2BIIA

Crystal structure of nitrate-reducing fragment of assimilatory nitrate reductase from pichia angusta
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
415
structure length
415
Chain Sequence
PFNSEPPLTKLYDSGFLTPVSLHFVRNHGPVPYVPDENILDWEVSIEGMVETPYKIKLSDIMEQFDIYSTPVTMVCAGNRRKEQNMVKKGAGFNWGAAGTSTSLWTGCMLGDVIGKARPSKRARFVWMEGADNPANGAYGTCIRLSWCMDPERCIMIAYQQNGEWLHPDHGKPLRVVIPGVIGGRSVKWLKKLVVSDRPSENWYHYFDNRVLPTMVTPEMAKSDDRWWKDERYAIYDLNLQTIICKPENQQVIKISEDEYEIAGFGYNGGGVRIGRIEVSLDKGKSWKLADIDYPEDRYREAGYFRLFGGLVNVCDRMSCLCWCFWKLKVPLSELARSKDILIRGMDERMMVQPRTMYWNVTSMLNNWWYRVAIIREGESLRFEHPVVANKPGGWMDRVKAEGGDILDNNWGEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRATE REDUCTASE [NADPH]
publication title Structural Basis of Eukaryotic Nitrate Reduction: Crystal Structures of the Nitrate Reductase Active Site
pubmed doi rcsb
source organism Pichia angusta
molecule tags Oxidoreductase
total genus 130
structure length 415
sequence length 415
chains with identical sequence B
ec nomenclature ec 1.7.1.3: Nitrate reductase (NADPH).
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2biiA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2biiA01
2BLFA 2XTSA 3R18A 2A9CA 3HBGA 3HC2A 2A9BA 3HBQA 1OGPA 2CA3A 2CA4A 2A9DA 4PW3A 2A99A 3R19A 4PW9A 1SOXA 2BPBA 2BIHA 3HBPA 2BIIA 2A9AA 1XDYA 2C9XA 1XDQA
chains in the Genus database with same CATH superfamily
4KKAD 1OAQH 1V3MA 3A24A 1WA1X 3MUUA 1CZ8H 4M7LH 3MQIA 4HAFA 3TF7C 3CDZB 1MVYA 3L95B 2WVUA 2YA2A 2H0PA 3LN5B 2F58H 4GIAA 5H2BA 4OV5B 1KCRH 1ES0A 5DS1A 2XN2A 4N22A 3S3BB 2IOMA 1Z32X 5JXED 3AB0B 4JFFB 3QORD 3ARFD 4NJ9L 1W72A 3CBKB 2AEPL 5KVGH 1JTOA 3ZMEA 2J8HA 3RKPA 4LHUB 3GLDA 4KRPB 4OFDA 4ALAL 5IQLA 3T2OA 4MDJB 4OW6A 4JR9H 1AR1B 1FE8L 4UUJA 5CF3A 1AZCA 2BJMH 1RK1A 4N5EC 2WLIA 4OQ1A 4E9RA 4S0HA 5GZNC 4FQLL 4PJBA 3DWTA 1HH6B 2IQ9H 2XBZA 3TJPA 5FYLD 3BPLC 2VZVA 2ZQKA 4FG4A 4RDBA 4XCNB 2R69A 4Z78B 1HHJB 1OHQA 1F4YH 3C08L 5D5ME 4GKNA 4KWUA 1CE6B 1Q90A 3DVGB 4Y4FB 5I8EA 3VH8B 4XMWA 4BZYA 5FKAA 3MSPA 5FCUH 3WE6B 2JCCE 3MGTB 2E9JA 5T5FL 1GPOH 2TSAA 4NP9A 4BE6A 4QRPE 1IBHA 3A6BH 4UM8A 4CJ0A 4LP4A 1IIKA 1WA2X 1DEEA 3QEQB 3UYPB 4JMNA 1E4KA 1IM9D 1I82A 1NCJA 5D93B 1M9WA 2JIXA 3ZL4L 7TAAA 2VITB 4GAJL 2DI7A 1DEDA 3PHAA 5DHYA 5ELIA 3WEBA 5IQ7L 2ED8A 1N19A 3LNHA 4QXUL 2CSPA 4I48B 2WO3B 2Y7QA 3DOSB 3VQMA 2IFGA 2UZPA 1UD4A 1GGIH 4X5WA 4RDQG 3CVIL 1J9SA 2FO4B 2XPYA 3S96A 4URKA 1GZQB 1S46A 3JT2A 4PS4L 3I6SA 1UCBH 1V5JA 2Z9TA 4AW7A 2X1WL 1BXAA 1GYUA 3RVWC 2EDHA 3MCLL 1FJ1A 1TEYA 4G8IB 1U91A 5F7DB 3J07A 1D5XB 3GXFA 4TPRL 1HILA 1QBMH 1T04A 3TJEL 1MZZA 2NY3C 5E51A 3VFGH 4XE5B 5F3HA 3GB7B 4UIKL 2BP0A 2WNGA 1XGPA 2EXSA 1GIGL 3SO5A 4XC1L 5TQ0L 2EC9U 3L95A 5BVPH 5JORB 4KI5E 3VDAA 2G5RA 4OV5A 3SDAC 3H1ZA 3VE0B 1UURA 2X4RA 2OCJA 3BPNC 3IJ8A 4S2SB 3HCVA 4JFFA 4KHXL 1QZNA 4ZUUB 3U46B 2ED9A 3KWVA 4QRSA 3C5SA 1EFXB 4FNLL 3CLFL 4ZNEA 4PGEB 3PL6D 3TO4D 4JRXB 2EEAA 1JBJA 4L9LB 2Q86A 2VIRA 4YVNA 3LEVH 4HZLA 1MLBB 1AGBA 1JP5A 4ZD3H 4F37K 3QRBA 4P2QB 5KVGE 1LJMA 3TBYA 2KI6A 3F6LA 4G8FB 8FABA 1LD9B 3P9MB 2G75A 4Z3GA 5A2BA 1RUPL 4OCNC 3M46A 4ODXA 2W9EH 3NDZE 1I8LA 3EO9L 1M6OA 3EXLA 1QFWI 1CE6A 3DVGA 3FOMB 5DDHB 3RTQD 2XX1A 4A67A 5MEPA 2DM2A 4UANA 1TZGH 3ARFB 3B2UC 5DA4A 5CEZD 4HH9B 4MAYC 3B7SA 3VDCA 4NZ8A 4ZO6A 1UZGA 4B0MB 4WJ5A 1KG0B 2I69A 3TBVB 3WNNA 4QY8B 4DK5A 5AW0B 1PX8A 2YD3A 5D5MF 5BZWA 3RBGA 1C16B 2VKXA 3PAYA 4U2YA 1U42A 2QTEA 3RGVC 5EU6D 3OXSB 3QEGL 5IROA 3O2DL 3G08B 1CGSH 3EDFA 1WT5C 4O5LH 2HAZA 3ZE1E 3O3UN 4D9LH 3NACL 2EUVA 4LHJB 4X7DC 2CBTA 4H8WH 3HBGA 3AADB 5J3HC 2C9QA 4C55A 3GUTA 3FFDB 3HS8A 2WXLA 3H0TB 5C0NC 4UQ9A 2FB4H 2PYFA 5HI3C 4XNMB 1SGKA 1DANT 2FLRT 5AB9A 1P53A 2YRZA 4WNJA 3CDCA 4D8PB 2H8PB 3GGWB 1AMXA 2FT7A 4Y1AD 2H6PB 2KKQA 4PJXA 4L1SA 3U7AA 5T3ZD 5D6DC 5AB2A 5HGBA 4N2LA 4I3RH 3Q5YA 2J4WL 1CYXA 5A2IH 2OK0H 1LGVA 2A7BA 1QEWA 3V8CA 3GC3A 2X6UA 4EN3A 3VE0A 1P69B 1KPRB 5EOTB 1YYLL 3D4GA 4XP4L 5FYKH 4F80A 3QJVB 4CBZA 3V6FA 3S8WA 4FOMA 2QQKH 5I6NA 4BXSV 3UAEA 4OD2B 4KI5F 3GMMA 4PGEA 5FOBB 1GGCL 2RHEA 3O3DB 2BNRE 3GSVB 4Q89A 5TE6L 1MLBA 3W37A 2GB2A 1M1SA 1OTSC 5IT2H 4OUOA 2XXMB 3GJFH 4P2QA 2AVGA 3O81A 5LBSL 5D4IA 3RU8L 1CFBA 5T1DL 3C5JA 5AAWA 1NIBA 4PGCB 5KSAA 1MCNA 3QZMA 4JQIA 4YLBA 1SZNA 4J8QA 4LAQL 2HKFH 1K4DB 4LSDA 1LM8V 4M1CD 4FYTA 2YD8A 4X9YA 1KGWA 1U8QB 2ITDB 4WGWB 2UY7B 3NK4A 1KG0A 4QY8A 5GISL 1KTJA 1M7DB 1S8DB 3PL6B 3TO4B 2MQ0A 5LN8A 5IJCC 2XHNA 3WD5L 2CBOA 3QJFB 5EEUA 3WKYA 2XFXB 1LO5A 3L5XH 1PKQE 5HHPA 3TEUA 4JW3A 1O9WA 4LRNL 1YO4A 4MRCA 3BKCH 1TTRA 3RIFF 3ZHFA 3HRZB 3IGAB 5F2FA 5C09E 4K23H 1TO5A 5SWZA 3T2PA 4JFTA 3BQUB 1MCWW 4QI3A 2GBTA 3VFTB 3RTQB 3TV3H 5DUBB 3MGOB 4JK0D 3V9EA 4DGIH 4BK5C 5ID0B 1CCZA 4ENZA 1CGUA 1CQKA 1LDPH 5LNGA 3BO8B 1P6FA 3UC2A 4QTHA 5FA4A 3S5YA 2WAHA 3RGBA 1MJ8L 4TRPH 1A1OA 4OLWH 4HPHA 5IHZB 3HR6A 3OMIB 4RZKA 2XXCB 3WYRA 3P30H 3TFKD 4P2CG 4B60A 3MNDA 4FMFA 5EU6B 4D8PA 3WJLA 3B3IA 3GSOB 3VXME 5I1CL 3ZJAA 1NCNA 3I3BA 1T7ZA 5JHLL 1AFVH 1J86A 4RDQF 2YAFA 3CLWA 1QMUA 2VL4A 4LASL 2DIJA 1MH5B 5DD1H 5ESVB 4UIMA 4EUPA 4ZW8A 2VQUA 1AO7D 1ZJBA 2AVFA 1I3RA 1ACYH 1N0XL 