2BIIA

Crystal structure of nitrate-reducing fragment of assimilatory nitrate reductase from pichia angusta
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
415
structure length
415
Chain Sequence
b'PFNSEPPLTKLYDSGFLTPVSLHFVRNHGPVPYVPDENILDWEVSIEGMVETPYKIKLSDIMEQFDIYSTPVTMVCAGNRRKEQNMVKKGAGFNWGAAGTSTSLWTGCMLGDVIGKARPSKRARFVWMEGADNPANGAYGTCIRLSWCMDPERCIMIAYQQNGEWLHPDHGKPLRVVIPGVIGGRSVKWLKKLVVSDRPSENWYHYFDNRVLPTMVTPEMAKSDDRWWKDERYAIYDLNLQTIICKPENQQVIKISEDEYEIAGFGYNGGGVRIGRIEVSLDKGKSWKLADIDYPEDRYREAGYFRLFGGLVNVCDRMSCLCWCFWKLKVPLSELARSKDILIRGMDERMMVQPRTMYWNVTSMLNNWWYRVAIIREGESLRFEHPVVANKPGGWMDRVKAEGGDILDNNWGEVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRATE REDUCTASE [NADPH]
molecule tags Oxidoreductase
source organism Pichia angusta
publication title Structural Basis of Eukaryotic Nitrate Reduction: Crystal Structures of the Nitrate Reductase Active Site
pubmed doi rcsb
total genus 130
structure length 415
sequence length 415
chains with identical sequence B
ec nomenclature ec 1.7.1.3: Nitrate reductase (NADPH).
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2biiA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2biiA01
2C9XA 2A9BA 4PW9A 2A9CA 3HC2A 3HBGA 3HBQA 2XTSA 2BIHA 1SOXA 2A9DA 2BLFA 1OGPA 3HBPA 2CA4A 2A9AA 1XDQA 1XDYA 2BPBA 3R18A 4PW3A 2A99A 2CA3A 2BIIA 3R19A
chains in the Genus database with same CATH superfamily
3UO1L 1I7ZB 3F7PC 2R0ZL 3LIZA 1II4E 1VFUA 2ZCLH 1IGML 4ADJA 2G0KA 5FDWB 1DFBH 1TZGH 3MLYH 4A6YH 4MAYC 4GMSL 3MO1B 2FJSA 2VRKA 2GIMA 1GCYA 4MMXB 1F45A 3QQDA 3DVIA 4A2EA 3O6FD 5IM7B 4KAQH 4ORGA 3PE9A 4N4YB 2VRAA 1LWJA 1FRGH 3QXWA 2I60L 4NO5A 4QT5B 3QARA 3F7YA 1BXUA 1HAWA 1K8DA 1OCOB 4BE5A 2J5LC 1E8XA 1P84J 1V3KA 2WB7A 2E59A 4L8SC 3QO1A 1UXLA 2NUTB 3BWAA 1HOEA 2AK4E 2CDFA 4W81A 3GSNH 4KKCC 4O02A 3D9AH 5JNYB 2CUMA 2Y72A 1RJZA 3ULUD 1OTTC 4F7TB 1K6QH 3DJRA 1N5AA 3SGJC 4PRHD 4P8QA 3ARXA 5CR1A 4YBHA 5FOBA 4P3DB 3GSVB 2JCCB 1J5IA 1W80A 3HG0A 4XWGH 2VAAB 3BQUD 3NJLA 2QLYA 5SWZE 2O61B 4PHXA 2BK8A 3FQ4A 1QBAA 1Z0NA 1HKLL 3MACL 2R9HC 1KB9J 3MRNA 4PIBA 4WV1C 3TA3C 4X9FA 4X4YA 3OR7A 2UYLB 2ICWI 4I9WE 1X6LA 4F8QA 4EOWL 3QXUA 1BYNA 3CZGA 5HVHB 5A2LH 1HH9B 2FX9H 4JJ5B 2Q7YB 2EAEA 1RKRA 3DXAA 5DJXA 3O3EA 2C9PA 4QTIH 3ARDC 3DBSA 2YFOA 1KELH 1XF2A 3IKKA 4JM2A 4P5RA 1OQXA 2OFQA 3EHBC 3QDHA 4LQ1A 3CVIH 2ATPB 1RFDH 4QRTA 5D1XC 5FA4A 2WXOA 2ICCA 3M1CA 2FO4B 2L7JA 1PZ5B 4WY7L 3NCWA 5GRVK 5D5ME 3TBTB 3F5WB 1KB5L 4E9QA 3JZ7A 3MBEA 1HSBB 5TPWH 4BKSC 3QCUH 2BVUA 5EEWA 4AIXA 3UJJL 4YHKL 4C56E 3TN0B 3NK3A 1AGEB 3DGDA 1UVQB 4ABWA 1QNZH 4P5TA 4ZDHA 3NTCL 3P4OA 2IDSA 3TBBA 4B50A 4DT2A 4ODTH 3I74A 3CSGA 1E28B 3Q13A 2WTPA 4J2XA 2DH2A 3FFOA 4JHUA 1WEJL 4Y9BA 5DMJB 3AS1A 4MMXC 3TFKC 4JFXA 3PAYA 1GZPB 3O6KL 2FEJA 3BKYH 3P0YL 1PLAA 5EF0A 1DVZA 1UA3A 3FQYA 4XXCC 4OZGA 1CJYA 1B4LA 1IGJB 4LCUB 1JXFA 2ZXBA 1INDH 1EAPA 3MCKA 4KO9A 3DUSB 2CIIA 4QTFA 4RGNC 5I74C 3VG9B 3ZE0E 4Z23A 4F5CA 3LKQB 4DUWA 1ZT4A 3K7UA 3GI9L 4LSUL 5C0FB 4YWGH 3MLPA 4N0FB 4I48A 4DGVL 2B1OA 3G6DL 4UTAL 3HUJE 5I9QB 4HZLA 3RY4A 4R96A 3D25A 4GKNA 3VG0H 5D7LE 3A6CL 4JFED 4PG9B 1X9LA 4LKXA 4TSAL 4PJHA 3OAYH 5MP6H 4EQ2A 2ED9A 4XZ4A 2ADIB 5ICZB 3O4LA 5AKRA 1KPUA 2CJTA 5F89B 1L0XA 4P0DA 1XB6A 3D7PA 5HHVH 2FWOA 1UZGA 2ARJB 12E8H 1NGWB 4F92B 2V5RA 5CJBA 4CAGA 3EO1B 2ICWJ 3BP5B 4IRJB 1IBGH 4LEOB 3NCXA 4GNKB 4M7JH 1L9RA 2RJMA 1MAKA 3RZCA 5H2BB 4DH2A 3LN4A 3UBGA 3FQRB 2DIJA 4FXGA 2LLLA 4JFEB 2X1OA 3BUTA 2EXYC 3FPXA 1IAMA 1E27A 1RK1B 3TGXA 5DA0B 4DP4X 3BSZL 5J9PA 4OLYH 5KSBB 1G7MA 2XXGA 1FYTB 1CGSL 3ZZQA 1TSRA 3QIUA 4URTB 1RUML 4Z78B 1EQWA 4QJ3B 2BOBB 1L9NA 2QGBA 5CGYC 4MZRA 2W5PA 3IGFA 3BHBB 5K39B 1RUPL 1UB5B 1EEUA 2XOTA 2ZX7A 3N43B 4MFHA 3TZVC 4R2GB 2EICA 1FL3A 3K4DA 2HFEB 3Q8EA 2CLRB 4Q9RL 3UYRH 2PCFB 4IIQB 4LPXA 4PRPA 5AKTA 1X5YA 3WAKA 1ZLDA 3QULA 1I9JH 3WJLC 3SQBB 5DC9B 3QS3A 1YEWA 4KPHH 4KVCH 2WB1A 4E41B 4N28A 4F15C 4ZW7A 5SV4A 4C54A 3BPCB 2GEEA 1ZA6A 2OW7A 4RGMC 4WWKD 4XN2A 2CKBL 4MRCA 4MXVE 3HC2A 3CZFB 1RULH 5ELIA 4Y7OC 2AC0A 2I07A 5CEZE 2DJ4A 3GRBA 3NJFA 3F84A 4HS6B 1NOLA 2WQWA 1JVLA 3BVNA 5FUZH 2EDHA 4G6AC 3RA7H 4KDTA 1ZVHA 2APFA 4MVBC 4CC4A 2HP4A 5D7SL 2W81C 4HIXH 5ITFA 4Q52A 2CRIA 1DQDH 2A74B 2W95A 4DHLA 3O2WH 3OLIA 3QZOA 4FABL 3PNRB 4OGAC 5CSZA 2WSDA 1FFQA 3PQYE 4ZZFA 1DBBL 2YD2A 4FFWD 2H3NA 2P5EA 4OFVA 1HDMA 4JGNA 3R7QA 1CGYA 1QMUA 4POYA 2WVSA 1M7UA 3BXNB 4QRAA 4BE6A 4PJXA 3MAWA 3L1GA 4KJPC 3V6ZB 4JX0A 2PR4H 3KEDA 4HETA 4NQSA 4ONGL 1QQDB 4IRJA 5IOKA 4DZ8B 4WEUD 3KPOB 3P30H 3DIVA 5CGTA 5L8JB 5AUMB 2A73B 3INOA 5LGHH 3ZVVA 3ZR5A 2YEZA 3STBA 2VLMD 5BMFL 1YDPB 3O3DA 1NFAA 5HGDB 5T3ZE 3RX9A 5DWPA 3DDGA 2VN3A 5B22A 2YFNA 3FO9A 1F6AB 3BUYB 4KQ0A 3ILPB 4FG6C 4RDQG 3TC9A 4AGOA 3X3GH 2ZOKB 1IGCH 3AQZA 3OWEA 4O02B 4PJBF 5HI5D 3CFBA 2YLKA 5EO1A 3M1BB 4ZG1A 2VDNH 3C2AL 4MMYB 1AQHA 1WUZA 3AW5A 4IHOA 3TCLA 2QPDB 1AYRA 1XZ0B 3MOBH 3WD5H 2PTVA 2D7QA 3GWJA 4X7FC 5ABDE 4GEIA 3UDWC 1JPFA 3MRIB 3DV6A 1KACB 3O6MH 2B4CH 2ADJB 5HI4D 3LD8B 1WZ1L 4M1CC 4OVUA 4YK4C 4OF7A 4DNLA 2GHZA 4KNSA 3CFQA 4G9FA 3QQ3B 1Q9WB 4OCLC 2C4FT 4PWKA 1Z9OA 4BHUA 3VSVA 3RIFK 4KUCD 