2BIMA

Human p53 core domain mutant m133l-v203a-n239y-n268d-r273h
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVHVCACPGRDRRTEEENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Structures of P53 Cancer Mutants and Mechanism of Rescue by Second-Site Suppressor Mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 50
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2bimA00
4QO1B 2J1YA 2WGXA 3WTYA 3WTXA 1YCSA 4XR8C 1T4WA 2AHIA 2MEJB 2J1XA 5BUAA 2IOMA 4IBTA 2IOIA 2BINA 4IBQA 4A63A 5ECGA 5AOJA 2X0UA 4IJTA 2XWCA 1EAOA 4IBVA 5KBDA 5G4MA 5AOKA 2H1LM 1KZYA 3WTTA 4L18A 4AGMA 4KVPA 5AB9A 3VD0A 4AGNA 5AOIA 2PCXA 3QYNA 2VUKA 4L0ZA 2J6WA 2X0VA 4G83A 3VD1A 2BIPA 3QYMA 4IBSA 4AGOA 1HU8A 4LO9A 3D09A 3US1A 5G4NA 1HJBC 4IBWA 3EXJA 4GUOA 4LOFA 1GZHA 1GZHC 5LGYA 4LOEA 4IBZA 4AGPA 3EXLA 3Q06A 1CMOA 1E50A 3D05A 4HJEA 1EANA 3IGLA 1TSRA 4G82A 2J1WA 2J1ZA 2RMNA 2FEJA 3D06A 2GEQA 1HJCA 1CO1A 2BIOA 2ADYA 4IBUA 2YBGA 1TUPA 3Q05A 5AOMA 1EAQA 3WTSA 3KMDA 3D07A 3WTVA 2ATAA 4L0YA 5G4OA 2J20A 2IOOA 4MZRA 5LAPA 4IBYA 3ZMEA 3WTUA 1IO4C 2BIQA 3IGKA 2AC0A 4GUQA 4AGLA 2OCJA 2BIMA 5A7BA 4AGQA 3D0AA 1UOLA 3Q01A 2J21A 3D08A 5AOLA 3TS8A 3WU1A 3KZ8A 2X0WA 2P52A 5ABAA 2XWRA 4MZIA 3US0A 1H9DA 1LJMA 3WTWA 3VD2A
chains in the Genus database with same CATH superfamily
3O2VL 4RMBA 5E2JA 3KPLB 1JV2A 4WY7H 2J88H 4BZ1L 3OZ9L 2BCKB 3PNWB 4FKEA 1F42A 1X9QA 2BVQB 1QPKA 4KTEL 4Z95H 1LE5B 2AK4D 3AVEA 3W0WE 1U21A 1PFOA 4IBTA 3H7BB 3VXNB 1PZBA 5FUOL 2HWZH 4G8EB 4MMXA 4Y5VB 4LLQB 5CLXA 4ODVH 1EZVY 4A63A 4P2OC 2PP7A 3TYFA 2N4IA 3BPNB 1P1ZB 4FQ1L 4Z7WF 3I6SA 1IM3D 1C16A 1JHTB 4HJIA 5EU5B 5I0ZA 3I9PA 1MXGA 1VZIA 4GKZB 4HPYL 4NWTH 1TTBA 1YEDB 3D8MA 3FJTA 5L4JA 4PLOB 1R75A 5E9DB 4M8VA 1NOFA 1WG3A 1JPFA 4NJAL 2XQ0A 5L4FA 2KMWA 5LB1A 3UOAB 1KCVH 1QP1A 1F5WA 3II3A 4KI5D 4NHUB 1HEHC 2FB4L 5AZ2H 2X4PB 2X6MA 1KPRA 3QDJD 2A6IB 4UV7L 2ZUQC 4WFFD 3ZDXB 2X42A 2BO0A 4Q9CA 1WAAE 2HFFA 3UJTL 2EIEA 5LWYL 3HB3C 4WKZA 3SDAB 2C3HA 2XN9B 2IGLA 3IFLH 5KG9B 4Y2NA 1XO8A 1S7SB 2L7JA 4ZPVA 4BXSV 1HEJC 5TDOA 1K9TA 1ZOXA 3WE1A 1RJCA 3LIZH 1MF2L 4BFGA 3CN2A 1LO4H 2E27H 4ZK8A 4MJ5A 1XH3B 1V05A 3L1GA 3M86A 4DSYA 5DZLA 3X3FH 4TVUA 2E59A 1PD1A 1P4IH 1A8ZA 2H2SD 5ADPH 1MCQA 4K73A 5E56A 4K3GA 1R3IH 2IDCA 3DX3A 4PJHF 2C3GA 1BLNA 3FB8A 4AV0A 2DKMA 3TBWB 1FVDB 3C5JB 1T03H 4JZOA 1BG1A 1IUZA 5K69A 1JPTL 4MQXC 3FC8A 4OIIH 3DRQA 3TCXA 1JV5B 3O4LE 2ARWA 1Q94B 4BSWA 3BD5A 1CGSH 3L3HA 3RL2A 4QDGA 5TFSH 2BNUB 4NN5B 5CN3A 3WY2A 3IGFA 1F18A 3FS9A 4K94L 5G2NA 4M4RA 4QXWA 3MOAL 2B1AL 2XBDA 3PV6A 4P3DB 4IOSD 1EDQA 4F7CA 4MMZC 1OHQA 4YEFA 4IYKA 1A3QA 3AU0A 1YQVL 4V2BA 3TTYA 1SM3H 4YSRA 4R90H 4PD4J 2XYCA 1DQLH 4HIIA 1CFQA 1WWAX 4LIQH 5E2TH 2YKLH 5EZOL 4K7PY 1FN4B 4HEPG 1KXTB 4RGNE 2AZUA 4L3AA 5EU6D 5DZJA 3T0ED 1SXNA 3CH1B 1QLEB 2XWBB 1G1YA 1MFAH 5IMMB 4PW9A 2Z31B 4OCMC 4R96A 2WQUA 5CJQH 3GXMA 3VGEA 4FFZA 5IVNA 1JGEB 3CZKA 4TL5A 3ZHNA 1EMTH 3QA3A 3S36X 2ZOLA 3FTSA 1TENA 2XZCH 3DUHA 5J12C 2GTQA 4NRYA 2K8QA 3MRPB 4XXDB 5IB3A 5HHMD 4PR5B 5JDJA 3EO0A 4JRYB 1ZS2A 1HCFX 3ABZA 2PLTA 4YBQD 5GZND 2A6DA 4H4NA 1N59A 2CPUA 3SPCA 1JWUB 1SMDA 4AK2A 5ERWA 2BIPA 4G6AC 4OI8A 3G6JF 4BWTA 1CICB 1WAAA 3PHQB 5MERA 3MRDB 3FTYA 3QK0A 1HHGA 4MQSB 4QLRA 3FOMB 4GW4B 5E5LA 2OBGA 5IUSA 3P4NB 1GMEA 4BYHA 1Q1JL 1BFTA 4OCRH 2IAMA 3DSNB 4HUUB 2L3BA 1ITCA 1RZGB 4YZFE 5DU7A 4WY7L 3VM7A 1ZLDA 3F7PC 4DZ8A 5EU3B 3VMPA 4WW2F 1XQ4A 4XCEA 3F7KA 2NXYB 3BN9D 5F7EH 3QQXA 4NZFA 2QMJA 2IGTA 4Z95L 5KVMC 1HXKA 4PJ5B 4S1SH 4WZ9A 1E8XA 3QBTB 3O6FC 1DO5A 1MFEH 2WXPA 1YEKH 1IL1A 2HWZL 3UTOA 4I8DA 4ZUUA 3VFMA 1CDIA 4ODVL 1Y0LA 4JQXA 3UBFA 3QORC 1LQBC 1BF8A 1RZ8A 5IR1B 2ZX8A 2X4NA 3EHBD 1UT9A 5FIEA 2FEDD 1T80A 4EOWH 4PJBB 4M7JH 1OPOA 1DVFA 3ML9A 3O4LA 4JDZB 3L2LA 4UUJB 1DBAH 5L88L 1XEUA 3MUUA 3AREA 1VADB 2Y1AA 1CVRA 1KCVL 1YYLH 4XT1C 3EKCA 3ZDZB 5E00B 3SOTA 1UXSA 5CJ5A 2QQKH 5IV2B 2OAAA 5LNGA 3T1WA 3N5AA 4RFNB 3CFIC 1ZLVK 3VH8A 1B2YA 3CFKB 4JDEA 4XI5D 3QNZB 4NEHB 2FSEA 2H32A 1OP3H 2ORBH 1QKZH 4KXZH 3AG2B 3Q44A 4JQVA 5AWNH 2V7HB 4OVUA 3OXSB 3PF2A 4GXVH 1R46A 1HVXA 2WVSA 2X4SB 1G5AA 4IHOA 3TZVB 1YN6A 3BH9B 5IF0A 2L7UA 3ZT6A 4YE0A 5TE7H 4AVIA 4L1BA 5DEFA 3LIZL 5AYQA 3LVEA 2BSSB 2VZTA 3U7WH 1X7QB 2E27L 2WBJA 2V5MA 1I1FB 2DI7A 2PTTA 3OKMB 4NQSA 5D1XE 1L4IA 3WFZA 4F58H 3IJSA 1P4IL 1RSFA 1ZGLP 1UM4H 4BCZA 4KKBD 3B7UX 3OB8A 1CXIA 4RMSA 3IRZA 3QH3B 2XV2A 1T03L 3BLBA 1HFUA 2BVUA 3UO8B 3DX7B 3MACL 2EKJA 5IJDC 3FRPG 1ACZA 2H6UA 1L7TH 4PLJD 5C0CE 4ABUA 2VN3A 1T21A 3G5XA 2DQ6A 2NYYD 2G5RA 4A37A 1SEQL 5FXCH 3S3BB 2WLMA 3HZVA 4JFDD 1N70A 1NM9A 3H9SB 1E30A 4TUOB 3CNKA 1XGYH 3K6NA 4Z7NB 3VTMA 5IMKB 4FXGA 2EXWC 3PPSA 4W9ZA 4GKNA 4YQXL 2F74A 4U7KA 4TUKL 4WWKD 3RFZC 3LPFA 1BV8A 2WANA 2WBWB 2DZEA 3KPNA 3VM5A 5F3HB 4P5KB 1SM3L 4X5WB 4TSAL 4ZUVB 1DQLL 4FYRA 5CAYB 4LIQL 5E2TL 4JM0A 5BV7B 2IBZY 5DRXA 1UCBH 3X3GH 1VKXB 1U8CA 3RZCB 1PY0A 5GSRB 1JI2A 4GW5B 2A9AA 1AD0B 1EGJH 3I85A 3RWGA 4A2MA 3GUFA 1MFAL 1FAKT 4PGDA 5CJQL 3FO1A 4G1MA 1KLUB 3B9KB 3O0RL 1EMTL 2VM3A 3E1ZA 3PABB 3WTVA 2XZCL 