1A25A 2AERT 4PB0L 5ERWB 3QJUB 3GI8H 1V27A 2BSCA 3KYMB 5I18L 4O02H 3VJ6B 4PN6A 1A3QA 5TQ2L 3Q7JA 3SE8L 1N10A 3V0VA 2GITB 4U05A 4CVUA 2ZXWB 2HJKB 5FYKE 4NRZA 3NCJL 5BJTA 2V9UA 1AQKH 2HT2C 4KOBA 3BCDA 4JGUA 5JHBA 2ZNXA 1FQ9C 4QHMB 3DX4A 4J23A 3SE4C 3WMPA 4F7TA 1CDBA 2WUCH 3GSRB 1MCRA 4ELKA 2MRYA 4PGCA 3RHWF 4A7UA 5EZOL 2XTSA 4HFUL 2ZT9C 3D85A 1G7JA 1K4DA 2Y1VA 2IH3A 1SDYA 3BAEL 4OM1H 2WO4A 4PW4A 1FI8C 1ZS2A 4PREB 1YEGH 4XB7A 4X4MA 1VGKB 5IVXE 4IKLA 3AGVA 2UY7A 4QRPD 1VESA 2EDKA 3PGFH 1D5BB 2O1AA 4QTIH 1JCKA 2N1TE 3OXRA 1II4E 4WKXA 3WFCL 4AQAA 1S8DA 4C54A 1JGVL 1EAJA 3EBAA 5A6MA 2PTUA 4IJ3C 4XP5L 3QYNA 3T9WA 1RZ7L 4LLDA 2XFXA 4LCCB 3ROOB 4X80H 1DBBL 3OKDB 1S5HB 2HLEB 1FZKB 2BMKB 1B0RB 4HD5A 3HRZA 4Q56A 2BM3A 5C2BH 4HIPA 4LKXA 5IGXH 1NGPL 1YQVH 3BQUA 3DUUB 3UDWA 4AMXA 1AIFA 4HJ0D 1F56A 2EIMB 4ZUTA 3QHZH 4P9HH 5GGTA 5HYIA 3HI1A 3V8OA 4NRXB 4F9PA 2F7PA 1ZK5A 4G9DB 1UD6A 2X4UB 3OQRA 4N2DA 1YEKH 4AGMA 3CVCA 4L1BA 1V3LA 4ERSH 2TRYA 4I8DA 3CMGA 1UZ8A 1XH3A 4Y16A 4Y5VC 5EUKB 2YPLA 4ZTOL 2MPVA 1BP3B 3BHBA 3CFEA 3APCA 2DQIL 3ZTCC 3ATFA 2WLKA 4KI5D 1IFHH 3NCFB 4XNUH 5AAPA 3HLKA 2GJZA 1PZSA 1KENH 2CGZA 1WH0A 3K2MC 1MH5A 2WUBH 3D7PA 3ISWA 3DJRA 3NSXA 3OWRA 3OKLB 3D1MC 5ESVA 1HK6A 1A9VA 3GRGA 3HNTL 4ISVB 3SYPA 3L16A 5ERWA 1MVUA 2YK1L 4HIHB 2YOCA 4NN6B 4OKDA 1PYWA 1C9SA 3Q1EA 1PD1A 2JTDA 4O4YH 2R0LH 5EU4B 4EBQH 1EUTA 2F08A 4IBVA 1J9TA 3MA7A 2GITA 3MOAL 4Z3JA 4M6OH 2QBWA 3ARVA 3QXAA 1O6TA 5F7AA 4LEBA 5DYFA 4HUMB 4A2GA 2O26U 3GSRA 3D69B 5LKNA 4LGSB 1KEGH 3V0FA 1KFGA 5IWLC 3POCA 2BINA 3SPCA 3IFLL 1UJ3C 1BV8A 3V6ZA 1JYVA 4HKJB 3FT3B 1AO7B 3QUMH 4NHCL 1P2CA 1I3VA 1VGKA 3B5GA 4L8DA 1PBYA 2ENJA 5HHME 5CS7A 4DN3L 3DYPA 3VCLA 5IG7B 3PPSA 2OJEB 3U2SB 4AK2A 1QI5A 2Y06H 43CAB 4FKKA 4LCCA 5ACZA 3ROOA 4N4YB 5IVXF 3UMTA 3N6YA 5LGJB 1FZKA 4FXLA 1H3XA 2BMKA 1B0RA 4LMQI 5HYQA 1PDKB 2NZ9C 5C70A 1BMWA 4H8UA 3BAYA 3PRZA 4GXUN 1F90L 4X0KA 1J48A 3QCUH 4YXHL 3UTTA 1OP5K 4D8OA 1GAFL 3OJMB 3OMNB 5BOZG 3LPOA 2YMOA 4MA7L 4H1LH 4H1LG 4LSVH 4NUGH 5TE4L 1C5BH 3DO7A 5EF3A 3IJEA 1PJWA 4QRPB 5I6MA 3MRJB 3V0HA 2R0KL 1BEYH 2WC7A 4WO4C 3PY9A 1WAAE 4KH9A 1BIIB 1DFBH 3MV11 4AC4A 3OJDA 4JHWL 4EE2A 1QX1A 2EDXA 5C07E 4HWBA 2ZKYA 5F7LB 3LXCA 4F8LA 2FX8H 2D03H 3B9KC 4YSTA 5F9OL 1WUZA 2HKAA 4R4BB 3T0EB 1EDQA 4JO1H 2FZ3B 1IAMA 5F7YC 3KNBB 3QUZB 3K1KC 4ZQKB 1DQDH 4UAHA 5HYEA 4DCQB 4TULH 5JIDA 5HBBA 1GYVA 4JREB 1M2OA 2MSPA 3W39B 4DHLA 5EU4A 3L6FB 2L8AA 5D2NC 2L4OA 1JYXA 5DMIL 1JNHB 2FK9A 2FEJA 2GSGA 4YXKL 1PAZA 1U92A 2A77H 2E27H 5KOVC 1KT2A 2QDVA 1AKPA 2YS4A 3N3EA 5ICZB 2BX5A 4HT1H 3CSYB 3B1UA 5F6IC 1YNLL 2KLTA 4NQVB 3ZU8A 2I9LA 5I1IH 1F11A 4M6ML 4AL8H 4DUVA 2OI9B 1NUNB 2AGJL 4I18A 3REVB 1ESOA 3TU6A 3OB8A 4DVBB 4HKJA 1T22B 3FQTA 1JNJA 2P26A 3EYFB 2X3BA 4ODWA 2WQSA 4P9MH 5IP4A 4TUUA 4X4XA 4KNTA 4WNQA 2OJEA 4M9OA 4DUXA 5CEYB 1A3LL 2ZICA 4BH7B 1X4XA 4FERA 4HBCH 2FSEA 1WBYB 2PYEE 4N3TA 2YAMA 2IGFH 3ECQA 5LGJA 2VXSH 5C09D 3VACA 1PDKA 4YAQB 3GSQA 4DVRH 4UT9L 1UATA 1O6SA 1FFNB 4XE0A 4IMLB 1T1YB 2ICEB 1GHFL 3EJCA 5DEFA 1MFBL 5SWSE 3QNZA 3NIGF 3VW3L 1H9VA 3B7TA 4XPFL 1U36A 2IANA 4NQDB 4X0NA 5F70A 1WS8A 2DL9A 4XVUD 2GIMA 3Q6FA 2DWEB 4PW9A 3ARXA 4EXPX 5F21B 1H6UA 3CU1A 3QZLA 5EORH 4ANUA 1CB4A 1M3JA 4OGQC 2YR3A 4QJ4B 3VWJB 3FO1B 4PU2A 3N91A 3MLZL 4F1ZA 4KROD 3NSYA 1BIIA 4R0LA 4P4KC 2QQLL 4XPAL 1NDGB 4A68A 2NY2D 4TOYL 4EF3A 1PZ5B 4ZS7L 5IZ7A 1HJBC 1E8YA 2QVTA 4ZOAA 1JVOA 1AQHA 4R4BA 3T0EA 4K15A 1WAAF 4ZPTB 2FO1A 1QR4A 1E4HA 3I6GA 3UGXA 3GSNL 4XNQB 2AMGA 3K6IA 1Q9KA 1A64A 4ZQKA 1DUZB 1SMOA 3FO2A 4DP2X 3IE4A 1IKNA 4L4VE 4N0YH 4NNYB 1EVTC 5CP7A 4U6HB 3K74B 4K73A 2OW6A 5HVGB 4HWNA 5LNEA 3UTSA 5CFHA 3REWB 3T77A 2NY0D 2K8QA 5F1OB 3L3IB 1HSAB 5FYKD 4Z7QB 3SDCD 1JNHA 3O4OB 3ASWA 3MYZA 3BGAA 2CCVA 2F54D 4QYOA 3QIUC 4WSKA 3MJ8B 4DP7X 2ADJB 1KGJA 3CSYA 3F8UB 4R2GC 4S0SD 1GA2A 2UYLB 3ISRA 4I3SH 4IGBD 1U95B 4HIEB 5E7FA 2ZUQB 4E42B 2ZPKL 2R1WB 4DEPC 1YAZA 5ITBH 2R29L 4LLAA 3V10A 5CD5C 1AIZA 3KLDA 1DL7H 1KJVB 2DH2A 1T22A 2C9AA 3MOBL 3TV8A 4L4TE 3WTWA 4H8HA 2Y2WA 4FFYH 3U9PH 5DQJA 4PJEA 3IMSA 3F2LA 2YBRB 2ZOLB 4BH7A 4L37B 1MFAL 2XN9E 1E8ZA 5ISZE 2NXYC 3U25A 1E8WA 4OQTH 4P2AA 1Z9LA 5B8CB 1LDSA 2JKTM 2YD4A 5F3FA 3RVXC 2QADD 1KJ2B 1U9KA 1JS4A 4YAQA 3B2XA 4Z3IA 2XA3A 5J0BA 1HWHB 5F9WB 1QSZA 4DGVH 4NOFA 1T03H 2ZOOA 5EOQH 1RI8A 4F58H 1RZ8A 3L3JA 4Y9EA 2Q87A 1KCSL 2APXA 3C12A 3ML9A 5T5FA 4GS7C 5E0FA 4NQDA 4AMKL 4DKDC 2P4AB 3LEXB 4G71B 2JFCA 4G6ML 4JFEE 2YPVA 4KUCF 4WJG3 2NX5B 3B5HA 3ILQD 3FO1A 1NEZA 3MRHA 3UIYA 1TFHA 1E50A 3EJQA 4JJHA 1G43A 4MJ5B 2IO5A 3QPXL 1PEZA 4H20L 4QYAA 3VGAB 2VGLM 3O8XD 1QG3A 4IKNA 3LXUX 2J2ZB 4V2BA 5BQDA 5HI5D 4FS0A 1TMCB 4EKXA 4W6WB 4XNYL 1XVSA 5DYOB 3WOVA 4G70B 3UZQB 2YZ1A 3DUHA 3D0LA 4PG9B 3ZYJA 4JB9L 3DYMA 4XO9A 3CFBA 4NQCD 3WSQL 2IQAB 1KZQA 3REWA 2XWDA 3I02B 2VKWA 1R5IB 4P2OC 4KROB 2R2CA 4Z3EA 4ZYKA 4FZ8L 4XCFH 4XCEA 1AHWB 1BBDL 1JJUA 3GHPA 3NQKA 2NY2B 5GS0H 4F2MA 1C7TA 1DJYA 2WYHA 1J8HB 1LL1A 1H6TA 1PZDA 1WG3A 3TNMA 2E7BA 3BPOC 5TGBA 1NMAL 1OP3H 1U8HA 2R1WA 4CN4A 2JQMA 3S3SA 5E8EA 1QABA 2Y1ZA 5E08H 3KPLB 5A7BA 4ZOBA 1ZVYA 2MPAH 3L9YA 3MU3A 4TSCH 4B9YA 4JQVA 5HHOE 