3BDYH 4UBDD 1SZNA 35C8H 1LM8V 3RIFF 4O2EB 5EWIL 3MTXA 1CURA 3V0HA 1TFHA 4ZFGH 1QRKA 5AL8A 3PAZA 3RVTC 4AUUA 3TEWA 1XGPB 2HT2D 2DD8L 3U2JA 3EOBB 4MNGB 3BIBX 1IC4L 4NCC1 3RDTB 2C9VA 1UB6B 4PYGA 3IDGB 3WJMB 2X9XA 4JFHE 4Y5VB 1AFVH 1DHKA 5EBLB 2O6FA 4P59H 1Y6NR 1KB3A 2NXZC 4OF8A 1WP6A 5AAWA 1CU4L 1G6RB 3TBSA 1VHPA 1SQ2N 3B8SA 5J4MA 3GZPA 1JJUA 1JWSB 1O9VA 4FC3E 3RU8H 3ZE2F 1FIGH 3RWJA 5HTSA 3V55A 1SUJA 3W3BA 2AVFA 4WW2B 2EDDA 3O3BA 5C0BE 5CUSL 3L3OB 1CFQB 1UT2A 2QDVA 3H2QA 1G5GA 2JKJA 4ZOBA 2QLVB 3TV3H 4FA7B 1NC2A 4HMEA 4NZUH 2XFXB 3T0VA 4Q0XH 2LQRA 4HZ1A 2DKMA 4HDIB 4IKIA 1V3JA 3HUJA 4P04A 2VSKB 3VFMB 1LTXA 3F65A 2BIOA 4QHKI 4DQAA 2Z4TA 1TJGH 4PRIA 1VGKB 3FFCB 1CUOA 3V0IA 3T2NL 2DLHA 1R1CA 1JRHL 3EFDL 3VX0A 4YGVB 1NUFA 1WTLA 3JWDC 1MCBA 4I77L 4ZW6A 4H7VA 2KERA 1NC2D 2JIXD 1BAFH 3KLDA 4BSJA 3UPCA 5TQ2H 3A4FA 4YE4L 1E5UI 2CJUH 3E6HA 1J86A 4AUYA 3FT4A 1XCTA 5F3HA 4GQPH 4P9MH 3X1NA 2DTMH 2O6DA 3FQNA 2FVNA 4FFTA 1QYGL 3VI3E 1VFAA 5JIKA 3HZVB 3KVDD 2IAND 1MFEL 1QW9A 3N42B 3FQWA 4G2AA 2VUYA 2R2CA 3QA3B 3VM5A 4P23D 4R97B 3LH2L 4RIRA 4KXZI 5EDXA 3WFBL 5KYXA 3H2PA 3KG5A 4E36A 2KQMA 4LSQH 3VXUA 5IHZB 1MHPH 4KK8C 4K8RD 4YPGB 3HRPA 4N87A 2BSTA 1MNNA 2IO5A 2ZXWB 2EIDA 3STZA 2WP3T 5DU7A 5I5JA 3RIAK 2L7UA 1HE8A 4FYRA 4QOKB 3EO9H 2J43A 1PAZA 3VRIB 1BLIA 5DDHB 4LAJH 4GRWE 5FYJH 3K6FA 4Z0BL 2ITCB 3TPUA 5A2KH 1KCVH 3ETBF 2HLFD 5SWZA 3HB3D 3P02A 4MB1A 3L3DA 1UQSA 4MKTA 1J0JA 1E8YA 1C9SA 1IGYB 2LR4A 4NC0B 1E0OB 3BPNB 4A7QA 3MV9B 1S78C 3CC5A 1X5AA 2H45A 2W60A 4U3HA 3LNEA 4FQ2L 4UMSA 1KFAH 3HLAA 1UXSA 4K3GA 4RRPM 3QUMH 1HYRC 2G5BA 3L5XL 5INDA 1YJDL 2IGFH 4XMPL 2PPAA 4HGWB 1G84A 4XC1L 5HDQL 3WFDH 3NACH 1C5CH 3BZFB 2QSQA 4G5AA 4MJJA 1JF1B 2G60L 2YUXA 5AVQB 5AW2B 5B38G 1A6ZB 3FFCA 1RZ7H 1EJ8A 4JFXB 3Q43A 3AGVA 4WJ5B 2CQVA 2O5XL 3PU7A 3CH1A 1XBDA 2A74A 2V33A 2X2UA 2GAZB 4HF5H 4PPTA 3MBEB 3HN5A 3IS0X 1JHKH 3GSXB 2ZOLA 4N0CC 3A6BL 4LQFH 3O45A 4EI6B 1L9MA 1GZHC 4Z3TA 1MUJB 3QZLA 3MRDA 4HPYL 3NG5A 3WTTA 2B1AL 3QCTL 4JDEB 1XVSA 4G8IB 3ARVA 1XIWA 2IIJA 1BMGA 3JUYA 4WFGE 1NLBL 1AMYA 3GJEB 5T3ZH 1B4TA 2Q9OA 1NJ9B 1PAMA 2Q10A 5FYJU 5LG1A 4J4PC 4XVUC 4WGWB 5JXAL 1LMIA 2E7DA 5IVNA 1X7QA 1HZHH 2ZX9A 1IGIH 5DLMH 4U6VL 3RWGA 3EXLA 3IAPA 1G9EA 3EO1A 4OFDA 1FG2B 3SOBL 2P7TB 1DEEA 3L9YA 3HC3L 2CM6A 1PKQE 2NMSA 4L4VE 5D7IA 4KMLB 3EH4B 4PJ7E 1FVCA 2WKLA 4JKKA 5T1KD 4JN2B 5BOJA 4AIEA 4FA8A 4UDUB 1GC1H 1KTKE 1NL0L 4YDLC 5HDBF 4R96B 4F2FA 1KTLB 4P5MB 4BDVA 1HS6A 2BIPA 5T5FH 1N59B 5FO7B 4S1RH 1T1YB 3NZHH 1GY1A 4KXCA 2FH8A 4IKJA 4TNVF 1FGNH 3S88H 2ZJSL 3VMPA 1GYWA 1UHVA 4NXKA 2GC4C 3TWCH 1BYOA 3QIWB 4AEHH 1KLGB 1IGIL 3SKOB 2Z31C 4NSKA 4LCYA 5F1OB 1MSPA 3SPCA 4XNYH 5JHBA 2WV3A 1X44A 1E9OA 4WK2B 1QZNA 1PZBA 4HWEL 1P6WA 4MNGA 3I3DA 8FABA 5JOPE 4Z7VE 4ZS6C 5GGUA 1PQZA 3NIGE 4X6FA 5DZPA 3GSRB 2IFFL 1XHHA 4DVRL 2YN5A 1I4FA 5D7JA 1YYCA 5EUOA 5I8KH 1G87A 1TENA 2X4RB 4NNPL 3D52A 4GRLC 3P3UA 4Z6AT 5LNGA 4DO5A 2E8ZA 3CVBA 1THCA 1BOGB 3QUMA 3IDIA 5JLZB 2OL3A 2BSDA 2NY4B 4I18B 4IMLB 1W72L 3MRDB 1NPUA 3IJEA 1C8QA 3U4BH 3DIDA 3GMQB 5B4MC 5I30H 1N3NB 3ZDWA 1K3IA 1OAXL 3WFDL 3KYKH 4NIYE 4KXBA 2F53B 1E42A 3F6JA 4OGYH 5SX5H 5E9DA 4IOIB 3CFIC 3VW3H 5FM5O 1KBPA 3RI5K 3TCTA 3EBGA 3ULVH 5GS0D 2WC7A 3LXCA 5GJSH 4FCHA 3B3BA 3KW8A 2VDMB 1TMCB 4PJ9A 4RGNB 3N91A 1CDCA 4FQ2H 1MFDH 4O02L 5HY9A 3B3IB 2FRGP 3T0EC 4HULB 1N9PA 4MWFB 2DBLL 5CF3A 3AG2B 3BAEL 3QUYA 3BKJL 2BWQA 5I6LA 1DQQA 1QRNA 2ZKHH 3ILPA 4RA3A 4TSBL 5HVFB 5KSAC 1K4CA 3PV6B 5EUOF 3VWJC 1SOKA 4JDTL 3QS2A 2J8UB 3Q6GH 1AGCA 3VFNB 4MD4B 4XI5C 4A2HA 1MH5A 3X12A 5GHWH 3PYCA 3E6FA 4P49A 5DZOA 5C0EA 1QLEH 2WLIA 4DK3A 1REIA 2EO7A 4AK1A 4FFZH 1SEQL 4AYGA 3T6XA 4IBWA 5DVMA 2XTJE 2WW8A 3QVAA 2W9DL 2APTA 3IPFA 1FPTH 4KI5E 3SHSA 3T0EA 4K7PX 4M9OA 4UTBH 4I2XE 2OMYA 2GITA 3BUYA 3LPGA 4KKQA 5E4AA 3CSTA 3W0WB 2GABA 1BOYA 3HI1B 4Q4IA 4C56A 3IDJB 2V3FA 3EIFA 2Z7UA 1LO5B 2I85A 3SDAB 1G7HB 2NNAB 5EC2A 3ZBMA 2XY2A 1BVNT 2FIKA 4ZXBD 4ENEC 3SDDD 2AS5M 4R6UA 4DZBB 4P5KB 2E5EA 3ARPA 4L8DB 1ZHBA 2LU4A 3QUZC 4M6MH 2OP4H 2ZYSA 3EYUH 3VXSD 3GQFA 3VRLE 3PP4L 4FADA 3BVXA 3BP4B 4X99B 5EEYA 1VFMA 4D0CB 4FFZA 3HZMA 4ALAL 3N6YA 3H3KA 3IAQA 2X4QB 3KLAA 5EV7A 2AJYH 3MZTA 3WJLA 4WHTA 5CEYA 5C0IA 3A23A 3ABZA 5I2IB 4FQHB 3O3BB 1A6ZA 5AB2A 5CUSH 1P1VA 3U83A 4K3EL 3PWPD 5KSAA 4OLWL 2YPLD 3VFRA 1G6VK 3QI9D 1GY2A 2GEQA 3DX2A 5DD0L 2A1WL 3EJCA 3H54A 2HFGL 1GH7A 4Y4FD 4HEME 1KCKA 3PGCB 1RURL 2HJKB 1MHEA 1KYDA 5KVFH 1D5ZB 4FXKA 3RFZB 4WJG3 1IEAB 4PCTA 1BMWA 1UWXK 1D9KA 2W9EH 4YC2B 1J9SA 4EKXA 3PG2A 5HI5C 5L0QC 4L9LA 4MB3A 3ULAB 1BBJB 2EDKA 4UAOB 3QFDA 4MD5B 3U7WH 4DEPC 3VFGL 5L2JB 4F27A 1A4JB 2EDWA 1TU2A 1ONQA 1E4KC 4JGUA 3QC5X 2R2HB 2B59A 1BVOA 4HAFA 1MN4A 3BISA 5MEND 4NO2B 1K72A 3SE9L 2NT0A 3VXUE 5DEFB 4NKMB 2WINA 5I6NA 1F3DJ 3IFOB 1XF5A 1DQJB 3HA0A 3HE7A 4P46C 1F11B 4O51A 1F8TH 5JW3H 2W80C 4LSPL 1ESOA 5DJ8A 4F24A 1VADB 2DKSA 3PJSA 1V3LA 5GGVY 5FEBA 4RSYA 1MW0A 4JCMA 3M1OA 2FGWH 4Q74A 4YHNB 2D4DA 2XU9A 1F4XH 2WLHA 4HG4J 5C09A 5AVXB 4TQEL 1IGCL 5A43C 4XAWL 2GSGB 3NCBB 3ZW3A 2QQNL 4MAUL 3IJ9A 1KCWA 1HE7A 5HGAB 1WCBA 4G7YL 3BWUF 3OB8A 1ZMYA 3ILQC 5E6IC 1T0MA 3TBCA 3GSVA 