3ARFB 2H2SD 5GJSL 3P69A 3FKUS 3D07A 4ETQB 3KL5A 4NHUB 2OXGB 1SUHA 3TOPA 1HH6B 5AAWC 3BN3B 1WUNT 2NY1B 3QDGB 5LNGA 3M17B 4C8XA 4FEIA 5GZND 4QRUA 2Z93B 1MNUL 5HYSA 3R18A 1HOCB 5CGTA 2Q8BL 1CI5A 1TCRB 4RGMC 3KVPA 5EZOL 2BMKA 3PDGA 1LDSA 3OR6B 4JDZA 5FV1L 3C09B 1MFBH 3OR6A 4JDZB 1Z5YD 4Y16D 3QUZD 2HAZA 1M3JA 2PW2A 3KPPB 1LMIA 4OLVL 1KJMB 4PJEA 1I8AA 3GMOB 5KYUA 1EXGA 2OMTB 3AXHA 4G1MB 1XX9C 1GPOL 2XXFA 2BC4B 1I1YB 1HFUA 1RZQA 5EZPA 5FGBC 3VXPB 1E28B 2XPGB 3BPCB 3N44B 1I75A 3A4FA 3CC5B 4GRWH 2DV6A 3FRUA 1NDMA 3E38A 1CO1A 3PGFH 5E4OA 2E7DA 5A2LH 4HV8A 3EJTA 4TNWK 4XP1H 4N2GA 3SCMB 2VQTA 4KY1H 4XWGH 3FFCB 2P45B 4G3YL 2DMCA 5E9DD 3VE0B 1T1XB 2ZP0T 2F0CA 1MCRA 2ZT9C 5DHDA 1WFTA 4PVLA 1UH3A 3NN8B 3AGVA 2GABA 3HI6L 1BM3L 3CFBB 3IRZA 4M6AA 4Y1AD 5HYJE 1UWFA 2VL4A 1XGUB 3Q1SH 2F7IA 3QULA 3BQUC 5EFIA 1KFAH 2VSMB 3IPBA 1K6QL 1IRAY 2Q6WB 5KSAD 3KPNB 1OAYH 4JGNA 1TVBA 3IGKA 4K94C 3GM0A 1R3KB 3MV01 2X4NA 3U82B 4ORZC 1OSPL 4U3XA 1R3KA 5E9DB 1E6JH 2EVIA 1UWEH 1XFPA 3KEDA 5H8DA 1YY9D 1E4WL 1M2VB 4FQXD 1XDYA 1J9TA 1DBKL 3TIEB 1OSZB 2R0WL 3IMUA 4WCYL 4O2EB 5CN3A 4H5SA 4Q74A 3WSQH 4QHPA 5DJ0A 5DJYB 4M7LH 4AY0A 2KZBA 3BUTA 2DWDB 2UXFA 3O6KH 4L3ED 4N28A 2DQ6A 3PL6C 1YQVL 2XN2A 4M5YH 2LU5A 4P5KB 2ZIDA 2J1KA 1KIQB 1P6FA 2LU3A 4YXHH 4L23A 3W56A 2PXYD 1DQJB 4LEOA 4R26H 3OJMB 4QTIL 3WJLC 2BOLA 3ECUA 4X8XA 2CUHA 3PP3K 2XETA 4PJ9A 4ZFZB 4IRZL 5GS1C 1E4XH 1NGZA 3B5GA 3HZ3A 1IT9H 1MLBA 5D7HA 4DP0X 2WWKO 3UO8B 4BELD 1PZBA 2DLFH 2AS5M 1GGYA 3V4VB 3H9SA 5FO9B 3KH4A 5BQ7A 2FNBA 2YQGA 1GAFH 4L0ZA 5ILTH 4TPRH 1U8CB 4TL4A 1DEEA 4RGOH 1CDIA 2CKBA 3IBOA 3N2JA 