1TITA 1NPUA 4HUUA 4R4NC 2GHZA 5I82A 2R8SL 1E27B 2XBDA 3TIEA 1G7MA 2C7UA 1GSMA 4GAGL 5IFHL 2VZUA 2YBRA 1WBXB 2NY0B 1JPST 5C3TA 3SDCB 2NDFA 3QI9A 1AXTH 2XV0A 3MLWL 3GO1L 3W5MA 1RH8A 2F54B 3HVNA 5IEKB 5JW3H 4JM2A 3FPYA 1S3KL 5E6IA 5FO7B 3UJJL 1Y6NR 1AYRA 1FORL 2F1BA 4GRLA 4FYSA 4IGBB 4LOUC 1O7DE 4L5FH 2KPNA 4Z18A 4YK4B 5GS1C 1MIMH 2A9ML 3ZR5A 4WW2B 1IAKB 1FH5L 1G9HA 4ZMYA 1BPVA 3C2AL 5KSBE 4PW3A 5CZKA 4OF6A 5IVXB 3DX8B 3NPSB 1OD9A 3G5VB 3CAFA 4K3DL 2BSDA 4EI6B 4F33B 2NX5A 4FZEL 1T89A 4ZMZA 3INUL 1VJSA 2XVLA 4H26B 2J7LA 1IEHA 3GNML 4MJ5A 3TCXA 1YZZA 1NGQH 2AXFB 2XICA 2XVBA 3ETSA 3IDMB 4Z7UB 1FH2A 1Z9SB 1XF5B 4XVOA 3U7YL 2YUVA 1QRNB 3U82B 3KLKA 3DURB 4BHUI 1JZ8A 3WKNA 3BD3A 3FQ1A 1F58L 3FTUA 3NIFE 1AI1H 4J3WA 3MRBA 4FC3E 4KKPA 1FF5A 3K5RA 1QKZL 2VW7A 5SX4H 1FLRL 1N5AB 4OGXH 4ODHL 5C1MB 3UZQA 1IAIM 5GRXG 4MA1B 2ZG2A 3NCBB 2YIHA 3CN3A 3PXHA 4PG9A 3OKEA 1BWMA 3BVVA 2Z0BA 3K71B 1LYQA 1BA9A 2YOAA 5ADOH 3I02A 4UTBH 2CO6B 2VRKA 3H8NA 2YQGA 5IFAH 4G5ZL 2UVEA 1XXDC 3O8XB 1N9PA 3AY2A 4K7FB 3IDIA 5EEXA 4LSTL 1FDLL 4OZGB 4Y5XB 1WP6A 1SOXA 5FYLL 2ZWYA 1KV3A 2BS71 2XA8H 2ZP8A 3EYOA 3RB7A 5L2JB 5C0AE 5EU3A 3L3KB 5DU7A 3VWKA 3UABA 3I3EA 5INCB 2IALB 4N2EA 3ZKSD 1M53A 1ZT1A 3KPRB 2BDNL 5DJDA 4NDMA 2Q76B 1FYHB 3RKDD 1VCBC 3CHQA 2IC2A 3C6LB 4NQCB 4KU1A 4JY5H 1G1CA 1H8SA 4MAUL 2YEVB 5HHNA 1ZHBB 4M5SA 4M00A 3NZUA 4XNXH 3ABLB 2XPGB 2IV8A 5LBSA 3EYVB 5DCCA 1Q9OB 4XC3L 3MNMA 5CCJA 4FG2A 1XBDA 2CRYA 4UBDD 1X3DA 4E41E 4LE8A 2ZYHA 4KUCD 5FGBA 3G6JA 1P7BA 4L3AA 1AY1H 4PRHA 4Y4KC 1XL6A 2UUDH 1X9LA 4GG8A 3QCTL 1DVFA 1WTLA 4LLWA 1YEWA 5DLMH 3GM8A 4ZTPL 1KACB 4PTTB 4F27A 2EYTB 4CC4A 4Y4HC 1VB9A 4DKAA 4ORGB 2E3VA 2Y7OA 2NYYC 1M2VA 1SJXA 2XOTA 4FMKA 2RA1A 1B0GB 3ZR6A 1K9TA 2VXUL 3G5VA 4OZIE 3DPBB 3ALPA 4L5FE 1JNLL 5EBWA 3EGDB 1AS8A 2GUYA 2R7EB 4Y9CA 5E2VH 2R9HD 3AMKA 3OQ3B 5KSBF 1V7ML 3HKZA 2MQGA 3NIGB 4Z7UA 2IPKA 4GQRA 3VTMA 4C4UA 3CFNA 1QRNA 4XWOC 1PQZB 5EC2B 1QA9A 2D0GA 1LMIA 1RZGB 3VRJB 4LFHG 4YSCA 1KDJA 4KV5E 5DJXA 1MUJA 4BYHA 1JNNH 3ARDA 4OI9A 1C5CL 4WWKD 5DGQA 3ZGHA 4F7EA 1HL9A 2F8IA 1UWGL 1VENA 4IHOA 4MD5B 3EGSA 4L4VD 4YHLL 2WXMA 5FIEA 4R6UA 2IADB 3KDMB 1NL0L 3NIFF 4V11A 1G1KA 2GQHA 1HH9B 4HGMA 4YHYB 4JG5A 1PF3A 3FKUS 3MLSL 5C0IB 5FO8B 1T0MB 2DM4A 5D1ZC 5JHLA 1P5UC 5B39G 3RJDA 2V3FA 1H3GA 3AVEA 3LKRB 4X98A 2WLHA 3OBAA 2ESVA 2RAMA 1UXMA 5DRWA 1NIAA 3WMSA 3E6HB 4A2MA 2YAQA 4OZGA 2RALA 3HN8A 4QRUA 2VJXA 4KJYA 1VFUA 2R59A 3BI9X 3CXFA 3HC2A 2CK2A 1NFDA 2BOCB 5GGQH 5L2JA 1TQWA 3L3KA 3WIFA 2QFRA 3FSAA 4L4TD 1Q94B 4RVBA 3HC3H 3KPRA 3RDJA 1JZJA 4Q9RH 3AC0A 4JRYD 2VAAB 3VFPB 5I0YA 3C60D 1ZHBA 3L7EA 5CP3A 2OJZL 2XN9D 3WL9A 1ADQL 1OTTC 4UV4L 1Q9OA 2AANA 1EQWA 3HHRB 2AJSL 2VE6B 2PO6C 3L4UA 2MIZA 4NERA 5EIIB 5D70H 2ZUVA 5EZIL 2YA0A 2Z35B 2WPGA 3GKZA 4MCNA 4NQTA 4F9LC 2CIKB 4X6BA 4DKTA 4GAAA 4OGYL 5GGRB 3V4UH 3S88H 3GEFA 3GRWH 1MEXL 1Z2KA 5IHLB 1OCWL 3HZKA 1UM4L 4GW1B 1TU2B 4IRZH 4O58H 2YSSA 4PTTA 4TV3A 5CAYB 3QUYD 2E4FA 4JFED 1JK8A 4MZ3A 3C5ZA 4C58B 1N8OE 4LBEA 2X6CA 3ESMA 4BIKA 1K8DA 3MBXL 4PWFA 1F97A 2A83B 2Q7YB 4QNPF 4UINH 3TBBA 3DTUB 3FPXA 4Y2DD 5K93A 3J8F7 3KJ6L 3M8OL 4NQEE 1QNIA 3AITA 3H7LA 3G9VA 5EC2A 1PD0A 3R0NA 3I9GL 2NOYA 2K4WA 3CXHK 1HKLL 3DMMD 4R7DA 1FVDA 3PWLB 4X5XB 2XZAH 4IIQB 3WFEH 4WKZB 3WO4C 3S35X 1FNSL 2ZZUT 3LIZH 3FB7B 5D72H 2DJMA 2AK1L 4NPYA 4W68A 2OX5B 3WN5B 2NY6D 1HH9A 1KZYA 1TETL 3EJUA 3N1QC 4KV5F 5E5LA 2X12A 4QHKI 4GIPD 4GUCA 3QG6B 4G3YH 4H1LB 5CUSH 5FO8A 2VQTA 1T0MA 2O5YL 4CAGA 2NY4B 5EZPA 1RIUH 1SJHB 3NABH 1DE4B 1H15A 5J12B 3RZCA 1A9EA 2V9QA 1IZKA 3WIHL 5ID1B 2IMNA 5GGVH 3HI5L 3W2DH 3OHXA 2V5RA 4WWKB 3O0RL 3WLWC 3JWNH 3JWNG 4PJCA 5CSBA 5DUPH 4CC1A 2RD0A 4XOAA 1HHIB 5KSUA 4LCUA 4PJ5D 3WIIH 3D9AL 5JIQA 4K94L 5EEWA 5D6CB 4J4PA 5L8LB 5JW4N 5IJVB 1HCYA 5F7BA 4JUTA 3HC4L 2K0RA 2YQBA 4YFLI 1FO0H 1S7TA 1KN2H 1NC2D 3H53A 2W80C 3OB0H 1JZ6A 1CLYL 1M4KA 4MJID 4NZTH 5HGDB 2GTWA 3EGXB 4IDJH 2VISA 3E80A 2JELL 4NWTL 4ZMAT 2CIKA 4FHJA 4ANXA 3WBDA 3SDXA 4L3ED 5GGRA 1MNNA 4JPWH 3OPZH 4GW1A 5C6WH 4WFHE 4L4TB 5D2LF 4KHTH 2P8MB 2E8YA 2DWXA 3UACA 4Q6YA 3SE6A 4XMTA 4JNXA 1JN6A 2DWYA 4JRYB 1NEPA 1FNEA 2MFNA 1RJLA 3LEYL 3C60B 3O2WH 4G8AC 4POUB 3RIFK 1E4WL 1Y07A 2QELA 2DOCA 1CURA 1NOFA 2OYLA 2OYPA 3R8BB 2ZOTA 5SX5K 1P84K 3UO1L 1U30A 3BH4A 4ZNCD 3A5VA 2VL5B 3AREB 4OIIL 2GTQA 2UWEE 5CZXD 3FSOA 4N28A 2HRLA 4JFSA 4MGXA 3SKOA 5C8JB 4NGHH 3TT3L 5BQ7B 4X5XA 1BZEA 2BY3A 4HWEL 2FNWA 5A16A 1Q72H 2WY3B 3F3HA 1MRFH 3KPMB 3QUYB 4BRJA 4WCYL 1G6VK 3P0VL 5E4EC 2I07B 4MS8C 3TLRA 1RJZB 3D34A 1YEEL 4XBGA 2ZUSA 3TZVD 1BVLA 2ARJB 1IGCH 2AZUA 3DDFA 3MRFA 3O3EB 4K71C 4PSPA 1V55B 2ZJSH 5E7BA 4NFDA 3TH3T 1KXQE 4YE4H 4Y2DB 5LHDA 4QIRA 3US1A 3FUEA 1JMZA 3JYCA 4MWFB 1SJHA 4XN7A 1IBDA 3DVNB 4LCIH 3EW3B 1A6AB 4PJIA 2BWDA 4ZAKD 5I1EL 3Q48A 4EEEA 5D7LB 2FWLB 1INQB 5GS0D 5E8DL 5FA3B 5C0AD 4UOJA 4EMZA 4MNGB 1E4KC 1KTDA 4UZGA 1A3RH 1WSST 5EOCH 4HOWA 4YDLB 4ZDHB 3FU9A 4FTVE 1UH3A 1JZ4A 2VJ0A 2B16A 2PP9A 4BSWB 3LXAA 3FO0H 4L1LA 2NY6B 1CDIA 3N85L 3JWNE 3RHWK 5H4YA 1B2WH 3CDYA 4TNGA 1A47A 1T3FB 3Q5OA 3WJMB 4P5TD 4E41D 1S5IL 3CC5A 1X5JA 2WKOA 4Z77A 4X9IA 2HT4D 5IJDC 2WXNA 3FB8A 1XQ4A 