1JDDA 3TT1L 4ELMA 4AWJC 3GMNA 5BW7C 3FT9A 5HPMB 5TF0A 1OE1A 1F3RB 2D7TL 3TT1H 3Q8BA 1UG9A 4Z7OE 2WWKO 2OMXA 5IW6A 2QGEA 3IPEA 1TJMA 2OYMA 2XSKA 1DVYA 4RVBA 4APQB 4PJ5B 5SV3A 4KZDL 4PJGF 3GEFA 3NIGB 3TONA 5DD6B 1GA2A 1W6LA 2XBZA 4ABQA 2WXFA 3LCYA 1SHWA 2DQGL 1SN5A 3IN0A 3UAEA 4HEPA 1TTGA 4Y16A 5K9QG 3PXHA 3MMEB 3CFJB 1QUPA 5L0QB 5CD3A 2ATPA 3ALPA 1UT9A 5KVGL 3NN8B 4KGJA 4HC1L 5EIIB 5JHLL 2GK0B 1IM3B 3SGDI 2P8LB 4ZUSA 4KQ4H 3CH1B 3ROLA 3WHXA 2OJ1A 2H1LM 2W60B 1SHSA 1D6EB 3BWZA 4G7YH 5BOPA 1ET7A 4JHWH 1XSIA 4W9GC 1IFHH 3QUXA 3L4CA 5DHYB 2DMKA 5D8JL 2W07A 3N5AA 1P5VB 4RFNB 4H4NA 3FONB 4M7KH 2BY2A 1DQIA 1DVFC 2FQDA 3EFFA 4OCWH 4NIKB 5BZWB 3TVMB 1OEZW 3TX4A 2EDYA 3EH1A 3UTSB 2ZWLT 3C9NB 4IJ3C 3B2UD 4QRFA 1PZDA 2SEBB 2WIIA 4IS6B 1OSPH 3I84A 5IY5B 3A21A 1F8TL 4PJFA 4R83A 1PG7X 4FYSA 4UOJA 3O2DA 4Q6IC 1WAPA 3L9RB 3INUH 2R59A 3POHA 1U2YA 5TDPB 4KOCA 4K8RC 2E56A 4LIQE 4Z7WB 3X17A 1OGTB 4HALA 1SF5A 1ODUA 1JZ4A 2Z91B 1RUMH 1PX4A 3CVHA 4OV6F 3D08A 3IDNA 3OMIB 3TEYA 2H5UA 2IG2L 5C7XH 3DV4A 4I89A 1OB1B 1AYOA 4QHKJ 3TT3L 3VQ1C 1AD9A 1T7YA 3ZX1A 1YY9D 2WO4A 4N0UA 3WEAA 3NEOA 3ARYA 2NY7L 1T21A 3MRBB 4IBLT 3VDBA 3B7SA 3ZKQD 2BFVH 2P5WA 1RURH 1VZHA 5FV2A 4JCLA 4U3SB 4X6EB 4BDVB 1RP9A 2B5IB 3T2LA 4UCFA 2E46A 1G7IA 4TUKL 5I15L 3LAFA 3SQOL 2E6PA 4ZMYA 3HI1A 3SIKA 1MCDA 3HKFA 1J1OH 4C56B 4FXGB 5B7EA 2R0LL 3LPPA 4KK9C 3VJ6A 4N86A 1RERA 1S9VA 2GBAA 2QADD 1NGYA 3OKOA 4JRYE 2W65A 3S36X 1T5WA 2J1KA 4DUVA 3HHMA 1A3ZA 2XKNB 3IN2A 2ERJC 2XN9E 3H3PH 3OX8A 5DO2C 4YXHL 2FDBP 4YXKH 1DN0B 2X2HA 4EBQH 4ALAH 2F9BT 3G9VA 2ZF8A 2DF3A 1U8JA 3VG9C 2G30A 1TEYA 3HG1B 4HFWB 3WEXB 4FJ6A 4R3SB 5C0IB 4PRPB 4OH2A 1CL7I 4MA3A 4G6JH 4MA8H 4BXSV 3SQBA 2DLEA 4FA6A 1BZQK 3BW9B 4K9EL 4ODTL 5C09D 3FOLB 5KS9B 4I0PA 3C87A 2SEBA 2WXHA 4X9GA 5D7LB 4LOFA 1FFPB 3D2UD 1RMFH 2WHVA 1OQOA 3ARUA 5F1KC 4LFHD 5LGKA 5MEPA 3HZYB 1OKEA 3MVSA 3ML9A 1A0QL 2JI2A 5BUGA 3RVUD 4PJ9B 2DWDA 5L6YH 3QIWD 1RZKL 1MWOA 2FBOJ 1IEAA 5FKAB 3M6DA 3VXTB 1OSEA 2DBLH 1WH0A 4B9ZA 1YNKH 2XETA 1V7ML 4L3AA 4DFHA 1SVCP 3Q06A 2QHRH 4QTIL 3NIFF 5GJTH 3WFEH 2A9CA 3MUHL 1HC1A 1QWUA 4RRPG 4MDRA 2VYRE 3PQYD 3LS5H 2GJZB 3VW3L 1M42A 2ZKHL 2X44D 5EN2B 3RGVD 3FUDA 3HNTH 4TXVB 5T1MA 2JJTC 1D9KD 2WWOA 3NCCB 3GO1L 4PRIB 2NY3B 5FKPA 5MHSE 4G80B 1LDSA 1X3DA 3CZLA 4BFBD 4LRIA 4NGHH 2E27L 5AYUH 5G5DA 5KYWA 1S8DA 1U8MB 3RWHB 3CDZA 1AAJA 5K1JA 2OCFD 1HTYA 3GIZL 5D4IA 4OSUH 3VSTA 1IQDB 3KS0J 1H9DA 2EQDA 1AKPA 3FQTB 2D3LA 3Q8CA 4XXCA 1F6FB 1IGJA 4FZEH 4L37B 3I02A 3IU4L 2BVOB 4LAQH 5FHAH 4DP0X 1RIHL 1WJ3A 1WBZA 2D03H 4A6YA 5J3HD 2UZYB 4G8GD 3RYMA 5A6MA 2VXQL 5EU3A 2JKWA 4PJ6A 1DTUA 1EWHA 3EO0B 4PG9A 5JHDD 4DERA 3E6FB 3L2MA 3LIZH 1X5MA 3QDGD 3U4BL 5I30L 5IMOA 1QI4A 5JORA 1CBVH 1SYVB 3GMNB 2VLJB 4QY8B 1ORQB 3DX0A 2EJ1A 3UAJA 3OXRA 3JXAA 3UEZA 4XNZB 5I8EA 5J56B 4YH6A 1CFVL 1SGKA 3UEQA 3IXAB 5G2NA 5B8CA 1BX2A 1NGZA 2B77A 3PDOA 4YSDA 43C9B 4DOHB 1OANA 3NA9L 2ZJSH 3L3KA 3MHZA 2AXWA 3UO1H 4AQEA 4IRZH 4L0PB 1FO0H 4U1NB 4MRBA 3RTQD 1CLOH 1NL0H 5TE7L 2AV1A 4P3CH 4GW1A 4P4RB 5I15H 2PWEA 1TJHL 4GP5B 4KK6C 1CQKA 1JVOA 1ZXQA 4A2FA 2K9UA 4BFEA 4XOAA 4EZKA 2X1PA 2IQ9L 1QBBA 3K2UH 4DQOH 2CSPA 4KXAA 2P8MA 4PBXA 1N8OE 1RPQA 4PJIF 2CLRA 1KFGA 4WHTB 3TO4D 4OF3A 1RIUL 1PDKA 2QVFB 3KXFD 5B1AB 5IB5A 1NCTA 5ECGA 1E4WH 3HAEB 1NLBH 5D2LF 1UM5H 4GG6F 3GXPA 4J2QA 1QBLH 4UILL 1NIBA 1CD1A 3AAZB 3OSVA 3MRLB 3N2JA 5CHNB 2Q6WB 4CN6A 5BUPA 5IQ9A 3SOBH 4N0RA 2OAAA 1K5WA 3GYRA 2V2TA 3BZ5A 1JGUL 4EI6A 3VTAA 5DLML 4EUPH 3ARSA 2BJMH 3ULSA 4WEBH 4OFKA 2LU5A 3UBXI 5ALCL 3QG6A 3DROA 3FT1A 4HWUA 5L7XH 2BHFA 3GGWB 5T3ZL 5DRXB 1EMTH 4GO8A 1FV1B 2J6WA 32C2A 2WUCL 1MJUH 5D8JH 3SE8H 1FNSL 1RIVL 1B88A 1C5CL 1IFHL 1TLMA 5JORB 1A4JA 2NSQA 3LRLA 4JHWL 4RSVA 4MNGE 1MFAL 2HRLA 3C8DA 1B0GB 5EU6B 5JQ6H 1FZMB 3RFZC 4NKDA 1IARB 2H26A 1QFUL 4RMVA 4WW2F 5FCSH 4OCXH 1MFBL 4OZIB 3GHBH 4W4NA 4HAKA 1T0MB 3BAIA 3KPSB 5DI8B 3EDEA 4OQTL 1WBYB 2EIZB 2N1TE 3VJ6B 4HIEA 1AP2B 1WTGT 1HOCA 4PV9B 4L18A 4FS0A 3RTQC 3V0DA 2EKSB 1M3JA 3QORD 1FSKB 4KZDH 3NACL 2JKTM 4O58L 3UG4A 3VI3F 2LFEA 2YZ1A 4X6BA 3ARFC 4ODXA 3VFVB 3H8NA 4ELDA 1ZHKA 4PBVC 5E03A 4A1RA 1FG9C 4ELME 4S2SB 1KFAL 3GBEA 3JYCA 3RI5F 4XX1E 1Z1WA 3KWXA 3TIEB 4G6FB 2JIXA 3IRZA 3L3DB 4FG2A 3TU6A 2KUTA 5DZVA 1MHPL 5DTFB 5GISL 2XX1A 1QO3B 2KH2B 3PWJA 5F72S 2I69A 2AZUA 3EZ8A 2IOMA 2YPLA 4M00A 5C0NC 1OVZA 3VFOB 3FOLA 3KLKA 4FQLH 4J28A 4MJHA 4MAYD 4MMZB 2OMNA 4I0PB 1XGYH 5TK4A 4DP1X 4HOZA 1AZCA 3WNMA 1HWWA 1C08B 4TQEH 4Y4FC 2NYYC 1RJCA 4NN6B 3RZCB 3B2PA 1ZK9A 3WTUA 1A6WH 3VXMA 1H0DB 2Z6FA 3F7VB 2H47C 1PPIA 2EE3A 3UTSA 1OM9A 1BJ1H 1A7PL 4MA7L 3L1OL 3CPLA 4LPTA 1LO4L 5LDSA 1PD6A 2X6MA 1JPGB 1TZIB 2Z31D 3EFDH 2PCPB 3BFWA 3KR3L 1ITCA 1GYUA 4NHUB 5GZNA 3TA3D 4CVZA 1U2HA 3MLVH 4XC3H 5L2KD 1U95A 3X1EA 1T1XB 4Z7NB 3FSZA 5IBTL 2OR7A 4E68A 2CPUA 3QHZL 1ACZA 4UM9A 4PW4A 1Z9MA 3DX7B 4XPGH 4YE4H 4LSSH 2K7PA 1KJVA 1URZA 2UXFA 3MPCA 4U7MA 4DN3H 3JWDH 3FBQA 2XFGB 1QFWL 4LPCA 3WUWA 2VQUA 4U0QB 1JRHH 5I1EL 4IS6A 1EV2E 1PEZA 4RZKA 4ERSL 4GSDL 1R3KA 4YO0A 3HG1E 2WK2A 4HCRA 3WU1A 1F2QA 4QHMA 3N40P 4KI5D 2OSWA 3E9UA 4A67A 3H9SA 4JFDB 5I6XB 1A8JH 3CSYB 4NZDA 