4KKAC 4X6CB 2OJEA 4YEFA 3QG7L 2L4OA 3QG7H 4PRPA 2K7QA 3K8LA 1S9WB 4MRCA 3OLDA 5HDBF 4OZIB 2QR0A 4AQ1B 4TULH 4XP1L 3VFTA 5BS0A 2ALAA 5F0JB 4G7YL 3EBGA 3O6FD 2OSYA 1BP3B 3L9EA 2ATPA 3I9GL 4UV7H 3BZFB 5C0BD 5LCVL 4AG4L 4L8CA 2D2CC 2Z34A 4TNGA 4KC3B 4DP8X 1BIHA 2VN5A 3PPEA 4I9WE 1F0LA 4JQIL 1FIGL 3TPKA 5FLVA 4FCHA 2QSCH 3QJVB 1GCFA 5EOCH 1I82A 4MYPA 2CAKA 1PY4A 4NGHL 5K59F 1SXCA 4M9OA 3QNXA 1TU2B 1H6TA 4Y2DC 4IS6B 4J3TA 4AIZB 3VD0A 1XB3A 3KXFE 3FC8A 2EYSA 2WKLA 3EF4A 3FH5A 4P46D 3VX0A 4HC1H 4MAUL 2A4ZA 4NAJA 5HI3C 2WLLA 4X4XA 1ASOA 3VFUB 43CAB 5CU5A 1BMZA 4NWTL 1H8NA 5I19H 4B7IA 2EE9A 4JE4B 2NY3C 4ANUA 1BLIA 3LZNA 1TQTA 1D5MA 4O9HL 2BZCA 1CFMA 1H3UA 3FH8A 3QO0A 2EYRB 4OIBA 4YGVA 5B22A 4CNIA 4PB0L 3IF1A 2AI0L 3O41B 2IADB 2CBQA 1MZZA 2EE3A 3JVGC 3LNGA 1MCPL 4Z76B 5I0DA 3DJZA 4KK8C 4XVUC 4LVEA 3BYYA 1U93B 2DQIL 4XP9L 2X4TA 4R90L 1GIGL 1BGXL 3SE8L 4PRAA 4H13C 4G6MH 4OIAA 2UUDH 3LB6C 1DBBH 2BERA 4PMEA 1ID2A 2YD5A 3OJDB 3L3JA 1IL1A 4ABVA 1ZE3C 3CFCH 4S0TD 3UADA 3S96A 3FT2B 2D7OA 5HHQB 3GI9L 2YAOA 5DEZA 3VGDA 5GPRA 4NOBA 5D1ZB 1U4FA 1GGCH 5HYJA 4JRXB 4HIEB 4H26B 4P5SA 4Y1TA 4N0FA 3GFUA 5B8CB 2Y1YA 3QJTB 1YUHA 4PW9A 3F3HA 4LSVH 1U8LA 1XR9B 1Y1UA 3FQRB 3U7YL 1EFXA 1QYGH 2XYCA 3U0WL 3GF8A 4JFEB 1NAMH 2ADJB 3FU7B 3HRZA 2FATH 4CDHA 2NQDA 1T2QL 5EF2A 1MQ8A 4J3BA 2XV6B 5C08E 5B1JA 3F7YA 3FW6A 1N2RB 4OZGE 5F1NA 2ENYA 3IU3A 4R6UA 1GZHA 2BNRA 2E0PA 5ESAB 1FFQA 1O0VA 3L3IB 4R2GD 4YHIB 5DMGC 5E6IA 1E43A 3KPSE 2R0ZL 3HLKA 3P4MB 4DFIA 1Y0LA 2EO9A 4U6YB 3BD5A 4JZOB 4NRZA 1CT8A 4P9HH 5DJCB 4Z77A 5D7SL 2X10A 3QEGH 4ZXBD 1VGEL 5AVWB 4WUKL 3AJ7A 