2BIIA

Crystal structure of nitrate-reducing fragment of assimilatory nitrate reductase from pichia angusta
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
415
structure length
415
Chain Sequence
PFNSEPPLTKLYDSGFLTPVSLHFVRNHGPVPYVPDENILDWEVSIEGMVETPYKIKLSDIMEQFDIYSTPVTMVCAGNRRKEQNMVKKGAGFNWGAAGTSTSLWTGCMLGDVIGKARPSKRARFVWMEGADNPANGAYGTCIRLSWCMDPERCIMIAYQQNGEWLHPDHGKPLRVVIPGVIGGRSVKWLKKLVVSDRPSENWYHYFDNRVLPTMVTPEMAKSDDRWWKDERYAIYDLNLQTIICKPENQQVIKISEDEYEIAGFGYNGGGVRIGRIEVSLDKGKSWKLADIDYPEDRYREAGYFRLFGGLVNVCDRMSCLCWCFWKLKVPLSELARSKDILIRGMDERMMVQPRTMYWNVTSMLNNWWYRVAIIREGESLRFEHPVVANKPGGWMDRVKAEGGDILDNNWGEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRATE REDUCTASE [NADPH]
publication title Structural Basis of Eukaryotic Nitrate Reduction: Crystal Structures of the Nitrate Reductase Active Site
pubmed doi rcsb
source organism Pichia angusta
molecule tags Oxidoreductase
total genus 130
structure length 415
sequence length 415
chains with identical sequence B
ec nomenclature ec 1.7.1.3: Nitrate reductase (NADPH).
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2biiA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2biiA01
1OGPA 2A99A 1SOXA 2BLFA 2A9AA 2A9BA 2CA4A 2BIIA 4PW9A 2BPBA 3HBPA 2CA3A 2A9CA 3HBQA 3HBGA 2A9DA 3HC2A 3R18A 2C9XA 1XDYA 2BIHA 1XDQA 3R19A 2XTSA 4PW3A
chains in the Genus database with same CATH superfamily
5TFSL 4OCYL 2B1HH 1FF5A 1YEWA 3QWRA 5E1AB 2X6BA 1FNFA 1L9QA 2NY4B 4GO6B 1SEQH 5FFOA 1QFWH 5TE7L 1MCWW 1U4EA 1YMME 4LCVA 4A7VA 4MKMA 2NQCA 3NJFA 2CDEB 2IPKB 5FM5M 1AZNA 3U2SA 2X4RA 2EVGA 5HJ3A 4V1DA 4W81A 3PHOA 1JK9A 4EZKA 1NCBH 4F37K 2W0FA 2GPZA 2A2QT 4GAGL 3EFFB 2AMGA 1BFSA 2AGJL 2VXSL 1OAUH 5F3HB 3D0LB 4TPRL 1MRFL 5SX5K 3RVUD 3BDBA 4E68A 1WVZA 3VU2A 3EH2A 4WQOA 4OD3L 1SJVA 1YMHA 3AQXA 3H7BB 4QAWA 1D5XB 4M1GL 2DMCA 1CG9A 1BXXA 2WBXA 1M7IA 4S0HA 3HE7B 1UEYA 1WA2X 3GKWH 2NZ9D 3NFSH 5FLUA 2AITA 4NKMA 1OAJA 2XX1A 1QW8A 2CSPA 2FBRA 1F11B 4GG6F 1KULA 2GIXA 3CN2A 5F7UA 1W72B 2Z7ZA 4NQEE 3CHXA 4NRYB 5IFJA 2IG2H 3SO5A 5GRVK 3C8KA 2C26A 3BQUD 3EO1B 3JWDH 3KCPA 3RL1A 1W6LA 2Z7YA 3KDMA 3WFEL 5LN8A 1A6WL 4JRXA 3TA3B 4X6CF 2B59A 4MMZC 4X7FC 4FTDA 3LS5L 1P7QA 4P48A 2F15A 3ENEA 1PFCA 4RFNB 4GKOA 5E5LA 3OGCA 2NY4D 5I1LB 3CFMA 1KEGL 1F4WH 5DR5L 4JDEB 5J13B 1QHQA 2GYSA 4R4FL 4WW1B 4DSYA 2O6CA 3HFML 2CDFA 1J9TA 3H9SA 3BEVA 4OM0L 4N6RB 4QEGA 2R0WH 5AVXB 5KW9L 4WHTA 1F97A 3PY9A 3LJ3A 4AENB 5D1XD 2ZJSH 5E99L 2IFGA 2ID5A 3ZDYB 3BKCL 1GGUA 1GPOL 1V54B 3RNQB 4FFWD 3IKKA 5FOJA 3S37H 4F8NA 4WTZA 5L2KB 5J3HD 1X5LA 5FHAH 2GI7A 4YLCA 3TTYA 1U3NA 5D6DC 4PRHB 1AO7E 4U1LA 5F1IB 3S37X 4PLJD 1IFRA 5G4NA 3N43F 3A4AA 3ECBA 3HE7D 1TF4A 4G71B 4GQZA 4HUUB 1CD8A 1AP2B 2FX8H 3AROA 3GC3A 3LSOA 4YZFF 4JO1L 5ICXB 3V5HB 1KC5H 4ZYKA 5HGGS 2PCPA 2CK2A 4BINA 4BEIA 2BSRA 4L2YA 2X38A 3KXFE 2H6PB 2BMKA 3LXBA 5CN2A 4P49A 4MXVF 4NB7A 1MW2A 2XG5B 3TA3D 3O9WC 4LZKA 1LQSR 4KK8D 2DYRB 1E8ZA 3CCHB 3NFNA 2VUOA 4IIQB 3CFQA 4HFWA 3X11B 1U95A 4YEEA 1P4LA 1Z9SA 2C4FT 2ICEC 4MJHA 2ITEA 4QHKI 3WL9A 4Z77A 3APCA 1FNSH 1JPFA 1FO0B 2FEJA 3L3JB 5DD3L 4ZW7A 5D93B 3LRSA 4JHWH 4NZRL 4E42A 1TTUA 3E6FB 3L7EB 2PYED 4ZUTA 4P2QA 5FAAA 1KCVH 4PRPB 5CWSA 2DTMH 5JHLL 3T09A 1ID5I 2XY2A 5DLMH 1S78C 2AJUL 1OT1A 4OUUB 2ZWYA 5GJTL 2D4FA 1OT2A 2KMWA 1HT6A 1C16B 1CIUA 1DN2A 1JPGB 3BH4A 4DH2A 2YRBA 4ZFOB 1XD0A 3VG9C 5L2KD 2PWEA 3B9DA 4B53A 2Y06L 3DMMC 4PRHD 3V0VA 3HZKA 4OSUL 4P57A 5EIIA 3F58H 2B16A 1ZV5A 1CTOA 1MWAL 2XXMB 4L37B 1V05A 1ZS2A 2HVKB 4XRCB 4NDMB 3UTPE 5GS0C 2WXRA 1XSOA 3TOPA 3DURB 3OG4B 3GMRA 1T3FA 3EFOB 2CBMA 1QVOA 4XNYH 3SPVA 1XCTA 1KYDA 2JE8A 4OM1L 5DA0B 2MEJB 1D3CA 3DX1A 4BE6A 4R7LA 1L7IL 1C1EH 1NCDH 3HG4A 3NZ8A 3D9AL 4Y5VA 4U1KA 1M53A 4QO1A 4LAQH 1U6AL 1EZVX 2QSQA 3SKJH 2QELA 3GD1C 1FORH 1QLEB 4MDJA 5DYFA 2IGLA 5E03A 4PLKD 3C60A 2NT1A 3R7RA 2ADIA 4LCWE 3RVTC 5EEZA 3RWHA 1GY1A 2DMBA 2OYMA 4K71B 3CZFB 3QHFH 4NBXB 2DEWX 4GFXA 4I77H 4Y4FB 3E8UH 3QE5A 3WSQL 3WS6A 4DESA 2FGWL 1MF2L 1A4BA 1G7QA 5DFWH 5DEZA 3C87A 3BUIA 2A73B 4BUGA 2C1OB 3GEFA 4PRPD 2HT2C 2WCPA 1HINH 1TZGH 3FU5A 4Y1AE 4UM9B 3QR0A 5F8RC 3DC0A 4NN7B 4CU6A 4Z9KB 5A6IA 4FTVB 3QDJB 3T2PA 3IDNB 3TNMB 4Z7OE 1FN4B 3SD2A 1G7HA 2FBJL 3RUGB 4KHTL 3FU0A 4DGYH 4KK6D 1PF3A 4N8UA 5IHBA 3B2VL 2MWCA 4MA8H 1RV6X 5T3ZL 2NYYC 3D6GA 3B9EA 5AG9A 1CFQA 1ED3A 3RIFF 4S10A 3RU8H 3TASA 3WEMA 4XR8C 1QBBA 2DQHL 2Y25A 4I0CC 3K2UL 8CGTA 1MFCL 2O72A 1V3KA 3FKUS 4J3SA 4MCMA 5EZLA 3UAJD 5KS9A 1MNNA 3D4ZA 4XGZB 4NS0A 4AGQA 3VXSA 2I7SA 3B6SB 2H0PA 5DJ6B 2IH1B 3FT3B 5HHOE 2EKSB 3AWGA 3QJSB 4PBDA 4Q6IC 4UQ9A 1E9OA 5DFTA 2EDOA 3OAUL 1UXWB 2YZ8A 3PNWA 5FV2A 4RISL 3WLWD 2VXVL 4HT1L 1S46A 2X6AA 2ZKXA 4NLHA 1WK0A 5CJBA 4OZFA 2BP5M 1N5YL 5HYIA 3O2DH 5IBLD 2WLMA 2QQLH 3D1MC 4AQZA 3QORA 3F85A 4JLRB 3W11D 2FQFA 4A04A 3CBRA 3I75B 4QD2E 4U6TA 1WZAA 2E7LC 1Z5YD 4N1CA 1ZT1A 2NY6B 4PJEE 5DMKA 5E1QA 3FHEA 2HH0L 3UADA 4BHUI 1CGUA 5H37H 2WLIA 5DD1L 4G1MB 4H25B 1E4XI 2Z31A 2VR6A 1VB9A 3ARDA 3G6JB 4LEXL 1OZTG 5EB9A 3SDCC 5IB3B 1YYLH 2KI6A 4KKCC 1HL4A 3OG6B 4UM9D 4DO4A 4PJGE 2R4SH 4LSDA 4URTB 1AS7A 5IOKA 5F96L 1KNOA 4FTVD 3IWVA 3A0OA 