4S1QH 5K1JA 1QBLL 2FWSA 3VXRB 1J8KA 4DP8X 1HQ4A 2P3YA 2X40A 4EZLA 3B6SB 4P99A 2W0LA 3ZRFC 1JTOA 2J6EL 3ZQXA 1ILUA 3QUZB 3C6LB 4UZSA 4F37K 3A47A 4FQLH 4C56A 3G5VB 4XC3L 3TM6A 3S98A 1F11B 2YGPA 5I6LA 2FK9A 3EJYC 3FKUS 4YHPB 2QQNH 1C1EL 4JFEB 4M6ML 4KKQA 2IFFL 2VLJE 1MHHA 5CEYA 2XACC 4ZMOA 2YXFA 3MLTB 3RJOA 3CDYA 4MSWB 3S97C 3ZHFA 4Z3FA 2WZ6A 5F7EL 4X4XB 3PAVA 1Z0NA 1DSFH 1HE8A 2VDNH 2OJEA 2FO1A 4S1SL 2DQIH 4EDXB 4HMEA 2YKKA 4U49A 4E42A 1MFEL 2CE6A 1YEKL 1NEPA 1QMUA 3L45A 3KS0J 5FM5M 5K39B 4P2OD 2YMOA 3GSNA 3SO3B 3NRPA 3S2CA 1JXKA 2MHAB 5ECJE 3AW5A 4N8VA 4WO4D 4LESA 4YDJA 4ATTA 4EPSA 2CO4A 2EEXA 1AGFA 3GI8H 1UM5H 3C5ZC 4LSUL 4M7JL 5B39B 3NK4A 1E7VA 2H0PA 4MRCA 1S9WB 2P8MB 3PWVA 4HUCA 1SJVA 1DBAL 2N01B 2QSCH 4MCZA 2IWFA 5C0CA 4CL7A 1JJUA 4CDHA 5L8JB 3GWJA 5IB1B 1YYLL 5FF6A 3GNMH 2Y9RT 1DJSA 1NLDH 4D0BA 1IAIH 2QQKL 5C8JA 4OZFG 3TEZA 3HI1A 2BS71 2OM5A 1T1WA 4YX2H 3UTTB 4GNKB 1YC8A 1ASQA 3HB3D 4NP4H 1GYCA 4YDKH 4JHUA 2H4EA 3PQYD 5AWNL 4GXVL 4AUYA 3QZOA 5EV7A 4KJQC 3KWWB 3QIBA 4GOSA 3CFBA 1OOWA 2I26N 4PRNA 1FG9C 4E68A 1J9TA 4X5XB 2DM3A 3CU1A 3DRTB 1IEAA 2E47A 4PREA 3UG4A 4ALAH 3LS5H 3B8SA 5JHAA 1UOVA 4PBXA 1ZE3C 3VXPA 4F58L 4I1RA 1N8ZA 3D2UD 3VXUE 1CGUA 1UM4L 1A3ZA 3D18B 1AKJD 3UAAA 2R1YA 4U1IB 3AY4C 1TTGA 4ORGA 4Z0BH 3VI4F 4MQXD 5I1AB 3A5VA 5JHDB 2DQEL 4LCCC 3CJJA 5JMOC 1L7TL 1TYEB 2APXA 2GSIA 4UM8B 1K8DB 4O2CB 3MJ8A 1ZHLB 1JZHA 4FG0A 4OZIF 1VFMA 4QXVA 3HR5A 3UBXG 3A4FA 1PX3A 1DJGA 4AGQA 5CD3B 1TIUA 3QXAB 1IJNA 4KRMB 4U1GB 4DOHB 4GSXA 4PV1C 4BA8A 2VLJA 2O5ZH 1R5VB 4GEIA 5GS0C 2DAVA 4Z76A 1YQ2A 1N7ML 1X4YA 4W1TA 4UQIM 2PCPA 2EC9U 3RIKA 4FXTA 4K3DH 1ECYA 4I0PB 3H6JA 4BCYA 1FFPB 1IAOA 3B9DA 1TTRA 4R0LA 5GRYA 4ZMNA 4GRWF 5DO8A 1Z1WA 3KAAA 4JO3H 2EDEA 1UCBL 2R23A 4FMVA 4OCXL 3X3GL 4DEPC 1MH5B 4KQ0A 1BBJB 1XB8A 2R7EB 3KBHE 2Q6WA 3UBHA 5IG7B 1EGJL 4LNRB 1PX4A 2X38A 3C8DA 5IOPB 2RQ8A 3MYJB 2P4AB 1XGTB 3VU2A 1M9SA 3DXAB 4PJ9B 1YMMD 1UM6H 1DLHB 4LASH 2BP0B 4RSYA 1JZ2A 4OGXH 1RUQH 3BAYA 4TXVB 1RVFH 3RQ3A 3TBSB 3BYYA 2X9YA 4A2FA 2D2OA 2K9FB 2Q76B 4KY2A 2ZOOA 4NZJA 1KSRA 3BDYH 5A16A 8FABA 2QL1A 4JFYA 5B7MA 3JVGA 2DWDA 2VWEC 4FQLL 4G6AD 4QRSA 4I0CC 1L0QA 1QSFD 3WNNA 2QFRA 5E1AA 4JZNB 4XOCA 4KXAA 2D0HA 5FWRA 3QULB 3WKPA 2QQNL 2BOBA 3P0GB 3T09A 2XFGB 3JBG7 2BS8A 1OTUC 4I3GA 2VZUA 4MA8H 5ICZB 2PW2A 4F3FA 1UZ6E 2VDNL 1DSFL 3CBRA 3JWDH 3RGBA 2DQGH 1JNNH 3MUGB 4X80H 2EDLA 3UPCA 3O6FD 1JI1A 3LQAC 1KGUA 4G43A 1Q4NX 4QT5B 3BRDA 4R84A 3QORD 3VXUA 4WEMB 1HH6A 3W5NA 5KSUA 2PPAA 4P2QB 4UTAA 3TIEB 1BG9A 1KTJA 4X7DC 4NQDE 3T4AB 4XMWA 1UM5L 3U83A 2BC4A 2ROYA 4OBRA 2WSKA 2WLKA 2EYRA 4EKXA 1RURH 1KB9K 4XXCC 3ZE2B 1YJDC 5GIRB 2ZSWB 5CMAB 1SJXA 4IBYA 1MN4A 4PJDF 4K4KA 3D5OF 5E08H 1AQMA 3QS3A 1AHWA 4ADJA 4AM0Q 1SBSH 3V5HB 4KVNH 2NQ3A 1NLDL 3ARZA 3FTGA 1IAIL 4XNBA 5I73C 1B0RB 5A7BA 5IVXF 4NQCE 2LU5A 5HGHB 5IJBC 2W0FA 3BGMB 5DFWH 2X4UA 4DN3H 2X0WA 4ZUTB 5HGDA 1QATA 2WZAA 4PJGB 5T5FH 4YHYB 3C5XA 3T77B 3AMKA 3MCG1 3IPEA 1IT9H 4OH2A 1AH1A 4M8UA 3QNYA 5ILTH 4LGRB 1OCOB 1YZZA 3H6AA 3KBEA 5ESVA 4E0RB 1D7FA 4JE0A 3U1QA 1TJMA 3SE4A 1IFHH 4AX3A 1BZQK 3ARUA 2K6ZA 4PV9B 1CD0A 3SKNB 3IVKA 3LS5L 2EIZA 1C08B 8CGTA 2IV9A 3GMQB 2WVVB 4YHIA 1S9YA 2AJXH 4Z23A 2X4QA 3W81A 1Y18A 4Z0BL 2E9BA 4G11A 4H8WC 2CR6A 1CD1B 1IBDA 3V5KA 5HJBA 4LSSL 5FKAA 2G0LA 4WFEE 2G4GA 3JTTA 4DETA 5J9PA 4KZCA 3OAZK 1V54B 3BZEA 2WP3T 2P5PA 1OVZA 4OLXH 4NAJA 1PZDA 2Y22A 4JRXB 3X13B 5J11C 2O5ZL 1EJOH 2EXWD 1A3LH 2EDNA 2D03L 3QW9A 1UXLA 4Q6IB 2WQVA 4CILA 1UC6A 1JK9B 2WMPA 3A23A 4RH4A 2HN7B 4XMVA 3TNMB 3LZOA 1FPTH 3SOBL 1UQSA 3QUXB 4W4NA 4IJ3B 1G7QA 1TCRA 2YD2A 3NGBC 3SGJC 2IV8A 1G7LA 4HSCX 1X9UA 4KKLC 1VGEH 4OFPA 3WIHH 3ZYOA 4JO3L 5DF0A 3SDXE 4N0FA 1A4JB 2ZKHL 2NLJA 1ROCA 2H3NA 1WBXB 5DJXB 2NCEA 2XQYK 3AUWB 4K9EH 2AXGB 4B60A 4UOW1 2ZCHH 3GMOB 3C8HA 5I2IB 1W8NA 1MAJA 4IM8A 4HOZA 3HHRB 4LSTH 5F0PB 4L1SA 2N7BA 2HCZX 3BQUB 3IMUA 4LASL 2FEJA 1PKOA 3OPZH 1RUQL 4M7KH 4G7YH 1NGPL 1RVFL 2OX5A 5MENB 4Z7QE 2WCGA 2CUMA 4AENB 3V4UH 4WUKH 2IH3A 3E3QE 1ZY9A 3QJOA 3QUKB 4K8RC 1D7BA 4U1KB 1H0DB 1JUFB 3OKEB 4JFFE 5I16B 4APQB 5CEZD 4JDTH 3EJYD 3BPOC 4HG4K 4NQCA 4HCFA 2OCJA 2W65B 2JKIS 5JORA 5LG6A 2NYZA 1ANUA 3KXFB 3V9FA 4NFBA 4PJCA 2JKWA 4AQ1C 3EJUA 1NBQA 3KYMB 3IJEB 5FCUL 4U2YA 5IW6A 5CZKA 1HIMH 4IIQA 5DYOA 4OV5A 4Y2OB 3ZGHA 4MA8L 1FIEA 1T5KA 2F53B 2Q1EA 3MBEC 3QNXA 4JFXA 2MOQA 5AAMC 1HESA 1BIHA 3JWDL 1L5GB 2DQGL 1JNNL 4PJ8C 2WXLA 3O6MH 3L4WA 1UYWH 1HOCA 1CU4H 4N8CL 1TVDA 1JSYA 3T3PF 4DGVL 3HNTH 4MA1C 2YD5A 3TFKC 1CD9B 1LNUA 2ENJA 3VFNA 1H19A 2PETA 3IJ8A 2QGEA 4GO6B 4YIQA 4BH8B 4OUOA 4CU7A 5I76A 3C5ZD 5CCKL 4ZQKA 1LTXA 1N5AB 2GK0A 2PWGA 2Z4TA 3B9VA 3HG1B 1K85A 3EOAA 4UDUA 1QFWI 5L4IA 1RURL 2DWEB 1GCYA 1NDMB 3BT2H 3MLZL 4BWUA 1J0ZA 4ZFZA 5LG1A 3UROR 1PZ3A 4BINA 5E08L 4AT6A 3EJPA 4OZ4A 1ID5I 4KVNL 5DJ0B 2WYTA 2P5WB 1E5UI 3BFOA 4YVUA 3EF7A 2A83B 1TQBC 3MGTB 1YY9C 2KDYA 3OM3B 5IQ9A 4WEUD 4Y8AA 5KVFH 4DN3L 4F2MB 1MLBB 3EDJA 5BCAA 3TASA 3STLB 4F8TA 1KGCD 4KJQD 2AERT 2W91A 4LOFA 3G6AA 2KYIA 5IQLA 3V0WH 4GJTB 3OKNA 1R1CA 2VUOA 