4ENEC 1AHKA 2WBKA 3MRLB 2YGOA 3CVHL 4RRPM 2LU4A 3HS0A 4EI5A 1XF2B 5D7HA 2OXHB 4PJ5B 4N8VB 4HIXL 4P05A 3PLYA 4X7SL 1OE3A 1NCWH 4KUZL 1FRGL 2IV9A 4ONOA 1BG1A 4BQ9A 1ZLSH 1OSZA 4Q0XL 4QF1A 3BP5A 1M6UA 4PJ8C 5EOCJ 4YFLF 4GQPH 1QSFA 2BIOA 2VDLL 3BSGA 2H6UA 2JF1A 4MJIB 2I60H 1GJUA 2VL5A 3AREA 2WQXA 4O51B 4WEBH 4GY4A 4UT9A 4YHKL 4ZXBD 4NM4H 4G6AC 4RQQA 1JGDB 1AKJD 3E2HC 2BNQD 3MKGA 4L3EB 3X1NA 1CL7I 1KNOA 1ZHLA 25C8H 3B2PA 2B1OA 3EYUL 3O2VH 4TF4A 5F3BB 3IETA 4OJCA 1RIVL 1CZ8L 1JRHL 4L0PB 2DJ4A 4M48H 2UWEF 2Z93B 3K3QA 2I07A 1BVNT 4ILDA 2F58L 3U9UA 1SVZA 4LLVA 5L0QC 1URIA 1KV7A 3TA3B 2YKLH 4N9OB 2ZUWA 1VPOL 1VGEL 4JFUA 3ULSB 1I8LC 1OT4A 3KXFE 3I50L 2W92A 4H4NA 2DEXX 4LSQL 2WN3A 1H6FA 2OMVB 3EO1A 5DHVB 1AJ7H 2CA3A 4DN4L 3P3YA 4H88L 5FEBA 5J13B 3DVNA 1AXSB 3CFCH 3HMXH 4BCXA 2F5BL 3UAJD 5I6KA 2IWEA 1A6AA 3NIFB 3GSNA 1PL3A 4OLEA 2QQQA 5E95B 1D5RA 3CZJA 1KELH 3QULA 3C5XA 2DY2A 4JEGB 3FUIA 2BJML 4TUKH 1JGLL 2G9KA 3F84A 4FQCH 5KJRH 5HDBE 3WNOA 5J6HB 5GRVK 4KJQD 5IROC 2E9GA 4ZDHA 4IK7A 3MACH 4GBXB 2DQTH 2KPWA 2AEIT 1N5YH 3TZVB 5E1GA 1F4YL 2GSIA 2VDPL 2H3XC 1KMGA 2EICA 2WLZA 4H44C 5HGAB 1LK3H 5FB8B 1X5ZA 4R97B 1L7TL 2RJMA 2Z0UA 4GMSH 3POHA 2KZ1B 2K6ZA 1GPOL 1QSEA 2V4LA 2XFGB 5F1KC 2R29A 4N6RA 1DQMH 4ZAKB 3V5DA 3V4LA 3KL5A 3MRLA 1IC1A 3L3GB 5C0AB 1QTPA 1QLFB 4M1GH 3GJFK 3TNNA 4U1NA 1XF2A 2VXTH 4L18A 3F85A 1YMME 2J8UE 2P8LB 5MENE 5F1NA 4JG9A 3IK2A 4C59B 2EIEA 3T0DA 1FC2D 1MREH 4RIRA 4A2FA 1F5WA 5GJSH 1FIGH 1UCBL 4V1DE 4ADGA 1XB3A 4EN3C 1D5MB 2PXYD 3N40P 1AP2B 5KS9A 4HW6A 5LGHH 3PDOB 2W8CA 1ZGLM 4NQED 4P5TB 2E47A 1X5MA 4KKQA 4ZODA 2XWBA 4E41B 5KTEL 1ZVHA 3FONB 2CBPA 1K4CA 4BD4A 3QQXA 3EDJA 2WIIA 1IM3D 3MRNA 3NEOA 4YDMA 5I74B 3MMEB 5I23A 5JOPD 2X2YA 3HMWH 2XTJC 3NSJA 4ZMLA 3IBEA 4NKQB 4RAUB 4JFOA 1OM9A 1DQLH 5CLWA 1A4CA 2X09A 1P4BH 2Q7AA 4FQ1H 1F6LL 3X12A 5FYKU 2Z31C 1H0DB 2FD6H 4Y88A 4W9LC 3TA3A 2V5TA 3HE6D 1ZLWK 5KSAC 1E5CA 3UEQA 1KJMA 2X42A 1EMTH 3H2PA 3RUGA 9PCYA 5MI0C 4U6VH 1OLZA 5AUMB 1H19A 1AXSA 1BVNP 3VO0A 4PD4J 3ZY7A 4ZXBB 1Y0LA 4BFIB 3ARGD 3GXNA 2R4RH 1NFIA 1COBA 2C3XA 1AKJB 4ZD3L 2BNQB 2G2NA 1SJEB 3DXAD 2Y36H 1G9MC 2OSLB 3JV0A 2ZXCA 4W93A 3Q43A 5KYXA 1CE1H 3RIAF 2CJUH 4GBXA 1BECA 3QDGA 2W9EL 4MTMA 1ND0B 4IHBA 5C6TH 1MWAH 3IJSA 4BFRA 2WBWB 3I74A 3U7WH 2NXZD 2D0FA 3S7GA 5GRYA 4ZMOA 5FB8A 4KY1H 1S7WB 4FNUA 4LVNC 4AJ0A 3MROB 3FT2A 1VZGA 1TLKA 1K3ZA 3K8MA 3KYOB 5G5DB 2QPEB 1PLGH 3BVNB 4X7FC 2WXRA 5A2FA 3QFDA 2MQCA 2FHFA 4WFHD 5BXFA 5T5NG 3E8UH 3K1DA 4PRIB 1CGSL 2L7UA 3CPLB 4O5LL 4KXCA 2A9AA 3DA0A 2BXZA 2YGQA 4H8WL 2DN7A 1FC1A 1AGCB 3ARBA 3PWPA 1NAMB 1KC5H 2J5WA 4MVBD 1G7QB 1UVQB 4QRRD 1AP2A 3WUZA 2CDFB 2P7TB 3JUZA 1ILUA 4P23A 4PJFA 5D2LB 1BQHG 1Z0MA 2J8UF 4IOIB 3NRQA 4KKLC 4N0UE 3AXHA 3KBEA 2EH7H 2PCPA 1QOKA 4XPBL 2JNZA 3DROB 3ZKXB 3S8GB 3MODH 1R3JB 1B2YA 3BUYA 3MMEA 2X38A 4ICXA 1EEYB 2VDKL 4NPKA 4PTUB 3IDYC 3KHQA 2JKXA 1A6UL 3D4ZA 5FYJD 1YEJH 2CR0A 1YY8A 2OL3H 1NC4A 5T1MB 1E4JA 2EDRA 4Y2OB 1TJHH 5IK3B 1GY1A 5C0DB 4NO3A 2FEDC 3S3DB 1SOKA 3PDDA 3PJSB 4JKNA 4KKBD 5AUMA 1LO4L 4MMYB 5F88B 4P5SA 2PETA 4U0RC 1E5AA 3B37A 3C87A 5C0BD 2XWTA 4E5XG 3V0AC 1G0XA 3P9LB 2LW3A 1AE6H 1U2CA 1IM3B 2P5WE 2XZCH 3NAAH 2NW2B 5D8JH 3NJLA 4XMUA 1OSPH 4IOFC 5GS3A 5LAXA 1ND0A 2OFQA 5L2KE 3LZOA 3II3A 1XD0A 3SZ6A 1XCXA 2HKFL 1CGYA 2GUOB 2W91A 5AD0B 4OCMC 3UDWC 4HULB 3D30A 4QRQB 3JV4B 4G7RB 4N2FA 3AWFA 3IXTA 1QO3B 3F01A 5EO1B 4WU7A 3ZW3A 3KYOA 4H0LC 3CSPA 4P2RA 4F9PC 3MRCB 3BVNA 3QA3B 4N86A 3VAEA 3SKUD 4PLNC 2HRPL 2NY1C 3HUJE 3DXAB 3L5XL 5HXMA 1T1WA 2FHCA 4TTDD 1BFSA 2EVFA 1HQRB 2CGRH 4ICWA 4M5TA 5E6UB 3SO3B 4Z6AT 4Y16C 1SEQH 1IC7H 4K23L 3QW9A 4Y19B 2GYSA 5ECJE 3MV7A 3FQNA 1RUAH 3DRTB 3MNVA 5C9JB 5T1KA 2CO1A 1AGCA 5FF6A 1X5IA 3HLAB 4NT6A 5CU9A 1T0PB 2NXZB 1IM9A 4BSVA 1G7QA 5CN3A 3ARQA 4TVPL 4DPAX 4HG4K 1XGTB 1QFUH 3OGCB 2YRBA 4D0BB 3VFSB 1TJMA 4M93C 4HEPA 5B1KA 4TRPL 3V5KA 4OLWL 1KFAL 5CBEA 4G5AA 5HY9B 4E0RB 5IFJA 2M2DA 1MELA 4K8RH 1UXSA 5HD8D 3SKNB 4GP5B 4YIQB 2QPSA 4OIFA 5L7XL 1I7UB 2W0LA 3BSZL 4NYLA 1FL3B 1HZHH 4QHNA 1M7XA 1T83C 1I1AC 1YDPB 3EJZD 2D4DA 3N9GH 3OLIA 3ARRA 2H6OA 1M7IA 5AZEL 3NP3A 4AUUA 2K4AA 3KXFD 1TVHB 3V4VH 1W16A 3QYCA 2JKNA 4M8UA 4OF7A 3SGKC 4QRRB 5EZLA 1CBVH 1N68A 3PJSA 4G8EB 1DVSA 4UZUA 4MMYA 2XV6B 3HZ3A 2YD7A 3GI9L 1ZY9A 3GMLB 1NGWB 4O02L 2P5ED 3BFQG 3K0WA 4DOHE 2AC0A 1HHGB 2AV7B 4N85A 1O0VA 1AQKL 3E7JA 3LHPL 4NCC2 5BCAA 3NFPB 2HX8A 4JKKA 1XGQB 1A4BA 2NW2A 2WUCL 5KVDH 4RRPG 1GCFA 3LH8A 3BXNB 3ALXA 2KQMA 3IJYB 1A65A 4XP1H 3BZEA 4CN6A 2V6HA 2DPKA 1AG0A 1WRFA 1JZGA 5J6GB 5DK0A 4KPHL 4NC0B 4PJ7E 3WO3B 1IEBB 3JVGA 4PRNB 3ZO9A 2BY1A 2KLRA 3W5NA 2GUOA 2HX7A 1DVUA 3TN0A 4LAJH 4QRQA 1ZDSA 1OAYH 1YEGL 3B34A 4G8GB 2K7QA 3OLEA 5IMMA 1P7HL 2J5LB 1XGRA 2AXGA 3PAUA 4UT6H 3OMZA 4ZBJA 2K3HA 5JIMA 4NSKB 4RGOL 4GSQA 1GRWA 1X5YA 4ZFOL 5C0BB 2XT1B 4QO1B 2FTAA 3WKMH 2CKBA 4G7QB 5JW4R 4X80L 3VB8A 5C7ZA 4JO2L 2KQNA 4PCKA 3QDJD 1HAUA 3GPEA 1UOKA 4OLUH 4Y19A 5IB5A 1WVZA 2EXTA 2ZUUA 3VTAA 5IGXL 5MEND 4A7VA 3SYQA 1QYGH 3FUNA 4FFZL 1ADQA 3HLAA 4C56D 5J06A 3DIFA 5DSCA 5IBLC 3FRPA 3EF7A 5E4OA 5EFIA 4FDWA 5GRJL 5JHDE 2DDQL 5C08E 5FECA 5CJ5A 3QHZL 