2BINA

Human p53 core domain mutant m133l-h168r-v203a-n239y-n268d
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
195
structure length
183
Chain Sequence
VPSQKTYQGSYGFRLGFLHSSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQEVVRRCPHHERSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of P53 Cancer Mutants and Mechanism of Rescue by Second-Site Suppressor Mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 42
structure length 183
sequence length 195
ec nomenclature
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2binA00
4LOEA 2PCXA 4IBVA 3D07A 2VUKA 4AGLA 4KVPA 3WTXA 1TUPA 3QYMA 2BIMA 3WTVA 3D08A 3D09A 4IBSA 3Q06A 2P52A 1CMOA 4G82A 1EANA 4G83A 4AGOA 4L18A 2WGXA 2GEQA 3WU1A 3WTYA 4L0ZA 3VD1A 3KZ8A 2BIQA 4LOFA 4IBWA 5AOJA 1HJCA 4IBZA 4IJTA 4GUOA 4AGNA 4AGMA 2X0VA 4HJEA 1YCSA 1TSRA 2FEJA 2AHIA 5A7BA 5AOIA 2BIPA 5BUAA 4QO1B 5AOKA 3QYNA 3KMDA 3VD0A 2XWRA 4IBUA 1EAQA 3IGKA 4XR8C 2RMNA 3EXLA 2IOOA 3Q01A 4MZIA 2IOIA 5G4OA 3WTSA 3Q05A 2J1ZA 1CO1A 5G4MA 5AB9A 3D0AA 5AOMA 2J21A 4GUQA 2OCJA 1LJMA 3WTUA 5LAPA 1GZHC 2BINA 1UOLA 2X0UA 3D05A 2J1WA 4IBYA 2AC0A 4MZRA 3WTTA 3D06A 3ZMEA 3US1A 1E50A 5G4NA 1KZYA 1H9DA 5LGYA 3EXJA 4LO9A 1IO4C 2XWCA 3VD2A 2J1YA 4AGQA 5ABAA 3IGLA 2H1LM 1T4WA 4AGPA 2IOMA 2J1XA 1HU8A 5ECGA 4L0YA 3US0A 5KBDA 3WTWA 2MEJB 2YBGA 1GZHA 4IBTA 2J6WA 2J20A 4A63A 2ATAA 2BIOA 1EAOA 2ADYA 2X0WA 3TS8A 1HJBC 4IBQA 5AOLA
chains in the Genus database with same CATH superfamily
4ZBJA 1A3LL 3TT1L 3NSJA 4D0BB 5JDSB 2ZWSA 2FBJH 4N2EA 5DMGC 3SE6A 3L95A 1V3LA 2ZQKA 3FQYA 4NQDA 3TA3C 2ZKXA 5DS8A 1BAWA 1LE5B 1J86A 1E4XI 3I6GB 3ILDA 3OZKA 1MVUA 5DLMH 5T1MA 5KSAD 2EECA 4ZFOB 1PQZA 5L7XL 5IOKA 1FYTD 3FAWA 4JFEE 1EWHA 3FSVA 2NW2B 2X89D 4F37K 3TPKA 4N6RB 3EJZC 2J4WL 3ARGB 4AQ8C 1BXVA 1CFBA 2A6DB 4NQVB 1E5CA 4FLRA 1LGVA 4M00A 4NQCE 1XF2B 3BVWA 3BJLA 3RZWA 2MHAA 1PX4A 1MRFH 2WNXA 4OF8A 3ALXA 4QHLA 1CFVL 1UJ3B 2XTJC 1YAZA 4XVJL 1I8KA 4XBPA 1KY7A 3UX9B 1V5JA 3KW8A 1T04B 2OMXA 