1EVUA 4EZJA 4Z7OF 3G04A 4WQOA 3K72B 2VUYA 3SDXA 5CGMA 4F27A 1ZVHA 2AJSH 4TQIA 4KV5E 1IFHL 4O2FA 3ZL2A 3SY0A 2BXYA 4MD5A 1VRSA 2AKRA 2BHUA 3ME0A 5JIQA 4P46B 4L9LA 4QXGH 1AY1H 1RK0A 2VLRD 1WFJA 4HAGA 3CCHB 3FF7A 4ELKA 2CNYA 5H37A 1OAJA 1I8IA 4MVBC 2HB0A 2OL3L 3ISRA 2WXNA 2OR7A 4BQBA 3NIGF 2WO3B 1HNFA 3OAUL 3GBNH 4JO2L 3UYPA 1T5WA 1WFOA 3HE7A 4NENB 2ALAA 3HRZA 4OI9A 3FUDA 3HBGA 1NCWH 2NY5H 2HKHH 4OLXL 1BP3B 5GS0D 1N18A 2AXHA 1IM9D 1EJOL 3F7QA 3K2UH 4RIRA 5D70H 2E4FA 3CSYB 1QNZH 5C0RL 4Y19B 5LNDA 3TF4A 3MRGB 3BP4A 1OPGH 2LV4A 1X4ZA 3OHXA 1JN6A 1FPTL 1UB6A 1CXHA 3UYRH 5LN8A 4P4RA 3AXHA 1CBVH 3Q3GB 5HDBE 4PRIB 1N0LA 1CI3M 1VGEL 3WIHL 3VFTA 4HS3A 3GLEA 3OXRB 5AAWA 5B22A 3ZKMC 5D7JB 3KHQA 4LIQE 4GAGH 4C47A 1AMXA 2VABA 2YAPA 4K9EL 3GZOA 2ZCHL 1U8QA 1Y07A 3V5DA 3I75B 4LSPL 3VGFA 3NEXA 3FH5A 3OPZL 4EI5C 4M7KL 4G7YL 1MCEA 4PJIB 4TUJA 5GRUL 1SDDB 5DK0A 4EXKA 4J39A 4JRFA 1FVCA 3QAZB 4XB3A 1FV1A 3CU7A 2QPEB 32C2A 1FVEB 5TH2A 3V4UL 4WUKL 1WD8A 2CHWA 3EFOB 5C70A 4FHBD 3S34H 3KPPB 4MHHG 5D5ME 3P0VH 1CFSB 1HXYA 1NIEA 1MNUH 3MNMA 4NUQA 4JDTL 4I9WD 4WRLA 3BT0A 3ZKQD 5D96C 4MS8D 1IC4L 2K7QA 1M3IA 2YLKA 3JV6A 5BO1H 1M2OA 3VXMD 1OTUD 3TBCA 2APTA 1V5JA 1HIML 4DO4A 4AQEB 3N50A 3V4PB 3NH7H 1WFNA 3NDZE 1JZ7A 2VE6A 1YEIL 2MNJB 4HKZA 2B8OT 3UCQA 5ENWA 5B3NA 4YHKL 2IPTH 3GZKA 1UYWL 3OLEA 3SYPA 3L6FA 3BEWA 1XHHA 3N04A 5C0EA 3LIZA 4G71B 1Y7VA 4FXKC 4JJOA 1AP2B 1S9XB 5GRVL 3V7MA 2WCSA 1JPGB 3IDXL 3UGXA 1DE4A 3EH4B 4HDIA 4KHXH 4JVUA 3EJRA 3CVCA 2EDRA 3QO1B 2JK5B 5DC9B 4YOKA 3DOHA 4G7QB 4GI9A 3D25B 1U3HA 5GGVY 4GW1B 4ONGL 3ZUCA 5HYSG 4U6TA 1O5DT 2YBRB 3AWFA 3VW3H 4DGYH 2KERA 4XNYH 5EUOE 3OG6B 3DO3A 4JPIB 3ARSA 2X6AA 1YNTF 4TOYH 3FQRA 1FNGB 5B1BB 3JUZA 3WNLA 4X8JB 2CGZA 3FQUB 2VL5B 2HVBA 1P84K 3KJ4B 3OLDA 2DEXX 1LD9B 3O9WA 5LNEA 1R5IA 3CQQA 1KTDB 5IQMA 4XPBH 4QLWA 1QSEB 4ZNCD 1JBJA 4GKLA 4OFKA 3UPRA 4FULA 2AJSL 3VD7A 1KN4H 5DSCA 4GAYB 5T1LD 2VIRA 1RERA 2EE3A 2C9SA 3F84A 3M17B 1D5ZA 1HSAB 5J7CC 3RWDB 4HX1A 1AY1L 1DZ0A 4MNQE 2ZKXA 2A2QT 3EZJB 4DK6A 4M5ZH 3HFML 4K3JH 3LDBB 3BDXA 5B7FA 4N9GA 3WXWL 5TQ2L 4V1DE 4AM0B 2GTWA 3QEQB 1NPJA 3DURB 4L3CA 1E4XL 5D5MA 5KYWA 3HAEB 5C0DB 2R8SL 1U92A 3HE6B 4RBPK 3LV3B 4KJYA 3D9AH 3V0VA 4FQXB 1VESA 3KPRE 2NY5L 2HKHL 4MJ6A 3O6KH 2Q7YB 4ODUB 2J2ZB 1SHSA 3QAQA 5D70L 3K2UL 1T4KA 5E6IB 1M53A 3GIVA 5MP6H 5HGBA 3WJJA 1YYCA 3DV4A 2EO1A 4IGBA 2K4AA 1J8HE 3OJVC 5GGUA 1OB1B 1OAQH 3UYRL 1ZWIB 5C9JA 5IEKA 1DVYA 4WDIB 5SWSB 4I1PA 1A6TB 1ZIBA 1CBVL 2FGWH 1RZIB 2XWTB 4PMEA 4OJCA 2VXSH 2EO7A 4JB9L 4X99B 5KS9E 1KIPB 3GGWA 1H8OA 2IALB 3MV7E 4FYQA 2ZOKA 4N6RA 2F7RA 5ISZD 4GAGL 1KC5H 1ZV2A 4ZSOE 5T3ZD 4P3CL 3F7YA 1T3FB 3S2AA 1WWBX 3M46A 3BKMH 3V9CA 5C71A 2CM6A 2ISDA 4WTXA 3MGOB 3QZWA 5J1TC 3BH8B 4YXKL 3R0MA 5FHBH 4NP9A 2RMNA 4KZEH 2K3HA 1BFOA 5AZUA 4XPAH 2MTPA 1ORSB 2Z93B 5BQ7B 1J18A 4K8RD 3RWFB 5LHDA 2DLEA 3S34L 1H8SA 3DJSA 2G5UA 4MNGB 4Y4KC 3REVA 4FQJH 3P0VL 4AC4A 1MNUL 3EBGA 4V11A 4Z3GA 5FO8A 4K3EL 1YAIA 3VD3A 4BSJA 1E5BA 1QRNB 1V3KA 3KS0H 4UM9B 5BO1L 1R3HA 1UOLA 4JX0A 3U6XA 3QDGE 3NH7L 3H1ZA 1HT6A 3LQZB 3MBED 4FG4A 3U1PA 5D1ZA 3ETBJ 1T20B 1KY6A 3GD1C 4PJ8D 1AO7D 1MCHA 1P7QB 1SJEB 2G3MA 5IFJB 2IPTL 5A2BA 3ETBF 3N2JA 4XBMA 3O3BB 3WO4C 5EEVA 2E8YA 1HH9A 4GT0A 4L9DA 1TTUA 1T0OA 4H26B 4G6KL 5FHAH 2H26A 4ZYKA 3PGCB 2BSCA 3TP4A 3RUGE 4NRZB 4L29A 4PVLA 4RDQF 4WVRA 3QP3A 4KHXL 3W37A 2WQ8A 5IKCB 4V1DA 2VR4A 4M61B 3BXNA 2JIXA 4A39A 1WCBB 5F44A 3KPSB 4MASA 4YK4B 2BW5A 2IDUA 3CBKB 3D4YA 2CHDA 3OR7B 1P4LB 4O51B 5HDWA 5HYQA 4QRTB 3TT1H 4AYBA 3KNBB 2R4SH 4UIMA 4XB8A 3KPRA 5E8OB 5EOTA 4CSZA 8PAZA 2VR8A 4MKTA 2YAMA 4XNYL 4WFHE 4XO3A 3SBQA 4O2EB 4GH7B 1MHEB 1CDYA 1YY9D 1HKLH 1ES0B 4DFIA 4TOYL 3N0PB 5MEOB 3SSGA 1OTSD 1J8HA 1WJ3A 3IFPA 1UD3A 2W1NA 4TN9A 1OP5H 2DYPB 2WTRA 4NO2B 2Y69B 4GXFA 3GPSA 4M1GL 4XPBL 4LLDA 3BYTA 4G8GE 1KJMB 1JYVA 2VN5A 4NO3B 1CE1H 5MHSD 4YO0A 1MCFA 3SGDI 1QBBA 3MV7A 4LOVA 4YSAA 1KN4L 2PYED 4RFEB 2JB6A 1CK0H 2MJWA 2OTWB 4MJ4A 4ZSOA 3TN0A 1A6AA 5I8CA 4QIRA 2IXQB 5HSFA 4XNMB 1L0PA 1AXSB 4UQ3B 3E6FB 1EGJA 4QXTA 4TNWK 4M5ZL 2YAOA 4K3JL 4EBQH 3D05A 4MA3A 4MVBD 2IPUK 3ERXA 1PCSA 3REWB 2RFXA 3IN2A 1JD9A 3LVTA 1SQMA 4PJXF 3ULAB 3V6FB 1GYVA 2Z91A 4GRWH 4CKVX 1UH3A 4ZDHA 5IOKA 5EN3A 4QJ3B 3MREB 5I23A 1VEMA 2ICEC 1HHJA 4PRPD 3D9AL 5DDHA 5C09E 4Y2DC 4U6HB 5FYLD 3O6KL 4FYSA 5D7LB 5EBLB 5IY5B 4R4FH 5E8NB 3QFJE 2R0KH 5DJ6A 1IVLA 3QDGA 3ARPA 5DHMC 1INQB 5MP6L 1MCWW 1MW1A 2ICCA 4NWUH 1VA9A 3O2WH 4L48A 1TQSA 4XGZA 1L9RA 1R24B 3OJ2C 2QPSA 1OAQL 4ZT1A 2IANE 3Q8CA 1EWHA 4LLAA 1NFDE 2J7LA 2NY4C 4MNHB 4CAGA 3W9EB 1FCGA 3MRQA 2P8PB 5FFLA 3FQYA 5HDLA 2Y4SA 3CBJB 3L7FB 2X5PA 3VD5A 2VXSL 1P5VB 4M48H 4X9YA 3ZKMD 4ZMTA 1NUFA 3CUPA 3RUGA 2GT9B 3OPUA 1KC5L 1VGKA 2BFGA 3QJSB 5BQDA 4QRRB 4GKOA 1JMZA 5KAQF 4EN3A 2DW5A 1BVKA 1RUMH 3BKML 4R7DA 1JGDB 2FJGB 5I8OL 1Z2KA 2CLRB 3MXWH 1X5MA 2X10A 4U7MA 2IGFH 4H8HA 1H3UA 5F3FA 4NXSA 3N42F 1S6NA 5FA4B 5FHBL 3UO1H 4Y7OC 1Q9WB 3DROA 1NCUA 3B3BA 3K91A 4XPAL 3KPOB 1LP9E 1ZLEA 2MOVA 1SLUA 4WUUA 3AB0B 4FQJL 4WEBH 4KNSA 1ESOA 2QVTA 