3QDJD 3BPOC 4AOFA 4LSUH 4N2OA 3RWIA 1PLAA 3QYNA 4J3OG 3KXFA 2JQZA 4NM4H 4MB1A 3RGVD 4PJAB 4F7CA 3WTXA 2XKNB 2Q5BA 1WCBA 5HP5A 4KK9C 2GQHA 1JP5A 5ENWB 1DJYA 4PMEA 1NGXA 3DO4A 5SWQB 2R29H 2DI7A 2Q8AH 3VXTA 3PHQA 2VOTA 4KTEL 1R1CA 4K9EH 1LK3L 1X5ZA 3RDJA 1WFMA 5I1JH 4TL4A 4H1LB 3WTYA 3UZVB 3IJ9A 4NFDA 1XGTB 1X4ZA 1UM4H 3FTWA 1CFSB 2D7TL 3KGTA 2AV1B 2DLEA 5FUZL 1E6JH 4I48B 3FT1A 1S7VB 3NIFE 4NZDA 4QRSB 5FCSH 1BMGA 4PLNC 5INDA 1SNRA 4U1NB 4KXCA 4PCTA 1AGDA 5C0GA 3VB8A 3L3IB 3QEUB 4PWKA 1VADB 4JRLA 4JFUA 1V55B 2C9UA 5K1VA 4Y9BA 1JGUL 4QHKJ 3QNYB 4OB5L 2NY6D 4P2AA 1LEKA 3S5LB 2YXVA 1UQSB 4JFXB 2ADFH 3GMPA 1AOHA 3POCA 1MWOA 4PJ5E 2DQGH 3QO0A 2W0LA 5LNEA 3D4GA 1H0DA 1J8RA 1RHHB 4UQBA 3OAYK 3B43A 3B9KA 1CLVA 4GG8A 4J28A 3O6LH 4U1JB 5D96B 2VL5B 2OLDA 1LO3L 3FOLA 3OKKB 2VIRA 1ZA3A 4D8PA 1FFQA 3JXAA 5HHNA 2FB4L 3EJUA 4QR7A 2PR4H 4MYPA 1ND0A 2Y36L 3UGUA 4X7TA 3VWJC 4YBLB 1MFBL 4GAJL 3GSRA 2CGRL 3G7TA 4JQIA 5IB2A 5TF1H 4J6IA 1FDLH 3SDDA 3KLSA 2DJSA 3GI8H 4XCYA 1EXHA 4Y2DA 1PX4A 4MRBA 4FFYA 5JHDE 3QZMA 4DGIL 2BLFA 4EDWH 1UACH 5IVXF 3RVVC 4ACPA 4C58B 3GMNA 2HLFD 1E9PA 2XZAH 3FO9B 4WTWA 3CAFA 3MV7B 4WWPA 5CLZA 1JZDC 4HF5H 5D70L 4APXB 5EA0L 4A1RA 2QPDB 1KTRL 4U7SA 2X4OB 5EO9B 4N2BA 3K4ZA 1GVIA 2X4NB 1P5UC 3BPLB 1A2YA 3MGOB 1OP3H 4PGEA 1MQ8A 5TE4H 1FV1A 3BKML 5F9JA 1HWHB 3U6XA 5D4QA 4EN3A 3HOGA 2R15A 3CFDA 5F7YC 1G7JA 1NCAL 4HX1B 4L4TB 5IM7B 4F33B 4AZ8A 4U6XA 4NQVA 1RKRA 4UF7C 2P44B 3TO4D 1OF2A 2L04A 3ZJAA 3SGDI 5DJYA 3WELA 1ZGLP 4AYGA 4G8GB 4WKZA 5DO2C 5I66A 3LHPH 2R1YB 4UOZA 5AG8A 5JDSB 2YQGA 3P2DA 3DJZA 1NAKL 2VLLB 2FYYA 2IOIA 3BVNB 3CSGA 3GSVA 2FUTA 3I3BA 4CUCA 3RP1A 3MRHB 5IB5A 5LN4A 1WP6A 4DHLA 2X0VA 2WC7A 5BW7C 4XNAA 3U46A 4AITA 2HT4C 1WV7T 5E00A 3A4DA 3QFGA 3FBQA 3QISA 4UTAL 4HS8H 5J6GB 2QADB 4ONHA 3RFZA 2ZCLH 4OCMC 5I1EH 5L0QB 4KROD 3ZTNL 4HIIA 2OJEA 4RAVB 3SD5A 5C0BA 4RWHA 1AAJA 3ZUCA 5FM8A 1K5NA 3LQZB 1IBYA 2P5WB 3HI1B 2YR3A 5T1MA 2X2YA 5CJOH 4PJEA 4O5LL 1DVFA 1NGWA 3FPYA 4PRIA 4K3GA 4F8QA 4JFOA 3MV7D 4PJFE 1H5BB 4DKFL 4MAUH 1RIHL 3U0WH 5IMMB 4QY8A 4LLAA 3DHPA 3QIWC 4P23A 4GSXA 1O7DC 4XO4A 1A3ZA 4PB0L 1YDPB 4H8PA 2E75C 4JAMB 4L8BB 2A74A 4OZGB 2FO1A 3ISRA 4LMQI 1W0WB 1ZY9A 2CLVA 2ESVB 5D5MB 2XZQL 4L4TD 2GC7C 2JJTC 4LDEB 5I71B 2J2ZA 4TLSA 1IJNA 2HTKD 1H15A 3WNKA 3H6AA 4MZRA 5DZPA 2GJPA 5ICZA 4G8GD 4BXVA 4PJDB 5HY9B 2H9GA 1E50A 3OKDB 4JFWA 1BFOA 2BP0A 5JZ7D 3L4VA 3VXQA 5FYLE 2LU5A 1J48A 3QPQC 1HI6B 3WMPA 3PUCA 2D31B 1UC6A 3QIBB 4KDTC 3SYAA 3GTTA 4TUKL 4BWTA 2JSFA 2BHUA 2D3VA 4Z0BH 3OZ9H 4WNJA 5FYKU 5ID1B 2BX5A 2WLNA 5E8DH 4GI6A 4IBTA 1CD1B 2EH7H 4M1DH 2P80A 3VXRB 3NABH 1XIWD 4OIFA 5GSRA 5I1HL 2GJZB 5FYKH 3FTZA 4OF3A 5CN1A 3U7YL 2AXGA 1RU9H 5JNYB 1A7BA 2W80C 1NH6A 2F58H 3CXHK 3MRJB 5DHVA 1U92A 1ZLSL 5ANMB 3H8NA 2X2HA 1MCSA 1IGTB 1QFWI 5KAQG 2P5WD 2CU9A 4PWJA 2A9ML 2LHAA 1TKWB 1R3LA 2CK0L 2WO3B 3FB8B 3I2CL 2CKBA 2VERA 2ZX8A 4YHLL 2J88L 4PJ5A 4Z5RA 5D4JA 4QT5A 2IVFC 5ELIA 1D9KB 1AZRA 4GB9A 1SXNA 3UX9B 1PKOA 2K1MA 2W9EL 4MCZA 3D0VA 3LKRB 4YBHA 1JNNH 3MSPA 3PWPA 4XPFL 5GRWA 3TT3H 4J8RA 1DBMH 1UA6H 4BH7A 3LH8A 4PTUB 3TJEH 2JLLA 4JZJC 2J6EL 4QDGA 5C0CE 3HRZC 4I3SL 4YDZA 1M1XA 3NN8A 3RWFA 4XP4L 5TE6L 2ESVD 2BWQA 5IWLA 2WXMA 2BSDA 1UWEH 1T1XB 4MMZA 2D7MA 4YSSA 5DMYA 5D1QE 2BZ7A 3T6XA 4YX2L 1KTDA 3BWUC 4ENZA 3Q5YA 3ZO9A 5AKVA 4OGAD 4LLQA 1XGPB 5BCAA 2QJDA 3F62A 3PWJA 4FXGA 1QTYT 3VW3H 5IHUH 4IK7A 2VZUA 3QIBD 2BCKB 4JQVC 4L5FE 1MWAB 1KIUB 1Z6JT 3EF7A 3LZLA 3NEOA 3Q6GL 4M4RB 5DT1L 1WLHA 4WK4B 4N26A 3V6FB 5IHLB 3QUML 1KWKA 4UT9L 3C5ZB 5FYJU 4DUXA 4FA8A 1MHCB 3CFIC 4GRLA 1XR8B 4LCCA 4X80H 4KUZH 1AKPA 3K0WA 1I82A 4IKKA 5B4MC 2WBWB 1HWGB 3OWRA 3FZUD 4K5LA 4BH8A 4XPHH 4B3VA 5D6DA 4P46A 4E9WA 4RDBA 4CMMA 35C8L 1FFNA 1YEDB 4FNLL 4U1MA 4B7IA 3D05A 5L9DL 1MPAH 4AKQA 1LQBC 3CWGA 4N1HB 3Q1SH 1QFUH 4OCSL 2MCMA 3TZVA 2QKIC 4YGVA 5GRZA 4TOYH 5IHZA 3VTAA 1D9KD 2CLZB 2IAND 1ONQB 3ROLA 3EYOA 3QNZB 3BWZA 5I73C 5I8KL 4M6NL 5IQ7L 4KC3B 3VH8A 1OTSD 4B97A 1V3JA 1JPSL 2OR7A 1GYWA 3FT9A 3MA9H 4NM8H 5HYJE 1T7ZA 5FA4A 3QUKA 4PMFA 4L18A 4HOWA 3ALXA 4AQ1B 5HI3D 3O9WA 3V0AC 3JUYA 3T3PB 3U4AA 2OI9B 1UVQB 3ULSB 2CNZA 1J1XL 1QTSA 3B7RL 3JV6B 3DXAA 4XMPH 1FAIL 4ZMTA 4YPJA 2AJVH 3HMWH 4J12A 2R69A 3WENA 4KKAC 1E4JA 5ESQB 5E6UB 1FG2A 3HCVA 1QI3A 2F5AL 5KVGH 1UA3A 2WSDA 4JBSA 1YQVH 3HUJB 2D9QB 4AW4A 3H42L 4QTHA 4N90D 3KLDA 1ZLDA 1X6NA 4TV3A 1MAML 2EIKB 2QQNL 3GSXA 3QC5X 1L0XA 2RA1A 1Z9NA 3C5ZD 3NJXA 4G70B 4MMYB 1L6ZA 4LCUA 4BYHA 4C56E 3BSZL 3G5ZA 5DVMA 5ESAA 3DETC 4B60A 2P5EB 3LH9A 5KTEH 4FNRA 4PIBA 5AOZA 2HX9A 3ZOAA 3IFOB 5EU6E 2LABA 3MRQB 3VQ2C 5JQHC 4JN1L 5DQJA 1JK8B 2PWDA 1YEJL 1T7YA 3DMMA 3EYQC 4NQCA 1LVEA 5IEKB 3HC3H 2CBPA 1DUYB 3DGGB 4P4RB 2A6JA 3ZMRA 4LDCA 5SWSD 2Q10A 2JKWA 3M88A 3UBXG 4ZDHB 4G80A 4F3FA 2TAAA 5I15H 1J8HE 1ZWIA 3EO9H 3L9EA 5BRZE 5JIDA 1AS6A 2VW4A 4JCWA 3U7AA 2BZDA 4YBQC 3VUAA 3WO4B 3WN6A 3IDYC 3QPXL 4YSQA 4YDNA 5IVNA 3N1MC 5JYMA 4H20L 4KY1H 5DK2B 2A9DA 4F2MA 4M48H 3AU1B 2VUKA 3FQNA 4R3SA 1PJ9A 3VRJA 5EBWA 5IP4A 4HSAC 4FF9A 3VGBA 3PWUB 3IDJB 3ZKMC 4GEIA 5DJDA 4H7VA 2F9BT 4L1DA 4H8VA 4X5PA 4RX4D 1IAII 1WAEA 1VKXA 1ADQL 1HXYA 4GG6B 