4IKKA 2PP9A 4KVCH 1BECA 4Z7VA 2VJXA 1GY1A 2PWFA 4LKCA 2NY0C 3D34A 5T5NG 4JK0D 2NY2B 3T0BA 4MS8D 3UEQA 2M8XA 1ADQA 2R2EA 3LNDA 3B83A 3QIBB 4PS7A 6CGTA 2Y1AA 2QHRL 4FADA 2F8VA 2GT9A 4X7SL 1A7BA 1CDHA 1D9KC 4GH7B 5ADOH 2QEJA 2X4PA 2WXPA 4FFWC 1NGPL 4UTBH 2VXUH 1MW3A 1IGCH 4YR6A 5D71H 4WKXA 5DJDA 2C7UB 1RHHB 1RQ5A 2HXAA 2CO7A 4WO0A 5ENWB 4QI3A 5JOPE 4CU7A 4X5XA 3MUZ1 1G1OA 1Y18B 5JOEA 2HVJA 2YQBA 2XNAB 3BIKA 2AJZA 2OR8A 3P2DA 3QORA 4J3UA 5E1IA 2KC0A 4PCKA 4F7EA 4Z7NB 5A2FA 1I1RA 4HLZG 5E2TL 4ELME 4G9FB 2EUZA 1CR9L 2KERA 2DMGA 4HH8A 1W0WB 4GRLB 2FX9H 1BBDH 1RJYB 5C0ND 3ZKQD 1TUPA 1RFDL 3EFOB 3DECA 2QADD 3GSWB 2CMRL 1KULA 2BIOA 2YRPA 4N9GB 2JLPA 3FCSB 4HC1L 4MAUH 5DI8A 3MRJB 5F6HJ 5CEXB 1C5DA 3X13B 4HBQA 4AEFA 4LGPB 2XXGA 2V0AA 2OMZB 4MTMA 3C5ZB 4X9IA 5C0CA 3QZWG 3MNDA 3C5ZA 4RBPK 1X5ZA 1DBJH 2IWEA 1A0QL 1YYLL 4LVNC 2VLLA 2BVPB 2J1YA 4QRUB 1QFHA 4YOKA 1FGNH 2R29H 4P2CG 5ABZA 1QO3A 1K4CA 2XWEA 1QKZL 5IHBA 1BVKB 1NUDA 5C1MB 1JPEA 5IQ9B 4AYSA 3X12B 1JV2A 3IDIA 4RFNB 4AQAB 3KJ6L 1JFHA 3T2NH 3VU1A 2E4FA 2WN2A 1L7IL 1EEYA 4OZGF 1GZPA 1SHMA 5EU3B 4AGOA 1MG3C 4QHNA 3BSZH 3E8VA 4XAWH 3DO4A 1SHSA 4FRWA 4UM8A 5EDSA 4JHZA 4PJHE 3D09A 2VDMH 4A55A 3TBTB 4G6AC 3GHEL 3K80A 4LHUD 2J8UE 5IM7B 1OO2A 4NT6B 2DKUA 5DT1H 1LILA 1P1ZB 3H0TB 5D6DC 5BZZA 2FEJA 4PJGA 3H7LA 1WITA 4BCZA 2R8SL 4BA0A 1AD9A 4N2MA 4PI2A 2AJ3B 1CFSB 4KUCF 2NY1D 3PREA 4LSTL 1HINH 3AUWB 5E6ZA 1A64A 1U3YA 1SEBA 1TOXA 3EO1A 5FGRA 3RVWC 4J1UB 1YNKL 3TJEH 1RPUA 3QB7C 1G7MB 1KLFB 1TITA 3L5HA 1RSFA 4HUCA 3NYKA 2P24B 5IF0A 1S9YA 1O6SA 3DKHA 3BVXA 5J11C 3BFQG 3LKOA 4NM4L 1JNLL 2X4OA 