3RGVA 1NCIA 2V6HA 3ATBA 4FTVE 4X6EB 2MQCA 4NLHA 3IS1X 5C0FB 2HUHA 2Y7MA 3JV4A 2VYRE 1DDTA 4S11A 4F8QA 4J12A 2B9AA 2YMTA 1J9CT 1FORH 1PZCA 2D3VA 1BQHA 2O6PA 1OW0A 1EPFA 1HILB 4G9DB 4G8GA 1CL7H 3V6ZB 3CE1A 3MLUH 3TOPA 4XNUH 5CZVL 2N59A 2ESVE 2DYRB 2JH2A 3FB5B 5ID1A 2AXFA 1MEXH 3FQWA 4H8VA 4JKNA 2VISA 4XVSH 3RU8H 5E94A 2XFXA 3D51A 3NA4A 4NO5A 1WLHA 4BDVA 3BHBA 5IHHA 1F56A 3CN1A 1DCEA 1KCRH 4ANXA 4E41B 2I9TB 3MRKB 1CTOA 1GW6A 1S4IA 3BZ4B 5FC9A 1BQKA 2WD0A 4KO7A 1RK7A 3O8XC 2IQ9H 3TT1L 2R4SL 5C0BE 5JXAH 1E7UA 2WIIB 5J6HB 3NP3A 2NOYA 2WLIB 3QR1A 5IZ7A 4LCYB 3UTSE 4RMQA 3FT4B 1HKLL 2G3NA 4RRPG 1NMBH 3GF8A 3U46B 5DD3H 5KSAC 4MXWH 3WUZA 3FUHA 1SXAA 3QFDA 4PJ7B 1RLWA 5E4AA 3QIUC 3MRFA 1NBZB 2J72A 3DK2A 5KVEH 4UF7C 1NFDA 5E8EA 2HT4C 4AEIH 5CEZH 1WT5C 1DQML 1AGBB 1T1YB 5BW7A 4XMXA 2JCWA 1CE1L 3RB5A 3PYCA 3S37X 4DFHA 1JTTA 1DEDA 4F7KA 3K6SA 4YFLF 3QI9A 1ZV5A 4LNVA 3VA6A 3EH5B 3KWUA 4XBPB 4M8QA 3INOA 1LMKA 4EBQL 1A7QH 3DX6B 2WXFA 1VACB 4W9LC 1IC5L 2V3EA 4NIYE 1H5BA 1KEML 3RWIA 3J8F7 1J9SA 4N2OA 1WUNT 3L3OC 2QKIA 3HZ3A 3L7EB 1XEDA 1E27A 1NIBA 2V8MA 2AK4E 1KLGA 1NCOA 2P42B 1ZK9A 5LAXB 1AGCB 3L9RB 3LRGA 5GGRB 5B8CA 2UWEF 4GI6A 4J4PC 4M1CC 4FTVA 3RWCB 1MLCA 3RWJA 1JV2B 4X6DF 5EWIL 4R4FL 5BO0D 2VQ1A 3JT0A 4JFUA 2R0KL 2DBLH 4AGNA 3J27A 3N40P 3TCTA 3TEUA 1FAIH 4NWUL 1RZQA 3QJFA 4Z18A 3IE4A 5E2UL 1EZVX 5T1MA 1MY5A 5IJVA 3MRNA 2D73A 2G3XA 3WSQH 4MMXB 6TAAA 3HUJE 2YJQA 2JKJA 4OM1H 3TYFB 4WHYG 3D12B 2E3VA 4FS0A 5D1QC 1C16B 3ILQC 4KI5E 4M48L 4A2GA 4E5XA 3BZFA 1R5WB 3TBTA 3QDJE 4LLWA 1D9KA 2F5AH 2Y7SA 4WFFE 3QVAA 4XPGH 4JREC 1QFHA 3WNKA 1RUML 4BKSC 2J8UF 4QHPA 1JPFB 4YC2B 4EE2A 5FO2A 2QHLA 4X6CE 4HJEA 1IZJA 4QRUA 3UO1L 5I5JA 3ARDC 4A7UA 1X5KA 1KPRB 1I7TA 2CRZA 3BFQG 5KZCB 1ZE3H 4GLRH 1E5YA 4Y4KD 2OJZH 5C0BA 4ZS6C 1PGRB 4G6ML 2DPKA 2HFFB 4I0KA 3P3TA 4OFYA 1U8JA 4WEBL 4OJFH 3PWLA 2P44B 4WKZB 4G1EA 1I1AA 3UAJC 4XP6H 3T6WA 3O4OB 4ZPVB 4F9PA 2WKLA 4ZODA 5GGTA 5TGBA 5TDOB 3B3IA 4FJZA 1MCOH 1RV6X 1FORL 1S5IH 1NUGA 3DDGA 4MJID 1TCMA 3M8OH 2H0FA 3SGEH 1BMGA 2YGQA 3LEYH 3S5ZA 3MLUL 4XNUL 4MJ5B 5T5FA 2VXUL 4K55A 4DUVA 2ILLA 3FBQA 3VFPA 1MEXL 3VWJC 2A1WL 3MCYA 4FQCL 4XVSL 5GS0H 2CD0A 4N20A 2ZX9A 4URKA 1UG9A 1P7KB 4NN5C 1N6UA 2NW2A 5DVNA 1VCAA 2AF2A 1BLNB 3FB8B 2GIMA 4XTRC 3LJ3A 1JCVA 4JZOB 2IMNA 5GPRA 4NKOA 2GAZA 5J1AA 3DRQB 4LFHG 1OARL 3S8GB 3IMWA 4BSWB 4ZFFA 2BLFA 2QSQA 1KCRL 1P69B 3PWUA 4L4VD 2IH8A 2AANA 3L3HB 1XSOA 4FEMA 2P7TA 3NSDA 4NNPH 1RUAH 5DHDA 3RL2B 3DIDA 2AK4A 2R0WH 3LZQA 3V0FA 1BZ8A 2JKTM 4J1UA 2DWXA 1BJ1H 3CZSA 5ECGA 2IF7A 4UTBL 5JXAL 2WZPD 1I8AA 2OCCB 4M4RB 2FECI 3PV6B 5K33A 5EU6E 2BOLA 3T0EE 4XX1E 3UC2A 1SPDA 1XFPA 4F7CB 5G4MA 1R3LA 1TQTA 2I69A 4JPWH 1IM3A 1NMBL 1U41A 4K7PX 5F9OH 5DD3L 4HIIB 3SDCC 1CFQB 3QGVA 2YJLA 3IMVA 4JFSA 3IBEA 1PJ9A 2LU7A 3ZTJH 4WGVB 2QR0A 5CEZL 4RAUA 5HHME 4PJHE 4ATWA 3DGCR 1IKOP 3WAJA 1JP5A 1MFNA 3ATAA 1LDSA 4R96B 1MWAH 4M1DH 3N85H 1U58A 1ZSDA 2DWSA 2VJXA 3QDJA 5E4EC 3QA3B 1TKWA 3OZKA 2ZOLB 3WIHA 5J1SC 2G0KA 4X9FA 3HG2A 4NRYB 4M7ZB 1ND0A 5IB3B 3EO0B 3SEPA 3Q5OA 1U0QA 1A7QL 4X6CA 3NSJA 3S88L 4N2HA 1YVLA 2A6DB 3LQAH 1N59B 5E0QA 1PNDA 4YL9A 4WK2B 5ERWB 3IN0A 3W1ZA 4AQAA 3O6LL 4HWEH 3P30L 1KACB 2CSPA 3A4EA 1YPZA 2VMEA 3HS9A 4CNIA 5EC2A 3JUYA 5MERB 3QUHA 1HHGB 4PGBA 2VLKD 3E9UA 4IKIA 4UT6H 4Y2DD 2AXJA 2IAMB 5AQ0A 2HLFC 2YD9A 3K7UA 5EF1A 4ZTOH 4DZ8B 4X98A 4LGSB 1FWXA 4F93B 4XCEB 3WNOA 1YJDH 4GQZA 1KCBA 2DBLL 2HSIA 3FCGA 2VDPH 4Z7WA 1BYOA 3QCUH 3QWNA 1RJZA 4BQ9A 2ZWYA 4TNVK 4ZMYA 1IL1B 4ZUUB 2NY4D 3I9IA 3VFMB 1LYQA 4LVHB 1Y0LB 4OM1L 3C87A 5DFAA 1RZ8B 2R0ZH 2PPFA 2A77H 2X4NB 3ARYA 4HIJA 4JLRA 1AQKL 2F08A 4KMTL 3FQXA 1RI8A 4NN7C 3QPXH 4Q14A 1YSOA 4WTQA 1H6TA 3PWJA 1U95A 2UYLA 4F8LA 2ICWI 1DVFB 3O4LB 5DQJA 2R27A 2P26A 3DVNA 5AKSA 3G6JE 4IOSA 1JHKH 3AREB 3L48A 1OIOA 3QHTC 3TIDA 1IGCH 3RIFK 2EVFA 1UXSB 4MX7A 2EDYA 4U3HA 2BY2A 1HDMA 1NGQH 2IMMA 2OJZL 3RL1A 3VH8B 4HYTB 1ZDQA 2Z8RA 3FTUA 3HBPA 3S36H 3SZ6A 1D7CA 4JDEB 5EU6A 4DTGL 5B38G 4OJFL 3T0EA 2H32B 2FSEB 2C3VA 1WFIA 5FUCE 4U1SA 3AXLA 3MUHL 4IBVA 1ZMYA 4NZTL 3ARFA 3RI5F 2YUWA 4H8WH 4IHOB 1YN6B 5IF0B 5BVJA 2W9DH 3VXQA 4XNZC 3KBFA 1MCOL 2WUCH 3WY3A 4I89A 5DEFB 3IJYA 4OQTL 3T0BA 2NXZC 2QVIA 3M8OL 2RAMA 4PJHA 25C8L 2WBJB 1QEWA 2OR9H 2PTTB 1ZLUK 4NQSB 3QCTL 2B15A 3BIBX 5GZNA 4KXDA 3IJSB 4A7SA 4MB1A 4ZG1A 5JW3H 3KBPA 2XTJB 3D09A 1HX0A 5GS0L 4HHWA 5IESH 1TJIL 3FFCD 4YDIH 2YK1H 1HZHH 4JFDE 5FK9A 3RLSA 5E99H 5D93B 4OJYA 4L3ED 1C5BH 1NCDL 3G7TA 4W9FC 4BRJA 3U7YL 2O6CA 4AQ8A 3U6RA 2F1BA 3DETC 2FJFA 4I3RL 3T8VA 2I9LA 1SJMA 4OFQA 1T21B 3G5XB 3MRRA 4K2UH 4NNPL 1FNAA 1RUAL 4WLCA 5GRJL 1FLRH 2CHZA 1YYMH 3UERA 3HZVB 2M2DA 3F05A 4BKTC 1JZ4A 3IDGA 3MRMA 1QBAA 1UURA 3O8XD 4B9ZA 4KDWA 2NX5D 2F1EA 4D0CA 5T3ZH 4FXGB 4GKNB 3U4EA 2F74B 1KGWA 3TC9A 2NY3B 3N3EA 5JHLH 5D7IA 3KPNB 4I7ZC 1J9RA 3SHSA 5KSAD 5F9OL 2IBZX 3QIUD 2LTQC 1PZ5A 4K8RH 2BIQA 3EH3B 2HJFA 4ZUSA 1ROWA 5DRXB 2HT4D 3OHMB 2E6QA 1U8CB 4N1CA 4RGNC 2BNQA 5DEJA 2OA9A 3RWGB 1WHOA 3QS2A 4TRPH 4XMPH 3MLXH 3JWNC 1Z5YD 4PGDB 1BJMA 2D4DA 4M1DL 