4XHQA 1G6RH 2XY2A 1GS7A 3BAKA 3HFML 2VDOH 3OKOB 5JXAL 3WMQA 4IYKA 4TNWF 3LMJH 1P1VA 2AXHA 1OAZL 1PG7L 4JLRB 5D1QA 5T5NF 3O45B 3P2DA 5CCGE 4E0RA 5TDOB 1E3XA 4OZ4B 2DBJA 1SM3H 3T3ME 1IC0A 3SKNA 3ZT6A 5IB1A 3V2AR 1TTAA 2CWRA 1RIHL 1XBRA 4LQ1A 4WJKB 3NTCH 1F3JA 4YZWA 1OO2A 1UT2A 3CFKB 5DEGB 4XNUL 2RIKA 1ETA1 3UERA 4WY7H 3S36H 1YDPA 4E9QA 3DX0A 3QIWC 2WUBL 4CDGC 1TVHA 3CUPB 1SXCA 1LEGA 1NEUA 1UA3A 5FW7A 2X70B 4N2HA 4AV5A 4I18C 1CXKA 1T2QH 3FT9A 1I7TB 5AL0A 3QUXA 3O6FD 4DP5X 2O61B 4IRSA 4O4YL 1XIWC 2YO3A 3ZIYA 1E2VA 5H37A 3TBTA 1HHGA 5H35B 4OF3A 2AV7A 1R5WB 3BFWA 4CADB 1D5ZA 4GRMA 4HK0A 2LLGA 3L9BA 5FUCC 2BC4B 3T3PE 4A6YL 1FZOA 1A6WL 1BVKB 3BDBA 3NFPA 1RVFH 1UEMA 4F2EA 2I25N 3W1ZA 1AR2A 1JGUL 4FKEA 3IJYA 5CCKH 1HHHB 3S4SA 2F7QA 3ULUH 5ANME 4WZ9A 4MQ7B 5DFWH 1XGYL 2XXGA 1ZA6A 1KN4L 3P11H 2WWKO 2FLMA 4EIGB 1OCCB 2J73A 4DNLA 4PRNA 1CR9H 1MHCB 2V33A 3GLAA 5KVDE 5LBGA 2HFTA 5F7EH 3LPFA 4G8GA 3AT9A 2X89A 2NLJB 4X4YA 5DC4B 3HPLA 3WIHA 4YDIH 3KWUA 3IFPB 4AEHH 2XPZA 4WLCA 4HCRL 4PJ7F 2P5EB 4ACTA 2MTAA 3MV8B 1D9KD 2EE3A 3BVTA 2B1AL 2Y06L 3HNVL 5I0WA 3K80A 1WCQA 1T21A 3OAWA 3GIZL 3V0IA 1KTKE 4MRBA 4R0LC 2XQBL 3NGBB 4DH2A 3JWOH 4PVMA 5ITFA 2DQGH 5IW3A 3QZPA 4G9FB 2FGZA 4B97A 5GIRB 3QISA 5I5RA 1MCQA 2G30A 2HVBA 1CQYA 2FUQA 1BX2B 3DVIA 1YUHA 3FB6B 4U33A 4YSDA 3QNYB 3CN2A 5ES4B 1U2YA 4K4KA 1JHLH 3O41B 4YBLC 1SXZA 2YD6A 3BISA 1IKNC 3C6SA 3I6KB 2M26A 4TQHA 4JLRA 4JM4L 2F74B 3MCYA 1XR9A 4NLHA 5E9DA 1NSNH 2V9RA 3PHOA 3ILPA 4OZ4A 1WLHA 3SEPA 3UBHA 2W9DL 2IG2H 3UTQA 2FX8L 2D03L 1CU4H 1MWOA 1FN4B 4PJ6A 2ZIDA 4XBPB 3X11B 3EH5B 5DEGA 3QDJB 4HS3A 4MHHG 3T0WA 4UM9A 5MENB 1J88A 1FGVH 1UASA 2ZKWA 3C09C 4HD9A 1YEIH 4PWJA 3W0WD 4C56B 4H25B 1LILA 3T3MF 1OPGH 1PG7W 2BS8A 4Z3TA 2GT9A 1VHPA 1Q9WA 3WAJA 4Z7VE 1A7PH 2NY7H 5FKPB 5GGUB 2RBLA 5EZJB 3MRGB 4OD1H 1N3NA 4GP8B 4K9JA 3BN3B 4F7PB 4MCZA 4ALAC 3FQUB 5FV1L 4Q9QH 5H35A 3BDYH 3S98A 1R5WA 2B4CC 1H6EA 4CADA 4RGMB 4URTB 4PR5B 5E2WH 3TURA 5E1HB 3EO0A 4WUUA 5E6RB 3TEZA 3QEUB 4P2YA 4N5ED 5L2KD 5DQDL 5I1IL 1DLFH 4QCIB 5GZND 3RWJB 4PY8J 4DZBB 3BD5A 1GGYA 1A6PA 1TZAA 2CQVA 1XF1A 4GW4B 3RWEA 4JHAL 2WYZA 2NYKA 4A7GF 4RZCB 5IB3B 1E65A 2K9FB 2EEBA 1IARB 3BIAX 5E6ZA 3L4VA 5LCVL 3D39B 3WDJA 4BA0A 4EI0A 3ULUE 3PUUA 4NN5B 3LD8C 3O6FB 4I2XB 2A9CA 1E5BA 1KBWA 4R3SB 4J1UB 3SE9H 3A6CH 1DBKH 4Z5RB 1L3WA 3T0XA 1BXXA 4Q8BA 3MBEA 4X9BA 2JCCA 1R3KA 2IGFL 3QG7H 4MJ6B 4IBWA 3ZHNA 3V4PH 4ETQB 1QI4A 3IN0A 3SQOH 2XWZA 5IB2B 5KVEH 2VDPB 2X88A 3BAWA 3AAZA 4DVRL 4HCIA 4WI9A 5CEXB 1Z5LA 4UDUB 4JFWA 3BH9A 4X6EA 3JUYA 5GIRA 5LAPA 2F68X 4CVXB 3KLAB 3U79A 1B3JA 2W60B 4PBXA 3VB9A 3SGDI 5HYJD 4P59H 3SSGA 5KG9B 1HXYB 3FB6A 1PIFA 1WFNA 2DTML 2FQDA 3EJYD 4M7ZB 1TKWA 1CXLA 4N20A 4J2QA 5JO5A 1EGJL 5EU7C 3RVWD 3UP1A 5I16A 4M8QB 3L3DB 3CVHA 4DZ8B 1D9KB 4AJVA 3PNWA 2R56L 4FQIL 4MXQC 1XAKA 4FI7A 5DZJA 5SV3A 5T3XH 4MHHI 3QQNA 1T6VN 2O5ZL 2XKUA 1FN4A 3A4DA 3X11A 4HWZA 3VG0L 4W9EC 2BLFA 4CSTA 4U1MB 4BH8B 5BRPA 4PPTA 2VH5H 4H25A 1EO8L 4S1SL 3X13B 3AG3B 4GQQA 3SDAD 4GH7B 3UGUA 5FKPA 2ITEA 4QHUA 3VXOA 1HWGB 1FYTB 1ZIBA 4N0YL 3BP6A 3L1FA 3MRGA 4JQVC 2W81C 3M17B 4JFZL 4F7PA 4HU8A 1BM7A 2AJZB 2O5XL 5D1XE 4WHTB 1N6VA 2ADFH 3ZOAA 3KYNB 3QORA 2ZOKA 4X8CA 1NKGA 1J0JA 1PMYA 1SDAB 4ABVA 2PCFB 3NJHA 2B15A 2FR4B 3QI9C 2M8XA 2PW1A 2VOTA 3QEUA 4PMEA 3FRUB 4I3SL 4WTWA 5EIQA 8PAZA 3QPKA 4N2KA 2ZCHL 5K9KA 4JM2C 5HYSG 5E6IC 3RWJA 5JPMA 1F8TH 1NLDH 1NAKL 4GRLC 3W0WB 1CTNA 3HAEH 3HAEG 4RMUA 1K2DA 1DL7L 1L3NA 4RZCA 5IB3A 3K2UH 3BKMH 2BVQA 1JPTH 3D39A 4XR8C 2WBJA 1MCSA 3HG1E 1TYEB 4AGPA 3RL2B 3U9PL 3B2UD 1H3UA 4R3SA 4J1UA 4KKCC 4MAYD 1B4JL 35C8H 3K91A 4Q52A 4Z5RA 3VFVB 1KLFA 3OR7A 1T89C 2WQ8A 5I1HL 4ZW3A 1UKQA 1NCAH 3ULUF 4W9IC 3RGVD 4KITB 3VXRE 4JG0H 5CFAA 1VKXA 4KMTH 1BGXH 1TG8A 3Q8FA 5FM8A 4PJAA 4XX1G 2Y2YA 1BZ9B 2VDNH 1HHKB 3JTSB 2I5YL 5JHDD 1WFOA 2QGDA 3KLAA 3QUKB 3BPLB 5B38A 2VLRD 5FW8A 1A6TA 1WQVT 3FL7A 3N43F 3O6MH 2COQA 5I8KH 5J3HD 4PBDA 3HIZA 4ONFH 4RBPH 2NR6A 5F0PB 1MJ7H 5KVEE 5BUAA 1A1NB 1I31A 1ZWIB 4JE0A 1RK0B 1D6EB 1DSYA 2WTPA 2FWOB 5HI3D 1WICA 2CZNA 4P04A 1V54B 1DQQB 1I85A 4N1HB 4NRYB 2ZAGA 5L88H 2HH0H 3IBOA 4LDLB 3FHAA 1JDCA 2EAEA 2YPKB 1AQDB 4LSSH 3LRSA 2BVOA 2IMMA 2W38A 2WD0A 5T3XE 2Z1PA 3OG6B 2AQQA 4ZFFB 1G7IB 3MRDB 4NM8L 5HYJB 5ENWA 1FZMA 5KEZA 3NN8B 3D5OF 3M17A 3R4RA 4XBEL 3VWKC 1KDIA 4WHTA 2ICWJ 3Q01A 3W9DB 1XT5A 3IPFA 1MHHA 4FFWC 1G4RA 4XCFL 3EADA 2VDKB 4UV7H 3LY6A 3QWQB 2OZ4H 2PCFA 4GUPB 3ARSA 3H2QA 2NY3B 43C9B 1FNGA 4N8CH 3VI3A 3FRUA 1H8OA 1RZJH 3HBZA 4X6FA 3ZO0A 5L6YH 2BNRA 1CT8B 1JPSH 1BBJA 3MUY1 4J8RA 2ERJC 3CZLA 3FQ4A 4YPGB 3QAZC 5E08L 1HOEA 5FGBC 2MPAL 5E2UL 3BT2H 3RBSA 4JANB 5DWPA 4AITA 1KLUB 2YFNA 2DV6A 1RURH 3SDAB 1I9JH 3K72B 1DVFC 2EXWC 3BPNB 5DHDA 2AS5M 3DX6B 2ID5A 1GGBH 5BMFL 4FJZA 4DOHB 1I53A 4OJFH 3QFJE 2FJSA 4OM0H 3TWCH 3SQRA 1Q4NX 1N18A 4XOEA 2F61A 4H0GA 5HVHC 1PFOA 1ZK9A 1Z7JA 2FDBP 4HF5H 3MJ6A 5FW6A 1PEWA 2X6BA 3LNFA 2N0MA 4OB5L 1JIBA 3TPUA 3CH1B 4PJ7B 4N3UA 4Z0XB 3GBNH 3JTSA 1KTCA 1YN7A 4W9FC 1JXGA 3L1EA 1PKQA 2BW4A 4HJIA 4HC1H 4KO9A 3ARDC 1TF4A 3CDGB 3VGGA 2QMKA 3ZN6A 3VMNA 3V0WH 1SY6H 2XETA 4XX1E 1ZWIA 3CBJB 3QRLA 4MAYB 