4RBPK 4LPXA 2FX7L 3FUMA 2Z91B 5IFHL 1H3XA 5BMFL 1KLFB 1LEGB 2VDOH 3F5WA 3X3FL 3SPHA 1I8MB 2EE9A 1OSZA 2J8HA 3GQFA 3QG7L 3LRKA 2OYPA 4WEBL 5E94B 3US1A 2WW8A 5IF0A 2NY5C 5AYQA 1KB5L 4JY5L 3DK0A 3RVUC 2BVQA 4HGKC 2FT8A 5C0CA 1AXTL 4YLQT 2DKUA 4UI2A 3RDTB 3S3JA 5EU5B 5JORA 3JUZA 1LO2H 3T6ZA 2UWEA 3GBNL 3VFOA 4OFYA 1F90L 2NZ9C 4NZUH 3ZY7A 4A7GF 4Y16A 1CXHA 5J6SA 1KG0B 2XN0A 5I6XC 3W2DL 2PW1A 3MACL 1BFVH 1JIBA 4BCZA 4PHXA 2OM5A 3V6BR 3FRUB 1F4AA 2VDLH 3FTGB 4ZMNA 1TTAA 3B8SA 2GSGA 4OZHA 5JA9A 2RACA 2VR3A 4AMKH 2KL6A 4LSVL 3BQUC 4Z7QB 5E4EB 3DVGB 3WIFB 2JK5A 1JHLL 1UT2A 1F58L 1PBYA 4JGJA 2ZSWA 2Z34A 1PZ5A 4QTIL 4QXTB 1UUSA 4UMGA 1S7WA 5GJSL 3DBXA 4D7PA 1RJZB 4BRVA 3D87B 4ICWA 3V0DA 3BSGA 4WVRA 4HJGA 3N43B 1ZLVK 4XP1H 5LO7A 4AK1A 1JZEA 5T1JA 1R33A 4R8WL 3WCYA 2QVKA 2NY4C 3G08A 3DOSA 4IGBB 3MLVL 3LKPB 1JGEA 5I19L 3RI5F 2EIZA 4KI5D 3LXCA 1X6LA 1S9YB 4LPCA 3CVHA 3MJ7A 3SDCA 2WJ5A 1KBGH 2EE3A 4KQ4L 5DJAB 2F61A 5FK9B 3VGFA 3KGUA 4CVXA 2DQUH 3QEGH 3VQMA 4AQEB 5F3FA 2G4EA 1D5RA 3FQXB 1PGRB 4X7CC 5D1XC 4UILH 1SM3L 2WOYA 3CXDL 4LPUA 3MO1B 1PJWA 1V7MH 3GDBA 3DHJA 4FFWC 4NWUH 5HYJA 2QZQA 1IKFH 1WO2A 4PWGA 5J3HC 1N8OE 1AOZA 1AFVH 2G30A 3QW9A 3L6FB 3WFDH 1UASA 3UOAB 3RDTD 4PLJC 1SJEA 2YN5A 4AUUA 3GRBA 5E0QA 2K6ZA 2NSMA 3HE7C 3L3HB 3O3DA 4JB9L 2BVTA 3PV6A 1YO4A 2OPCA 4WFHE 4PG9B 2EUVA 1JFQL 3BUTA 1GL4B 1QSFE 4NQUA 3S3PA 4Z7WF 2Z7WA 4M3HA 5E2UL 5FLVA 2Y3AA 2V7HB 3OSKA 5AOKA 2DEYX 1QMUA 2P4AB 4GAFB 2HFGH 5FKAA 3FDWA 7PAZA 4AIOA 3CXFA 3TA3C 4KK8C 2YUWA 4N0YH 2JCCA 1MI5A 4J6RH 2V3DA 2WAHA 1W0VB 4YL9A 1IBZA 2DMKA 1QUNB 3L4TA 1O5DT 4JCMA 4LF3B 4N2MA 7PCYA 1H6EA 4R83A 4FQJL 5IY5B 4IGBD 3GS4A 1JF1B 1XGUB 3FO0L 5G55A 2DYPA 3NZSA 5J13C 1A7NH 2IGTA 2Z64C 4B9PA 1TTBA 3RWEB 2ADGB 2XKSA 3V0GA 4B0MB 4R7NB 2A5UA 1AH1A 4GMTH 5D72L 2COVD 2WCGA 1O9ZA 1DSFL 1O6TA 2MCAA 1V10A 5KBKA 2PO6C 4KFMA 1NUGA 1CI5A 4G11A 3F7LA 1VIWA 2GBUA 2WXFA 3Q5OA 4F9PC 1TJGL 3G9VA 3MOAH 4LIQH 4B9ZA 2MCG1 3Q43A 3CK0L 3MJGX 5L2JB 2D0HA 2BNUB 2FL5A 1BIHA 1ITCA 1L5GB 3SYOA 4A55A 4UYQA 5JOPD 1Z2KA 3MCLL 2OMWA 3T0DA 5I8OH 4TUJA 2HTLD 3TO2A 1AQKL 3MJWA 1TSHA 3AB0C 4TSCL 5HDQL 3F65A 1FYTD 5K9QI 1TYRA 3MRKB 5EC1B 1JGDB 3G5VB 4ABVA 4A2FA 1FFOA 5DC2A 3LXAA 5FO2A 1ZTXH 4CSZA 4WUKH 4EUPG 3DX9B 1MH5A 3GSNL 4N3UA 2Q6WA 3TCXA 3SGJC 1XGQA 4MNQA 1NFDF 3H7LA 3HKFA 2VLJD 4E5XG 4AEHH 4NNPL 2ZXEB 1CGSH 1HHJA 4M6OH 4L1BA 3BD3A 3NSFA 1N8ZB 4IIQC 4PLKC 1SEBB 2IQ9H 4TN9A 1KPRB 2NY1B 2WZAA 1I3VA 2W0PA 2DKSA 3AUWB 1GYUA 1P5UA 4LSSL 3STZB 3ECQA 3Q48A 3U9PL 2HKHL 4PSPA 1A1NB 5F2FA 1QI5A 4U1SA 2YKKA 4JM2A 1SVBA 1A6VH 1YRKA 2J71A 5F9OH 4QXGH 4MKTA 2FJUB 2ZKHL 5D93C 5JXAH 1NCIA 4Y4KB 1WQVT 1VACB 2P24B 2Y5TB 2O5NA 5C6TL 1A3QA 1PZ3A 2BSTB 4TQIA 4X83A 1SYSA 1KIPB 4NUJB 2FSEA 4G9FB 3JT0A 2C3XA 4HPHA 3ZYOA 4JHAH 4GKSA 3LKOB 2GBAA 4LEEA 4G6JH 4KPHL 1DVXA 2ZWLT 5J6HB 4Z7NB 1TJMA 2OS7A 3HNVL 1E27B 2R9HD 1XGYL 4Z0XA 4DAGH 2Y7QA 4EKJA 2ZUXA 4NN5B 3C09B 3J2PA 3S8GB 5HPMB 5KSAB 2YFOA 4QXVA 2WVUA 4IOIA 3UZEC 4W4NA 1CC3A 2H3XC 4XBGB 2DBJA 3K6SB 1OT4A 6FABH 2RQ8A 1OE3A 1G6RH 2IXQB 1W2KT 4TUOB 4N22A 1J05B 1ZLUK 3S8FB 1GS8A 2QSCL 4EE2A 3UAJC 4QJ4B 3ZE2E 1Q72H 4JFSA 4WI8A 5CLTA 4B9JA 2R59A 4PJIF 2XWBB 4WDIA 4P2YA 3IGAB 3MRCA 3I9AA 1OAZH 1ZT7B 4KAQL 4V33A 2ARJA 2RFXA 2Y7SA 3WUWG 3CDYA 3O6FB 5L8LB 1UFUA 5HYEA 4KNQA 3GSOB 4BFEA 2CPCA 1X5JA 5C07A 3P0GB 3GO1L 4B9IA 2NCMA 3WLWC 1T66D 3QIWA 3NH7H 2XV6B 4JY4B 1HN1A 2NY1D 2OMYB 1N6QL 3BP6B 3NSXA 1DQDH 1NUNB 2YWZA 4WAFA 2A77L 2GK0B 3NZHH 5IBLC 4JS7A 4K71C 3W11C 4OLVH 3NUKA 2ITCA 4LVOC 2HCZX 4XI5D 2KZ1B 1MREH 3QUMB 5I0XA 2JJTA 4A68A 4Q0XL 1EZSA 3P0YL 3BC9A 3LEXB 4Y4KD 3VXUD 3FW6A 3NCYS 4LLMB 5CSZB 5DJXB 4E41B 1MLBA 2UUDH 1P1ZA 4G9FD 2PPFA 1S7TA 2ZOWA 4MJ6B 3B7TA 1NBZB 4MHHG 3VFSA 3MV9A 4WI6A 4EZJA 3BZ5A 3II2A 4WO4D 2N1TE 3DUUA 2MQ0A 1Q9OB 2RR3A 3PHSA 1IBGL 4CBZA 5KSAD 4HH9B 4EI6B 4LSQH 5AAMC 4IOSA 1A3LH 2UXFA 2AKRA 3ECUA 3LNDA 1DSWA 4HPYH 3RGVC 5FO8A 1CS6A 1RZQA 3SDYL 3MRMB 3OKOA 1E8XA 1S7UB 1HAUA 2CA4A 2DICA 2HAZA 3QDAA 3ASWA 4BFKA 1MAKA 3ARVA 4FQIL 5F7DA 1B3JA 4NHUA 1ZHLB 4ZPVB 2CBTA 2JB6A 1GZQB 2HJFB 3S3SA 4KOBA 3DJTA 5I0YA 4Q9RH 1BZ9A 1ZEAL 3D3VA 4PJ9B 4W9DC 3O6FD 5AL8A 3FRPB 5DGQA 3QA3A 4IIZA 1KXQE 4HCRH 2W07B 4HXAH 1TZIA 3JWOH 5HHMB 4XNZB 2ZWNA 2WKOF 3T1FA 1MVUB 2DWDA 2ZAGA 1TU2B 5GRJL 1WBYB 1SMOA 5CEZH 4X5WB 1HSBA 1A9BA 3VXMA 3L7FA 2APWA 3ES6B 2R1WB 1HDMB 4Y89A 5EOTA 1ZDQA 2C4FU 2FWOA 1A64A 3L1FA 2Y1VA 5LNGA 4U1HA 4LU5L 1NAML 2NY6C 2X9XA 5F21B 3GMQA 3STLB 3UPAA 3VJ6A 2D9CA 2YD9A 3U4EA 4CJ0A 3IXAA 3QXDB 4E41D 1UKTA 4Q4EA 1GOFA 2GFBA 3KR3L 4MD5A 2FZ3A 5CCGE 5IVXB 1G5GA 4JEGB 4WI4A 3S6CA 1BIIB 1B0WA 1NDMA 3PDOA 3VI4B 4WHDA 3K7UA 1CTNA 2XUWA 2CRIA 5FOBB 1CXEA 4NQDA 4DZ8A 3JV4A 4TUUA 5C70A 1B0RA 3L2MA 5T1DL 2R83A 2XVBA 1NMAH 2DWSA 2FD6L 2O5ZL 3DX7A 3NT0A 4AQAA 2YHGA 2EUXA 3FB7B 4KKNA 1AI1H 1PYWB 3FB5B 4JKWA 3RTQA 4IMLB 2VN7A 1PQZB 4P4KA 3UC2A 3ULVF 3J07A 4PRNA 1I31A 4XCCH 1F13A 3QK0A 4U4IA 5DS8A 3BKJL 1J0YA 2CJ3A 3C6LB 4Y8DC 4ICXA 3UO1H 2QKIA 4PJ9D 4NFCA 5C0DA 3F7YB 3MBXH 5DD6B 1VA9A 3QUYB 2HLFC 3DDFA 5HDBB 4YHYC 3WNNA 5HHMD 1IVTA 5FKPA 3HAEG 5FGCB 4KKPA 4IBZA 4XXWA 1BQLL 