3FO1B 3N85L 4G1MB 3WNPA 5BJTB 2W38A 1WP6A 5I74C 3EAKA 3H9YA 3SBPA 4YN3A 3WJMA 5EEXA 3EDDA 1EFXA 1ZTXH 3TURA 1HQ4B 3G6JA 4FD0A 3LRSA 1NCCH 3QXVA 4UZUA 3HFFA 3B5GA 3RY5A 1CYWA 2WK2A 1E40A 3LQAL 3EYSH 4C56B 3QC6X 4HWEL 3CSPA 1OP4A 3FFDA 2VKXA 2HAZA 1BSIA 1PKQA 4WW2A 2A6KB 5DQDH 4DN4H 1KOAA 1T0MA 4J4PD 4M1CD 3L95A 4UT6L 2DMBA 1MHHB 1MFVA 1Q9LA 5CEYB 3ZUNC 1IARB 2PPDA 2EVGA 1BYPA 4Y1AD 4ZTOL 1NM4A 1J0IA 2NY6B 4KDTC 1YJDL 2AV1A 2OJEB 5I0VA 3VRIA 2VDPL 2GBUA 1TZ8A 4NYLA 2PNDA 5T5NG 3BSHA 3S4SG 3U30B 5I1IH 4E42B 2D7TH 5I9QB 1CFBA 5F71A 3MNWA 1E9PA 2WXOA 2D31A 3GSNB 3TX4A 4NBYB 2R0ZL 3HKFA 5I28A 4KNQA 3ILQD 5MEQA 1D2PA 3DJ9A 5HYJA 4N8VB 3N1MC 4YDJB 5IK3A 4OJEH 1AGFB 4H7VA 1IGTA 4MD0A 2XV6B 4XP4L 2Y23A 1R9FA 1TJHL 2QLVB 4ICXA 3PWVB 4WWKA 2ZD0A 1UUNA 1ZANL 4M43H 4MCZB 1ACCA 5C0CB 2Y5QA 5BMFL 4NUMA 3K0WA 1CGYA 3NZHH 5KVDH 3GBDA 3PQYE 1XMEB 1E4HA 3ARDD 5CNHA 3PIQA 5FF6B 4JKPH 3MOBH 1T1XA 4D0BB 5C8JB 5I1DA 3N43F 1W16A 3HI1B 4MRBA 4ZS6D 1TF4A 1NGQL 1K6QH 3BAKA 1T1WB 3S36L 3ARRA 3WGUB 1KFAL 4U6YA 3UAJD 5C0AD 4HCIA 3KDPB 1CG9A 1NCAL 4H8WL 3L5HA 3WG7B 4I5BA 3MYZA 3QIBB 2W9DL 5KBMA 3CFBB 5B1JC 2WUCL 3LIUA 4KX9A 1U30A 4PRNB 1N2RA 4AY0A 1QABA 1IEAB 1E4KC 4PREB 4YFDB 3ZZLA 4OGYL 1E6OH 2WYHA 1G7MA 3VXPB 5D1XC 1J12A 1N8ZB 5FYLH 2A74C 5JW3L 3LN4A 5KJRL 5ACMA 2Q20A 5IESL 3WU1A 4YDIL 4KMQA 3EYFA 2R1YB 4LQFH 4M4PA 4XTRD 3MRBA 4ETQA 3IAGC 2JJUA 1HZHL 4ORGB 5E99L 1OP9A 1XGZA 1O0VA 2X9XA 1XF2A 1C5BL 3GTTA 4S1DC 4Z3JA 2W88A 4JCLA 3FT3A 2GSIB 1B4JH 1UKQA 3OL2A 3MJ8B 3I6GA 3GSXA 4K2UL 3X12A 3BZDA 5HDRA 3HR5B 2QTVA 1YYML 4U3XA 2XPGA 4UMSA 1CDUA 5CBAB 2ATKA 1Z9MA 4AEFA 5F7AA 2VLJB 4E9SA 5F96L 4Z76B 35C8H 3FSAA 2FO8A 4P2OA 4NNXA 3WUWA 4DO6A 2PCPB 3LKQA 4OCWH 2IVFC 4PJBF 4DQOH 1CR9L 2J56A 4TVPD 4U31A 4ZXBA 5BXFA 4WTZG 2I24N 3IWVA 4HD5A 1IAOB 3CK0H 3SDCD 3JYCA 4R0LB 3UPAA 5JW5A 1EIBA 4K8RL 1PLGH 2ZWZA 4LPCA 3R8QA 2R23B 1A1OA 3IS0X 2R2CA 3FYIB 2WINA 2Q6WB 3CLEL 3RZWA 3QYNA 1TITA 4XMPL 3MLXL 3O2DL 5INCA 1OQXA 3VI4E 3VD1A 1KJ3H 5K9QG 1LGVA 1UJ3C 1N64H 3WLWD 4A7QA 1NGWA 2ZJSL 4HFUL 1FH2A 1QSFE 3FB6A 4B3VA 4ZJ9A 3ECVA 3SD5A 1ZTXL 4OZIE 1U3NA 1ZA3A 4GS7B 1KTRL 1ZT1A 2Z3FA 3SQOL 3DYOA 1T0NA 4KC3B 1ZDSA 4JY6A 5A16B 4XZUA 8FABB 4JFYB 3MV9D 3PDOA 2DWDB 4QRSB 3EYSL 4CVUA 3LQMA 3MQIA 3BVNA 3SPJA 3ET9F 3VTTA 1B9ZA 5E1AB 2OQJB 4IKJA 1XF3B 5IIEA 1OGPA 5DQDL 1SHXA 4DN4L 1I3VA 4HK0A 1CD8A 2OMNA 2BOBB 2UVEA 4LHJB 1EH9A 4GRWE 2HLFD 1O9WA 2FH6A 3O45A 3QRLA 2LVEA 3D2UA 3UBGA 3OMNB 1I53A 2PW2B 5SWZD 1MW3A 1AKJA 4F3FB 2ATAA 2IWEA 3W0WD 3CHRA 1P4UA 2JJSC 2D7TL 4OJAA 3HLKA 5GRWA 5LN4A 2VN6A 1TXKA 2BVPA 1IC1A 4G43B 1ASPA 4HFWA 4R5XA 2DLIA 3VXUB 2Z8SA 5KN5A 3ZXAC 2GHWB 1GMIA 1G6RL 5HGGS 1RIHH 3B2UC 3SDYH 1J7VR 1KLFA 1OT2A 4AI7A 1B0WA 1MCCA 3BAEL 2BC4B 5GISH 4L1LA 4BK4A 2EYRB 3KHOA 1FDLH 4YPGA 3NZSA 5I6NA 4B7IA 1MWOA 5CIPH 3ECUA 4M43L 4YPJA 4MMZA 5J6GB 4X6FA 3NZHL 1G0YR 1RPQA 5KVDL 1AHWB 4AUUA 4PYHA 3MLSH 3CXHK 4NC0B 2Y5EA 1I3GH 3MOBL 1S7TA 5TF1L 3FTGB 4HG4J 2O6EA 3GXUB 3S96A 3QUMH 4DKDC 3RY6C 2W0FB 3HNSH 5T1JA 1KTKE 2X4UB 1TJXA 2O4EA 1JXFA 2KLSA 5HGDB 3E1F1 3FMGH 5FA3A 2NY1B 1YMMA 2PO6C 4FG6C 3QNYB 5ESVB 4PW4A 1X5ZA 4HK3J 2NXZD 2CM5A 4A1RA 4FZEL 2YMXL 5CLZA 2CHXA 3IPFA 4YLQT 3BJ91 5EFIA 4PCKA 1E6OL 2V2XA 3IVKB 1IEHA 2EIZB 4AYFA 2XJKA 5FYLL 4NQEB 4PWEA 4YHIB 3UX9B 1S9YB 4FLQA 1QSFA 4DP4X 2X4QB 2V2TA 1P6AB 2X6CA 4LQFL 1W8EA 4PJDE 3C60C 1U8IA 1Y18B 2JLPA 3VNYA 1PEWA 3P4MA 3BWAA 3W38A 1BVNT 2FATH 4OZIA 1UENA 4P8QA 4ZOAA 5L2KD 3V4VA 4CVXA 4LBAA 3T5WA 4IK6A 3V5KB 5IWLC 3DETD 4E9VA 5FKAB 5IVXE 2M83A 1B4JL 1KCSH 4G7VH 5AVVB 3MUZ1 3JTTB 3PAZA 5J9PB 3JVFC 4HIXH 2O5YH 3F12A 3BZEB 5F7YC 1UHVA 3JZYA 4QRFA 3O6FA 1KPUA 2Z65C 3NMEA 2UX6A 2WZ0A 1B3IA 3I3EA 3Q5YA 4ODXA 1NH6A 1JOIA 2NY7H 1AYOA 1JRHI 35C8L 4GG6F 4G82A 3QORA 2WMPB 3DI3B 4DQOL 1KN2H 4LDOB 5IBTH 1BW8A 3RTLA 1DFXA 2MPAL 1UQSB 1QLRA 1G7QB 1TCRB 1G7LB 4MQTB 5EU7C 4KJWC 1PLGL 1K2DB 3CZJA 3QRGH 4OU3A 2NDFA 4N0FB 2NLJB 2RALA 2H3NB 4R2GC 4ZTPH 3RKDC 2X2JA 5I1CH 1SLXA 1W72H 4EQ2A 1M3JA 2WXRA 5KVEE 4TNFA 5DJDA 3WXVH 5JIDA 1KJ3L 1N64L 4WI0A 2NY0C 2OYKA 4WK4B 2Z0UA 5CEZE 1WZKA 2CBOA 1HHHA 5IFHH 5DMKA 3PJNA 2OX5B 1E2WA 2QADC 3V55A 4D9RD 3JYBA 1WRFA 5CFAA 2IH3B 1OLZA 3ZRCC 2AJYH 3CDGA 1DJZA 5D55A 1B0IA 3ZDYB 4O5LL 5EA0H 4IRZH 4ZX3A 4NQCB 3HR6A 3K81A 5JORB 5CJXC 1HHKA 3B7RL 4PJCB 2GC4C 1L9SA 2FZ3A 3HC3H 5SX4H 5IW6B 4OV5B 4IIQB 5DYOB 3T2NH 1I8MA 5E95B 3L3IA 3JSSA 3GRBA 2VDQH 2X1PA 3QNXB 4JFXB 4XBGA 2NCMA 1SVCP 5I18H 1HOCB 2Z92A 5IROC 4R4ND 3WIAA 2D9QB 3GXPA 3QQ9D 5SX5K 3U9PH 2CRIA 3MZGB 1LNUB 3NACH 3VFNB 3MODH 5D4JA 4L0PB 3UZVA 4J3VA 4NPYA 1FRGH 1RP9A 3OBAA 4YIQB 2NSXA 3X2QB 1RIHL 3DK0A 2X09A 2UY7A 3SDYL 5I76B 4ZQKB 4G5AA 2GK0B 5GISL 4BE5A 3EJJX 3EOAB 4UDUB 3TPUA 3L9EA 1MQKH 3OQRA 3S35X 1FDLL 3PY9A 3RFZA 3JTSA 5IVXA 2A0LC 4P05A 4ZFZB 5AYTA 2WY3B 1LWHA 3U2SA 3SBRA 5HY9A 4AT6B 2FSDA 5LGYA 3FH8A 4OZ4B 3MLSL 1KGCE 3L08A 1I3GL 3FSOA 2DIEA 5GS1C 3QUML 1G1CA 3GYRA 5IQ9B 1HYSC 1FIGH 3HNSL 3BW9A 4Z9KB 4NNYA 3FQ4A 3FMGL 2FDBP 3PCYA 1GYWA 1KBPA 3O0LA 