3QIWD 4KMLB 4QAMB 5GGTL 4B3VA 5BOZG 3EXJA 5KYWA 3OAUH 3V8OA 1OE2A 3KCWA 4HETA 5GZNA 1DVFB 1KYFA 2WBJC 2ZQKA 1TVBB 3GMNA 3JT0A 3UROR 4OFYD 3D0AA 1OF2A 2HT3C 3HA0A 3KYKH 3EOBB 4MA7H 2RFXA 3ZQ9A 4NKOA 4JFDD 3JWDH 5FXCH 3MUGB 1IC4L 4EI5A 2ED7A 2A6DA 4GUOA 1QBBA 1A7PH 1X7SA 1HZKA 4WW2B 1TZGH 1MZYA 2JKSA 1KT2B 4FXLA 4YN3A 4CVWA 1IBYA 1F11B 5C3IA 4JN1H 3AXIA 3WMSA 1MHPH 3Q0HA 2A5UA 2UZPA 1NKRA 2WANA 4OKVB 4NB7A 4WWKA 3QDME 2NY3B 5L2KE 1M71A 1VFAA 4P2RA 4P49A 4Q58C 3JWOL 1FL5B 1MLCA 3R7RA 3BUQA 2NW2A 1RUML 1NOLA 2Z31D 5IQOA 1DUZB 3MNVB 5HHVH 4FF9A 1WWCA 5IW1B 5HHOB 4UINH 3FQ2A 3QJHB 4J7RA 5FHBL 3NABL 2VLKD 1F6AA 3EYUL 1DVUA 4M48H 4UIMB 3KS0J 4CU6A 1RIVL 5D1QA 5TK4A 4PJGE 3C5XA 3KH3A 3RFZA 4YHNB 5AVTB 4ZNEE 4ZW6A 5IFHH 4NZDA 4NQDB 3LRLA 4MNQA 3V4UH 3JTSA 5IVNA 2ARJB 1WJ3A 1HE8A 2VC2B 2IBBA 3GSRA 4P5MA 3MYJB 4PJHA 4Y5VA 3FDWA 1AANA 4WI0B 4M4RA 3WJJC 4KV5E 1P7BA 3GIZH 1LVEA 2QELA 4P2YA 3TVMA 4F58L 2Z0BA 4XAKE 5E6YA 4PB9L 3DVFA 3SDCC 2FHCA 4DPCX 1MW2A 3BEVB 3GUFA 4PV8B 3FJTA 2DQEL 2YEVB 1F00I 4Q6YA 3ZMNA 4PWHA 2AEIT 1I3GH 4UMGA 1CFVH 1IZJA 1EGJL 4TRPL 5BVPH 5C8JA 2VR3A 3WFHB 2WO2B 3ASNB 1V7NL 3CU1A 3QIUA 5DVKA 3S3JA 4BZ2L 4F37F 4WAFA 2DYRB 1JHLL 1CFTB 1JUFB 2Y22A 3PWVB 3TBSB 4LPXA 5GGSA 3VVWA 1HQ4A 2B39A 3PYCA 4AYGA 3HR5B 2DLGA 4MBOA 3BAXA 1VAHA 1BIIB 1UUNA 1XH0A 1CD8A 2D3NA 2Q7AA 5DURD 2NXZB 2R0KL 3CDZA 3L3KA 5LGHH 3S3CB 5JR1H 4YUEL 5ISZD 2XVKA 4H40A 2OA9A 3O4OB 3FHAA 2HJFA 3P4LA 1RZKH 3L3GB 3ML8A 2NR6D 3V4VL 1INDL 3VQLA 3WN5B 3NJLA 1EVTC 3B2VL 1I9EA 3DBXB 2AJSL 2VLRD 4X4KA 3ZKXC 5EF1A 1OCWL 4CNIB 2BP8B 4QY8B 4KJPD 4L1TA 5CD5D 