1PD1A 3WEMA 4AZUA 3N42F 3KBHE 3UGUA 4NZUL 3VB8A 2EEAA 4QI3A 3RWCB 2J2ZA 3PNWA 2WXNA 1QEWA 4C83A 4NO0B 4KK5D 1NCBL 3KPRE 4F2EA 1QUNA 3EYFA 3FQNB 2R8SL 1G0YR 5J5EA 3O9WB 4HA1A 5ACZB 2UXTA 3NIDE 1Z6JT 1L6XA 4YE0A 1Q8MA 2W0PA 1J0YA 4KRNA 4URKA 1EFXA 1EHKB 5IVXA 4ERSH 2AMUA 4R90H 4GY4A 4MMZC 5E6IA 3IE9A 1XWVA 2X3AA 5E1HB 1CCZA 3TYFB 4F57L 2FK9A 2BNQE 2WMPA 4DOHE 4NO0D 2KHAA 5DJ6A 1CGWA 2HWZH 4YR6A 1G1KA 4MJIB 5FGCB 4DAGH 1UURA 4WSJA 4ZSOA 2LGNA 4ZUVA 4UIMA 3KHQA 2IAMC 3OKOB 5EBWB 4DTGH 5EWIH 5F1NB 3EYOA 3NJXA 2A4CA 1JZJA 2NY3D 4KKAC 4KK9D 3VVWA 35C8L 4ONFL 3WEBA 4E9TA 4D3CL 4PRIE 1B0WA 2Z35A 1T1WB 3CHOA 1BFVH 1OAUL 3LDBC 2XLLA 2FLBT 4BGDA 4LGPB 4QCIB 4FQIL 2WTRA 1S78D 4A2LA 5H94B 1B2WH 2P80D 1OCZB 1R47A 4LCYB 2XWJA 2B4CL 4ZFZA 1JPFB 5CKAA 4PTTA 4RFNC 2DJSA 5BQ7B 3IBOA 4YZWA 5T8IA 3P0VL 2YJQA 3NFSH 2P48B 1BDYA 4LCWB 5FCUL 2L04A 1Z9NA 2CKBB 5GGUB 3ULUE 1NGXA 4RQQA 4PJAA 3R0NA 2P42B 4R5VA 1NCGA 2VW4A 3D39E 2BVQB 4JHAH 2UVFA 5IB4A 3D3VB 3U4KA 3QG7H 3BAEH 3U30C 4YBQD 1NBYA 4ZMZA 5D71L 2JELH 3HG2A 1JSYA 2EYSA 2WPGA 1ZV2A 2XWZA 4NN7B 2D7TH 5C07D 5L2KE 4W9LC 1AXIB 3KPTA 4PRPD 2IPUG 3IYLW 4WKZA 5DT1H 5K69A 4N1CA 1IAOB 2PR4L 4ONGH 4U49A 2ORBH 4WEMB 3ZRCC 3MRJA 3R06B 3UFIA 2RMNA 2PYFB 4MAUH 5KVDE 1O7SA 1OAXH 2R69L 4Z7NF 1I85A 1XIWB 4H8QA 5T1MB 2Q2LA 2XPYA 1ZWIB 3UTQB 1J7VR 4HJJL 5E94A 4PB0L 4OZIE 1QPXA 1WSST 2QPFA 1GGIL 2VM9A 3ZIYA 1BZEA 1YN6B 3TN0C 4JFZL 2HT2C 5GRXG 4PP2B 2A74C 1R5VA 1RU9L 5TGBB 4J39A 3H53A 1KLUA 1K8DB 1X7QB 4M48H 3TEUA 1YMHA 1CLCA 1XB8A 3QRLA 5FYJE 3AQXA 4YDIH 4PJAF 1RUPH 2F15A 3ISYA 4EN3B 1Y18B 2X70A 2XZZA 3L4VA 1AXTH 4KTEH 4JN2A 4IU3A 2F53E 2B15A 4IRZA 4PLKD 2A9BA 5H37H 1EMTL 4Z3JA 1P7BA 4LDEB 1YEIL 1FVDB 1ZA3B 3FSVA 4YHYC 5L7XL 5HI3C 3PQYA 3T8XA 4HIIA 4F8NA 2D31B 4OCNC 4PM1A 4GRWH 5AB1A 3I6SA 3QZWA 5IESL 1K4DA 3JWNE 4NZTH 4F93B 1EX0A 4JM2C 5DGQA 1YNTB 3HVDA 3WNJA 2V6HA 1JGUH 5F9OL 4G5ZH 3WTXA 3QJHA 4ZX4A 3C75A 1WT5C 4WV1B 5DO2D 1XAKA 1IBGL 2BX5A 3TO2A 1FGNL 4KKBD 3LIUA 4FNQA 4WSGA 1SVZA 1ZK5A 2OX5B 4JVPA 4PJAB 3LMJH 1TUPA 2A1WH 1W6WA 4F3FB 3MNZA 1M57B 5IB4B 2V8LA 5DC4B 3JTTA 3S96A 4BFOA 5J89A 4HKXA 4AITA 2P5EE 1H6EA 2E3VA 4M5SA 2PF6A 2Y1YA 5IJCC 3HC3H 1MAJA 5C0CA 3SPVB 1MRCH 1GGBL 4P46D 2WLKA 4JY6A 1R3HB 4YX2H 1HZHL 1U3JA 3IDIB 1YSOA 4N2LA 3VRLF 2P5WE 2PW1A 3BZDA 2NY1D 2IXQB 3UAAA 5E8OA 4V1DB 4WCYH 3NSCA 3O6KH 1KXQA 2ZP8A 4PRBA 4DF9A 3QJVB 3N9GL 5F9DC 5GS1B 5D93C 3HE6C 1PLGH 4N0YL 4PP1D 4XO9A 4Y4FA 1SXBA 3ZL1A 5IF0A 4Z95H 3NAAH 4EZMA 5HHMB 2PP8A 4ZQTA 1SDDA 1F58H 1FZMA 1ZD6A 3P11L 3QQNA 3L8QA 4X98B 4NN5B 1JIBA 4KXZH 5KJ7E 3APMA 3UJJH 4JREC 1VB9A 2HJLB 4X5XA 4YDLB 1TITA 4PLJD 2YD1A 4JFOA 3Q5TA 5B3SB 1XV8A 4HH9A 3FUKA 3QG6B 3TBTA 1P4IL 5BS0D 5E5MA 2Y36L 3ECQA 1GGCL 2E9GA 4I3GA 1QLEL 2DQ6A 5IHWA 3EFOA 1UWGH 3C5XA 4ANUA 2WLMA 3NFPB 2CNYA 2R2HA 1NKOA 3NTCH 2AVGA 1TVBA 4FZEL 2AXJA 2K6YA 1B0RA 4PRDB 3MJWA 4NKDB 2J8UA 3GZOA 4TSBH 2VZUA 4ELKA 2QZQA 3D69B 3MO1A 4J3OH 5CEXB 3NP3A 1YC7A 1J9TA 2JLPA 2HUHA 2XACC 4NGHL 4P2RB 2FATL 1JGEA 5D6CA 5AALA 3T9WA 4ZTPL 1Q9LA 2FIRT 3LKNA 4XWGL 3VDAA 5I66B 1FNGA 2Z64C 2CU9A 1JGVL 1GCFA 1HEZA 1U93B 1KIRA 5JHDB 3ZHNA 1CIUA 1DLHA 1WS7A 2AEPH 5JTWA 1N6UA 3CU7A 1W2KT 1IAII 3U1SH 4M4RA 4BCYA 1A64A 1T6WA 5FLVA 3FB7B 3GIVB 3FFDA 4NRYB 3GSNL 4GAGH 4XO4A 3EG9A 4NUJA 3B5GA 3ARDB 1CICD 1WHOA 4XPFH 5A16B 3KYNB 1VGEH 1DN2A 2I32A 3RZCD 2JKSA 5PAZA 5C0BD 3I3EA 1A6VL 5E6RB 2ESVB 2J5WA 2HRHA 2CCVA 2R2BB 4TVPE 4DP2X 4PVLA 1JCKA 4WUKH 1MFEH 1MG3C 3OZLA 3RWEB 3O4LD 2PPFA 2Y6TE 2AK1H 4JQXC 4P9ML 4NKQB 5IF0B 1SJHB 1NUGA 2FQEA 3L4WA 4FXKC 3MLTA 1FC2D 3PUUA 2CRYA 4XBPB 1DFBL 1TZGL 2VXQA 3MFFB 4QEGA 3PPSA 1BAFL 4I1NB 5C1MB 2OSXA 3CZFA 2XQBH 1TKWA 1DSWA 1LXMA 1LEGA 1KYOK 4FNLH 4JRFA 2CPCA 4NDMA 1JK8A 1WCQA 4LCCB 3V6OC 2OMVB 2ZE0A 2NY2C 4LEBA 3FTXA 4NQCB 3HBQA 1IAKA 4KAQL 3C6LC 5DWUL 3BHBA 3BYTA 2YUVA 5KBMA 5IG7A 2K0RA 5ERWA 3SKUD 4QXUL 1IE4A 3O2VH 2WKGA 4JFFB 2ZWNA 4A6YL 3PGFL 1OAQL 4Z7OB 4N6RB 1T2QL 1U95B 4L8BA 4OFPA 2ZCLL 2WZAA 5DEJA 3S88L 1Q94B 4LP4A 2ZKXA 3CVHB 2DQCL 3SBRA 1HNFA 1H3PH 2OTWB 4NUMA 5FYLL 3D4GA 2VE6A 4S1RL 2FAUA 4ZYKB 3KPLB 2RBLA 4QIRA 5KS9F 5DD1L 3WSQH 4KRPD 2NXYC 5ISZE 2NW2A 1JGEB 1HWHB 2UZPA 3LNIA 4Q58C 5L2JA 5E2TL 1UCBL 4PGDA 3WTYA 1DQMH 2CM5A 3JVGA 4GINA 1G9NL 3ZZSA 5I19H 4YN3A 3KWWB 1KCSL 5DEFA 3KAAA 4XODA 2X89A 1U91B 2YAHA 3SD2A 1TTRA 5CLZA 3L9BA 3EKCA 3AUVA 2ETWA 4JNXA 1UD6A 2IC2A 5F0MB 1F3JA 3W2DL 3OGCA 2XQYG 3KMDA 1WA2X 2PUQT 1OZTG 2M1KA 2YD8A 4HUKB 5J57B 2H1PL 1RZGB 3TTSA 2BIHA 5IVXE 3D3VE 4OJDH 1UZ8B 4S0SD 4NPKA 1I85C 3FO0L 2BSED 3I85A 2Y5QA 1TQBB 1V8HA 3WOVA 5EOCJ 3HS0A 4NQED 4H8WC 2EE0A 1E6JL 4NQSB 4AY0A 4C58B 1S9XA 5H94A 2W0FB 1QNIA 3PL6A 3QEHA 4PRHA 1QR1B 1IO4C 3CDFA 4PJDB 4Q7DA 4UNUA 2ZPKL 4Z7WE 2YGNA 3MUUA 4JG1L 1A02N 4BHUI 4M7KL 1E5ZA 1N8ZB 3DX4A 4XHQA 1LP9A 1L7IL 1BD2E 2W65B 1WO2A 4N8VA 4XNMB 5FB8B 5EBWA 1ITBB 4PJ7A 3S35X 4X4MA 3I6LD 1KBVA 4EUPG 1MIEL 5JW4N 1FLRL 3L5XH 5DC2A 4QF1B 1JGLH 3KDMB 2E7LC 5KZCD 4KQ4L 1QWHA 4JFUA 3V9FA 2F18A 3VGGA 5L9DH 4U6YB 3T4YA 3I9PA 4YLBA 4P2YA 3O3AB 5JHLH 5HHOA 2F19H 4GQRA 3UP1A 5C0JA 4FQJL 4JPIB 4YDVA 3K8MA 4LP8A 2NW3A 2YKLH 