1VEOA 2X7LB 5BV7L 5EEWA 1MLCB 4M3KB 3T2OA 1RULL 2AJ3B 2WTPA 3MRLA 3ULUF 3A21A 4HUVB 2LU3A 4L8CB 3BLBA 3ASOB 2VZTA 1O9WA 3LX9A 3L5JA 3CZSA 4ETQB 4NUQA 4NCC1 3CDZA 4YSUA 1CICA 5FHBH 2VLKB 1OB0A 4MDIA 4PBXA 3TO4C 5K1NA 9PCYA 1TCRA 1YPZA 3ILPB 3UJJL 3RB5A 1KB5B 1BJMA 2WQAA 3ARZA 1M57B 5C9JB 2BXYA 3DO7B 1G7MB 5D96C 4ZOCA 1YN7A 1E4XL 4JFFA 4WUUB 4BQBA 2VC2L 4E9RA 1FAKT 4AL8H 5HHQB 1N2RA 2D03H 4XT1C 5JO5B 1SLVA 4N2IA 3NIDB 3Q2LA 4A6YL 4FABL 3BP7B 4JFDA 4RVBA 5E9DD 1KFGA 4LFHG 3BUDA 2VISB 2YPVL 5F7BA 5HI4C 1LWJA 4MCYA 3ZVVA 5AALA 4YBLC 3HZYB 4ELMF 2UZPA 4FQLH 3H55A 3VFRA 4XMVA 3WJMB 4KROC 4AH2B 2VDML 4KDVA 2DM2A 1J0ZA 3IF1B 1J8SA 3VX1A 3FXIC 1FVDA 3SJVA 3V2AR 4JGUA 3DPBA 3C6LD 1HOEA 1HOCB 2QTVA 3VFMA 1OCWL 3BUYB 3QUYD 1Y6NR 1WWCA 2C9VA 3LH2H 4EBQL 3TFKD 5E24E 3ZDYE 1AE6L 2Q2LA 3GSWA 4YAQB 4XE0A 1MFDL 2EYSB 3DSFH 5L2KE 3TIEB 1Z5LA 2V17L 4XAWH 3BPLC 5HYSG 3D09A 4PRHE 1T7XA 1VFAB 1BBDL 4QRPD 1KN4H 4EZLA 4YC2B 5IOPA 1A1OB 1NLDH 1O7SA 2NLJA 2R51A 4FKHA 3SKNB 1S7SB 2HB0A 2WUCL 3L95A 3P54A 3I3DA 2VLKD 3MUHL 1A9EA 5DVNA 5C7ZA 5D6CA 3PQYB 3S4SB 3QXWA 3H3PH 3PABB 4XVSH 5HGAA 4HZLB 3MYJA 1S3RA 5EH1A 3K2MC 4WUUD 5JZ7C 4X9IA 3C2SA 3P3RA 1RK1B 4E0RA 2WXLA 1BG9A 4X6FA 4BGLA 3AT0A 3FU3A 4PM1A 3MLSL 5LKNA 1AGFA 4LOFA 3KPPA 2VYRE 4HAKA 2P46B 4FLSA 1EEYA 3QEQB 4Q9BA 3T0BA 4L8SB 3OXRB 1LK2B 1XIWC 3N3EA 3QZLA 4C83B 3NPZB 4OTXL 5HJDA 3MLTA 3ZHDA 1LO4H 5L0QC 4JFZH 1SY6L 2BOBB 2I5YH 3I50H 1TVBA 2WYZA 3DHMA 3PFQA 4MB4A 3D85A 3ZN6A 2R2HA 4PRPE 2IV9A 4NXKA 5FGSA 1SVZA 4GBXD 4DK5A 1TVDA 1ACXA 5IEHA 1Q9LA 3GB7A 2HLEB 4YDJA 1H5BC 2YPLA 5B38G 3QSKB 1JYWA 4BFNA 1PD6A 5JMRA 1MXGA 3PJSA 4OBSA 5EZJB 1EEQA 4B3EA 4PS7A 4ZO6A 4YHIB 2DS4A 4RFEB 5KUMA 2CMRL 3E0GA 5KSBB 1KJ2H 3BQUA 2BVPA 4LOUD 3T71A 4JHUA 3SOBH 4YXKL 1RCYA 1G7PA 2VDKH 2HWZL 4JL1A 4O2CA 5I71C 1KWGA 1M3IA 5EFIA 4H8WH 4MNGB 5CINH 3PQYD 4O02L 1U93B 1OLLA 2VXQH 3P3YA 4NIYE 3ROOA 2B1AH 1NEZA 1C5BL 2VZSA 1T21A 2ZAIA 2QVTA 4LCIL 4M02A 4OGAC 4XN2A 2IWGA 1BQ5A 2WQSA 4CW1A 1P84J 1RURH 2AXWA 3QIBC 2J8UE 4YVNA 1LE5B 3PGCB 4C8XA 1R5IB 4TNVF 4OKDA 4JPQA 3QEQD 2CXGA 2IBZX 3PGDA 5D1XA 3M17A 3S96A 4O2FA 1W80A 3VRIB 3O4LA 4HYTB 4F7PB 4AIEA 4AVJA 5EULV 5EOCL 4PWHA 3GSNB 4HXBL 4X6DA 1VFMA 3FZUC 4ZUSA 1FVEB 2FIRT 3CFNA 3LN5B 1QZ1A 1DDHA 4F9LC 3HPLA 1NBQA 1U2YA 2JXMA 4X6EA 5TPWL 3RL2B 2MOVA 1AS8A 2V3FA 5DD0L 5KEZA 1ZHNB 3VWKD 2DQFA 1XDYA 2BIMA 4FTVE 4ZT1A 1D9KC 3QDJE 1F11A 3N55A 2FAUA 3BP4B 2IQAA 3CBJB 3RUGE 1W72A 1ORSB 3P4OB 1ZSDB 1OTSC 4WI3A 3MRDB 1SF3A 1X44A 2XPYA 4H5SA 1SOXA 3AADB 2CO1A 4QHLA 4ETYA 1U4FA 1JPST 1JNLH 2RD0A 3UYPB 2IDUA 1O7VA 4RRPM 2KPNA 1SJHA 1D6VH 5EZIH 5HHVH 3NPSC 3QJHA 2L8AA 1PDKB 4TQ8A 3D51A 4ZQTA 4TL5A 7TAAA 5EZOH 4MD4B 2Q7YB 3T4AA 2UY7A 5LAXA 4QHMA 1TQWA 2Q3AA 3DARA 2CRZA 2PYEA 5DS2A 4JG1H 2ZG2A 4FQCL 3ETTA 4WGKA 3BMWA 3NGBB 3CNKA 3B34A 2E9JA 3ULVL 1RJYA 3A67H 2F1BA 3C5ZC 1XR9A 2PO6A 1NC2B 2ZXDA 4XNUH 4DKAA 3LEVL 1KTLB 3W3BA 3EH4B 3U25A 1KYAA 2JB5H 3WJLC 3RWCB 4KVPA 3X2QB 4XXDA 2OMZB 1CDGA 5FDYA 1ZLWK 3GK8L 2LOEA 1MCOL 5TH2B 3C8DA 2BNQA 4KOCA 5F1IA 4CSPA 2B1HL 1CFTA 1KV7A 3G6JE 5CLWA 5C2BH 3QQXA 5ISZD 4JKNA 5CILL 2DYSB 2D8KA 1VESA 4MTMA 1BVLB 1Q9WB 2OX5B 3D39B 2ALAA 5T33H 3BVVA 5DEGB 3SE4C 4Q7DA 2ITDA 4ISVB 4PI2A 4XOCA 3ZE1F 3BVUA 4NO5B 3TWCL 1IGMH 1UXSB 1Z32X 3M1BB 1UXMA 4K3DL 2IADA 1SDDA 4NGHH 5H2BB 3EXJA 4TQPA 1U8IB 3E3QC 4PJAE 5E6RB 4AQ1C 4OLXL 3G9AB 2OK0H 4YPGB 2DLFH 3QFJA 5A6LA 3CCHA 1LE9A 1CE1H 2DJ4A 5DVOA 4IRJB 3K2KA 2VDPH 1LD9B 5ALCL 4LGPB 4AGLA 2WXPA 3ARGA 2NXZB 1USQA 3OPUA 4KXBA 4R4BA 4HOXA 1C8PA 3BH9A 3AGWA 3O8XB 4BFRA 2B3IA 3MODH 1HZLA 3VFWB 4WWOA 4HOMA 4FQ2H 1FZJA 4M5TA 3IFPB 1HEHC 4TLTA 1INQB 5F71A 4NCDA 4F58H 2OMUB 2Y2YA 1RZPA 1WBXA 4MMXB 3TBSA 3AREB 2IG2L 4NQXA 5I5RA 1XH0A 3VI3A 4L3EB 4D3CH 1BA9A 1NC2D 2MSPA 3NCFB 4QWWD 2VTFA 5I16A 4K7FB 3FTUA 3BWSA 1XF4B 3IMUA 2ARWA 4UDUB 2O1AA 5E08L 1AHMA 3ELAT 3V0JA 3DROA 4Z7UA 4NQSB 3UZEA 3WKPA 2C4XA 4X8JB 4YFLI 2IPTH 3ZMEA 5L4FA 4JRYB 4HKJA 2FQDA 3SBQA 2VQTA 2ZNWA 3BAIA 3K91A 2G3MA 3CVIL 3L4CA 1Y0LB 4NDMA 1MFAL 4UDTA 3D39D 2BIQA 3UAJA 1SYVB 1KCKA 5L88L 4Q9CA 4K8RH 1EGJH 3LKNB 1DANT 4LFHD 2ED9A 3N44F 5E8PB 1NAMB 2FJFA 3U1SH 3VD5A 1OGPA 4GKZA 4OGZA 2X1WL 1UOKA 4LHJB 3O41B 4HSCX 2J8UA 2CAKA 3GXIA 3MX0A 3S37L 3U1PA 4PJBA 4KVCH 2WYHA 4RFOH 1IGFH 3BIAX 1SHWA 2PN5A 4JDTH 4IRJD 1XB8A 4R7XA 3QRGL 5LNDA 1CU4H 3OJDA 1A22B 4X5RA 2NXZD 3RJDA 1SOKA 3GEWB 5EO0A 5GGVL 4K23H 1SOSA 3BXNA 4H8QA 3O8XD 3B56A 4DQOH 2YSSB 5F70A 3QGVA 4Z7OF 3K4DA 1X9UA 4JKKA 4XVJL 5JW4N 3N91A 2CBOA 1MCIA 2A73A 2FEDD 3CHPA 1E2ZA 3HMXH 3MV7E 3OAYH 4KI5C 4QRUA 4WJ5A 4YHMH 4BZYA 4FQ1H 2VSCA 5DRWB 1AGBA 3ARED 4N8VG 1AQHA 3Q13A 5TGBA 3G04B 3L3KB 2PF6A 3BUBA 3JWNG 2BS9A 4L3ED 4ABWA 1ZPLA 3MREA 1K9TA 5K39A 2YK1H 5AEAA 2K4WA 3TNMA 3VMOA 2B0SL 3TEYA 3QJRB 5C8JB 3K71A 1SZNA 3V4PA 1R3JB 2XG4B 2BVEA 5F93C 1CVSC 4L4TE 2V3EA 1OP5K 4AT6A 4JFED 4V2BA 4KRLB 2AVFA 2ZOKA 4GI9A 4H2AA 3RGVA 2XWJB 4JRYD 4GH7B 4ZAKD 3RDTC 4LPYA 3WFCH 4G8GE 2IALB 3MNWB 4KKRA 3TV3L 5BZWB 5BV7B 1SLXA 4JHWL 4ODSL 1WFNA 2LE9A 1V3LA 1D5IH 3KWVA 5T5NG 3FQRA 1HL5A 4RAUB 3CDGA 2HJLA 3KHQA 1T1WA 1XD1A 4ZW5A 