4IGBA 2H26A 3U7WL 3IS1X 4QYOB 2BH0A 1VFBB 3TXAA 5CINL 2P5EB 3K2IA 1DN0B 4XMVA 4YSTA 5F7LB 4WGWB 1UVQA 2H32B 4GO9A 1J8HD 2EDKA 2WVUA 4M00A 5EZLB 5IB1A 1SDDA 5TH2A 5I28A 2AXHA 5K9JL 3RWJB 4FXGB 2ZSWB 3Q3GA 2OFQA 4R4FH 3MLSL 5C0DA 2BY1A 4JUSA 4EN3B 4PSPA 1ZS8A 5AW9B 5C0EB 5KAQF 1AHWB 1OAUL 3QORC 4EN3A 5AW3B 2EVHA 3OJDA 4Y2LA 2J43A 4B9JA 2BNQE 1LDPH 4YSOA 5IROD 3IFOA 2AMGA 3VH8G 2QQKH 3BPLC 4OFDA 4U3SB 3FT4B 2L7UA 4ANWA 5MEQB 4EQ3A 4LL1A 1YJDL 2OL3L 1TFHA 2AQ1A 3STZB 3EYQC 4AT6B 5B8CA 1VADA 4JFQA 3LIUA 1TSHA 3OQ3B 3VFNB 3WTUA 2X3BA 4I5BA 5K9KB 2AK4A 2VDOL 2D7PA 1KGJA 5B3SB 4JFFB 2OCJA 2HLFC 5LGYA 3MR9A 1NMAL 5SX5H 1C16B 1MUJA 4KHTL 4PFEA 3U7WH 2GJJA 3F7YB 4PVMA 4GW5A 4XAWL 1NGZB 1P5UA 2EXWD 2YKLH 2W0LA 1MN4A 4OCRH 4XC1H 2M1KA 4TUKL 3QZLA 3N9GL 2QPFA 5BJTB 4RDQF 1S7VA 4UOQA 3R8BB 2X89A 5GGUB 5AYTA 2DEXX 5FKPA 2X4SB 1MW0A 3ZR6A 5KVDE 1PFOA 4HALA 2XTSA 4NUGL 2GY5A 5CGYD 3KPRB 3MCYA 1OTTC 4XVSH 4BWWA 1AJ7H 1XVSA 4CBPA 5F7HA 4AUUA 1B88A 4UYPA 4PJ5B 1WBXB 1O7DE 3MDJA 5FKAA 1JXJA 2P28B 3DSNA 3ECVA 3BAEL 2CRMA 4JFOB 4F8NA 4L5FE 5I1DA 3EOAA 1QWHA 3B1TA 3IJ8A 3IM1A 3RBSA 3BP4A 2JKIS 4PJAF 2XRAL 5KVEL 3L6FA 1M7DA 3NSDA 3MLPA 3V5KA 1QLFA 4MCZB 3EJRA 3HE6C 3IDXH 4MZRA 3RKPA 5AB1A 1A4JB 1ITBB 4E9XA 5DEFB 2AVGA 2YHGA 2XBZA 3L4XA 5AL8A 5HI5D 1A1OB 3FT3A 3DRTB 1T03H 2LU4A 1KXHA 1L9OA 4Y5XC 5EIIG 1JZJA 4K2UL 3ZDZE 4HYTB 4ADGA 4FMVA 3PF2A 5KS9A 2CR0A 2J8UB 3M1CA 5K69A 4FFYH 1MKFA 4QTHA 4WEBH 3TU6A 3VFPA 1S3KH 4C54A 5ETUB 4EIBA 2W59A 2I85A 1Y6KR 1M7XA 3VFPB 5BUPA 3GSUA 1XCQB 4NUQA 1KXVA 4V33A 1OARL 1DVFD 4AC4A 4N9GA 1IU1A 2MIZA 5BMFL 4JY6B 