1BIHA 4M61B 1RZPA 4ZTEA 4NO5B 2DD8H 1I7RB 4U1JA 4FRWA 3LV3A 4WI2A 4Y5YC 5HDWA 1BF5A 5F6HI 1RHHA 4OD3L 4NKMB 1DVTA 3MTXA 4MA3B 3WDHA 4M4PA 1R9FA 2GJPA 2Q6WB 1Z9OA 2IXQB 1AI1L 1DO6A 1ASPA 5IVOA 4XVTL 3VXMA 1ITCA 2Z92A 1G7IA 2VLRB 4OGXL 3SYCA 1FGNL 2CHNA 2D7QA 1A1MA 2CLVA 4BBWA 4XZUA 2FECL 2DQDL 4JJOA 2J1WA 2OR9L 1ZTXE 3AS0A 4EN2A 5ADOL 1VCAA 1GKEA 1J87A 1A5FH 1JVLA 2DYSB 3DV4B 3F7RA 4MKTA 5F71A 2ZF8A 1XXFC 2AJUH 3CHXA 4PIRF 3GJEB 2XTLA 3MLRH 3OR6B 4NAJA 3TIDB 5C0RH 5JNYB 1NCHA 2HT2D 4QRBA 3GK8L 4X2UA 2IPUK 3DSFH 2WKGA 4RGNE 5K9JH 2ZX6A 4HZ1A 1E28A 4PRAB 4YPGA 1SEBB 2Z8WC 3TCLA 5IM7B 4JANA 4M03A 2B14A 1C08A 4U1KB 3NOIA 1L4IA 3ULVC 3ULUD 2DQUL 3GXDA 1Z66A 2COVD 4RAHA 3DX6A 4FLHA 3BAXA 2EE2A 3LHAA 2BY0A 1CYWA 3C5ZC 4W9GC 4AKOA 3LZPA 3KE0A 1RQ5A 4XNXL 4YEEA 3N06B 2A5UA 2QKIA 4N24A 1EJOL 1L7IL 3UFIA 3QHFH 2BHUA 4RCAA 1HNGA 3X14A 4JZNB 4ZT1A 1S7VA 4X8JB 2MNWA 3CXDH 2XV3A 4AG4H 2AHIA 3I3DA 1YPZE 3CH1A 2VDMH 1CFVH 1JF1B 5JMOC 4RISL 3UPRB 4OSUH 1AMYA 1G94A 1AQMA 4HFWA 5ETUB 3PWUB 4ZFOB 4R26H 1UGNA 5BO1H 2Y22A 2XJKA 4EDXA 1CGXA 1U6AL 1UB6B 5F9JA 5TE7H 1VDGA 2XV2A 4U2ZA 1SMAA 3VU2A 4M7JL 2XDHA 5ECGA 3OB0K 5AVUB 3L3HA 1NIDA 4FLQA 1I7RA 1JDAA 2E6QA 3MOQA 3IDNB 4A7TA 1CS6A 4G43B 2YUXA 4NB7A 2N59A 4R90H 4YHOL 1JGEA 1T4KB 2IXQA 3KPQA 3RZCC 1BQUA 3TPKA 2TSBA 3ETBJ 3UO8B 1FVEA 4U31A 3V6OE 5TDNB 2BFGA 2IBZY 3CE1A 5DJ2B 1XR8B 2MH4A 1M71A 3AXIA 1GZHA 2FT8A 3OHXC 3DGGB 4AX3A 5ESQA 4FMVA 1LXMA 1EBPA 1MLCA 3MX0B 2DLFH 3AUWB 4YR6A 4KOCA 4MNQE 2X0UA 5DZAA 4J4PC 2VQ1B 3IJHB 1QI3A 3NZSA 1CXEA 1KB5H 4HHAB 1U8LB 2AJ3B 3BSZA 1Z9PA 4RAVB 3GJEA 3MGAA 2VNCA 4PSRA 3RVVC 5JNYA 2NTSP 1JPEA 1NCDH 3EOAB 3EYSL 2V2WB 3OKNB 4G11A 5D6DA 3ELQA 2EVHA 4MFHA 5LGKA 2V7HB 4J3VA 5BV7L 4P5RA 4YQXH 1SEBA 5DZOA 3HW7A 1JVKA 1ZHKA 3K2KA 2F9BT 4U1KA 4G1MB 1DFXA 5FHBL 3MFFB 1E40A 4UT7L 5LQBH 5FGCE 5FM5O 2WN2A 4JZOA 4O02A 3FO9A 3APNA 1ZLVH 1HQ4B 1L0PA 4Q9RL 4PJGE 1OOWA 3MLXH 3RIAK 4D94A 4A6YB 4IJTA 3VFMA 3ECUA 4ZSOE 1ACCA 4RSYA 4J3XA 4ESKA 2H5UA 3X3GH 3VXRD 5EEYA 3KLLA 3VVWA 5D70L 1I8KA 2BOLA 1LE5B 5GHWH 2ZKMX 3OF6D 4Z1PA 3HHSA 4MQXD 1KTLA 4QJ3B 3S88L 2NZ9D 4ZMPA 4XAKD 4HJSA 1LMKA 4O58L 4F7CB 2GJ6B 4BFKA 2WZ6A 3VI4E 5FWQA 4LOEA 3N41F 4HUVB 4ZFOA 2H26B 3WHXA 2WWMC 2W9LA 4LEOA 3ILDA 2V2TB 3WUWG 4QLRA 4APQA 1JZEA 1BG9A 5FK9A 2BIPA 3BP7B 2CLZA 3KWXA 5AWNL 4Y7MA 3RZWA 3ME0A 5HHVL 4WO4D 2NY5L 3N43B 3IDNA 5AQ0A 1ZGLB 4IJ3B 4AWJC 2XKNA 4FFZA 1T4KA 1F4AA 5T3XD 5KYUB 3AT0A 3B9KD 1UZ6F 4JKMA 3C75A 2XZAL 3EBHA 4HS8L 5C07A 1WFMA 3ZIMA 2W0FB 4YSRA 4N8UA 3D4YA 3LIZL 5JLZB 2G60H 4QRFA 4WFFE 4YSOA 1LO3H 1TJIH 4XP6L 4Z8FH 2CO3A 5TH2A 4CMMA 1BD2E 5EUOA 1NCCH 5CUSL 4B5EA 3PABA 4E9SA 3NCEB 3ET9F 3PHQB 3APDA 1U8LA 3B9AA 1D5IL 1CFNA 5DS8B 5IHWA 2AQPA 1I75A 3NESA 4Y5VB 3QH3B 5F97E 4WWPA 4H2CA 3LKOB 5IVZB 2F5AH 3TX4A 2YMXH 4ZMTA 1AD0B 3FTGA 4BK8A 4QWWD 4G2AA 1ZVSB 3W2DL 2R51A 4G42B 1E7VA 3HZYB 4OCWL 4R96A 2DLHA 5DUPL 3PGDA 3WIIL 3U4EB 2HKHH 5BNXD 2F53E 3HS0C 4EI5C 3QFJD 1XDTT 5E24E 4GSDL 5FDWA 1EXHA 3CQFA 1A7QH 4E9WA 4LDCA 3GHBH 15C8L 4NZTL 3V9FA 5C0EB 4FNSA 4IDJL 2FJHB 4OZHB 1KXHA 3WXVL 1ZV2A 5F1SA 4YLQT 2Y6SD 3MRRB 3QUMA 4FNTA 3H3BC 1DN0B 4JPWL 5CIPA 4AJWA 3SCMA 1S9KC 2GJ6A 2PYEA 12E8H 3N0AA 5CWSB 1UJ3B 3QJSB 1CLOL 2JLPA 4KHTL 3LKNA 4FXGA 4HCRA 2RFXB 4ZUVB 3OZ9H 2Z4TA 2WTRB 2FWUA 2X3CA 2OMUA 3BP7A 4B3VA 5INDB 3U0PB 1BMZA 4FG6C 1FNFA 5SWSA 2GW5A 1YECH 3VI4F 3ARPA 4HKZA 2CA4A 4J5VA 2B3IA 4XOCA 1T5XA 3BJLA 3ARYA 1VSCA 2NW3B 4TM9A 1C8QA 1N0LB 2FJFB 1IFGA 1S7UA 2NNCA 4RSVA 5BRZE 2H2SC 1HESA 5KYUA 5GSVA 3IXAB 1IGMH 1IT9H 3S5ZA 2RQ8A 2X0WA 3EG9A 5HPMB 1J9QA 3L7FA 2EO7A 3H9HB 1Q72L 3SGEH 4I0PA 3TBWB 1MFEL 2VMEA 3MCKB 3BW9A 4BFEA 2DQCH 1MRFL 4N2MA 1ZT7B 4YHIB 4D0DA 1JWUB 3TT1H 3NIDE 2WP3O 4IU3B 4MA8L 3MLTA 3AQXA 4EOWL 1A4KB 4U4BA 4KKRA 1XZ0B 2DYPD 2ZJSL 2CHDA 4FF9A 5HDLA 2YARA 4KZEH 2GI7A 2B59B 4WO4B 1JL8A 2YGNA 1AS6A 3M1CA 4APXA 3T6QC 2ALWA 2X7LB 1H8LA 4P5KB 4AENB 2EUZA 3QH3A 3QIUD 4RGND 3I84A 1WITA 4MCYB 5MHSD 3B9KB 1AD0A 3V0DA 1WF5A 3FN0H 3ZDYE 1HZLA 1ZLDA 1BZ8A 1ZVSA 5E00B 5LGYA 3FZUC 3MREB 4G42A 4OLZH 2WXHA 5DK2B 5AW5B 1TYJA 2AEQL 5EOCL 5IW1A 4DGYL 3P4LA 5BOJA 5MEOB 4NBYB 3ZTNH 1F18A 1TZHA 1UFUA 3QZWB 1MHPH 2WM0A 4HS6B 5AZ2H 5I71C 4IRJD 2XRAH 2WB1A 1LK2B 2UZXA 4OT1H 2LV4A 3NCXA 1QHPA 1IRAY 1EHLH 4AV4A 4TNFA 5D2NB 3RDTD 1X5KA 5C0EA 3QO1A 5HDQH 2ZYSA 2OBGA 4OZHA 1OEZW 2H32B 3EJTA 1FFOB 4JFVA 4K3JH 3ZYIA 3BGMA 1LP9E 2NXYD 3P02A 5K69A 2HFFB 3F62A 3QJHA 3RVXD 2BVPA 2A4CA 5F6IB 1QTSA 3T6ZA 4IKKA 5EBLB 5KBLA 4ELMB 2KZKA 5LCVA 2XN9A 3RVTC 1F1DA 2O6FA 3LRLA 5ISZA 1Z1WA 3ZL1A 1JHTB 4PS8A 5J8OA 5KN5B 5IWLA 4MNHA 3INOA 3H3KA 2IDUA 3BWZA 2R2BA 3H9SA 2V5SA 1WCBA 5IHBA 1NCWL 2Z91B 2CMRL 4KVNL 1ZVNA 1N6QH 1ZLSL 3HAEB 4JPKH 5JDJA 3BLBA 5EA0L 1P4UA 3OX8B 1AXIB 5D7IE 1B9KA 3IM1A 3DI3B 1A7RL 1BAFL 1ED3A 5I2IA 2D7TH 3BRGC 4E68A 1HAWA 1W72H 3QXDB 2XQYA 4YX2H 4P3DB 2K45A 2FX7H 3SGEI 2HWZH 4BFNA 3S2CA 5GGVY 2DQFB 2PABA 4PGDA 3FFOA 5DHEA 1MZYA 1ZMYA 4TNWK 3CLEL 3RAJH 2GCYA 3B3BA 4DPCX 3TA4D 3F58H 3OG4B 3TBWA 4AK1A 3RX7A 3CZNA 4YGAB 1MCOL 4ZMVA 5B7EA 1EGJA 4FNQA 4P57A 1Z9NA 3GM0A 3A3YB 4MNQD 4EJ1C 4HPYL 