2CWRA 3FQUB 4Y4HA 2GJRA 1A7PL 1G9NH 5LCVA 2WBJB 5DJ6A 3V7AG 4GSUA 1AVAA 1HH6A 2L7EA 4BUQA 3IMTA 4POYA 1PKQB 1FL6A 1S9WA 4PJEF 2J43A 4YSAA 1EXGA 3MJ8A 4AXWA 3U0PB 5K59E 5LG6A 1QA9B 2D7QA 2ZIDA 5L4MA 1YEFH 3PNRB 2ILLA 2VC2B 3MJ9H 3UJTL 4GXUM 3B8YA 3HG0A 4G72B 4A6YB 4PJGF 4ZTOL 1G6VK 2P5WE 5KBNC 2JKSA 1OCCB 3TIDA 4LBEA 1IEHA 4IGBC 6TAAA 1OPGH 4FA7B 3D2UD 5LVEA 4G1MA 2WJ7A 4QOKD 4S1SL 1FCCA 2C3VB 5IB3A 1I8UA 4WW2B 1B90A 2CH8A 1RK0A 4ODTH 1IAIL 3K5RA 3FFCD 1NCDL 4GJTB 4LVEA 4UB0L 1NJ9A 3E1ZA 2JTYA 1T20B 2VDMB 1P69B 4WU7B 1MJJA 2Q86A 3SKJL 5DRZA 1NGZA 3GIVB 1J7VR 2WMPB 3PP3K 5DMIH 4U1GB 4OZGE 5CR8A 5D5ME 2ESVE 3UBGA 4M7LH 4BKSC 1JPTL 2APTA 1KEML 2NX5A 4KO7A 3T65B 2BJML 3SGKC 1HH9B 3PIQA 1IEAA 4AQ8C 5IR1B 3BP5A 4KO5A 1J1PH 1FYHB 2HTLC 4KRMB 4PJDE 3AM8C 3NQKA 3O2WH 3S2AA 4ZUVA 5KSVA 5SWQA 5B1JC 3OR7B 1IC5L 4IEFB 3NIFF 3A3YB 4FI6A 1BLNA 4N2GA 3BGAA 3LPWA 2VL4A 1SFHA 2WBJD 5HI5D 3SDAB 5ANHA 1DVQA 2MTPA 4JZNA 1GJWA 1RIVL 3VXRE 5LLIC 4I48A 2OTPA 3MUY1 4WRLA 2YS4A 4QRSA 1KGXA 4ZMAT 1HEJC 2FTAA 2Q76A 3ZKSD 4U1NA 2E9IA 1R5WA 2J72A 1VGEH 2G3ZA 2NUPA 4NAMA 3L3IA 5ANME 3KPQB 4PRBB 3QBTB 4YHKH 1IM9A 3RLSA 4OFIA 1KBBA 3NTCH 3KGSA 5A2BA 4YDKL 2BVUA 3O2VL 1A66A 1YEHL 5DK3A 3TO4A 2ADYA 1RHHA 2Q2EB 1A5FH 2VJ8A 3PAYA 2IANE 3KH3A 4AJYV 4PJCB 4FQXB 4U1JA 4ZPTB 2A9NL 3ZYZA 3SE8L 1DBKH 5DUMH 4QRRA 1SBSL 4HG4J 1UH2A 3DWTA 4DVRH 2R9HC 1K6QH 4YHPA 4M62L 3FUFA 2F5BH 1EO5A 1UURA 4KU1A 1HXKA 2ATKB 5FV1L 3NSYA 2ZYRA 3QJFA 4H4NA 2EICA 4ZMLA 3GJFK 4MS8D 5EBMA 2X4TB 4PGBB 3PXLA 3P4NA 1N64H 4N68A 3VFPB 3KM2A 4WK0B 1A7RH 1OARH 1OK8A 1I3UA 1QFWM 3A6BH 4HALA 5IW3A 2L0DA 2BVYA 4NXSA 5C3TA 2DW5A 3EYFB 5E56A 1YEIL 1FSKC 4N90E 1A7OH 1F3RB 1QHPA 4MVBD 5AD0B 4S2SB 4KTDL 4JX0A 1I9JH 1PD1A 2VLMD 4HK0B 1DQQB 1E43A 4MNHB 3E38A 3VYOA 1OQXA 2QLVB 2J57A 5I17A 4WWKC 1T66C 5ALBH 1KTBA 3HTLX 1XDQA 2V5SA 2NY1C 5AW9B 1I8IB 2GTQA 3A47A 1GGCH 3HN8A 3L8QA 4TNWF 4XBPB 1Z9PA 5AWNH 3Q9QA 1XGRA 2VO5A 3JZYA 4XI5C 5SWSE 1NZRA 4HX1A 5GS1A 4ERSL 4OZIE 3SY0A 4F33A 4Y4KC 3KYOA 2Q8AL 5IESH 5EN2A 2AQQA 4F8LA 4ALAL 3KPSA 5JPNB 1NCWL 4QF1A 4ZTEA 2ZKWA 4FQXD 1RP9A 3P30L 4NWTL 3KEDA 3RPIB 2CRYA 4IK6A 5L6YL 1V7NH 1HCYA 1UM4L 3ZL4H 4WO4C 5T8IA 3E3QE 2XICA 4D0BA 1HZHL 3ECVA 3C09C 2CUAA 4NN5C 5KSAC 3MRHA 4EZMA 3ML8A 4UMSA 5JW4R 3EGSB 4JCLA 4IBQA 4JQIL 1M2VB 1XIWA 5J6GA 4YH6A 3WFHA 5J89A 3A4EA 1GMEA 4PJFF 1MFVA 2VKWA 4U4BA 3HUJE 2BO0A 1OGTB 3I9PA 4FFYL 1MDTA 3QI9B 4P5SA 2WUBL 1T03H 3W56A 2EZ0D 3X14A 4UM8A 1IBHA 3HNSH 2GTWB 4J3TA 5E2TL 5ECJE 1T2QH 1NMCB 3X1FA 3O6FC 5MHSD 4RMUA 2HVJA 1ROWA 2OMTA 3GRWA 3QPKA 3UEQA 3UACA 2PR4L 4XMTA 1MZYA 4JQXC 1RUQL 2DPKA 3WG7B 2NNCA 3U2SB 1N3NA 2X4RB 4L4VB 4N2HA 5HJ3B 1VPOH 4V1DB 1YECH 1H3VA 3PHOB 4AV0A 1WUZA 1F3JA 1JK9B 2NOYA 2W0FB 5D5MA 2ESVA 3SYPA 2E76C 1FNEA 4R90L 2DI9A 1FGVL 5FCUL 1QKZH 4QUOA 1BM3H 2VSKB 6PAZA 1YMHB 3OKDA 5B1CA 2K0RA 1VERA 2ZP9A 4IDLA 3NEXA 2CO2A 5FW8A 3UXFA 1CG9B 4HJUA 3EOYG 1M7IB 1DLFH 3ARBD 4G6ML 5AKRA 4PR5A 2N1KA 4PS4H 2D0FA 3QIBA 4KXZH 4I1NB 4NKMB 2W92A 2W60B 3FL7A 2EVJA 1SGKA 3OL2A 1LLAA 4AI7A 4JE4B 5IFJB 2VZ1A 3GZKA 5AW2B 5KANI 3C8KB 5I75B 3KCPB 4M93B 3RL1B 1FVCA 3MRJA 1UYWH 3N41B 3KDMB 4P3CH 4DN3L 1TZHA 4JRXB 4TSAH 1BOGA 5TDOA 2V9QA 2B59B 5I28A 3STBA 4EKXA 2X2IA 2D3JA 4H88L 1BEYH 4C4UA 2EAEA 3LPGA 4YE4L 1P7QB 1ZAGA 4GIAA 1FGNH 1MN4A 1MZZA 1ZOXA 2GK2A 3CU1A 3HZMB 4KMLB 3ZGIA 4S1DD 1T6WA 3MLZL 3OGCB 4ZMQA 2IANA 3UH8A 4R84A 2OFQA 4XNZC 5T5FH 3UBFA 2BXZA 4NNXA 1IGIL 1DBJH 2CDFB 3H9SB 4GSDH 2Z4TA 3BEVB 4L4VD 5H37G 4V1DD 5GS0H 3IMRA 4WHTB 3RIAF 4PD4K 2ZTBA 4S1RL 4Z1PA 4XNXL 4NKIH 3RQ3A 2EH8H 3IVKA 4I89A 3N2JA 3RAJH 3AAZA 4BZ1H 3WTTA 2XFXA 2FYVA 5CF3A 1EXUA 2CHZA 2I85A 3RVXD 1F4YH 1IAIM 4WHCA 1XGPA 1JZIA 4RBPH 2QV4A 3C2AL 3GBDA 3ECBB 4ZFGH 4JE0A 4ILDA 4JG0H 4Z7QE 3MLUL 5GQBA 2E47A 3LSOB 1SXCA 2NYKA 3V6FA 4ZYKB 3SBRA 2R0LH 2PCPB 3LN4A 4AC2A 5AVSB 5GGRA 5B7MA 3KPMA 1EIBA 1KELL 3QDGA 2BMKB 1EHKB 2DM7A 3LS4L 4RZKA 3WJLA 4WSKA 3Q8EA 5HVHB 15C8L 2JH2A 4HAFA 4S1QH 2FLMA 4JRXD 2UZIL 5B3SB 4AJVA 3NFNB 1THAA 2CKBL 4HFWB 4HJEA 3EDDA 1U95B 5IJDC 2VWEC 1P4LB 3OR6A 5SWSA 1Z9SB 5CU9A 1P7QD 1KFAL 1OF0A 4OZIA 3IGKA 2O6EA 2OZ4H 1HVXA 2DQCL 3WL9B 3O0LA 4Z77B 3QUYC 1RPKA 1U8HA 2WV3A 1JPFB 2LFEA 2JVUA 3ATEA 3FQWA 2E6QA 3T2QA 4W9FC 3T0EA 3LRSB 4HBCH 2VABA 3TFKC 4K2UH 3E80A 3T3MB 4ZUTB 3H9SD 4P2QB 2ZOOA 3N06B 5CWSB 5G4MA 3UPRA 5KSUB 3LEYL 2NPLX 1IC0A 5IZ7A 5AZEH 4AQ1A 5JOPE 1DLHA 2J12B 2VAAB 3L9YA 2ZX7A 1RVFH 4FFTA 1M6OA 1PSKH 1HQRB 4NZFA 1JGVH 5E5MA 1H9DA 4OLZL 4OJFL 4NZTH 4V11A 4MJIA 5C7XH 1ZLVH 3ARXA 3P11H 5D7SH 2BY2A 4GMSH 1RZ7H 5ADPL 3PU7A 3V0VB 3HZKB 4L5FH 3BE1H 4P57B 3ZSSA 1I7TA 3HUJA 4KNTA 3V0HA 4XXCA 4UT6A 3KJ6H 1G9EA 3PS6A 3EUUA 3GMRB 3EGDA 3GXUB 1T3FB 3CMOL 4Z95H 1QVOB 2Z1KA 5CGYD 1XCTB 2X2UA 3SPVB 4Y5VB 2O6PA 4CILA 4U1KB 4QO1B 3W9EA 1RHFA 4GXFA 3MZGB 4OV5A 3VDCA 4WY7H 4K3EL 1WS7A 4MDJB 3MLWL 1OPOA 5A16A 3C60B 3NDZE 3DGGA 3WHE0 1ZSHA 2ADIB 2BHFA 4PG2A 4AGOA 4EOWL 3HPJA 3ORJA 5B21A 2OL3H 3RWHB 1I8LC 4GBXC 4I85A 1SXSA 4PVNA 5B39G 3VW3L 2AQ2A 2JELL 2AFNA 3QB7C 5E8EA 1ZGLM 2Y7MA 3M86A 1JCKA 4LPTA 3VD7A 3NYKA 4BCYA 4P2QD 1PIFA 2WOBA 3SPCA 2HKFL 