3T3PE 1KB3A 2FX9L 1W6WA 3OWEA 2VLRE 3INUH 3G6AB 2YD0A 3OKNB 3CC5A 5F7NC 1AZVA 3G04B 3FPYA 2DJUA 4KK5C 3SDXB 1SFHA 4O2FB 4X0NA 5D2LA 3SY0B 2E7HA 3P4LA 1XL4A 2FJHA 5D1XD 4MD5B 2AKRB 4DNLA 3ME0B 1JFQH 4LL4A 1HL8A 2XXMB 3SYCA 3H8NA 4L9LB 1FCCA 1T2XA 1RK0B 1AZUA 3D30A 3BPLB 4E9LA 2VZ1A 1TZIA 4PB0H 1KENH 4ELKB 2G5BA 2AJ3A 5AYUH 4BGLA 5I5MA 5F9WC 1I8IB 1MAKA 3Q2CA 1DHKA 2E7BA 4G80A 4LDEB 2DWYA 2FATL 4G7SB 2OTPA 3WHXA 4S1DD 4RGOH 3KYNA 2XQYA 2BERA 3RAJL 3CFDA 4YDNA 3ABLB 3UYPB 3QEGH 5HVGB 1T5WB 4EIBA 3HE7B 4UANA 2WWKO 3HRZB 3MKKA 2O5YL 4HIXL 1BVOA 5CSZA 2FUTA 4PRHD 4BFFA 1BECA 5E5UB 3S7GA 1PLBA 2K3TA 1N67A 4RIRB 1RULH 3SDDC 2NY7L 2NYKA 5A40E 2E74C 4QPEA 3ZQ9A 1MFDH 1S3KH 3BP4B 2AQ2A 4Z7OE 1KN2L 1EV2E 1F3JA 1JN6B 3OHXB 1UB6B 3DXAD 1G94A 1G7IA 1WBZA 3C5ZA 3A67H 3P0YH 4P4RB 3HZYA 4OFDA 4UCFA 4K71B 1N0LB 4G8FA 3VFTB 3QRGL 1LXMA 3TCLA 3I9GH 1PMYA 1D5IH 4HS3B 3BVXA 1XR9A 2WV3A 3A3YB 4I13B 1TTAA 1PBYA 3QYCA 4LDCA 4OFVA 4ZTPL 5I1CL 3LZNA 1AKPA 2VABB 1VFAA 1AI1L 1W72L 2EYSA 3P9LA 3VCLA 3NIGE 1U8QB 3V5DB 1J1OH 3ZZ1A 3WXVL 4AMKH 2VWEE 3HN3A 5EO9A 4I9WE 1UXMA 3B2PA 1XD0A 4PJEF 5IFHL 5F7LB 1J11A 1BD2D 3VWKC 3NJVA 4TUJB 5DK0B 3S5LA 1FVCB 2FL5A 1FV1B 5TH2B 2GI0A 32C2B 4CVZA 4IBWA 1Q9KA 3VXME 1X9RA 2AJYL 3C6SA 4F80A 1HXYB 5CHNA 5EA0L 4IRZL 5E9NA 1HCYA 4DO5A 1QVOA 5DMIH 2WAHA 3LKPA 1G1KA 3JV6B 2WIMA 3HC3L 4OF8A 3PG2A 7PAZA 1EXUA 2DQCL 3PWNA 5A2CA 1N12A 1OAUH 3QISA 1A5FH 2VE6B 1QOKA 3ARGC 4HKZB 1GOGA 1S8DA 5ENWB 2ZP9A 5I18L 3VDAA 3APCA 1UA3A 1FYTD 1XZWA 3BEWB 3L6FB 4LCCA 4DKTA 4R97C 3U9PL 2RCSH 3NACL 3BP7A 4CVWA 5C0EB 3MODL 1R0AH 3RWEA 4PWGA 5HDOA 1FRGL 4W4OC 5GGSY 1L9QA 3WLBA 4XE0A 3B2UD 1DE4B 1JF1A 4QNPF 4HDIB 1R47A 1FG2B 5ANME 1UASA 1TZHA 3L5WA 1IM9A 2ZG1A 1U3HB 2OLDA 3LKSA 1R17A 2B39A 2VSDA 1ET7A 4D8PA 4R7VA 1YDPA 4XN2A 2UUDH 4MXQC 4KRPC 5F6IB 5EOQH 5FGRA 4KRLB 1KIRA 4RVBA 4C83A 4U0RC 3RRQA 3I6LD 1QUNA 1ITBB 1FIGL 3FQRB 1AR1B 2BZDA 1AYRA 2YWZA 5BNXD 1ZVSA 2I7SA 3CN4A 3ZR5A 4AH2A 3LN5A 4I2XE 1XD1A 1FNLA 4MAUL 2IOIA 3O9WB 4MGXA 1R5IB 2PO6D 3FRUA 1SY6H 4FG6D 4DQAA 4DH2A 2BINA 3O3UN 1Q0YL 1JYXA 1I9RL 5J13B 3MZTA 3UPRB 4AITA 2VDMH 2WXMA 3PUCA 5DSCB 3MX0A 2VIRB 4Q9BA 5CZRA 3UZQA 1D5ZB 1E5ZA 1XF5A 3KVPA 1HEZA 4HX1B 2O6FA 5E03A 2DLTA 4PB0L 3QSKB 2NUTA 1KENL 4OKDA 1DQTA 5AVUB 3C60D 5AYUL 4FGMA 4AC2A 5JQIB 4N9GB 1IU1A 1MWAA 5KSVA 3VX1A 4HUNB 1WZAA 2ZNXA 2GTWB 4RGOL 4NC1E 4JHBA 3VXMA 1F2QA 1GAFH 5FYKU 3US1A 5DWPA 2CO2A 4L3CB 5L7XH 3SKJH 4G70B 3PXJA 3CG8A 5D2NE 3IETA 4JFVA 5D5MB 5KYWB 4DKAA 3QEGL 3MI6A 2AJZA 1U92B 3F58H 5ELIA 3DVFA 4KJYB 3V0VB 1PD6A 1RZPA 4MJ6B 2YOCA 5FPIA 2WNGA 4P2RD 3TO2A 3Q0HA 2WZ5A 1M1XA 3VDBA 3FQ2A 1F97A 1T4KB 3GIVB 5HGBB 1F0LA 1OGAD 1S3KL 2FLMA 1UFGA 3DV4B 1VFBA 4IGBB 4PB9H 4YHMH 5ISZE 4UT6A 5GGUB 3NJMA 5C9JB 4H1LH 5AW9B 4X8CA 5IEKB 3T2OA 2F6AA 5CLYA 2GEQA 3A67L 2ENSA 3P0YL 3QG7L 1NBVH 4LVNC 4KJWD 7PCYA 1GKOA 2X9ZA 1ZTMA 2ZQKA 4XXCA 5CR8A 3KLDA 3UFIA 3I9GL 1D5IL 1RKRA 3GGWB 3RGHA 4R2GD 2J20A 3RKDD 2ZOKB 1DBBH 4GQ9H 4ZW5A 1ZHNA 4N6RB 4YBLC 4G8IA 1E8WA 2Q8AH 3NSCA 3F7YB 1J1OL 15C8H 1KBVA 2NY0D 4FQHA 7FABH 3VJ6A 1PTZA 3W2DH 3QXTA 3A21A 2QELA 3QZWB 5EN2A 3NCBB 4TNWF 2ZONA 3NTCH 1BFOB 3U0WH 1YEEH 2V17H 7CGTA 3FONA 3QFGA 1SQ2N 2Z4QA 2F53D 3REVB 1CYGA 1ZTXE 3APMA 4XXWC 1D3CA 1QZ1A 5ITFA 3ARBC 5C07D 3WTWA 5FO8B 2ENQA 4FNPA 1AO7E 5DMIL 4OBSA 5FOBA 1KCWA 5DYFA 3F6IA 4NZUH 5T1LA 4DUWA 1OK0A 1V3LA 1R3HB 2X1XR 2CDGA 4ORZC 3P4OA 3C12A 2C4XA 1XGPA 1A5FL 3AWGA 5D1ZB 1U8PA 2LVCA 2NDGA 1NWOA 4C59B 2UZYA 1S7RA 3WEMA 3CWGA 5IROD 2OYMA 2WO4A 4AUJA 4U1NA 1HH9B 2RCSL 1HCVA 1QLEH 4Z0XA 5M95B 4UV4H 2H26B 4FN0A 4ZYKB 4P9HC 4OVVA 1PFCA 5B39G 1U8NA 1BXUA 3TTSA 1OSEA 4L29B 1UXWA 4TVPH 5D1ZI 4KXZI 1X5YA 2P5WD 4NQDD 4ZFQA 2V9QA 3WELA 5DS1A 2QLYA 4V1DB 5BRZD 4LAQH 3BXNB 2GSMB 4ZMQA 4G6JH 2A0LD 4XAWL 4P59L 3E2HC 2C1PA 4OLYH 5HYQB 2WLLA 3IF1A 1ETJA 2JB5H 4Y4FA 2HG0A 3DX4A 4UIMB 2RH0A 5EOTB 3SGJA 3KPRB 5JPNC 1UFUA 1AJ7H 4WNQA 2K70A 1TEYA 4R3SA 5I19H 4LHQB 4WWOA 1HYSD 5KVDE 5MHSE 1QTSA 3KVDD 1OAKL 4Y7MA 1FH5L 2PYEE 5ISZA 1J8HB 3EW3B 4Z3TA 3IFPB 4B96A 2WTRB 1VCBC 4R83A 1SY6L 1GSMA 1NDGA 4LLDB 5JHLA 5ACZA 4YHZH 3DMMC 4KK5D 3IU4L 2BIOA 2VDML 1QTYT 1SOSA 4YO0B 2WTPA 1RUPL 2UZXA 3MV7B 1YA5A 3FUKA 5AB2A 2JB6B 2V8LA 4ZSOB 2AMGA 3H54A 3TN0B 1Q0EA 1A6AB 4RMUA 5I8CB 5AZEH 1MCSA 4BXVA 3TVMC 3TNNA 5GZOD 2EIBA 3I3DA 3HC2A 4GSQA 5EU4A 4QXTB 3WKMH 5C0NC 2Y5TA 1F4AA 3MC0A 3QG6A 4MA3B 4PRPE 2HG5A 1TEGA 4AQ1A 3GLAA 4U3SA 2Q2EB 5CWSA 2RFXB 5FYLE 1L7IH 5DGQA 4BKLA 3FUEA 2IH1A 2Z91B 4XE5B 5L7XL 3SKJL 4ZDHB 2DBJA 3QUGA 3MBEA 3H9ZA 3NESA 3AS3A 4Q52A 3B83A 3F58L 5AAMA 1A14H 1HHJB 4PJ8A 1AO7A 3AY2A 5DDHB 4H0LC 3PGDA 2E86A 4A2LA 5D71H 3G3LA 4RWYH 4FOMA 5DJ6B 3QDGB 2XRAL 1J5CA 5F8QC 1GS6X 1J10A 4QRPD 2QFPA 2BHYA 2LLLA 4XGZB 3LS4L 1BWMA 1MI5D 2PCFA 2X89D 4FYTA 3U6XS 1MCRA 1YY8A 5DVMA 2P24A 3KYAA 1NBVL 3C09B 4ZBJA 1GGUA 3OKOA 4P0DA 2OMUA 3MRQB 4NJ9L 1MRCH 3FQTA 4LLMA 5LBSH 4ZD3L 2VDNB 4BBWA 3OB0K 4R6UA 4PGZA 3CUPB 4BQCA 3RUGB 1VGKB 1IGMH 1ZV9A 2XICA 4F7TA 1Z5HA 15C8L 4EN3B 1FFTB 1BVKB 