5HI3C 4WJ5A 5TE4L 1SXCA 1WIPA 4OUUA 4AZUA 4J6RL 3EJQA 4G80A 4EXPX 3HEIB 3WN5B 5L9DH 2H7WA 3F6IA 3WFBL 4K9EL 2C1OB 3PDGA 4WO4C 1DCLA 5C0BA 3FQNA 3Q01A 1A1NB 4RSVA 1G7MA 3UTTE 3RDTA 3B2VH 2FO1A 1BVLA 2VERN 3V4UH 5CWSA 3KJ4B 2LU3A 1LVEA 3BZ5A 3HBQA 4MMXA 4WI7A 3KLAB 3UAEA 1BA9A 4FFZA 4CSPA 5IWLA 3P3RA 1ROCA 4HWNA 4F2MB 2OCCB 3CK0L 2VMJA 4XT1C 3WTUA 4TL4A 4B41A 5CP7A 3FPYA 4CVXB 4KNTA 3TEZA 1PKQB 4TTGA 3HMXL 2WW8A 2PR4L 4I3RL 4APXA 2FH6A 3OAUL 3WN6A 3US1A 4N8CH 1S7TB 2UWEF 2WZ5A 2JCCE 5FGBA 3HPLA 4PJFB 2JKIS 3KJ6L 4BINA 2IQAA 5T1JA 4X7FC 1OGTA 1IFRA 1A4BA 3DJ9A 2J57A 2QPDB 3WL9A 1XEUA 2GY7B 1MFCH 4MGXA 4L23A 1KJ2A 3UTSB 2EEFA 2VXTL 3GKZA 4YMPA 3OZ9L 2WKOA 4BZ1L 4CVXA 2AF2A 3AG1B 3RL2B 4WHTB 3A67L 1KPUB 2VR4A 4MA1B 3ZTDC 3M8OH 2VL5A 1AE6L 1H3XA 3POCA 3K1DA 5ELIA 2FWOB 3QDMA 4H8WH 2BMKB 5A7EA 5AYQA 2WJ5A 1HCZA 4GRWE 4JQVC 5H4YA 4RZCA 3V5KA 4Z7UE 3QQ9D 1N0XL 1MN4A 1G5AA 4KY1H 1CFNB 2F2HA 1XH3B 2BVQB 1GW6A 1WD8A 3NABL 5KW9H 1SN0A 3QYMA 1FVCB 4KHTH 5MP6H 1ONQA 2CO1A 2R0WH 3U7WL 4TKWA 4WNJA 1GGBH 3O3DA 5DZAA 1IILE 1RPQA 3KGTA 4NNXB 4OV6F 3FOMA 1F1DA 2JCCB 4HBCL 3RFZB 2YPVH 3IJHB 5B1CA 5FA3A 2QGDA 5GSRA 1R5VA 1MAML 1TF4A 3IS0X 1FIGH 2G5BB 3Q5TA 1JV2B 1RZKL 2FJFA 5SWSB 1SJEB 4H44C 5CJ8A 3RVXD 1G6VK 2GQHA 3B9KB 4GKZA 5K9QI 2XKNA 5I30L 4RA0C 2BS9A 4HHAA 5D1XC 4WI0B 3UPRA 5ESQA 4BFFA 1RSYA 3HG1A 1SFDA 3VI3A 2X6AA 4HPYH 2CKBA 3LZLA 3FC8A 3MRGB 4BZ2L 1QBMH 5FIEA 4YAQA 1FPTL 1KYDA 5D55A 5BXFB 4WHYG 1G6RB 3HHSA 2Y3NA 3C5JA 1MI5B 3ILPB 4F7CB 5EUOA 5GJSH 5EPMA 4JG9A 1WA1X 5AALA 3SKNB 3LPWA 2HKAA 3FB7A 1MJ8H 1XMEB 4WW2A 3QCUH 2EO7A 2QVFB 5B39G 3TNNA 5DSCB 3TIDB 3IU3A 5F8RC 2GJZB 2JB5H 1ZJAA 3TPUA 4AIZB 4ZMPA 1Z5HA 4JKLA 3NSFA 4H5SB 1LP9A 1EHNA 2YQ2A 3ARGD 4A6YH 3GBMH 1CFMA 4LMQI 5HGGS 3ISWA 5SWSE 1N3NB 5K39B 4AH2A 2HUHA 1OHZA 1RUKH 1UB5B 4XXCA 4H8UA 2EAEA 5CU9A 3RGVA 3VM7A 5I75C 1N4XH 4N0YH 1ZAGA 2QPFA 2DJMA 3LD8C 1EK3A 5CCKL 5E56A 2VQ4A 3WNOA 4G8EA 1T89C 2WVVA 1PSKH 3BGMB 2DF3A 4PP1D 4U1IA 1BQLH 