5DK2A 2W81C 1KCRL 4HMCA 4LOUC 5FYJL 4YC2C 3H56A 1E4KC 3HLKA 2R69L 5CZVH 3QS3A 1G7HB 3L9RA 4NENA 3NCBB 1N26A 3PWUA 5HYQA 4X9GA 4X7DC 1J0IA 1CFQB 1U21A 4BELD 5D4HA 3QJOA 3ABLB 4D0CA 1JCVA 1BQKA 4O9HL 4TOYL 4ANWA 3IAGC 4UTBH 3K6NA 3FRPG 4MZ2A 3BRGC 4IBLT 5EZLB 4JFHD 3ZZLA 1NFIA 4X8GA 1JGIA 5KS9B 4WGWB 3FO1A 1XVSA 1MJUL 1LEGA 1WFIA 1H19A 1IIIA 1QRKA 1AZUA 3VXSB 3ZR6A 4L8SC 2X09A 2N3JA 1FNGA 2WSPA 4NJ9L 3D50A 1RQ5A 1E9OB 3PNWB 2G75B 1KIQA 5K33A 3VXUE 4OZFB 3N40P 4ZQKA 2QGDA 4G9FE 2Y5EA 3QORB 3QIUA 4DEUA 1F3DH 3HN3A 3N6YA 3NSJA 3VWKC 1SXAA 1IC7L 4LXFA 4M7KH 1FNAA 4AGMA 4Z7NE 1ZT1B 1R6VA 5DMKB 3N04A 3MV11 4JGNA 4LRIC 2EXYD 5FYLL 3OAZH 5DEFA 1UB5A 4Z78A 2F8XC 1VFBA 2Z31B 3ARDB 2ORBL 2E46A 5FO7A 1NCCH 2ZUVA 3X3GH 4WJG3 1YNLH 3A6CL 2IOOA 4QRQA 1KNOB 1ZKAA 3BVXA 4EJ1C 5CCKL 1EWHA 3RWIB 2P42B 4AYEC 2B5IB 4XHQA 4B50A 3OC8A 2AQ1A 1CFNA 2YO3A 1PLGH 1THCA 1JD9A 4ZXBB 3IK2A 1HL8A 1T4WA 2R4RL 1A0QL 2TSAA 3SYCA 4C55A 1E8WA 4XC3H 4F7CB 2FH8A 2HUEA 2L7JA 3LHAA 3OBAA 1J18A 1WCBB 4PJ7A 3SE3C 3ZE1B 2BDNH 1NGXB 5DJAA 4P9HL 4GAAA 3VXTB 2DLHA 3PHQB 2EEDA 4DP6X 3OKNA 4KY1L 3LYRA 3VXSD 4DK3A 1WAPA 2DWEA 3KS0H 3MO1A 1Z9MA 2XWEA 1YYMH 2K4AA 1I7RA 4XAKD 2FRGP 1ZGLB 1PG7H 1H8SA 1BAFL 3L6FA 3L17A 3SGKA 2LTQB 4E41E 3M8OL 4AQ8A 4B9FA 1AGDB 4A2LA 5C0GB 1ZLUH 3QORD 5J11C 5I8EA 5B1JA 2ZUSA 1FYTA 1LEKB 3CHOA 3DI2B 4PG9A 5J11B 3SCMA 2WQRA 3GMPB 3QCVH 3QO0B 1XSIA 2WN2A 1IC4L 3ARDD 2VDOL 3NA9L 1T5KA 5E8OB 4NO2A 1J8KA 5IKCA 4GG8B 3RA7H 4LT7A 1BW8A 2VLJA 4TS6A 3FOLB 4NERA 4XCEA 1SRDA 2XTJB 1CURA 3DNKA 2VIRB 1KCSL 4HWBA 1ZA3B 4D8PB 5KZCD 3IYLW 3T6QC 4P2RA 5HHNB 4ZXBD 1XO8A 5BO1L 3B3IA 1LXMA 3NOIA 4H0HB 1ND0B 5F9DC 4ABQA 3EDFA 4X7TB 5KVDL 1JF1A 1R3HA 5AYUH 3CVHL 1UH4A 3GSRB 1IAOB 1EDHA 3BZFB 4I8DA 5CZKA 3GM8A 5TQ0H 3HBPA 5IB2B 2WIMA 4NRXA 5HHME 3SDDB 3G3LA 4OFKA 4PUBH 2H26A 3NGBC 2ZOLA 4C4KT 3DRQA 4YDIH 1FBIH 4KQ3H 4UQ3A 4XCYB 4Y2DB 3COOA 3BWUF 1QD0A 4AMKL 3LPPA 4O4YH 4YE0A 3ZTCC 4QWWC 4YXLH 3DO3A 2ICWJ 3KAAA 1H3UA 1L6PA 4X42A 1IFHL 1E9PB 4DKEL 5IBUG 4AV5A 1QNZL 1MKFA 1G7LA 5TTRA 2N7SA 2X41A 4GXVH 2DI8A 4XP1L 4NN6B 4UBDD 1XZ0A 3TT1L 1A2YB 4PGEB 1FV1B 5AW0B 3ZTJH 5F9JB 3I6GB 3LVTA 1WFTA 3QUXB 5FW7A 2Y9RT 4K7PL 4EN3B 2LAGB 1MHEA 3QWOA 5F89A 3VI4E 3CFDB 4PB9H 1KBGL 3X1NA 5E2WH 4QRTA 2W94A 4AZ8B 4U6XB 4NQVB 4M6ML 1OF2B 2P7TA 3EYVB 5E9DE 5DJYB 1GCYA 5JLZA 1IQDB 4LLVA 1UOVA 2X05A 5CJQL 2Z8SA 4WWKA 4NWUL 3UDWC 2XTJD 4FXKC 1SEBA 2FYYB 4YMPA 4Z7AA 4IRJC 5DWUH 2OMVA 4FX5A 3GSVB 2GBTA 3STZA 2PR9A 5IB5B 5EO1A 3UBXA 1YEKH 2NXZC 3U46B 1L9TA 4YDMA 1J5OL 1U42A 2EKJA 2VWEE 3FCBA 5E00B 5IBTH 1YY8B 5HGDA 2F8IA 2MKLC 3IKCA 1OAQL 3RFZB 2P24A 4ONHB 4G5ZH 3VXUA 2X10A 2FEDC 5HDBE 2VCOA 3SDDD 2BW4A 2YRLA 4HIIB 2OJEB 4X50A 2FWSA 4NUJA 5EBLA 5FGCE 5C0BB 3RIFK 2XQYA 4MMXC 5GGTH 5ABAA 5C97A 2MOGA 3AREC 2E56A 1K5NB 4ZNEA 5J6HA 5T1MB 1OLZA 4WO4A 4PJEB 1DVFB 1NGWB 1K3IA 4MJJA 4PRIB 3V9EA 2KLRA 3OJ2C 4JFOB 3ZE2F 3VA2C 3OMAB 4HK3N 5H94A 1NOLA 3QCTL 1ACZA 2O5YH 4XX1G 2EDRA 4QY8B 1NDTA 1PY9A 1F1GA 2VLKE 3HZVA 4FG6D 4P23B 3IJYA 1R3IL 4AG4H 1JZ2A 1KJVA 4ZAKC 1AXSA 1DN0A 1HCZA 1M42A 4MDRA 1QP1A 2BY0A 2H3KA 3N1FC 4O2EA 1N7ML 2JIXD 3WTSA 1N5AA 3QUXD 4EN3D 1YUKB 3TP4A 4WUUE 4CL7A 3OF6D 1REIA 2CLVB 3MFGB 3MAWA 2J2ZB 4OY9A 3NIDE 4MAYA 5SWZA 5BVPH 2ZPKL 1H15B 3MRPA 1OD9A 4OCRH 2QBWA 2EVIA 1CK0H 4KFZC 5HVGB 4ELDA 3P0VH 1BFOB 2BP0B 2JJWA 3QNXA 4TULL 3VXQB 3K6IA 5TK4A 4NZ8A 2X6UA 1O6SA 1EK3A 2GK0A 2I60L 1GKEA 3HJEA 4DO5A 5CMAA 1FPTL 1AJ7L 2F53D 1EJOH 4GP4B 4LHUG 3MVSA 3IJEA 3BFWA 1QABA 2DIEA 3L81A 1E5YA 2CZNA 3PWNA 5GSRB 2C3GA 4AV4A 2AXGB 2QT6A 3R4RA 1JHTA 2A1WH 4LLMA 4AJWA 4BQ6A 5DHVB 5C0BD 4WUKL 1U92B 2AQ3A 3O0RH 4IDJH 1PU0A 5KG9A 2PP9A 4MXWH 2YGOA 3HHSB 4FZEL 1R3LB 1W8NA 1DVFD 2I25N 4HJ0D 3KPRA 3K81A 2CKBB 1Q9OA 1INDH 5E6YA 2PPCA 2NRDA 4PRID 4JPIA 2BVOA 4Z5RB 5I1IH 3ILQD 4QT5B 1MDAA 4PS3A 4AJ0A 5DFVD 2FATL 4MCZB 2Q3ZA 3D0VB 3QQ9D 3PWPB 1S7RA 3QHZH 3NJVA 4J8RB 3EYSL 3PQYE 4JPKL 4OF7A 4TM9A 4ZOEA 4BH7B 1GIGL 5HDRA 12E8H 5BV7C 1VEMA 5F9OL 3TL5A 3JV5A 1M1XB 3NN8B 2JI2A 5BZZA 3RWFB 3V52H 1VJSA 2PYFA 3RY5A 2KPWA 3CFCH 4MMZB 3RPKA 1U58A 1GZQA 4K94H 4KXZI 3MUZ1 2WBJC 1IM3A 5HI5C 3T9WA 1KTDB 3DYMA 4TMPA 1HS6A 4CGTA 3QEQE 1A25A 2XQBL 3BDYH 3L3OC 4LLQB 3WIHA 1TSRA 3CLWA 2OAAA 4FXGB 3VFGL 4DEPB 3JBG7 3FUJA 5JDJA 4X5XA 4KDWA 1LMKA 2F7OA 2VSDA 4ESKA 5EUOA 2XPZA 2NY2B 1WDAA 5E7FA 3GF8A 2DL2A 5EDXA 4ZSOA 2JI1A 3RYMA 1O75A 4GRLB 1ANUA 1JMXA 4LCCB 2EEFA 1ZA6B 3EYUH 1RY7B 1A4JA 4BH8B 4WW2C 2H32A 1OAZL 2BCMA 1BJ1H 4WZ9A 4P46B 2E6JA 3DV6A 2CUHA 1GSKA 1HWWA 1FFNB 2ADJB 4U1MB 1MIEH 2YQBA 5I0VA 2XDHA 4A2DA 3TZVB 5KSBE 3H9HA 2OP4L 4U1GC 5IHZB 3UP1A 3L4ZA 2R0ZH 5J4MA 1RIUL 5E9DA 3HBQA 4FE9A 3PWPD 4J3XA 4OD1L 2N7BA 2DWTA 3VH8B 4MNGE 1JD7A 1MG2C 4MS8C 4KJYA 1NANI 1Y18B 3D25B 3SSGA 5FA4B 4EUPH 3QUKB 2V2XA 2WVTA 3BPNB 3O9WB 2UX6A 1LEIA 4OV6F 2ENYA 1T80A 5JIIA 3DXAB 1RPUA 3BKYH 4L8DA 4TLUA 3V4UL 1DANU 1GXEA 4MVBC 3F01A 1FG2B 4PS8A 3HCVB 3QUYA 2K6YA 1XXDC 1ZJAA 3LQAH 3U7WL 2CO7A 4FZ8H 4W6YB 4NP4H 4RIRA 1QATA 2OYKA 4DGVH 3D5OF 4JZOA 3BAYA 3OHXC 1KENL 3QJQB 2F19L 4BFOA 3GUFA 1MLCA 4QTHB 1KCUL 1A65A 5HHXL 4IRZH 1CF8L 