4NGHH 7FABL 4R7DB 1ZT7A 1A47A 4YDVA 5DVOA 2A9MH 1VEPA 3VWKD 5LKNA 2YS4A 1UCTA 2F18A 3CFEA 3GO1H 1N6QH 3DROB 3U0WL 2MSPA 1FNHA 2BFVH 4LLVA 2V17L 3NPSC 1UGKA 2A9NH 4HS6A 5LDUA 2CJUH 4WUUB 4JFFD 2ZUUA 3D39D 1CZ8H 2YRZA 3F01A 3RGVB 5DR5H 2WPGA 3DGDA 1JTPA 3T2QA 4AQZA 3MFFA 4IMLA 5B3JF 5DRWA 3JV4B 3HMWH 5CO1A 4XWGL 2PYEA 2CUAA 4FL4B 5TE4H 2KZWA 3OV6A 4PJAF 4G9FE 1BQHB 1OXYA 3QQ4A 5CS7A 4UAHA 3ASNB 3GHEH 3QJVB 1GL4B 2VMFA 3ZKNC 4G8GB 3ARGD 3WEXA 1LQSR 3MBXH 1V27A 5ICYA 2C1OA 4ZW7A 5KSBF 1QSZA 4X6BA 3K74B 5ID1B 2IFGA 4K9JA 2AXFB 3FQWB 1IAII 4LRNH 2VISB 2F15A 3LKNA 3OKKA 3VACA 2ZAIA 1QLEL 5E94B 4NUPA 1CF8L 4UV4L 1D5MA 2XFXB 3PE9A 3GDBA 4NO5B 5FW7A 5K9KA 4XCNA 4BDVB 3BHBB 4AE0A 4PRPA 3LZLA 4TVPL 1ADQA 2V5YA 4DCQA 4CMHB 1W2KT 4LAQL 2YPLD 3N44F 1LMIA 3GK8H 1TNMA 3PUUA 3W82A 1DBJH 4ABWA 4HULB 4MYPA 4MXQD 4KRPD 2VB5A 2JB5L 3JWNH 3OLGA 3QXWA 4MAYC 3O11A 1AJ7L 3EYOA 5I19L 5I1GH 1IGYA 2XOTA 1U9KA 3R8BB 1Z66A 3AROA 5L0QC 4KX8A 4J3XA 3NIFF 4FZ8H 4RMWA 4HCRH 3QFDB 5C9KA 1SUJA 3WTXA 2ZT9C 1CS6A 3MRFB 5ADOH 2E5EA 4BK5C 2OMTA 1NFDB 5E8EB 5BUAA 4QRBA 2GABA 4TULH 4EI5A 4Y9CA 3NCYP 3VD4A 4YHZL 3SCMC 3MLVL 2Y3NA 4XC1H 2VDLH 1MAMH 4OUUA 1KXHA 3K6SB 5E0FA 2ZCLH 3QI9B 5H2BA 3IFNL 5I5RA 1EHNA 1UA7A 4PJXA 1F4WH 1X44A 5AZEL 2Z0BA 3MA9L 3NAAL 4M8QB 1M7DA 5MI0C 4HWBH 3WKML 1XGUA 4RGMC 4OQ1A 5E1IA 3ILPB 5JO5A 5E6ID 3GC3A 4W9GC 4TQPA 1H5BB 3RWIB 5FYJU 5IEHA 1X5IA 4WSGA 3DLQR 2WAQA 3ROOA 1E27B 4Y4HC 5I24A 1KLGB 1ZT4A 2J5LC 2P8LA 5E1GA 3AS1A 5SWSD 1HWWA 2RHEA 4YH6A 3T6XA 5A2IH 4FTVB 3SODB 5B8CB 5BZDA 1WS7A 1E9OA 1MLCB 3RWJB 1AZBA 2XLLA 1FC1A 1RD6A 5D71L 5J4MA 1DN2A 2CKBH 2VQ1B 4RWYL 3WMQA 5AVXB 1CUOA 3QJFB 4L8CA 1E5CA 2AP2A 4GEJA 3DX2A 3BGFC 1NCBH 5T1MB 5IJVB 3GMRA 1FZMA 4EUPA 3MRNB 2VSMB 3PL6C 5ALBL 2HT2C 2UY6A 4O02H 3WN5C 2WM0A 4UAOC 1D5BA 3QXDA 4NHCH 2ZWKA 1MRCL 3BVWA 1XBDA 1JZ8A 2FWLB 3KVQA 4DKEH 3SE3C 1A2YA 4E5XB 3BZFB 2B7DT 3TBTB 4LLWB 1T6BX 1D9KB 1WVZA 3P3UA 1IGML 1IIKA 1HINH 2WHVA 2Y0SA 3ZLQC 4NGHL 3GDCA 4YSSA 3DGGA 2A9ML 5EG6C 1VZHA 3CDFA 4QRUB 2UWEE 4KHTH 5FR3A 3GO1L 5DJ2A 3KCPA 4XOBA 4R9HA 3S37H 1N6QL 2BFVL 1I7TB 3OKLA 3H4FA 3Q01A 4JHWH 3BD4A 2A9NL 4X6DE 3APDA 5C0BB 2CJUL 1IE5A 3TS8A 4MJIE 3DUUA 5CIPA 3LEVH 1U8JB 3ARBD 1NSNH 3PWLB 3UDWC 2NNAA 1YMHA 4W68A 1NJ9A 2WN2A 1I1AB 1I3RA 4G1EB 5DR5L 3FZUC 3VB9A 1A4BA 4N2IA 3WJLC 1ZD6A 2BP8A 5K59F 1HNGA 2GJ6D 3HMWL 4JFWA 2HRPH 4HMCA 5TGBB 3B3IB 3A4DA 5F21B 3GHEL 5JHMA 2AVFA 1Y6KR 3MBXL 3RWHA 4FAAB 1VHPA 5D72H 3W39A 3F8UB 4IRJC 4NM8H 4JRLA 5BV7L 4IS6A 2OKMA 2DM4A 4TLKA 3VFPB 4N2AA 4LRNL 3RDTC 4L4VE 3NCMA 2J8UE 3EGXA 2NW2B 3WS3A 4YHOH 5E6YA 2I32A 4BFOA 1PCXA 4P5MA 5HHPA 1VZGA 1KYAA 4YVNA 3VI3F 4NKOB 3CMOL 5IUCA 2B0SL 2GAZB 2HX8A 5J1AB 4N5UA 2H2PD 3OMAB 4ERSH 2J57A 5AAPA 5IM7A 2X4OA 1OP3K 4ZFFB 2OI9B 1CDGA 3PWUB 1A3RH 2H8PA 3P77A 1DANT 4AYEC 2X6UA 2P7TB 1A0QH 1AR2A 4OTXL 3GK8L 3ZGIA 3IXTA 2AK4B 4HUVA 3GJFH 4BUHA 3BC9A 1DBJL 2XZAH 4J1UB 1DVSA 1ZHKA 1NC4D 1S7VA 1KYOJ 4OF6A 2UXVA 1DYZA 4LSRH 1XH2A 1TPXC 2DN7A 1R3LB 1GH7A 4F5CA 1THCA 1IM3B 4IK7A 4EIGB 4LDLB 3A6BH 5IHBA 2IPUG 5EEZA 5ADOL 1HI6A 1B4TA 1Z9PA 1S78C 3KL3A 2QR0B 1U2HA 4RAUB 2AI0H 4X7FC 2RGSA 3DMMD 3UC0L 1A7RH 5BOJA 1CLVA 4XC1L 2VDLL 4N2LA 1U58B 1ZSDB 3QDJB 3WFEL 2ZCLL 1TKWB 2NMSA 2PWDA 4Y4KA 3SIKA 1BOGA 4NN6B 1ZAGA 2LR4A 5LCVL 3TVMD 4HKBA 4P23C 4OD3H 2MMXA 1ND0B 1CBJA 1EBAA 4MNQD 5C0ND 4JGJA 2IOOA 4HWBL 1KYDA 4K5PA 4X6CB 1W72A 4NBXB 3WAKA 1FZKA 2N1KA 3LD8B 1NANH 2UWEA 3EYQC 2AABH 2G75A 3IJHA 4QYAA 5C92A 2XVLA 3BRFA 2I7OA 2IJ0C 4I18C 4AQAB 3FN3A 1YPZB 4MJIA 4CNIB 5AL8A 4LOUD 4XZ4A 5EC2B 4PGBB 2Q0ZX 4OKVA 3TH3T 3FU8A 3OSKA 3MLRH 3ZKXB 2OP4H 4G59C 5C3IA 5EF0A 4IRZA 4X98B 2MRYA 2I60H 4LEXL 3KWTA 5I66A 2VOTA 1QI4A 5C08D 4PJFF 3UIYA 4Z7WB 4QRRD 2J25A 3ULVC 1RJZB 2XA8L 2MQ0A 5BVPH 4YDLC 4N3TA 4O02L 5DLMH 1AZCA 1N8OE 4M5YH 4L4VA 2WKOA 3FB7A 4RESB 4NHCL 2J8UA 4R7NA 4HIJB 3AG4B 4LEEA 4JLRB 4DERA 4NS0A 3FQXB 3RKPA 3CHQA 1KIUA 1DANU 2A38A 4K7PH 4WGKA 4N2BA 5FAAA 1F3RB 4W6WB 3PWJB 4OCNC 4XVTH 1U95B 2UYLB 2EZ0C 1M05A 3P2DA 2CK2A 2FBOJ 1HINL 3FN0H 4HQQH 2M1KA 5DQJB 3UCRA 3DVNB 4XVJH 4BFJA 1H15A 1K4DA 4ISVA 4FLRA 4WI9A 1HZLA 4WCYH 5ESAA 2NQCA 4DGWC 5E8PA 4HLZG 3H56A 3TIDB 3GT6A 1CPUA 4KHTL 2JWYA 4MX7B 4PSPA 1Z32X 4JHWL 4HU8A 2MTAA 4MZ3A 3V10A 1HDMB 1RL1A 3RL1B 1OE1A 3HMXL 4PN6A 5EU6B 3LEVL 3T0EB 2C3VB 3UG3A 1KGIA 4PIBA 4BELD 3MROA 4U1SB 3AXLB 4LPVA 3ARFB 3P9WB 2HRPL 4AVJA 5BVJB 1HOEA 5K93A 3VXQB 1U4FA 5JXEC 3FFCE 1P0SE 3IJYB 3FPXA 1QWUA 3ZKND 5DQ9A 1INEH 3M1CA 5HHMB 3IXAA 1O7DE 1KGJA 3GIZH 4PJHB 4O9HH 3Q6GL 1QEWB 4M03A 4L3EE 4Y2LA 2CBQA 1H3VA 2X9WA 3D0LA 4FERA 5D72L 3L4YA 5F7KC 4NM8L 2PR4H 4YBHA 4M9OA 1PW3A 2JQZA 1CDCA 2DJSA 2CJ3A 4UQDA 3BRGC 3GSOA 4YHOL 4AG4H 2F61A 5FK9B 1N19A 2VLKA 2ICEA 4LCIH 2NX5E 3Q8BA 4U33A 4Y2DA 1HYRC 3BESR 1BZ9A 4ERSL 4NCDA 2EIKB 4YGVA 1ACXA 2Z8WC 4D9QD 3U6RB 2FJFB 3MNVA 4HUWA 2I9LB 1A3RL 2QGDA 4ADIA 1PVHA 3MRRB 3CPLA 5F97E 1A0QL 5I75B 1OOAA 4YSEA 4CRPA 3IDGB 3MRMB 2GTZB 1GJWA 4D0CB 4OF0A 7TAAA 2L8AA 4MAYD 3PAYA 5DA0B 5DK3A 4HWNA 3U4EB 