1YHPA 5I6PA 5E8NB 1H9DA 4JFDE 1XZ0A 4NEHB 1KCVH 4LXFA 1E90A 3X17A 3H3PH 2AI0H 5AENA 5F9AC 5FGRA 3ZE0F 3KPSD 1AJ7L 4P2OD 3FFCB 3F64A 1PCXA 3CFCL 4P4KB 1OQXA 1QLRB 1PLCA 1WHPA 3B9EA 4GKZA 3T2LA 1IC4H 3FU7B 3H6AA 4QOKE 3VFOA 1XCQA 3WFBL 1KELL 1LEKA 2R0ZH 5E00A 5K9QI 4TUKL 3R8QA 4Z7OE 3QQ3A 5C0FB 3D48R 4NENB 4U6YA 4LCWB 32C2B 4R4ND 1N5YL 2OMYA 3QZWA 5F96H 5DJ6B 1KYFA 3I2CH 3ZDYF 3VD4A 4OLXL 2XWEA 1LK3L 5HHOA 3NZHH 3ARBC 4XNZC 2WXKA 1JZIA 5D2NA 2MCPH 4HA1A 1QWHA 4FQXA 1J5OL 4OCYH 3EYQC 1PZ2A 1JTPA 4N68A 1TFPA 3EBIA 4ZS6C 3QIUB 4NKIH 1DQML 2OTWA 5GJTH 1N59B 3S97C 4P23C 3PWJB 3T2NH 4LOFA 2ZE0A 4M29A 4N2IA 3GF8A 1NC2A 4R2GB 3TASA 2FH6A 1U8MB 4ELMA 2DMCA 1BYOA 4LOUD 4MQSB 1DANU 4M1GL 3SJVB 4DEPB 3AUVA 5JHMA 2BCMA 1I1RA 1A21A 2VXTL 3LZLA 4NNPL 5CSZA 2W65B 1A7NH 4Z7IA 5SWQB 1LP9F 4YWGH 2GEQA 2WXOA 3WS3B 3HE7C 2ZCKL 1JDDA 3PIQB 4XCYB 2OP4H 2ZSWB 2PPAA 3OX8A 1MREL 3KLSA 2CK0H 2JKSA 3KGRA 5GRUH 3WNLA 1AOHA 1UC6A 1S7SA 3BZDA 4LIQL 3QXDA 1GMIA 3DX3A 1RZFL 3B83A 3N41B 4LHUG 1OE1A 2OMWB 3JTBA 3OWEA 1TTCA 4KKAC 4P3DA 4YGVB 3KWWB 2NXYB 3VXUE 2AJYH 3MLVL 3NK3A 4ONGL 3NJMA 1PSKH 3D2UD 1MFCH 5DZNA 3CFJB 1H3VA 2XWJA 1G9EA 2AABL 1JV5B 4KY2A 3DX2A 2N3JA 1BJMA 1MIEH 2LAAA 2QZQA 1ETZA 4O2FA 2ZNWA 2YXMA 1LQBC 2E86A 1USQA 1P4BL 4GS7B 2QGBA 3SDDA 2QPDB 4LPTA 1B6DA 3NBNA 1JUFA 2ZKHH 4BKLA 2FD6L 1MHEB 1KULA 2QVFB 1N70A 3FN3A 1OP4A 4D7BA 1HFUA 2AAVA 3VH8G 1JWSB 1GC1L 3GXMA 4PFEA 6TAAA 1EMTL 3L48A 2Q1EA 4GIOA 2B5IC 3DHMA 3FFCA 1F4XH 3CHRA 1HOCB 4K3EH 4N2BA 4UILH 1QLRA 1EJ8A 4JPVL 4Z7AA 4HPOH 2VDRL 2BP8A 4Z7WF 1CDGA 4BHUA 2CHWA 3LS4L 1TQBC 2YKKA 3DARA 2VWEE 3DX7B 4LCYB 1CDJA 2F53D 4XVJL 4R7NB 1R17A 4LCWA 32C2A 8CGTA 1JK9B 3MRMB 3EAKA 4WW1A 4RX4D 3N55A 5C6TL 1UH2A 1NUDA 5DJ6A 4YXLL 1GZPA 2EDNA 3GZPA 4Z7OF 1EJ6A 4ZOCA 1NUFA 2G9HB 2BRRH 5GGSB 3KPSB 1FAIH 5T1LA 1WFUA 4P2OB 2BIQA 4KO5A 3GMQB 3KVPA 3V6BR 1IGFH 2KDGA 1S9XB 1WFTA 4TS6A 1IZJA 3HEIB 5CGBA 3PWJA 4DP9X 3HPJA 3Q9PA 3BUTA 1PY4A 3BPOB 4AIOA 1R75A 2VLKE 1BOGB 3E8UL 4Y4KD 3SJVA 2CE6A 1E9OB 1YN6A 2Y4SA 1MAMH 1SLVA 4BGLA 4WI0A 5I8OL 1CGVA 2FH8A 2C9VA 3FQYA 1KC5L 3RVUC 1SHMA 4AKQA 1A14L 1CTOA 3MLYH 2YQ3A 1YSOA 2Y07H 1ZSDA 4GAYA 3L3OC 1J0YA 4PRDB 4KQ4H 4TQ8A 3BUIA 3QNXA 4OZIA 3UJIH 1U8JB 3FAWA 5BRZD 4HP5A 2EH7L 3KWWA 1THAA 3BJ91 2ADYA 4U1SB 1P9MA 4NQSB 4JFFE 4XWOD 1FV1A 1HEZB 3NJJA 4JCLA 4GT7A 4KXBA 5DA0B 3M1BB 5BS0D 2HFEB 5E1AA 2C9UA 5GS1B 5DTFA 4XB3A 5LNDA 4ZNEE 4XI5C 5KUMA 2VDMB 2GG1A 5EBMB 3PFQA 4XXCC 1YEJL 2HFGH 3DI2B 2OL3L 4D3CL 4N0CC 4HJGB 4JQIH 4ZFQA 5EIVA 4W9DC 1F4WH 3WI9A 2EVGA 5IHUH 3T6VA 3EUDA 1QUNB 1YEFL 3Q9QA 2CDGB 4PGBB 3ZMRA 1JWSA 1KWGA 2E5EA 3HN5A 5F72S 3JVGC 3VFUA 3BEWB 5TK2A 2A6JA 2WVTA 2XN0A 5IMKB 3TN0C 1X7QB 1DZ0A 3NJKA 1TYRA 1KLGB 5HDRA 1RZQA 1U21A 1NM4A 4KTGA 2Z3FA 1G9MH 3VRLE 3U6XA 3OZLA 1PG7X 4Z9KB 4LCYA 1IGIH 4PJBF 4GG6F 5FC9A 1BJ1H 3BKJH 1A9BB 4NNXB 1CXHA 4O2CB 1U8CB 3BZFB 3MFGB 4L29A 2WXQA 4MD4A 1TVBB 5D8JL 1U8KA 1OSPL 4LHQB 1JK9A 3VXQB 4MS6A 4UTBA 1CK0L 4BCZA 4Y7OC 3MYJB 1GTFA 2HYMA 2DQHL 2AK4D 3FUHA 2JXMA 4C4BA 4UQIM 4RA3A 5J9PA 4NOBA 5B4MC 3DV6B 3MZTA 4G6KH 2A2QT 1WAEA 4C4KT 1OTTD 1L5GB 4JDTH 1JERA 2PO6D 4EVNA 1S9XA 5A3IC 1IKFL 2UXTA 1M05A 1W0WA 3IWVA 1OK0A 4PJDA 3T65A 1J0ZA 4S1QH 4AW4A 1SFHA 5E6YA 1FBIH 2BSSA 4ODSH 5D1QC 1BOGA 1S7XA 2CGRL 2WCGA 1E9OA 2GJJA 5DMKB 1W0VB 5KYYB 1SEQL 1IC7L 2DL2A 1MW0A 3GMPB 3GS0A 1SF5A 1RUAL 3FCTB 5CCHE 3UG4A 4OFYA 1BLNB 3MA9H 2GVYA 1KXTB 3RE0A 2Z8SA 4EUPG 4EUPH 5F7HA 2CO2A 2QQNH 5CJQH 5PAZA 2HTLC 3B7UX 2WLNA 3VXNB 5E1QA 4CW1A 1N8ZB 4YHZH 4EDWH 4GLRI 3PCYA 2ATPA 1VFAA 3EFDH 4A66A 1ZEAL 5F7FA 3QUXC 3LRGA 4U1SA 1U4FA 4NQSA 3QSKB 4H8VA 3ZRCC 1PZBA 4IQHA 4IRSC 1G7HB 3GRBA 1FZJB 4PWKA 4K8RL 3SZKC 5JOFB 4Y4KB 1ET5A 1FG9C 2FLBT 4NQEA 5FFLA 1MJUL 4JRXE 5EBMA 1MPAL 1HS6A 2B77A 4JFDD 4Y4HB 3HB3C 5JYMA 3HBQA 2IPTH 4P2QE 4PGBA 3SHSA 5MEQA 1NCBH 4W9JC 2CJSA 2ZAIA 3AS2A 4XPGL 2V17H 1DTUA 5LUMA 2ORBL 2WAQA 3PWVB 3G6AB 1CFSA 5IMKA 2Z34A 4NQXB 4QOKD 4IBSA 4IS6B 4L3CB 5ICYA 3VM7A 1TT6A 3KEDA 4TTGA 3HC0A 1SXSA 5DD6B 5JR1L 1S7QA 1XF4B 2UZIL 3B7RL 3BWAA 3MLUH 4OUUB 1DDHB 4XTRC 4UYPA 3Q8EA 2KZWA 2ZSVA 3ZE0B 1OD7A 3GLEA 1NDMB 4NNXA 5CN2A 5KVDL 3BZFA 1LE9A 2TRHA 3QAQA 4KGJA 4BDVA 4BXVA 4GEJA 4K7PL 4K94C 3V5HA 4XP1L 3WLWD 3BWUC 3G5WA 3VRLF 5IOPA 3MYJA 5DD5H 4XP9H 1UT1A 2BSTA 2DF3A 3PQYB 1JTTA 1JPFB 5CEZH 4N90E 4OFIA 4L8CB 3FQRB 2LQRA 5D1ZB 1NPNA 1P5UB 2G0LA 3D0VB 1XSKA 1H8NA 4W1TA 3WY3A 1R5VB 3F7PC 4JFXB 4HQQL 1I3UA 1ZANL 2WCSA 5D71H 3KYAA 4OR1A 5C6PB 4GQ9L 3UBXB 4TQEH 4OLUL 4F5CE 1P4IL 5KYYA 2CO7A 3IGLA 4PUBL 3HG2A 4YC2C 2ETWA 1BLNA 3V52H 3ZDWA 2BHZA 1KXTA 2AK4B 3MUJA 5FUOH 2XN1A 4QT5B 2F19L 3K4DA 1G6RL 4MMZA 4G72B 3H6JA 1SBSH 2VDOL 3IDXH 1QLEH 4HXAH 3VXNA 2A74A 4TMPA 3VA6A 1SN0A 1VEPA 2PO6B 4GI8A 2WZ0A 4PJXF 3ECVA 5DWUL 1UD2A 3SPJA 3THMH 4NZRL 2OR7A 4YDVA 9CGTA 3LN4B 2XC8A 2XBTA 3X1BA 2UWEA 1BM3H 1YYMH 4WY7L 3S36L 4GG6B 1W91A 4Y4HA 1BWWA 2ODHA 3BVDB 2YN5A 4WSJA 5AOZA 3F12A 5IV2B 2PW2B 3WGVB 2NNAB 1KGXA 4JDVA 1U3HA 2IAAC 1SYVA 4TN9A 1OK8A 2H9GA 5IKCB 2WB7A 3E9UA 2IFFH 4ZMXA 2ADIA 5I76B 1YC8A 3RQ3A 1N2RA 2HSIA 2W59A 4IS6A 3S34H 4LLQB 5DD6A 1OB0A 1KXQA 