3CXHJ 3VA6A 4H8HA 3MLXL 4LASH 2Y2WA 4YHZL 2NY2D 3GSXB 1R24A 4QRPA 4LCUB 4GRLD 3EOAA 3G5ZB 4IJ3B 5KYNA 2WWOA 3ZR5A 4EUPA 4U1IA 2PXYA 4XVOA 2VLKA 1BQHG 1CLZL 4K0OA 2GJ6A 1G0YR 3DMMB 4P46D 5DZOA 4FQXC 4NQCB 4E5XA 3DO7A 2A6JB 4M8VA 2YOAA 5KYXA 1NCJA 3TZVD 1UCBH 1KGCD 3AACA 4F3FB 1WT5C 3BP7A 4HC1H 4X4MA 5L7XL 2AQSA 4BQ9A 2VR5A 3M7FB 3F84A 4NO3B 4XNQA 1P4UA 4YZWA 1T1ZA 2A7BA 3U9UA 4JVUA 4CBPA 3HZYA 2DV6A 2W9DH 3B2UC 2ATAA 1DQKA 1N0XL 2IDQA 3R1GL 3WJMA 4F2MB 3O9WD 4I9WD 4KZEH 1ET7A 3ZDYF 1RUMH 2IV8A 3FQNB 1BWMA 3DXAD 5FYJD 2ZCKH 4R3SB 2EZ0C 3VRJB 1OW0A 2AAAA 3L1OL 5EBWB 2B4CC 2YN3A 1I9EA 2DQIL 2Z7UA 5HDWA 1I8LA 4GBXA 4R26L 4Y5XA 1VCBC 1A7QL 4MX7A 5DJDB 1M71A 3WEXA 2X12A 1MJ7H 1NGPL 2APFA 4HS6A 4P2OA 2VZVA 3MFFA 1NPJA 3PXHA 5D2NB 1HXYB 4ONGH 4TNGA 4NZJA 3GYRA 3OQRA 4KZ0A 2HPTA 5D1ZA 4X7SH 4M61A 5FGBC 5MEOA 1AI1L 4ORGA 2J7LA 1NTDA 3EDKA 3VMPA 3F5WB 1X7SA 3MTRA 1E4KA 1OSZB 3BVTA 3DVFA 3UC0L 5IF0B 3H53A 1KJ3H 1MEXH 4GP8B 4XCCL 3D39E 1QLFB 2BWDA 3V79C 4XB3A 3WUWA 5JPNC 1DBAL 2V2WA 1WF5A 4NQCD 3UO1L 5C0CB 1WYJA 4HHGA 3AJ7A 3ARBC 5ITBL 1G9MC 2UWEB 4GS7C 2DQTL 3VFOB 4YIQA 3OM3B 1P9MC 4Y16B 2WY3B 4X99B 3KVDD 4WK2B 4HOZA 5HYFA 3Q2CA 4FP8L 2WGXA 2DH2A 3Q06A 3OXRA 3FSOA 3WHE1 2GSGB 4OZHB 2APBA 2VDOB 1A6ZA 4TTDD 2V5MA 2JK5B 3WHXA 2ZSWB 5LWYH 2NNRA 4XC1L 1Q0XH 2X53A 5BQ7A 3BCDA 3DBXB 2NTFA 1B9ZA 3A6OA 3DSNA 5LXVA 3VWKA 1JTPA 2D03L 1MIML 3K80A 4L3EE 3TM6A 4Z8FL 1G84A 1CGVA 2X42A 5AVVB 5DLLA 5LQBL 1CLOH 4EI5A 3DOSB 3RRQA 2PABA 4LRIA 4RQQA 4BSVA 1T1YA 2EIZB 1ACCA 2VXUL 3M1OA 2VN4A 4GOSA 3ZHNA 2HT2D 3A23A 3CVHB 3MJ7B 3SDCB 2AI0L 2F6AA 3RNKB 4Q4IA 3QJVB 4BIKA 2F54A 4JRYE 3ZW3A 2AJXH 1N9PA 3EAKA 4XNBA 3IFNH 1CJYA 2J8UF 3MDJA 4P5RA 1UZGA 3S36H 1U93A 4HIHA 1NIEA 1O9VA 4HZAA 3RVXC 1UM5H 2DD8L 3SZKC 1DE4A 1SJEB 3R7QA 3UO8B 2G5BA 1OQOA 3SE3A 4C4BA 4URKA 3B9AA 4OFYD 3O3DB 4LNRA 4XB7A 1HHGA 3PV6B 4Y16D 2KDGA 4PJHA 2DWYA 2GSMB 4KMQA 4MSWA 5GRVL 3OMIB 4XAWL 1FO0H 4O51A 3RB7A 2NY5L 3H85A 1WTGT 2WO2B 3C75A 3DYPA 3X17A 4LRNH 3VXNA 1D7FA 4YSEA 4A2MA 3WNPA 2ZQKA 4NP9A 5I75C 5FKAB 3DUSB 5IJCC 4M93C 2QPFA 3RUGF 1TZ8A 2W65A 4J27A 2WIIA 2X1OA 1MCPH 4K3JH 2P45B 4QOKE 2JCCB 1MI5B 5C0JA 5ISZA 2LVCA 1M1SA 3FFCE 1QBLL 1ZHNA 3NACL 1OOWA 2BW5A 4DTGH 4G6AD 2MPAL 3N1GC 3NBNA 2ZXGA 4LPVA 1TVHB 4ANUA 1B2WH 3FB6A 3FU9A 2DYPB 1XAKA 1ZSDA 3GXTA 3SDCD 2FSDA 2EC9U 2O6DA 5DYOB 3W0WA 2FE0A 2YMXL 3BT2L 3PAVA 4KMTL 1QFPA 1OAXL 5K9JL 2ZCHL 2VN3A 2C9RA 2EE2A 1W8OA 2ZT9C 3QZPA 1QBMH 3BOVA 4LSPL 5FX3A 1QQDA 1UATA 4IS6A 3FSZA 2FL5B 2WM0A 4AEIH 2ZXAA 3HAEA 2K9UA 2OMWB 3T2NL 3KZ8A 2LAAA 2VZ3A 4G59C 4TUJB 3TO2B 2BNRA 1PKQE 8FABA 1OWWA 1U3HA 1QI4A 1IVLA 3NCJL 1X5GA 2F7IA 3DX2A 1IAKA 1HTYA 3KYNA 2CG9X 1FFOB 3VM7A 5CGYC 3G6JF 3SPIA 3K6DA 3WNMA 3LY6A 3LPFA 1MH5B 4G7QB 3UTTA 3F83A 4FS0A 1PLBA 2Q6WB 3NAAL 1FP5A 1XGQB 2BIHA 5I30L 5HVHC 5LJYH 4MNQB 5I1CH 1XL6A 2DLTA 5F0LB 4WENB 4QHUA 3ALWA 1AD9A 3WFBH 1Q1JL 1Z5HA 2J56A 1KXVC 1PIGA 4I0KA 4I0PA 3DGDA 4OCXH 4WIQA 1MI5D 4PCYA 1LL1A 5D7KD 3MPCA 3HB3B 1P5UB 4GQ9H 1CDHA 1G4MA 4HWEH 4PJAF 4WEEA 2ZZUT 1Q9WA 3U6RA 5HSFA 4D8OA 4JM2B 4KI1A 5DEGA 1IEBA 1QACA 1W72L 2AERT 2ED6A 3QVAA 3UCRA 1X9RA 3ZZQA 1TIUA 1XSJA 2A3TA 2DYPD 4NO5A 2WO4A 3SGEH 5J06A 4HEMA 5FUOH 1SYSB 1EO8L 2XYBA 1U8MA 2J4WL 4YHOL 4YDLB 1RUPH 3RPBA 4U6YA 3UBXI 4GKSB 1JRHH 4EMZA 4UV7L 1LP9A 4XX5A 1OAKL 4FXKA 2PW2A 4XPTL 4AE0A 4Z0XB 4IRJA 2Y7QB 4UT7L 3BIKA 1XF2A 2MNUA 2X9WA 4FD0A 3SQOL 4IOIB 3TV8A 1DFBL 1XX9C 5AL0A 3QZBA 4IU3A 1UD5A 1PZBA 3V0WH 2JV6A 4DP2X 1S5IH 2VLME 4OF0A 4YWGL 4YQXH 3QJTB 4YGAB 3ARSA 3KE0A 4KZDL 3QCUH 4MMXA 5HYSA 2RB8A 3GBMH 1KT2A 4OQTH 4CRPA 1VCAA 1HAWA 2X6CA 4Z7VE 4XMUA 3OX8A 3WIIL 1TJXA 4WDIB 2B8OT 3MRCB 1ACYH 2ARJB 2XJKA 4Y5VC 2VE6A 3PXJA 1XF4A 1ROCA 2A9BA 1BFTA 4GUPA 1F4XL 4MNQD 2E86A 4XPAH 5C07B 3BO8A 5JQIB 1H8LA 1NIDA 4JGMA 4JFEA 4PGJA 4X8JA 5I1GL 5IJVA 4G7VH 1IQWL 2H1PL 3QIWB 4Y7MA 4ZAKA 2G5RA 3KPTA 5GRXG 3UTSA 3HB3D 3GJEA 2VDQL 5DUPH 4PJCE 3MRBA 1R9FA 1PAZA 4FOMA 4PTTA 4U7KA 4PI0A 4JM2D 1SYVA 2ITCB 4JANA 5I1KH 4JM4L 3CLFL 3WS6C 3WO3B 5HBBA 3ZBMA 1EERB 1MAJA 2EXYC 1PX3A 3W5MA 3GMOB 3A67L 4L2LA 1OGSA 2E27H 1P1ZB 2LR4A 3OLDA 4OQTA 4XCFL 5DO2D 1S7TB 4RCAA 4S11A 2JB5L 1RZGA 3MV9B 3VFSB 1NLBH 3RI5K 3VM5A 3IMBA 1B4JL 3L1GA 5CIPH 3DUUB 4FNQA 4JO4H 2XZCH 1NCGA 4H1LH 1KXTA 4GIOA 2MRYA 1F3DJ 3N9GH 4Z23A 4OJEH 3EZ8A 4Q9QL 3ZZ1A 2AKRB 2VR7A 3ZDXB 5FO8B 5B38A 2EDNA 3OKOB 1NWPA 5MHSE 3D2UA 4K5NA 3WTVA 1EVTC 1UD8A 2ZOTA 1IGYB 2EINB 2IF7A 3BAWA 3BGFC 4QOKA 2R56L 1IGML 1KJMA 5DRWA 3GUTA 1ZXQA 2FECI 2FJGA 3NESA 2WZPD 3FFCA 1RZJH 5F7DB 3KVPA 4R97B 4HQQL 5GGQL 3WY3A 4NHUB 3FFDA 2MCPH 1Z0NA 2JB6B 2QQKH 5EF0A 2VDRH 5GISL 3PV7A 3UYRH 4U2YA 4XMKH 5IK3A 1PFOA 1IT9L 1BZ9B 3D3VB 4RMBA 4LL4A 5K1JA 3VQLA 3VXPB 3EBIA 3QA3B 3ATAA 4LHQB 1UM6H 1TZIB 2VDPL 2LGNA 4GFTB 4LSRH 5IW1A 4HFUH 3GJFH 3TPUA 1CZ8L 1IGJA 1R75A 2UY6A 4FFZA 3T1FB 3FS9A 3WN5A 1HSBB 1A9BB 1E30A 3VXMB 1MCHA 3I6KA 3L7FB 4X2UA 3QORC 5LGHL 1Q0YL 2FWOB 3ZYJA 5K59F 3S88H 2ZWZA 1SPDA 4U1HB 4LEBA 1CBVH 3GMQB 5B7FA 3VJ6B 4CVUA 2R0KH 4RSVA 3U4EB 5JR1L 2EVHA 2WXIA 3D2TA 3KS0J 2CXKA 3FOMA 3ARDC 1P4BH 2YAPA 2GFBB 1QLEL 4MD5B 5LBVA 