3WNLA 2D4FA 2MSPA 3QUZD 1NDGB 4UQ3A 1AY1L 1NWOA 1WQVT 3BUIA 1MW3A 3H85A 1SOXA 3M86A 3OKLA 5ICYA 2GTQA 3D51A 1MRDH 2WAHA 3BDBA 5JR1L 1OV8A 3MJGX 2GT9A 4H20L 4O2FA 5FGBC 4QRSA 4PW3A 2NDFA 1SMDA 2AJVL 5DK2A 5AAWC 5FUZL 2MCPH 4TM9A 1ZS8A 5CWSA 3DO7A 2EDJA 2V9RA 1JYXA 4W9DC 3M8OH 5C0GB 5MEQA 3C12A 4YHML 4FEIA 1FE8H 2D7MA 2EDQA 2NQ3A 4Y9EA 4LLUA 4ZAKA 2B4CC 4KPHL 2UZYA 4LT7A 3HAEH 2DTML 3UTZA 1IBDA 3GK8L 1D9KB 4PRID 2B9AA 3D30A 3QR1A 3D69A 3WNKA 2ZAGA 3S37L 4R7NA 3NJJA 4ZFFA 1TG8A 3VI3B 5CCGE 1UGKA 2QELA 1A21A 4TUJA 4YBLB 2PLTA 4JKWA 2ROYA 1JL8A 4NQDD 1NAML 2VMJA 2E7LA 5GGTH 2YMOA 4AIZA 5SWQB 5IUCA 1DQKA 2G0LA 3VU1A 3VNZA 3DUUB 2SODB 3AQYA 4K8RL 3VRIA 3U7WL 5GRVL 5J8OA 3QDMB 4QLRA 2DMBA 2OJZL 2AEIT 3KPRD 2AJSH 4M4PA 4M7ZB 1KDIA 2V7NB 5AVZB 2AV1B 4JPIA 1S3KH 5DQJA 1SYVA 1QBMH 5D55A 4PYHA 3ARFD 2X6VA 2YMXH 1KJ2H 1I31A 2VITB 2V7HB 12E8L 3GJFA 4CMHC 4OFYD 3UX9B 1HX0A 1LLAA 4GW5A 3BGAA 2ZCHL 4N8PA 1CVSC 3OHXB 2GPZA 5AZUA 2X87A 1U8PB 2XTJD 1IC7L 5I24A 4YDMA 5E8OB 1SY6L 4L4JA 1Z66A 3NJIA 5I8CB 1R3LB 3ZE2E 4JR9H 4FKEA 3ZT6A 1TZHB 2CK0L 2W1NA 1WK0A 3PWUB 5E1GA 3HI6L 4X8GA 4N2DA 4OY9A 5KS9A 4U1NA 3BD4A 1NQBA 5DK2B 3LS4H 3MREB 3DOIA 3DX6A 3PJLA 4LHUA 5IW3A 3TJPA 5DFAA 3RPKA 2B1HL 1R5IA 2NY5C 4NHUA 4CVZB 4KROD 2F8IA 3FOMB 2VDKB 3BZEA 4HS3A 1FH5L 1E7VA 1Z32X 3QEQB 1UC6A 3MBEC 4FULA 1MWAA 1I8MB 2VQ1B 5DJYA 1E7UA 5GRYA 5HHQB 3WL9B 3WS6C 4L1DA 2JQAA 4ZUTB 3KJ6L 3BVVA 2CR0A 4Y88A 1RZJL 4U1JA 4PWFA 2B2XL 1IX2A 1JTPA 3D07A 3HB3B 1ID5I 1LDPH 1UASA 1N18A 3VXRE 2XBTA 4MJ4A 1EA9C 4KMTH 4PHZA 1FQ9C 4OKDA 3VNYA 4XPBH 4XOBA 2F0CA 4IHBA 5AKVA 3X3GL 2YXMA 3WNNA 1T4KA 2APBA 3ME0A 4NS0A 3UZVA 3O6FA 3K4AA 2IEPA 1GL4B 1OK0A 2P43B 5IM7A 3PWLA 4OBSA 1YUHA 1ZE3C 4QR7A 1JCVA 4LPWA 4Y19D 3TF4A 5G55A 1MI5A 2VDKL 1EO8H 5G5DB 4D2NA 5KYWB 4ZXBB 3VD9A 1F56A 4HHGA 3RWHA 2F8OA 3ATAA 5CZKA 1Q0YL 2O5ZH 1WUNT 4QHPA 5AW0B 5IWLC 5J6GB 2DW5A 1L9TA 2H32B 4PRHE 2JJUA 3CCHB 4NBZB 1P5UB 5CZVL 4ZUUA 4UT7L 2WKOA 4L8SB 1TO5A 4NAMA 5E7FA 3NIGF 3QJUB 4HCIA 5DD3H 4ZJ9A 3ZKND 2Q76B 2QT6A 2ZSWA 3ARQA 3BP5A 5LCVA 1BJMA 3LV3B 1XMEB 3U4EB 3DVGA 5LCVL 3R7RA 1KCBA 1OP9A 3G6JA 3AWGA 3LVEA 1D5XB 4JFQB 4UYQA 3EZJB 1Q9LB 2MQ3A 4UIMB 3BKCL 3OF6A 2XPGB 3LXBA 3MJ9L 3I9GH 4XNUH 1ZANL 4PJ8C 2EIEA 4IGBD 5TFSH 4P5SA 4PH8A 2XV3A 1N70A 2OYPA 2H2SC 1BD2B 4O2CA 1SF3A 3FCSA 4OF5A 4KRLB 3MXWL 4Z7VB 5E0QA 5FK9B 4EN2A 4HV8A 4K7PL 5E2VH 4A7TA 1A7OH 2WLNA 1I1AC 4PJHE 1KV7A 3ZR6A 3O0LA 3APCA 3P9LB 1JAEA 3AB0B 1JV2A 4BWTA 1W0WA 2K70A 1FAIL 2B20A 1G7PB 4MDIB 3HAEG 3KPSE 3ZDYB 1N0LB 2VZVA 3DOSB 4LCWA 1PKOA 4PGBB 4Q9RH 2LHAA 1EDYA 5CINH 5B38A 1SPDA 5AZEL 1M6OB 1LGVA 3N04A 3SDAC 1QA9B 4TTDD 3GRWL 1QSFE 3LTVA 3OKLB 4YLCA 5E23A 2IH1A 1NFIB 4LNRA 1C1EH 1BQSA 3KWVA 3CSFA 3P4OB 4NHCH 3EOTH 1E4XH 3SYCA 5INDB 4EI5B 1WC7B 1RUAL 4Z0XA 2PO6A 3NVQA 5ID1A 4X0NA 4P48A 1RZQA 3UADA 4N90E 3DOHA 5BZXA 4QWWD 3CLFH 2FR4A 3C09B 4XP4L 1BZOA 1PZAA 3MQIA 3WUWB 1HXMB 3H0TB 5F0PB 1FJ1A 5JW5B 4GLRH 4NKOB 1IU1A 1ETJA 2EEBA 5I73C 3T09A 4JM4H 1MCSA 1FNFA 5L88H 1JGIA 4ZNCD 3VGAB 5EEVA 3EYVA 1DZBA 2R4RH 3ZYIA 4U3XA 1LWRA 2BINA 5EA0L 1ZDQA 5GSVB 2ZSWB 1QQDA 3ILDA 5DRXA 4N2MA 3EGSA 2OTWA 1J5OL 4DPBX 4X4XB 2AQPA 4JKMA 4B0MB 4KO6A 1I8LA 1NFDF 5C2BL 1L7TL 2WUBH 2FHFA 3MA7B 3WDJA 2BNRD 1NKRA 3QIWC 1I82A 2FJUB 2VDOB 1OM3H 4LSUH 3O0RL 2X7LA 4AXWB 1YYMH 2FECI 2FX7H 2WOYA 3ZYJA 3ZTJH 1R6VA 4XNZC 2EVFA 2WM0A 5J0BA 5CINL 2BNRE 4L1HA 1YN7A 3VXPB 2FWUA 3ZTNH 1L5GA 5DUBB 4QKTA 5H8DA 4HIEB 5F0LB 5K1NA 5K59E 3FO2B 4X2UA 1QI5A 4ZD3L 3N0PB 1N8ZA 3S34H 5T1KB 5D1ZB 4X8JB 3VWKD 1R3JA 4PGEB 1NM4A 3RY5A 1ACYL 1F1DA 1NEUA 5HD8D 4YSQA 3C5ZD 5EC1B 2NX5D 4TULH 5FDWA 5DJ0A 1TTUA 3L16A 5JOEA 1GW6A 1UH4A 3QQXA 4OM1H 3PHOA 3FQ1A 3D12B 1L9QA 2XA3A 3MA9L 3QIWA 1Q1PA 5EU7E 3V5DB 5I5MA 2H3KA 4IIQA 1YMME 1RZ7L 1J1PH 4QTHA 4BZ2A 4L0ZA 3PWUA 3B56A 2ICEB 4XPTL 5JW4R 1G9MH 2UX7A 2NNFA 4TSCL 3JYBA 3UMTA 4DGIL 3EOAA 4EI5C 4ZMLA 1S2EA 5C0CB 5C7ZA 3SD5A 1KIQB 3DGCR 4X5XB 2F54E 2X38A 3NCYS 5DMGD 3VFRB 4WTWA 4JG0L 5ETUA 4XPHH 3DVNA 1VERA 4XTRD 1XZWA 2X4RA 2ZP0T 4BFGA 4W9FC 2O5ZL 4JZOA 2YS4A 4GW4B 1AGFA 1F41A 3LZPA 1CD9B 3EDKA 4WKZB 1OP3K 4N20A 5MENE 1DQLL 1AI1H 2ZUWA 4P2OD 3FRPA 5EF3A 1HHHB 2OZ4L 1IEBB 2AJZA 2LU7A 5LXGL 4DEPB 3ZL2A 8PAZA 2EDLA 5E5LA 1K6QL 1J5DA 2C3HA 3H9ZA 4PJCE 3WYRA 1AGBA 4JPVH 4IIZA 4ANKA 3GF8A 1I7TA 4EDWL 5EFIB 1G7JB 3UZQB 2WINB 2XWRA 1PD0A 2AITA 2WBWB 2XN9A 1QP1A 3G5VA 3QHFL 4JJOA 2A77H 5LGJA 4PJFF 1QG3A 5DZNA 2Z7ZA 5C9KA 4JUSA 1FZOA 3WFBH 5KYUB 1EO5A 2FUTA 3K8LA 2FO4A 5E4OA 3TA4D 4BH8B 3B34A 2WVTA 5FYKU 1NZRA 5DMKA 5DHDA 3BRDA 4PAZA 9CGTA 1P7QD 1A6TA 4L8CB 5DUPH 3PP3H 3CHSA 1LO0L 1UOWA 3TVMC 1RQ5A 1FH5H 3T6ZA 1HYSC 1WGOA 3SJVB 2VZSA 4UZUA 3CZJA 2WCGA 4G8EA 4Z7WF 4HUWA 4XCCL 3UAJD 4A68A 1MH5B 3JZYA 4UUJB 1JNJA 4QHLA 2VDPL 1BZ7B 1ZVSB 5HDBE 1HHKB 2CNZA 4YLQT 3WMQA 1OPGL 3T08A 3QEQE 3O3DB 1IC7H 1PG7W 2V7HA 2LTQB 3GJFB 4WZ9A 4XAKE 2YEVB 3RX8A 3PL6C 2DQJL 2D0FA 5IBUG 5IHLB 5K93A 1TVHA 3VD0A 2AQTA 1PZ2A 4KKCD 4XCYA 4Q6IA 3ILQD 1B0IA 3TV3L 3P54A 4AZ8A 3QPKA 5C08D 4TVPL 3VXRD 3UL4A 1N7MH 5I74B 3WFCL 2UUDH 3D25B 4GKNB 1T22B 4J3VA 4ZPTB 1TJXA 2AJSL 1INEH 