2FYYA 2N7AA 4ODVL 3LIZA 4OUUA 4FQHB 3GSXA 4X4ME 1LO0L 1FHGA 1RVFL 5KYWB 1NDMA 5AYUH 2VXVH 3MBEC 3WO4B 1O5PA 3KVDD 1I9IH 1EFQA 2JIXD 4Z7WB 3O3BA 3AJ7A 3P4MB 4E9XA 1ZA3B 3IF1A 4OH2A 1IEAB 3T4AA 3WFHB 5GZOD 3F7LA 3GSWA 2IF7A 3VA2C 4AYSA 1I9RH 3PQYA 3A23A 1BREA 5L4IA 4YLCA 3UPCA 4J3OH 4J3OG 4N0RA 3FUMA 4FTVA 4YDIL 3O9WA 4G6JL 4NCDA 4UTCA 4BQ8A 1P5UA 3D0VA 3LKQA 4NN7C 3B56A 3EIFA 3FBKA 3Q06A 2DJUA 4A38A 3QDHA 3OD3A 4HDIA 5LN4A 3VFWB 4ANWA 2PWGA 1X4ZA 1CD8A 2VLKD 5CEZE 5DC0A 3M6DA 1QEXA 2OMXB 2WSDA 5DJZA 1N26A 2DH3A 3LAFA 3UBXA 1OF2A 4YH6A 2ODIA 2Y72A 3H56A 4E2OA 3BVWA 4BUQA 2IAMA 2WVVA 2YPLE 2GFBB 5DJ0B 3G5XA 1OGSA 4OKVB 1GH7A 1K8IA 1LNUB 4PWHA 1YJDH 4HKXB 5I73C 2L3BA 4JVWA 2AV1B 5DHXB 4AQEB 3UZVA 4M62H 1XV8A 4E36A 4JFFD 4GFTB 2RACA 4HJEA 1OALA 3P0YH 4KI5C 4PP2B 4UQ2A 4F9LA 4G6AD 4I5BB 3LQZB 1R0AL 3QORC 4OTXL 1SN2A 2Z7ZA 4KRPD 4XMKH 1J1PL 1UM5L 1CU4L 3JTTA 4XMPH 5G4NA 5AAMC 5KW9L 2WLMA 3E6FA 3L54A 3NA9H 3KYKH 4B95C 2VLLB 1G84A 3R06B 2PWFA 1FGVL 3D50A 4WHDA 5IB4A 2HX9A 5IV2A 2NNAA 5JPMC 2X6MA 2WXGA 2NY7L 5E2TH 5CILL 3R4DA 4H8PA 4CRPA 1K5WA 3N42B 3OAYK 4RBPK 1HXMA 4I7ZC 1ES0B 4AI7A 5I76A 1HKFA 1TQCC 2WBJC 4Q9QL 2IDCA 2E7LA 4DW2H 1L9OA 2RMNA 5E23A 3PV6A 5I66A 1W72B 4XPHH 5EO0A 2BOBB 1G9NH 2CAKA 5KYWA 4FFTA 4PWEA 3BKYH 5TFSL 1XTMA 5JIHA 3AXLB 1QACA 2FUTA 5DMGC 4DPRA 3H54A 4M3HA 5IROD 4UUJB 4BELD 5E4EB 1IVLA 3WFHA 1RK1B 4DAGH 1CG9A 2WLIB 3R19A 2G4GA 4M6NL 2L04A 2JMRA 3PP3H 4PJBB 4ANKA 4CSPA 5BW7C 4K71B 3H42H 3UEZA 5IMOA 1IKOP 1HCFX 1NLBH 2PCYA 4XT1C 4HWUA 1UWFA 2CRMA 3S35H 3NPZB 4UAOC 5TF1H 4IEFA 4R7XA 3VGBA 3LDBC 3LQMA 4GKNB 1ICTA 2NR6C 4PGZA 1DBKL 3BUBA 1GS8A 1INEH 2DWTA 1R1CA 4PI2A 4UNVA 2J88H 3G7TA 3ILEA 2OS7A 3D06A 1TNMA 4JAMA 4DSYA 4S0TD 1P7QA 2J1XA 3V4PL 1I85C 1J5IA 1VA9A 4UM8B 4U3SA 4QDGA 1DEEB 4YDKL 3EF4A 4DP1X 2JIXB 5DRZA 3RFZC 1OM3H 1CUOA 3ATAA 3E3QE 4HGKC 5DJ0A 4DUWA 1TJGH 2P8PA 4P59L 1LNUA 3FH5A 4DTGH 3BAJA 1YC7A 2Y7QB 3CZFA 5F89B 1YMMA 2AV1A 3MBWA 4BV1A 2EH8L 1DCLA 1AC0A 1JV2A 1WWBX 4HMEA 4ATTA 4PJ9A 5T3XL 4PB9L 1W2KT 1NJ9A 4V1DA 3IMUA 3VFRA 1JZ5A 3LQZA 2CHZA 3MXVL 4Z7NF 1FJ1B 2BO0A 4NZFA 4JRXD 2EKSA 4RH4A 1U91B 3JWDL 2VLLA 2HRGA 3G5ZA 3R06A 1HILB 2AFNA 3EZ8A 2XTJD 5F1IA 2ZX5A 4P2QD 4JS7A 4K9EH 4NJ9H 2BP0B 1JPGA 1XGPB 2AEPH 5DEJA 4D2NA 3FCUB 5KSAD 2A4ZA 2L7QA 4PJ8B 2OR8A 5ESAA 3U4KA 3UCQA 3K0YA 1X5AA 2X4RB 5EN3A 2ADFL 3OKKA 4R83A 1ZDQA 3ML8A 3HCVB 3MRKA 1MCPH 4LPCA 1AO7E 1CN4A 3GKWL 5AKVA 3TONA 4QRSB 4CUCA 3C5SB 1CF1A 2BOBA 1E3ZA 3E2HB 2PMZA 2E76C 5FUZH 3AXLA 2Q86B 2VIRB 4G82A 2B4CL 2YD1A 2X9YA 4HZLB 3C08H 4JPIA 1AGBB 1T7YA 3IFOB 4UDTA 1JYNA 4YMPA 1CXIA 4JFYA 4UZSA 3TBYB 2HN7B 8FABB 1YAIA 5DGRA 2G75B 3K2UL 5T5FH 2E59A 4N90D 5L0QB 2LTQC 1CVSC 4ODXB 5SWZD 4DWHA 1M6OB 2DBLL 3RL1A 2D31A 4HHWA 4PV1C 1RUKH 1DQIA 3ZL4H 5MEPB 5SX5H 5IQ7H 3LNDA 5DO8A 2JWYA 1NCAL 1QFWH 4WJ5B 2IH8A 4JG0L 5A6LA 3BESR 1PX4A 2AJXH 3H9ZA 4KMTL 1BGXL 2YPVL 4U3HA 4XMLL 5BZWB 3CVIH 5IEHA 1SN5A 5CINL 4H8WC 2BXYA 4PS4H 5E56A 2LR4A 2WSKA 3SB3A 2WTOA 1YNTB 3BZ4A 1CTMA 1OTUC 4J3OF 5KJ4A 1QUPA 5I8KL 4L48A 4GW5A 1MJ7L 3AT8A 5F89A 3T0EE 3QGVA 4TPRH 3CU7A 3TJEH 2XWRA 3GUTB 2ENSA 4RFOH 2GHWB 3LTVA 2HMID 4UIKH 1W0YT 1WISA 4KKLD 1GIGH 2VZOA 1F0LA 5DD0L 2PYFB 4E9VA 5CKAA 1MNUH 1T6WA 4YS4A 4FULA 3UTSE 4N0UA 1P84J 4C83A 1A8JH 1J10A 1VZIA 2VR9A 4DETA 4KHXH 4MD0B 1ZTXL 2JB5L 4PJXB 5HGBB 5DMYA 2BVUA 4AUYA 4KTEL 1IC5L 4FNLH 3CLFH 2AEWA 4PJ8A 1QEWB 2FEDD 4FXKC 1BFVH 5C0GA 4LSRH 1BW8A 4EN3B 3D85D 1NKOA 3QUHA 5EN2B 2C4FT 4JDEB 3KBFA 3VM5A 5T33L 3V6FB 4YZFE 2H41A 5HJ3A 5ADPL 4KI1A 2VW6A 1RUPH 2OZ4L 2WGNB 4TSBH 3GMMB 4N8CL 1RZJL 1S4IA 3LN9A 2QKIC 1KJ2H 1NBVL 1E9PA 2XTJB 3IFOA 1EZVY 3FU5A 4GI9A 3T1WA 1NFAA 3BOVA 3K8KA 3BT2L 4Q2ZA 4IOFD 1A3ZA 2HN7A 3AG1B 2P5WA 1RURL 1DR9A 4H13C 3RTLA 1ID2A 4JO5A 2Z31B 3IRPX 3C5JB 4B9FA 4FLSA 5KSAB 2JI1A 3BQUD 1FFPA 2QEJA 2AMUA 3VDBA 3GHEH 4OJFL 5MI0B 2QADC 1EEUA 3QEGH 3BFOA 4OM0L 4PRPB 3TWCL 5K9OB 3O2DH 2IIJA 4NQDE 5E0QA 1M7UA 2QKSA 3UCRA 5A2AA 1V7NL 2JJWA 1CFTA 5I75C 4HF5L 4XHJC 5CJOH 1N6UA 4ZJ9A 3P1VA 2XNAA 5DR5L 3NJIA 5EMYA 4Y16D 2D2OA 4JHVA 1LO5B 3GBNL 2YPLD 4LARH 3HUJA 5HHPB 5KBKA 1YNTA 3ILQC 4LPYA 1RZKL 2XZQH 2DI8A 2OM5A 4HC1L 4GYBA 1I3GL 2B1HL 5SWZB 2BIMA 3V0WL 2L0DA 3JSSA 2Q3AA 4M5YL 1GZHC 4LVNB 5K39A 1ZLVK 2PUQT 3G6DL 4KJPC 3BYYA 3QHTC 4UU9A 1G0YR 3JYBA 1E43A 4JN1L 3MCG1 5HHXH 3GS7A 3QARA 3AS1A 3RG1C 2J4WH 4UOQA 1CGWA 2HJFB 4ZX5A 4QTHB 5FA4B 5A2CA 5BZDA 4AVKA 4X99A 3RX9A 3AQZA 1ITBB 3D08A 1A1OB 4Z7QE 1INDH 1YYLH 3ARWA 4L23A 2XY1A 4ZPVA 3N1MC 4MD0A 5DS2A 3P2BA 3B3IB 2A9NL 4HIJA 4GXUM 4F2ME 4JBSA 1BQHA 4PMFA 2GK0A 2NNXA 4X4KA 2G3ZA 5LG6A 3VXTA 4EUPB 4UIMB 4XO8A 5EN2A 4JDEA 4F3FA 1I3RB 4Y1TA 3O4LB 4RFEA 2XU9A 3RU8H 5T1DH 5C0RL 4MBOA 5C86A 2OL3A 3V0VB 3DSFL 1FL5A 1ZTMA 1XCTB 5K9JL 1N64H 4NRZB 5BJTB 1Z3GH 5DFVC 4YUEH 2JJUA 3BLPX 1CJYA 5L4MA 5LDSA 4YZFF 1CLCA 4F7TB 3IDYB 3BP4A 4O9HL 4WSGA 3HG5A 2YD0A 1U4EA 1URLA 2Z31A 5IUSA 4ELKB 2Z7WA 3EFFA 2F2HA 4PJEF 2CR3A 4TUOA 3D85B 1EHXA 1G7JB 2AQ3A 3UTTD 3QR1A 1P6WA 2IH3B 4PRPA 5K9OA 4J3OD 1EAOA 4APQC 4LRNH 4U0RB 3PXLA 1J7VR 3QHFL 4NC1E 3CQPA 5GSRA 1XDQA 4AQAB 3OXRB 2XVGA 1XH