2FZ3B 2ZKMX 4ZX5A 3FSWA 2EIBA 3B7SA 5SX4H 3L3OA 4R96A 4PJXA 2G0KA 3MV9D 1NDMB 1AYOA 3PDOB 3Q0HA 1RZKH 5MEPA 2N4IA 1YNKH 2EQDA 4NQDB 4DZ8B 1OHZA 2WQVA 3GJFA 3L3GA 4I87A 4OCWH 4Y1TA 3JV4B 4ZXBC 1B0RB 3IMVA 5TFSH 4IOSD 1HC1A 4XP5L 2QHRL 4OLWL 1V8HA 3DX7B 5DVPA 4AQAB 3FONA 2P8LA 5JPMB 5DSCA 3AG2B 4HJJL 3RTQB 4OZGF 4LMQE 2CA3A 2Z35A 3BAKA 4P4KB 5TE7H 5D5MF 4ODHH 2OTWA 3KDPB 3LV3A 4P04A 5JUEL 4PRNB 2OV0A 2WVVA 3ZDZE 3HG1A 1T20A 1B6DA 5DS8B 1ITBB 4UIKL 2IWKA 4HV8A 4PJDF 4L4VE 1HNFA 2QKIB 3D3VD 4GAGH 4V1DE 5C0DB 2AGJH 2VXSH 3V4PL 5DUBB 1BYPA 4FEMA 3A4FA 4FMFA 5CU5A 4TPRH 3RX7A 1M2OA 4Y1SA 1S7QA 3L4XA 5BZDB 1NGYA 1TLMA 2VT0A 2LTQC 2RJMA 3DX6A 3H2QA 3VXMD 4DQOL 4UBDC 4GXUN 3DGCR 2VMEA 4M1GH 5LBSA 1F6AA 3C6SA 3W1ZA 3WNJA 3MRLB 5JW3L 4Y2OA 5EIIG 3RILA 4IEFA 1VRSA 1IKNC 3VFVA 3OC5A 4ZJ9A 5LCVL 4N1EA 3CDZB 5CP3H 1CICB 1RZIA 1X4XA 3U36A 2ZF8A 3KW8A 1KN2L 3PL6C 4IBUA 3UYOD 4MDIB 1TCRB 1YPZB 3AQZA 4JFQB 2UUDK 4K9EC 1YHPA 4ALAC 4OF8A 4L9LC 1YN7B 4JFFB 3OHXA 3WFEH 1A6WH 1N2RB 4Z7VA 2XTJC 4XVTL 1N10A 3SPGA 2IFFL 4JRXE 4JFDB 4WU5A 3LS5H 4ZFQA 4JPWL 5H4ZA 4MCYB 2JF1A 1QWHA 2Y2TA 1D5IL 3LMJL 5J1AA 3D7PA 3Q2WA 1ES0A 4XP9L 3RTQD 5AZUA 1E2VA 4P4KD 1KEGH 3ZPDA 5DR5H 1X9LA 3FQ1A 1UGKA 2XNAA 5E6IA 3VFRB 5HPOA 1XV8A 4R4FH 3SDDC 4D94A 3HFMH 2A0LD 1TJHL 4OM0H 1JGLL 3CN3A 5MEQA 3E6HA 4N2KA 3H9SE 1FVDB 3SJVB 5A2CA 5KW9H 2G3NA 3LZRA 5GGSA 3DPBB 2QR0A 5IIEA 4FLOA 3VFMB 3IU4L 2OW7A 5C1MB 5C0AD 3L5HA 1NCTA 1MNUL 3BKCH 1GPOH 4NKDB 3SDXA 4YEFA 1TQUA 3GSWB 1F2XK 4FG6C 3IDYB 2V33A 4NN6C 1Z5LB 3T1WA 5ILTH 4H0IA 4JREB 4WI0A 1DVUA 3C5SA 4P3DA 5AKTA 3QUXC 3DX8A 4EN3C 4H26A 3QNFA 3I6SA 5IOPB 4JO1H 4O58H 2NLJB 1QNIA 1CICD 1T0PB 1ICTA 3L95B 4OGQC 1A9EB 1FZMA 5D6CB 3VGEA 5D1ZI 4ZMVA 3VTTA 1L6XA 1ESOA 3MYJB 1L3WA 1RZ8A 2N0MA 1OE1A 4ADJA 4JFFD 4DF9A 1S3KL 5CLYA 2Z93A 4F57L 4OZIF 4E0RB 1EBPA 3WEBA 3EFDL 3MR9A 4IU2A 4X6FB 3IXTA 4JFDD 3TF4A 4UU9A 3V55A 5FGBA 4UQDA 1AGFB 2IH9A 1TQCC 3KPPB 1NIBA 4X4ZA 4JFVA 3O2WL 1I3RA 1E5AA 4P0DA 2WNGA 3RFZC 1OALA 4NZRH 4JFYA 3GWJA 3MLTB 1FZOA 5G4OA 3FJTA 5D2LA 5ACZA 1TITA 3KNBA 1A1MA 1TVBB 2G9HA 5JHLH 1JV2A 2AJUH 4UCFA 1XCQA 3T3ME 3D85B 3SJVD 4P2QE 2R2HB 4KUCD 5GJTH 1YNTA 4UOQA 2N0KA 1DVFC 3ARBA 4HJ0C 1L0QA 5E1IA 1OAYL 3HUJF 1P9MA 5IEHB 1Q9LB 3GB7B 1FL3A 3ILQC 1C5CL 4G6KL 2YPLB 4LVHB 1VGEL 4FJ6A 5DFVC 5C86A 3LIZH 3QQ9C 5A43C 3NP3A 3PJSB 4A67A 3KLHD 1CLYH 1DR9A 1MCDA 4MHHI 4OSUH 4PP1D 4YSPA 1PZDA 1JYNA 4XO8A 3BQUB 1XMWA 2BFGA 3F6LA 1MWAH 2BVPB 5D7HA 3TESA 1MW3A 3QQ3A 1WC7A 1S5HA 4N8VA 5DK0A 4K07A 4ZD3L 5CEXA 1G7PB 2DZEA 5BS0A 1YAIA 3O3EA 4HVBA 5EFIB 4JFHE 4YSTA 4OM1H 2XACC 3GDCA 1DBKL 5JIMA 2ZYSA 2QPEB 1L7IH 2WWKO 2DQEL 3EJYC 3ROOB 3KBHE 3K4AA 1NEZB 1U6AH 5EPMA 1T21B 1OP9A 1DQIA 3F2LA 4RAHA 3CSYA 5C6WH 1LWHA 3LZFL 1LGVA 5ECGA 3M7OA 3SODB 4CW1B 3BFQG 2E4TA 3MUJA 1AY1L 4L4VA 2Y1YA 3LIZA 1DQML 4IKIA 4QGYA 2QGCA 1ZVYA 3ALPA 4HIQA 1WJ3A 3APMA 1N64L 3PGDB 5D1XB 2SEBA 2R23A 3M17B 3S96B 4O2FB 2DQMA 3TFBA 3IDUA 3O4LB 3A6BL 1MF2H 4FYSA 2XRAL 4DK6A 1GC1L 4X6DB 3PCYA 4ZUSB 5IB1A 2IGFH 4F93B 2DQDL 1I9JL 3P1VA 4PLOB 3D85D 3ZKQD 3W9DA 1DDHB 3DHUA 3HPLB 3E9TA 2JXMB 2L4OA 1Q94B 4X6EB 1EBAA 3CZGA 5FF6A 4RMWA 2DQFB 2NYZA 4RA0C 2FBJH 4GLRH 5ALBL 4KHTH 2YPLD 4JO3L 2W60A 1MRCL 4J3BA 4Z7IA 2PP8A 4KI5F 3B2VH 4UQAA 2NW3B 2IQAB 1IBBA 5T3ZH 3VB9A 1CDJA 1DJIA 4X6BA 3WXWL 5I5IA 4CKVX 3UABA 2DQHH 2LFGA 4MA3A 3K2UH 4LVNB 3AS0A 4H5SB 4U49A 3SQRA 4QHLB 1BJ1J 1XFPA 3OKEA 4AVKA 5DZ9A 5IW6A 5IUCA 4PYHA 1MCKA 4XNMA 1OGAB 5IWLC 4QPEA 1SJHB 1AGCA 3C9NA 5KS9E 3QJHB 5IB4A 1U8QA 2P8MA 4HUKB 3ESVF 4FYQA 1G1OA 3HZMA 4WNSA 2KBGA 3GRWL 4BRJA 2VDNH 1PZSA 3T4AB 2M83A 3VXSE 2UY7B 1Z3GL 1XTLA 4PN6A 5LAXB 3EO0A 4QHMB 3ZL2A 4FXGC 2H6OA 1IE5A 3V95A 3OAUH 2X4UA 4DEPC 4RISH 2VXVH 2YLKA 2PYEB 3H3BC 5CKAA 3CQFA 4XAKE 1N5YH 5DZVA 4H44C 4ZS7L 2NY2C 1JMZA 1RJYB 3BRFA 1MG3C 1XR9B 2PO6B 5G5DA 3P77A 7FABH 4GRLC 4NPJA 4Z7QF 2X89A 5EU4B 4LCCC 3O4LD 4HIPA 2HH0H 5C9KA 4RMSA 1JDDA 2CGYA 3H1ZA 4XXDB 5DD1H 4AIXA 3BAXA 4BFJA 3QARA 3OKMA 1MQKL 4LEXH 1GZHC 5DI8B 4P46C 4B96A 1UKSA 2BNQB 3TH4T 2DOCA 3ESOA 3H4HA 4X5QA 1CFTB 4ZW8A 3F7KA 3Q3GA 5F96H 3AB0B 3TZVC 5HGHA 1JNJA 2VDQB 1WZ1L 5EMYA 4FI7A 2IH3A 2KZBA 5F88A 3VFUA 1BXUA 2ITDB 1JE6A 5T1KA 3P4MA 1DDTA 1G5AA 4IW4C 1WFUA 2IADB 1SDDB 3DJSA 1X5KA 4XN4A 3EOTL 4GT7A 3W39B 3BPNC 1P4IL 5DO8A 3U2IA 3QFJB 1KXVA 1OGAD 3JVGC 1LE9B 1BM3L 4BSWA 3ZE1E 3MN8A 4FYTA 2HG5A 4KTEH 1EAJA 2C7UA 1LK3H 4PAZA 3GRGA 3ARGB 4ODVL 3L3DA 5DJ0A 3TPKA 5IQOA 5GRUL 1NMBL 1V27A 4R4BB 2GITB 4PHZA 3BH9B 4PS4L 3CC5A 2YA2A 1FZJB 2D7TH 4E36A 3QR2A 2ENSA 1COBA 2G3XA 5D8JL 3EJSA 1EZUA 5KSUA 3V4VH 1WBXB 4P8QA 3TBSB 4OBRA 2X4SA 4NQXB 3VI3B 1UTDA 1I9IL 2PO6D 2VAAA 4WCYL 5AOJA 3ECWA 1A14L 1E28A 1UYWL 1GZPB 4IJ3C 5I16B 1HQRA 1PEZA 2O26U 3IETA 5I76A 1CR9L 1MVYA 3DROB 1OEZW 4UQEA 4Z7UB 2AEWA 4HIJA 2BNQD 4M8QA 2OR9L 2Y0SA 3S35H 2VDPB 3SGEI 2EIEA 4HKJB 3QEHA 2EDMA 4JW3A 4X6CA 5C2UB 5BJTA 5I2IA 4OJCA 1LO3H 4MJ4A 2Y69B 3S35X 3V6ZA 4DT2A 4UDTB 2OZNA 4BK4A 4BXSV 5GHWL 3EG9A 2IBBA 2FB4H 2XTJE 3DDGA 2Y6SD 2FVNA 4X98A 2FJFB 5IHWA 1A4AA 2Y36H 1JN6A 3CU7A 3FQYA 3L5XL 4GKZB 4OQ1A 2NW2A 2CGRH 1IL1A 4TT