3H1ZA 4IKKA 3ZKMD 2YAMA 1PVHA 3MREA 4LHUB 3GS7A 1N0LA 4JRYD 3SPIA 3HPJA 3V95A 2VABB 3LQZB 3QJHB 3W39B 1F1AA 1FWXA 3BP7A 3SY6A 1T1WA 4APXA 1IB5A 4FFYL 1JNNH 3HS9A 7CGTA 2F5AL 3T1FA 3AU0A 2VDPH 3VXRA 1MWAH 5E8DL 2VN5A 1WITA 2JCCA 5AEAA 3U6RA 3WY3A 4LMQI 1S7QA 1U58B 5KSBA 1T03L 2Z7YA 2P47B 2XZCL 4Z8FH 3ULVF 1C08A 1GSKA 1JPEA 2XZQL 5H37G 1J18A 2KC0A 3IMRA 4P9HH 1Q1JH 3U0TB 4Y5VA 4JKPH 2W88A 2HYMA 1R3HA 1FCCA 2OS7A 4PBWD 1JPTL 1VCBC 4JFYB 3O6ML 3DHJA 1QLRB 1MY7A 3D1MC 2VOTA 5CD3B 1N4XL 4GXUN 5CCHE 5HHQA 1EXHA 2CHNA 4LLWA 3QQ4B 4PJCF 3VAEA 1ZGLP 1MI5B 4FQXC 3BX7C 4Y9CA 1IC0A 1H8OA 3IDNB 4R7DB 2UXVA 1KN4H 1OB1A 3WNIA 2AERT 2VTFA 1I53A 2UZXB 2VDNL 4EDWH 5CSZB 1KPVB 2VZ1A 5DUJA 4LE8A 4NM4L 3QI9C 4GSUA 3ZQWA 2L4OA 3L9EA 2V9TA 4WWPA 5GGVH 5KOMC 3OPZL 5JDSB 2Q76A 3OJMB 1KZYA 5DEZA 3WI9A 3PABA 4XBMA 4AOFA 1MW1A 3HG5A 5FIEA 1MG2C 1FH2A 2ZOUA 3AY4C 1ZWIA 1J0HA 1OHQA 4YFDB 2I25N 3RB7A 1LD9B 5HHOE 1KOAA 1H6FA 4G8FB 4RLDA 4CADB 1MVYA 2V3EA 1NKGA 2ERJB 4ZFOB 2X70B 1XH3A 3DMMB 2B08A 4ZUUB 3AS2A 1X5LA 4ETYA 4QUOA 4DGIH 2Y1AA 1FZJB 2PWFA 5EZJB 3N43F 1HL8A 5IOPA 3D06A 5LBSA 4QRPE 3NBNA 1XF3B 3P9LA 2CE6A 1YEHH 4RESB 3VCLA 2GYSA 3QJOA 4TL4A 4R4FH 4P46B 2H0JA 2VN6A 4Y2DA 3TJHD 1R3IL 1AZUA 3DSFL 5CILL 5JPMB 2MTAA 3HS0C 2XKUA 1N4XH 2KMWA 3LZQA 4HEPG 1EXGA 3HCVA 2CA3A 2W0LA 3QQ3A 5BO1L 1H3UA 1CYWA 1TTFA 3CN1A 1OT4A 2XCMC 3PAVA 5G4MA 2X42A 3MNDA 3IF1B 2J56A 3M1BA 2ENPA 3NPZB 5DJAB 1I9JL 1BQKA 2VQTA 1JFQH 2A9NH 2MIZA 4AYID 4ZD3H 4ODBD 2XZCH 3IKCA 1ND0B 3ARED 4D8PA 1Q9KA 1KCUL 1T7VA 3QH3A 3IMBA 2APXA 3RDTA 4Y19B 3FHEA 3DX8A 3W2DH 1JGDB 1DBAL 1PZ3A 1EK3A 3NN8A 1GHFL 1W0VA 2X4PB 5FUCC 4PY7A 4FQXB 2B3IA 2AJZB 1IEBA 1G43A 3HB3C 1MWAL 1ZLEA 1DE4A 3BT0A 3HI5L 2Y06H 1GJUA 2OXHA 2YAQA 4HXBH 5TF1L 1OP3H 2EIKB 3BKML 3PF2A 1AGBB 2ZUQC 3KW7A 3VACA 1G9NH 5I19L 4M93B 4OAWB 4X6DF 4N2BA 1DQML 4WF7A 4E41D 4E5XA 1BG9A 3CFMA 5E2TH 3IMSA 3MLXH 4OLYL 3GT6A 3BSZH 1Z0MA 1CT8A 3WO3B 2K4AA 4JDZA 4HKZB 2K7QA 3KPQA 1KTRL 3VXQA 1XCQB 4N2OA 1B6UA 2VDLB 1MIMH 2OMVA 5FR3A 1YEJH 1JN6A 4X0KA 3WE1A 1S7TB 2IALB 1VEOA 3N1QC 2DQCH 4TVPH 3T0ED 3FU9A 4H1LB 5IQOA 3VXME 3QEQD 3WO4C 4L5FL 5JIHA 1DQQB 1QRNB 3MRQB 4XPAH 1F2XK 5GZND 3TA3A 4AENB 5GS0C 3O2VL 1YMMB 1G4RA 4JFOB 1WFMA 5DUBA 4Y1AA 1NICA 1ML0A 3ALXA 1XSJA 2YKKA 3VG0L 4M7ZC 3ZSTA 2CHDA 4BRJA 1VACA 2DOCA 2R1WB 5J1AA 1AC0A 4I0KA 2JFCA 5DRWA 3PWVA 4R8WH 2XNAA 1C16B 1I9IH 3SYQA 5F3HB 2YLHA 2VXSH 3EFOB 1B4JL 3PP3K 2EIJB 1T21B 5FUOH 2C3VA 3CDGB 4OLXL 4NP4L 4G7VL 5HVWA 3IGAB 2Z92B 4K55A 3RNQB 5HHXH 1CFMA 4KUZH 2OKMA 1LP9F 4Q6IB 2Q86A 5SWZD 2J55A 2R23A 3SDXE 4BCXA 3DGGA 4Y4KD 3V5DA 3W9DA 5IFAL 3DBXA 1JZHA 1OZUA 2XXCB 1HL4A 4RMTA 1WEJH 3QDMA 4YGVA 1L5GB 1XO8A 4ODUB 4OKVB 5EUKB 3LN5B 4OD3L 4OZFB 4UV7L 2GY5A 7FABH 3Q6FA 4ZOCA 1DDHA 4M9PA 5D7EA 4LCWD 1PY0A 1DQTA 2QKSA 1RZGA 3CV5A 3GIVA 4MHHG 2DM3A 2C3WA 5CIPH 1ERNA 5EUOB 4HK0B 1NMAL 3QNXA 3OHXA 3DO3A 3FTWA 1MFCL 2Q7AA 1WICA 4OT1L 9PCYA 1W15A 1PCXA 4I8DA 1TYRA 2EVIA 5E99H 4GUPB 5BS0B 1FFNB 5LCVH 4DW2L 1MZYA 1KCRL 3VH8G 4R3SA 1J8HE 3RWEA 4FLOA 5K33A 1P6FA 1KWGA 4JO8A 3J7HA 3UTTA 2VJ8A 1NMAH 4PJEA 3K2IA 4UF7C 3RVTD 1SXAA 5IMMB 3U0WH 1Q9WA 3EGDB 1ZLUK 1AKJA 2DQMA 2H0FA 2H1XA 4RMWA 4N24A 5F9WB 2XJLA 2Y4SA 1AJ7H 3KDMA 4QD2E 4ZSOE 3TEZA 1KB9K 4AJYV 4W9ZA 1UWGL 3ZL4H 5J12B 5D5MF 2NLJB 4TLKA 2YSTA 4WI8A 3ORJA 4OZGE 2BS71 4EIGB 1EZSA 4BH8A 3K6NA 1MI5E 4L9LB 3REWA 4WU7A 3CFDA 4PV8A 1Z5LB 1F00I 3ARGD 4NENB 4MTMA 4V2BA 1OP5K 5JHMA 1VPOL 1GKOA 3K5RA 3MLRL 3OQ3B 4FHKA 3TBSB 3PXJA 4LHQB 4Q9BA 3A67H 4TV3A 1NPJA 4K7FA 4OD3H 1DCLA 2YZ8A 3H42H 1A4AA 5F1IB 4ZYKA 3WMSA 2I60H 1U8QB 1ZT7B 5DI8A 4AQOA 1MDTA 3UGXA 2DYPA 1XGQA 3DPBA 5HHNA 3I3BA 1X5KA 3TO4A 4RBPK 1G6RH 1CLYL 1BIIB 4G9DA 1NA8A 1NMCB 3KDPB 4WCYL 1DBJH 3S4SA 3DHPA 3D4CA 4IQHA 4M43H 4XE5B 2BM3A 2C8NA 4NP4H 4ZK8A 3V4VA 1ZKAA 2HRPL 4LARH 1L9PA 2CO1A 3QO1B 3P0GB 4ZW3A 4S1SL 1OM3L 3RPIA 3VA2C 1XCWA 4R4NC 3FAWA 1SM3L 3U4EA 4DKDC 4UDTB 1JPST 4IBSA 2HB0A 1P1ZB 2Y2YA 1EZUA 4Y1TA 4PLJC 1SY6H 1SLVA 2UXGA 4M5ZH 1J5OH 4RDQF 3T65B 2XI9A 4Y4KA 3VDCA 4ELMB 3L5IA 4QRPB 3EJQA 3NZ8A 1KIPB 3L7EB 4QRBA 3ZKSD 4JFTA 2YXWA 1U41A 5TD4A 2ZXEB 3BKMH 4F80A 3C6SA 1Y1UA 3ZE0F 1I3RA 2FR4B 4CDGC 4P23C 3TBWB 3WN5C 1KTDB 1O7DC 3IF1A 4Y89A 1U8PA 3BRFA 4HIQA 2Z93A 5D7HA 4WI4A 5DT1L 4W4OA 4RWYL 4IRSB 2FWSA 2OJZH 4K7PY 4HUNB 4XP4H 2GB2A 4AQEB 4XOEA 4JW3A 4AYFB 4OZIF 2L7QA 2VDOL 3W82A 3P9WB 1XF4B 2OW6A 1FYTD 2PCXA 3MRGA 3ESMA 3FFDB 4HWNA 4NRYA 5B1BB 3T6VA 2VL5B 3BVWA 4OGZA 1FL3B 3GRWH 4Q97A 1N5AB 2MEJB 3BPLB 3HFFA 3WEOA 2VDRL 4MQTB 5DHXB 1E4JA 2F1AA 3GRWA 4WDIA 5HHOB 1XGTA 5HGHA 1YEHL 1FAIH 4KZEL 1AOZA 1O75A 3LSOB 1PDKB 3ZY7A 5H35A 1I3GH 4OJYA 4EF3A 2BP5M 2Y23A 4NFBA 1W91A 4XBPA 1J8RA 2YPKA 5ESVB 5TQ0L 3QRBA 3BZEB 4P3WA 1KENH 3BAXA 2VM3A 2FJGA 3QJQB 3EYVB 4P23A 2WY3B 3WN5A 1URIA 3L6FA 4NJ9H 4NDMB 1DSFL 3EHBB 3MV7E 1EERB 4ZUWB 3SGJA 5HYJB 5AB0A 4HBCH 4ATTA 4HC1A 3TYGL 1D7BA 2G75B 4LKXB 3ZE2B 3GUTB 3Q48A 5D71H 3PL6D 2HA1A 4QXTA 1I9EA 5CFHA 2EXTA 3POCA 1Y0LB 4G1EA 1DJWA 3O45B 3QG7L 4F7PA 1X7SA 5LWYL 2VM4A 2GBTA 3LEYH 5LNEA 3MGTB 1AY1H 4L5FE 1TT6A 2WXPA 1KTDA 1GPOH 3P0VH 4ZFFB 1F11A 