4WI4A 5CCHE 4C55A 1XSIA 1UACH 3BWUC 4EI6A 5KUMA 3HC0A 3PWPA 5D7IB 1YN7A 3EJTA 3RIAF 3T3MF 3BEVA 3EHBB 4MQ7A 4FA7B 4CJ1A 1VDGA 3A6BL 5CILL 1D7DA 3MRLA 1PZ5B 4YHLL 1BZOA 2HJFB 2BWIA 2LE9A 4LCWD 4ZUSB 2KQNA 5A2KH 2DIJA 2L7EA 4WU5A 5JOPD 2BNQB 5CF3A 2AI0L 3CHSA 2DLGA 3SCMD 2RBLA 1A7RL 2MEJB 3T8XA 1IVTA 4OZHF 1XZ0A 3Q8AA 4Q74A 4N5EC 4FNRA 3KR3H 4EN2A 4EIZC 4OCLC 4OI7A 2ZXWB 2E9GA 3FU3A 3WJMB 1EFXB 1W9XA 3FO0H 2Q9OA 4OD3L 2YPVH 3G6JB 5ITBL 3LRSB 1HN1A 4JFOA 1JDDA 5C97A 5HYIA 4L18A 4TUUA 5I8EA 2KPNA 4BZ1H 3OZ9H 3LXBA 1NMAH 3HAEG 1E2ZA 3DKHA 3FFDB 4Y4HD 4KTEH 3ZPDA 1CQKA 4PTUA 4WW2B 1PKQB 2DM2A 4LSVH 5KBLA 1AE6H 1T0MB 3VDCA 5TQ0L 3L95B 5DZAA 5FGBC 5IGXL 4RX4D 1OTTD 5C09D 1JZ3A 5FUOH 3MLRL 1Q9LB 4PM1A 2FT8A 2OP4L 3J2PA 4KTYA 4GXUM 3VMOA 3QFJD 4IKNA 2VLLA 2I60L 1C5CH 3DX0A 3ILEA 3TBVA 4UZGA 2AV1B 3VRIB 1RZKH 4NYLB 4OV6F 2WWNA 4J5VA 3D48R 5E70A 5JDSA 3PL6D 4X5LA 1EDHA 4DGIH 2NSMA 3MNWB 5H8DA 4X4ME 2HT2D 1E9PB 2D31B 3EDFA 2X1WL 4NJAH 4M5YL 1GVIA 5MEQB 1JCKA 5HYJB 5BZWA 5IK3B 2R9HC 4MD0B 1IGTB 3O8XA 4PLKD 5I6XB 2NX5A 1SGKA 5EH1A 2AQSA 4C4BA 4EIUA 4XVTL 1MJ7L 1OSPL 4HQQL 5CEXA 1ZGLM 4A7TA 4FP8L 4WWKB 2H1PH 3LSOA 4XVJL 2DIAA 1LWJA 4K5NA 5C0AE 3FU7A 4ONHA 5JYLA 4ELMF 5KSAA 3PIQB 5EEYA 1T1XB 3QIUA 2L04A 3JZ7A 5I1DB 3TBYA 1YAZA 5AVSB 4QHLA 1EQWA 1VFUA 3ZKSD 1WT5A 1NFIB 3HS8A 5E6SB 3G08A 4U6YB 3FZUD 4HF5H 4PJ6A 2LFEA 3KZ8A 2FCBA 1CG9B 4FFTA 3SPGA 2FEEL 4I5BB 5BOPA 1H9DA 5CN2A 3D85D 3CSTA 1N2RB 4EKJA 1INEL 4O9HL 1JPTH 4IRJD 2VXTL 4KNUA 3M6DA 4FCAA 1G7MB 1CLCA 1IC7H 3P73A 2ESVD 4MXVF 2PR4L 2YXWA 43CAA 1SY6A 3GBEA 3RDTD 3LN4B 1XMWA 2K78A 4QR7A 3L3OA 4M3JA 3LH9A 2GSGA 2J44A 1LK3H 3EYFB 2X2YA 2DIBA 2Y24A 4AG4L 4ETQB 3MRBB 4HC1L 4EVNA 5F3BA 1OK8A 1QPPA 4J4PA 1J87A 4LCIL 1XF2B 2DTMH 4D8OA 4FXLA 2FBRA 2ZUSA 3FT3B 3NCCB 1QYGH 4Y1AA 3I6GB 3WDHA 1FGNH 2F58L 4KGJA 3GSXB 3X12B 3CXHJ 4TVPE 4AL8C 5TK2A 1NEUA 2F7PA 2XPGB 3FUMA 5EZJA 2ATKB 4ODTH 4IRSC 4PHXA 5EZOH 5CCGE 5K9JH 4E9RA 1UD5A 4A7GF 4M7LT 2DRUA 4JRYE 4P2OB 4NNXB 3WUWB 4CC1A 5CJBA 4L23A 3LKQB 4AKOA 5D1QA 4Y16C 3EJQA 4ZXBB 3ULVF 4S10A 4P4KB 4RMVA 4BZ2H 5BXFB 5JMRA 1WZMA 3SJVD 2TRYA 3ZYIA 1PZUB 5JW5B 1LHZA 1F86A 1FE8H 1HC1A 1GR7A 1A1OB 4X4MA 3X1FA 1V3MA 3RNQA 2WINB 3QRBA 2E0PA 2PW1A 3ECWA 3I3BA 4KH2A 3EXLA 3V6OC 4H1LA 1TLMA 1KBBA 4GMTH 5INCB 3ARDA 3IGAA 4F57L 2ZUQB 3KR3L 1NGWB 5TD4A 3FB6B 1PZAA 4P23D 1XH0A 3BUYA 4UT7L 3DVGA 3HB3B 2YPVL 1ZA3B 2X88A 4PS7A 5FDWA 2QKSA 3UAJA 4N2GA 5C0AA 1ZT1B 3RPBA 2ZKMX 2D3JA 4KO5A 2D3LA 3U48A 1T0NB 3EYQD 5HHNA 3MJ7A 4JY6B 2ZOTA 1BXVA 3CQFA 4WWNA 4XZUB 3PDOB 2NY2C 2I27N 2VNCA 4OLVH 1W0VA 1NMAL 4FLSA 3BVNB 5LGHH 5I6KA 5SWZE 2Z35A 4PJBE 2JXMA 3B9AA 5CLWA 5IIEB 4LSVL 1OF2A 1AE6L 2XWZA 3EBIA 4HK0B 1CFVH 1CCZA 1BQLL 2MQGA 3KYOA 3OC8A 2J21A 3K6DA 4HJGA 3VWJA 4B50A 3O45B 3D2UB 4YUEH 4NCC2 2C9PA 1KEGL 4L37A 4JEGB 1YC7A 1C5CL 1AKJB 4HEMA 4L8BA 3OAYH 4WO4C 1AS7A 1RZKL 2B77A 4H20H 5CLTA 3ULVD 1WTLA 4K15A 1WBYA 1MCKA 2BVPB 4GRLC 4DGIL 1G43A 3FCBA 3CHPA 3MGAA 3CVDA 5L88H 2OXHA 1RLBA 2CDEA 4URTB 4AEHH 2HXAA 5KN5B 4QYOA 4FMKA 4X42A 4KFZC 2AMUA 2Q86A 1KLFB 2R29L 5PAZA 2CALA 3SBWC 3V95A 3HG4A 1TETL 1YUHA 4A66A 2EZ0D 2KHAA 3WEOA 4YPGB 4Z7VA 2JKSA 2H1PL 5HVHC 1Z9SA 4MMZB 1J8RA 5T3XL 4X6FB 4BRVA 3AUVA 2WWMD 4F2EA 4UWQB 3SDCA 1S7TB 1JVKA 3PAUA 5H35A 2FO4A 3K2IA 5DJCA 4KXBA 3S96B 4MJJA 3BWUF 4PV8A 2CHNA 2YAQA 1UGNA 4RLDA 2WOBA 3QZBA 2G2RA 4DVBA 2CBTA 4HF5L 2XWXA 5FA3B 4NQUA 5FWQA 5GRVK 1J5DA 4DZBA 3ULSA 2OMYA 1YMMB 5JXED 6CGTA 1TVBA 2H1XA 2ZTBA 1F1AA 2XIIA 4NI3A 5J12B 3Q2LA 4UNIA 1GKEA 4DP7X 2ZAGA 2NT1A 2I25N 1K3ZA 5EFIB 3ZJAA 1MVUA 3VYNA 3MACH 4UNTA 4AJWA 5L2KE 2V2XB 1SN0A 4YSPA 1XXDC 1IC7L 4AYFB 1CXEA 2D7PA 2PPCA 3MV9A 3VX0A 5HDQH 1SEQH 1LK3L 1U2YA 2DJ4A 2DICA 3GTVA 2V2TB 1MDAA 1UEYA 1U8IB 5DD0L 3QARA 4OZIB 4MDIA 3P4MB 3BWAB 2J1WA 2HVKA 2DTML 1MDTA 1KPVA 2EE6A 1FYHB 2OTUA 3V4VB 1AIFA 3NT0A 4CVXB 3PJLA 3Q05A 4YQXH 2FTAA 4TUKH 4HHGA 1QYGL 2WB1A 2NNRA 2F0CA 1FGNL 2CH8A 1I8KA 1OE3A 1KCUL 2QZQA 4AIEA 5SWZA 5TDNA 3T6QC 4N85A 3F12B 1LE9A 4J6RH 5AALA 3SB3A 3W0WA 1F4XL 5FYKD 1IO4C 4TSAH 3O6FB 1KPUB 2ADGA 4ODTL 4ES8A 1DN0A 1UT2A 5K9JL 3U2IA 4ODXB 3FCSA 1L0YA 3NN8A 3ESMA 2AEWA 2YGVA 3QORB 3U36A 4XN5A 4P5TC 1NOLA 1MVYA 4LLYA 4H13C 3JWNE 3T2PA 5FM4A 4BZ2L 1QLRB 4YHNA 3ZT7A 4Q9RL 4XRCA 5DS2A 5AD0A 4J3UA 3O0RH 2JKNA 4FA6A 3SN6N 3V4PL 3TJHC 4Z7UB 1FE8L 2QDWA 4E9YA 1QBLH 4JFEE 1K5WA 4XX5A 4D9RE 2J6EH 3H55A 3WTYA 4GMTL 3DJRA 5DRZA 2H47C 2XYBA 1GS8A 4G42A 4N5ED 4PD4K 5DJDB 2FRGP 4AE1A 4WI0B 5EOCJ 4XC3H 5HHVH 4KTDL 1HHHB 5AG9A 3VXTA 5DMKB 5LBSA 2CIKA 1AOZA 1NCTA 5DUML 1NMCC 1OAYH 1C1EH 4M6MH 2IFFH 3FTWA 2XWCA 1B9KA 1DLFL 5C6TH 1D2OA 1DEEA 3OGOE 2CLZA 3CDGB 4B9PA 3C8KA 4OLVL 3TESA 4N3UA 1CFMA 1TMQA 4GG6E 5LGHL 5TPWH 3HLAA 1XTLA 1NLBH 4M3HA 1HHKB 4P9HH 4QGYA 3RPKA 4WV1C 5AB0A 3BVVA 3VFRA 1AS6A 1CFVL 2JJTC 5AOIA 2IPKA 4B5ZA 3L2MA 4ECNA 5L8LB 2ICWA 1K8IA 1TO5A 1MCIA 1I8MB 3FDWA 5IBLC 2UZPA 4Z8FL 3L3IB 5H4YA 4YUEL 1W91A 1FC2D 2XWEA 1FQ9C 1LILA 4XBGB 1TR7A 1S9KC 1MKFA 1O75A 4KQ3H 3WI9A 3K3QA 4H20L 1CN4A