3ABMB 2IDUA 4HWBL 3ZDYF 3FO9A 1HSBB 4QO1A 3GLZA 4ONOA 1FZMB 4PGZA 2ZX9A 4Z18A 4YIQA 4NRXA 5F0MB 1GOHA 2A3TA 5AB2A 3DV6A 3SQBB 3TJPA 2JCCE 1UURA 3HC2A 1EJOH 5ID0A 4J3VA 3LN4B 4TS6A 5EOQH 1YUKB 2R0WH 4G5AA 4HQQH 3CFQA 2OL3A 2J6WA 3VXTB 4ZAKA 3UAEA 4XX5A 4ZOCA 1UYWL 2CDGB 3HB3C 3ZJAA 3KZ8A 3Q06A 2CU9A 4FTDA 3T65B 4WENB 1DSFH 2R23B 4X4ZA 1QLEB 3FQ4A 1AGBA 3QFJE 2DQDH 1FVCA 3V5DB 3WLBA 2BO0A 2YKKA 1PYWB 3O2DA 2YUVA 3RVWD 2AVFA 3EO9H 3LJ3A 3ZW3A 4DP5X 4QRAA 5LN8A 4HH9A 1QD0A 4JVWA 3EDJA 4N2DA 3FCBA 5FB8A 2CJSA 5IP4A 3MAWA 4BKLA 5JW4Q 3MROB 1OCCB 5D96C 3C9NA 4WF7A 1E0OB 3MROA 4YHZH 1PIGA 5IK3B 3NZ8B 4G1MA 5GGRY 4NO0A 2IVFC 1N6VA 5F9OL 2VDMB 3AU1B 4ODUA 1H15B 1YN6B 2EDYA 1IAOA 2PCFB 3MTXA 5DWPA 1NGYB 3QWQB 3UG3A 4BQBA 5SWZA 1D5ZA 5JDSA 3ZMRA 4B3EA 1HH9A 1PAZA 1KN2H 1KEML 3CFMA 5DURB 2OTUA 1KEMH 1ET5A 4MSWA 1KPVB 4K8RD 3VTTA 5HDQH 2X6AA 1LO2H 5FYKL 3DHMA 4N2EA 1P5VB 4Z7UA 1T1XA 1BJ8A 2WQXA 4MA8L 4HSCX 1KB5L 4HUVB 4GKZA 5E6IB 1A3ZA 3Q2CA 4GRMB 2W0KA 5AW6B 2VB5A 2WOBA 3FOLA 4DF9A 3K6FA 3TA3C 4PJ9C 2UX6A 4WK2B 4R90H 4YSQA 4JQXA 3KW8A 4Z7VB 1A6ZB 1NCDL 4PJ8A 4X6FA 4CW1B 3T04D 2VUKA 2R83A 4TVPE 1Y6NR 1ZK9A 1G7IA 4I1NB 4AH2A 2E7HA 1IAII 1G7IB 2ZP8A 5ALBH 4DZ8B 3PHOA 2XIIA 1E2VA 3LZFL 3O4LB 4MVBC 1EAOA 4QKXB 2P80D 1RZJL 3P9LB 4FG0A 3FONB 3OX8A 4WSKA 2VISB 3BEWA 4BRVA 3IRPX 2IPUG 2ZYRA 1UOWA 3WE6A 4BQ8A 1OAKH 1EEQA 2DQTL 1MCIA 4FQ2L 1ZDQA 4FNSA 4GAJH 5K9QI 3MXWL 2C7UA 4JDEA 5C08B 4UQEA 2IQ9L 4EI5B 1AGEA 1GVIA 4ODVH 4PJDE 5EBLA 3NJVA 1X44A 2X0WA 2VABA 3GBLA 3S4SG 3OSKA 1JRHI 1T6BX 1GS8A 4ZUTA 3C6LD 2AC0A 5DF0A 4WHCA 3FULA 3BIKB 4Y2DD <