1JXJA 1JMZA 3ATDA 5I6OA 3V4VH 3LN5A 4HJ0D 5ANMA 4NM8L 4YR6B 3MV7A 3ZUCA 3W9EB 2VDKH 4U3CA 2EEXA 3MJ8A 5D7KD 4YFLI 2BNQB 5C92A 1JGLL 4FNSA 2FD6L 1F6LL 4G8FA 4GRWF 4BA0A 1IAIL 3QIUD 4J23A 2O1AA 4KK6D 3SBWA 3V0WH 2I5YH 4HK0A 4RNRA 1IAIM 2AJUH 2VNCA 1OD9A 3V6FB 5D7JC 4E2OA 1XDQA 2N4IA 3IJHB 3OBAA 4B9FA 5EMYA 3C60C 2IH3A 2NNAA 4WNSA 5EC2B 5EUOE 3RDTC 4PSPA 1GJWA 3MFGB 2XTLA 4WFED 4CW1B 2IGLA 1EZVX 5B1JA 2G5RA 1QX1A 4QYOB 1T1YA 2Y3AA 5D7IE 4JFDD 4PJEB 4U1HB 4JKPL 5ANME 3WTSA 4GIAA 1Q1JL 3GBMH 1A1NA 4S1DD 3S36H 3QIUC 1NCNA 4TVPD 1ZGLB 1MEXH 1T83C 4OCYL 4C4KO 3LHPH 1DLFL 4PRHB 5DJZB 4F7EB 4CMMB 1QR1A 4KJQD 4OB5L 5D9SA 2ZSVB 4RX4A 5AWNH 1U8CA 1UH3A 2JKIS 3FUJA 3Q5OA 5DD6A 3VWKC 1YVLA 2IBZX 1QVOA 1JZFA 4KV5E 1F86A 2XV0A 4HU2A 4ZMTA 3BVNB 3S35H 1XGRB 1ZE3H 3MJ7A 5IB1A 5EEZA 4YL4A 1MQKL 3AADB 4KXDA 4IGBA 1FF5A 1FJ1B 2C1PB 5IMKA 5IK3A 3V0JA 4DEWA 5JW5A 2O6PA 4RZCB 4FD0A 3F12B 2JH2A 1SDAB 4LB8A 2X3BA 2VDLL 5D4JA 5TDNB 3K71A 4AENA 2CUHA 2GJ6E 3OL2A 3SBWC 4ODSL 3WSQL 1JPSH 4G6AD 1ZLVK 5C0JB 1ETZA 2JB5H 3MV8E 3M45A 4OGAD 4LVEA 4PJXB 3K2KA 3AG1B 2FX8L 5T3XH 3QULB 4P4KA 3DV4B 2AK4A 1D9KC 3WIHA 2VJXA 4JZJA 4GT0A 4PJIE 3F04A 2BNQD 3RUGA 8CGTA 3LXAA 4J3SA 1OAQH 1R5VB 3WKYA 2JWYA 4LK4A 1COBA 2FEDD 2FT8A 3P69A 4GI9A 4OCYH 4JLRB 3H4HA 4XCFL 3GPSA 2EP6A 3B6SB 1EFXD 2WVVA 3ME0B 3Q1SH 3T3ME 1MCJA 3UTPD 2VMFA 3MBXH 5GGTL 3PREA 3OV6A 4Y1AB 4PJDF 1P53A 4FNLL 4IYKA 4O5LH 3PIQB 5IBUB 4B7IA 2Q20A 3IAGC 2XZAL 1TCRA 1CGTA 1D5IH 3K6OA 1IAOA 3P77B 3BRGC 1DDHB 1RLWA 4K94L 1LK3H 3F01A 3VB9A 3C5SA 4NUQA 3KBFA 5DR5H 1KYFA 3PRZA 2CRMA 3SDCB 5IB2B 4L48A 2N7BA 3TFBA 4Q6YA 5DUPL 3FTVA 1AG0A 1I3UA 2XG5A 2WQAA 4WFHD 3Q3GA 4BFIA 5LXGH 2P3YA 4Z3IA 4B53A 2OK0H 3SYPA 5D1XE 3SN6N 4N9GA 1FE8L 2CA4A 2X6CA 2BRRH 2FNWA 4YHMH 4D9QE 2V5MA 2YARA 1A6AA 4IRSA 3M8OL 5D1QB 3ARTA 1T66C 4OJEH 4AYFA 2EDTA 4JFQA 2YBRB 1H3WM 5I0XA 2FB4L 4OZFA 2WYZA 4QRRE 2YJLA 4ZO6A 5F70A 5E95B 5LWYH 4UQCA 1KY7A 4APQA 3WUWG 2YQBA 2DLFL 1VFBA 2EUXA 2DM7A 5TE6L 1QSED 3QP3A 5EO1B 2DMHA 2R83A 4TNWF 3ARGC 1B2YA 4AJVA 4LLVB 3TLRA 3E38A 4HBCL 2D31A 3FUNA 4R5TA 1MNUH 2NQDA 4TNWK 1A7NL 3HHSB 3NIFE 4JL2A 3CVHH 4BK5C 1J5HA 3ROOB 3LSOA 1U3HB 1LEKA 3KLHC 2OPCA 1BG1A 5AOJA 1G0DA 1HHHA 1SFHA 3V4UH 2EUVA 2JB6B 4L4TB 1OGSA 4R7LA 4YK4B 2ED8A 5SWSA 1LE5B 4KNTA 1F90L 5JXEA 3MRPB 4OCRH 4GAYA 4CBZA 4RQQB 5E4EB 1EBAA 5A2CA 2IH1B 3VI4E 1RXLA 4YS4A 1QLRA 5AVTB 2HKFL 3TWYA 1FNSH 3IU3A 2ADYA 1ZT7A 4GSXA 5IJDC 3F83A 2UVEA 2IADA 5DURD 1HXMA 2YA2A 3COOA 3H0TA 4TRPL 3ETBJ 3U9UA 4GFXA 3RVVC 4HIPA 2GKIA 1IKNA 1NCDL 3ZE1E 2ICEC 1NFDB 1FIEA 1P7QB 3L9RA 1IQDA 3FRPB 1S5HB 2D9QB 2EIBA 4GKOA 4NQTA 2GUYA 4PV8B 5F7EL 3CFEB 4LSTL 2CALA 4CSSA 3BEVB 2A9DA 4XT1C 3KXFE 2VDQL 4YHYB 1JUFB 4PS7A 3N9GH 5I71B 2R0KH 4ZI8A 1JYVA 4XP1H 4MHHI 3EGSB 5EA0H 3UPRB 5AB9A 1DL7H 2Z9TA 4QRPA 4WO4D 3ZTNL 3L13A 1DANT 1GAFL 3ZKNC 5HYSB 5D1QC 5T1LA 4GAJL 2D2OA 4NC1C 3MKKA 4TUUA 1YHPA 1TO4A 4ONHA 5PCYA 2QVTA 2VGLM 3P4NA 3FU5A 5JHDE 5BUAA 3AG4B 1WISA 2H6PB 1FZJA 5EZJA 3PGDA 3VXMD 3I9IA 3W11D 2VLJD 2HG5B 2N7SA 4OLVL 2JJVA 3EJTA 1D5BA 1SBSH 2H2PD 4FMKA 2ITCA 1BREA 1RUKL 3MKGA 1TZ8A 4I5BA 4XMWA 1EAJA 2OR9L 4NHCL 4BEIA 5LKNA 1DN0A 3II3A 1IGTB 1PEWA 2O61A 2V17H 2ISDA 3MXVL 5C6PB 2VR6A 1T2QH 4D7BA 3HZVA 2ZUUA 3HLAB 1DJXA 1ZLSH 4I1PA 5HYJE 4FI6A 2QZ5A 3CLFL 1N67A 4Y5VC 4ICWA 4RIRB 4FLSA 3VRJA 1F1GA 5IESH 1X6NA 4HZAA 4GG6E 2PWGA 4IIQC 3RBSA 1KPRB 3DLQR 2ZZUT 5I1GH 1S5IL 5B4MD 3EOTL 3C5ZB 4HUMB 2ZYIA 5C97A 3IDXH 3U48A 3CPLB 5E2VL 4TTGA 4A7GA 3S3SA 1S7WB 4IEFB 4FI7A 4DPAX 4U6XB 3ESVF 4P06A 4RAUA 4DVBB 3C6LB 4TQIA 4A2GA 3FHQA 3QJXA 3L2NA 4N2CA 4Q8BA 3BQUA 2DWSA 2K9FB 3S98A 4HJGA 3MJ9H 1AOHA 3FJTA 2ZOLB 3HRZB 3X13A 4E9VA 3JWOL 4OSUL 4PTUB 3CDYA 1JTTA 1ZTXE 5HYJA 1FP5A 2ENSA 4F7MA 1XCQA 3UBHA 4QHUA 5EORL 3AREC 4XE0A 3EYSL 1MZZA 4WO4A 3L4YA 5FAAA 4EIBA 4RAVB 1QSEA 1HHJB 2G3XA 1VGEL 3HNTL 3OAWA 2I7SA 4G42A 3U0WL 3ZDZE 5I1IH 2UX6A 2YPKB 3HZYA 4GAGL 5ESVA 3MRQA 3TA3B 5JO5A 5DFWH 4NKIL 1S6NA 1WC7A 2VMEA 1D6VL 1U92A 3EFFB 1KV3A 2Y22A 3LB6D 2QHRL 4HMCA 4ANVA 1AIFA 3VE0A 4GQ9H 5ANMB 3WIFB 2FATH 3OAZK 1HVXA 1MLBB 4L4VB 4NZJA 5J3HC 5EEXA 1MCPH 5DD3L 1LMKA 4NQEE 2GI0A 3IT8D 4AYBA 1FV1A 5DMKB 3TF7C 3RWDA 4PQXA 2ITFA 3O11B 1UYWH 3O41B 5TH2A 3TNNA 3GSWA 3MROB 2E7BA 4TKWA 2PYEA 3GLDA 3T2QA 2OJEB 4XNXL 3V2AR 1ZVNA 4IMKC 3SJVA 1IGFL 2BSSA 1E9PB 4X7CC 4DPRA 1H5BC 1YUKB 4Q9CA 2QADB 1QRND 4QKXB 3BAYA 3LQAL 3BGMB 3O4OB 4G6JL 1BVLB 1CFSB 1GS6X 1B2WL 2H9GB 4MA8L 4Y2DB 5TE4H 3ZT5A 2ZX5A 3MRRB 2I9TB 1LD9A 3W5MA 1JNLH 1G7MB 2GJ6B 3L3IB 3WXWL 1IZJA 1YEFL 2GSIB 3QFJB 4GIPD 4XPBL 2AZAA 5KUMA 1PQZB 1EXUA 1E4XI 4ONFH 5FUOL 5LG6A 4GS7B 1B4JH 3P11H 3K74B 5EZLA 4JVWA 1I9IL 4XCYB 1G1OA 1MREL 3L1EA 1R24A 5EZPA 3EG9B 5DJ2B 4PJIB 5EU6E 2CK0H 5FM4A 5IVZB 5JLZA 2GTZB 4Z5RA 4F57H 5KOVC 1AHWA 5T1KA 3ULUL 3WIHH 2I26N 1B9ZA 1QI3A 4IGBB 4MCMA 5HPOA 1CDHA 1J1OL 2R2BA 4LCIL 4PJ8B 2XDHA 3L54A 3TZVA 1QASA 3NIFB 3UBXB 3V0AC 4U1LA 1WZLA 2WAQA 3STLA 1CLZH 3HE7C 4H0LC 5CD5D 1VZIA 2XRAL 1GGBH 3ARRA 3QNYB 4UT9L 3LRGA 2PTTB 3MRFA 3I6KA 3O8XD 1QBML 4AG4H 2Y3NA 4PVNA 1MFVA 4XMLH 3IVKB 4LKCB 1C5DA 2NY7H 2EC9T 2Q1EA 4WU5B 5DUMH 2AK4B 3RRQA 1TKWB 3VSQA 3MLXL 2Z65C 1KT2B 2W38A 1XGUA 2JCWA 2O72A 1NCAH 3DX8B 4FFYA 5FO8A 1FORH 5IQ9B 3I50H 4JKNA 3AZUA 4BZ2H 1T7XA 4K73A 4GRLB 2DLGA 2XG4A 4LVNC 4OTXL 5CMAA 2ZX8A 5C3IA 5I1EH 2BIMA 1PS3A 2AQ3A 3H9SB 1TZAA 4JFDA 4LCVA 3KGRA 1IM3D 1X9RA 4EMZA 1WAAF 4LLWB 2DJMA 1MCOL 1XR8B 4LBEA 2X0UA 3RVWC 1YPZB 4FGMA 5ICXB 4DZ8A 1JFQL 4TUOA 2EUZA 4GMTH 4PIRF 4XBGB 3IFPA 2X1WL 1CXKA 1KJ3L 5IB2A 2G4GA 3LNHA 4NKMA 1UKSA 3HMXL 1T5XB 3PABB 5KEZA 3QR2A 5IWLA 3KEHA 2IV8A 3GXNA 1F4YH 3QFJD 4QDGA 3HLKA 4Y4HD 2GJ6D 3DJSA 4G80A 1B4RA 3NCJH 1WBYA 4MA7H 1YEDB 3TH3T 2PP9A 1YEEL 5B1KA 1YECL 5F8QC 3BT2L 2UY7A 3N85H 1AQ8A 1OGAE 1ES0A 3L4ZA 2J88L 3ZRSA 4KU1A 2F53D 2ZOOA 4ZO9A 4QAMB 3MGOB 1SYSB 4HJJH 3X11A 3V52L 3I2CL 2IMNA 1JV5A 2YMTA 3E8UL 4K23L 2WXRA 4MQSB 3SY0B 3LNDA 3K5SA 3ILEA 4FQLL 4NRZB 3TIDB 4G8EB 3D0AA 2XG5B 2G4EA 4F58H 2R69A 3R0MA 1AR1D 1K2DB 3HR5A 4MXWH 2RACA 5DFVD 1LVEA 3VXUD 4XP5H 1RK7A 5LBSH 1K85A 3VD5A 1FN4A 5EUKA 1P4UA 1UACH 2FZ3A 1BBDH 2YWZA 4XBEL 1I8KA 3CZUB 4ZPVA 3ARFB 3ARBA 3QRGH 1I7RB 2OMTB 2AP2A 2QQNH 2J57A 4HCGA 5FF6B 4DKFL 4POZD 1NCCL 4JN1H 3KPRB 3S48A 1FSKC 3ZN6A 2MCG1 2R1YB 4PLOB 3IEAA 3N55A 3U6XS 4S2SA 4X7SH 3VWJA 1XF2B 2WGXA 3D18B 3LKSA 4OJFL 2ED7A 4C47A 5AVSB 1EHLH 4X7EC 1XGTB 2MWCA 2RTTA 5JUEL 2NXZD 3II1A 1A3LL 4U1KA 1B90A 1NEZA 5GGRA 4UBDC 5D7KE 2B16A 3D0VA 5I1AA 4GPVA 4FL4C 4BZYA 1I1RA 3EBHA 3VFOA 3RGVB 4Y4FB 1I1AB 4JFEE 4OI8A 1T1XA 2CXGA 2QVIA 3SE9H 3VQ2C 3VXRB 3U46A 1XH1A 4NPYA 1N5YH 2VXTL 3B9KC 3NSXA 4MS8C 1KJVB 3OAZH 4KDTC 5ICUA 2PW2A 2F1EA 1E28A 3AUWB 2ZAHA 1FBIH 1NBYB 1UWXH 3ZZ1A 5ALCH 3RFRA 2FCBA 1T03H 1ORSA 5DQ9A 1IIKA 1YEDA 4UNIA 4QRTB 3HE6D 2DQHL 1L0YA 1X4YA 2W9EL 4PP2A 2C7UB 1ASOA 2F5AH 4YHLL 4OJFH 1ZV9A 2Y6SC 3WFHA 5I16B 4X7TB 1SYSA 1YMMA 1HHIA 4KGLA 5I1CL 4JRLA 1T66D 5D7LD 4U1MB 5FPIA 3ULSB 4E9LA 4RRPA 5IMLA 3WIAA 1EZLA 1ACCA 4HZLB 3BXNA 1N6QH 1HEJC 2EDRA 2F74B 4YAQB 1J9QA 3PWVB 5GRUH 2FJFB 1GYAA 1C16A 5IT2H 5E70A 2APWA 2WQUA 1DDTA 1E50A 4MGXA 4B3VA 3B2VL 2YAOA 4F8LA 2Y5TB 3MLWL 1E8ZA 2IQ9H 3IGAA 4HUUA 5EU6A 4OZGB 2QPUA 3W5NA 1YMHB 4ONHB 5C0AA 4OCMC 4NFDA 5H4YA 5A6IA 2XC8A 3I6GA 3QXAB 5IVXF 2JQMA 1KBGL 4N8VG 5INCB 4KKLC 4Y16D 3UCQA 1R24B 3OC5A 4HCRL 1FO0L 5LUMA 4W9KC 1AP2A 3AXLB 5DVNA 2XQBL 3RHWF 1W8OA 4CC1A 4EE2A 1GYVA 1BVZA 1H5BA 2HH0L 3EYOB 3FCTA 4PJHB 2YRZA 3QNFA 5CU9A 3RHWK 4WWKC 1I8IA 3MNVB 1IM3A 3ZQXA 5ESAB 5HI3D 5BRQA 1DVFD 3NCJL 3APFA 1KJ2B 5FHBH 3VX1A 1CFVH 2DN7A 1F4YL 2WLZA 3H7LA 3MOAH 5DWUH 4YOKA 3WLBA 2NY5H 5E6IB 4KBPA 1A1MA 4M6AA 4MJ6B 5E6ID 4O4YL 5C07E 5I18L 2MPVA 4GMTL 4U31A 5I17B 2WXMA 3FL7A 4GBXC 4GT7A 1A6VH 1LO4H 3WKPA 4NQEB 1E27B 3B9DA 4J12A 2J7LA 5GS1A 4XMKL 1OAJA 3QYNA 5C0CD 3RGHA 2OYKA 2NTSP 3QHFH 4FFVD 1RIHH 4GAAA 3ZHKA 3BUBA 1MKFA 4ZO7A 1S9WA 5KANG 1A6UH 4JPVL 2BSRA 4L1LA 3IDGA 5IEKA 4KQ3L 1R9FA 3OZKA 4HX1B 3RJDA 2IMMA 4R5XA 4GRMA 1U4FA 4UAHA 5EBLA 4WUKL 1AI1L 4L4TD 1DSYA 1U92B 1DEDA 1PBYA 4I85A 1VAHA 3G5XA 5E2UH 5AYUL 2BZ7A 4PTTB 4FYQA 4LLDA 3H9SE 4GFTB 1P9MA 2FYVA 1IL1B 2FUQA 2AK4D 2ENQA 1GW0A 4BXVA 4JMNA 4XPFL 4FCAA 3VWKB 5D1ZD 1ASPA 3L3OA 5AW6B 4J3OC 2DMCA 3OB0H 4XPHL 4HDIA 3AM8C 5CJ8A 3O41A 2H3NB 2P5EB 1NC2B 2JTDA 3B7TA 1QSEB 4WFFD 1IIIA 5TH2B 3V5HA 1J8KA 1A14L 5D2LB 1CLZL 3L5WB 2IDUA 3CZSA 4LGRB 3GBDA 3TBYA 4F91B 4XP6H 3SPGA 3KPOA 3LZFL 1V10A 4XPTH 5IIEB 5CEXA 2GK2A 4HS6A 4UTBA 4AYMC 1CE1L 1HHGA 4HISA 1N2RA 1G9MC 3PIQA 5I76B 5B8CC 5L6YL 3GUFA 2PMZA 1VFOA 4MQXD 1BZ9A 3GMLA 3FT2B 5KBKA 1FNGB 3K6SB 1JWUB 4FTVE 1KIRB 4DO6A 4CU8A 3NJKA 3FO9B 1RVFH 4JPWH 2ZNWA 3GHBL 1MREH 3FW6A 3SDCA 5CLWA 4TULL 1MFBH 3RWDB 4BFIB 5IB3A 1ACYH 2MQCA 4IU3B 2FLRT 4U4BA 4BKTC 3JV6A 7PCYA 4L3FA 4PD4J 1CZ8L 4ZMAT 2VDQB 4G1MA 1P4IH 3QWOA 4H8HA 4Y9FA 3WIIH 5EO0B 1NBZB 1WBXA 3HG1A 4HFWA 3NZ8B 1ZLWK 3WEXA 2NY3C 4KKAD 3FQUB 3G04B 3UERA 4MNQB 3NZSA 5GZNC 1MHCA 2H8PA 2C9RA 3EJPA 3MJ8B 3GSNB 4RETB 1OLLA 1HCZA 3RVWD 2NY6B 4HWBA 4OGQC 3EJZD 1YYML 5ADPH 2P8PA 3LRMA 3STZB 3H3PL 4ZS7L 4L1SA 2ZOKA 4CKVX 2YA1A 2JK5A 2OXGA 2YQGA 4LKCA 3KD4A 3OQRA 4JE0A 2YWYA 3T4YB 1X5IA 4JFEA 1NBQA 1ILUA 1BW8A 3H4FA 4J5VA 4GXVH 4HOMA 3HC0B 4NC2B 2WXIA 3MR9A 3QBTB 1ZLUH 2IV9A 5H4ZA 2GSMB 2F8VA 2ZKYA 3AY2A 1A9EB 3ELAT 5AW1B 4MAYA 3W1ZA 4XP9H 4FQ1H 5L88L 1N0XH 5IJKC 1AR2A 2WXGA 3K2UL 4HKJA 4DQOL 5I1IL 1P7HL 4KROC 2X6BA 4V1DA 1SJEA 1OGAB 3ERXA 4ZTOH 5JOPD 3S96B 1BD2D 4AKQA 1IJ9A 1MXGA 5MI0C 5CD5C 2LFGA 3KPLA 2P26A 3N1GC 3KPNA 1V5JA 1P6AB 1A47A 1KT2A 2ZYRA 5E5RB 4JRXE 1IAKB 4BZ1A 2JTYA 3WS3B 5T1DL 4A7SA 3VFMA 2GAZA 3BWUC 3WNOA 5ETUB 4NCC2 4AL8L 4JO5A 5MEPB 2KYIA 1LL1A 1C7TA 5CCKH 3FB6A 4S11A 2NNRA 4P2QB 5DZAA 4BKLB 4NZTL 4Y2NA 4UQDA 4HWBH 1AGCB 1L0PA 1JWSA 5KG9A 2G3MA 2EECA 4YJZL 3IDXL 4HG4K 1X7TA 4KTDL 5AAPA 2ALAA 1CBVL 4M8VA 2EVGA 2BC4B 4QWWC 1FFRA 2NY0C 3FU7B 3LIZL 1XFPA 4HWBL 5T1LB 1KJMB 1Z7JA 2UV3A 2X4UA 4FKHA 3O6FC 5F9JB 1BQ5A 3WS6A 5EFIA 4NUPA 1S46A 4KKPA 5TFSL 3C60A 3VXSB 2L8AA 2VLJE 5TK2A 3IU4H 2D3NA 3ECBA 5CIPB 1S9XB 4AL8H 1FO0B 2JJSC 4V1DD 1NBVL 2J6EA 2NY6C 4R4ND 4U2YA 2YD6A 3BIKB 4JFFE 5KVDL 4HFUH 2WNXA 5IGXH 1JZ2A 3F00A 1Q72L 3B7RL 1OTSD 3DX9B 4WI0A 3FO2A 1Q9OB 2XTJC 4AV0A 3X1GA 1KLUB