3PGCA 1S7UB 5FB8B 3DXAB 5K9JH 5DMYA 2IANA 5BZXA 3ZO0A 2NY0B 1U8KB 4L4TB 4POZD 1NCBL 3PNWB 1Z5YD 4H26A 4WEUD 5T3XH 1H5BA 3NCEB 4GBXA 4P4KC 5D7KE 2XKSA 5EU7E 4YPGA 5CR8A 2DH2A 4OJFH 2YSTA 1XZWA 1F8TL 25C8L 5HDWA 2OMTB 4KKNA 5EU6D 3GS4A 2F54B 2CXKA 2EC9U 4YNYB 4TLSA 1EVTC 4Z78A 1WHOA 3IN2A 2IPKA 3BGMA 3ILQC 3NA9H 2AW2A 1UB5A 3D12B 4PB9H 5FWQA 1SEBA 5JTWA 2LTQB 5AKSA 4CBZA 1J48A 5EOQH 1DBAH 5D4QA 4YJZL 3LZFL 3WHXB 3BUDA 1CWVA 2P43B 3AADB 4LB8A 4U31A 1DQDL 4M7KH 1U8IB 3C5ZC 4HEPA 3O3UN 4DW2H 4LRNL 3DC0A 4MD0A 4L0ZA 4ERSH 4ODHH 2H3NA 4CDGC 3WKQA 2AK4A 1IQWH 4HU8A 3F12B 4NM8L 2BHFA 4ODSH 2JB6B 2H6PA 3C6LA 1M7IA 3ZU8A 3FRPG 4YHZH 3SKOA 5C0DB 3FFCE 1YEWA 3PDDA 3VMNA 5FOJA 1DDTA 4XVJH 2C4XA 3BO8A 1FG9C 2LABA 5LAXA 4Z76B 1AMXA 4UAOB 3E8VA 4AENA 2QQLH 3BPCA 4KUCF 3TIEA 1S5IH 1LEGB 5LXGH 4AC4A 4D9RE 2MH4A 1M9SA 4AW4A 5CCGE 1GZPA 1DSFH 2WLLB 3AJ7A 3HZYA 3UO8B 2V2TB 3KLQA 5F3BB 5E9DD 1BG9A 4OM1L 1PFCA 4BCZA 4WW2C 2YAHA 4FNSA 4MMZA 5H94B 4OZHF 5C8JA 2V2XA 3CDGB 2BNQB 2KZBA 3QFJA 8CGTA 1IGTA 4XPBL 2HH0H 3D4GA 1P0SE 1CT8A 5IVXE 4ZK8A 3OV6A 3AVEA 3MU3A 4AK1A 3LXUX 3RWEB 4GG8B 2X4QA 1WLHA 3ML8A 3EO1B 1FZMA 3C8DA 4NBXB 5A40E 1IV8A 4WWPA 3MGOB 5C7ZA 5H2BA 1J0HA 4NERA 5KYXB 2ZAHA 4UT9H 3WJLC 3EJRA 4PIBA 5CLXA 4YDVB 2Z1PA 3P4NB 4PUBL 1P4LA 3BD5A 4XX1E 4NQXA 4PRHE 3RHWF 3W11C 3PWJA 4WJ5B 1CD0A 4KX9A 1DVFC 3MGTB 5FUZH 2BSCA 1ZHBA 2ZXDA 2QZQA 3JVFC 3QJQB 2R1YB 3EOTL 3IGLA 5A1AA 2ORBH 4M8QA 2VZTA 2CLZB 1ORSB 5HBBA 3FYEB 2V5YA 4LIQL 5J6HB 3CD4A 2ZCKL 5HYJA 4M93C 3CDFA 3NRQA 2XZCH 2ZOOA 5LXVA 4L0YA 2J8UA 2NCEA 1CGTA 2WM0A 4PJCB 2F74B 1ZA3A 2XQYK 1O9ZA 3QQNA 5DS1A 3HE7A 5BVJA 5AOZA 2QKSA 1X5ZA 1MWOA 2EE2A 2FX9L 2Z93A 1D5XB 3KWXA 5L2KA 4L29A 1F11A 3NEOA 3T0WA 2B59B 3O4LD 5I1LA 3QEQA 4LFHD 2HPTA 1KC5L 1M7DA 5E6UB 3WFHA 4FQXD 4TQPA 4EDWH 3HE6C 1QOKA 1BQKA 3VI4F 1KUMA 4G1EA 1M6OB 4G7YL 3SDXF 1NPJA 4QKXB 2W65A 2DQUL 2NY2D 3NABH 4ZUVB 3APNA 5AYUL 4FKKA 4GT7A 3RIAK 4AGOA 4FTVD 3M88A 4L37A 1U8OA 2NLJB 4X7TB 3BH9A 4X6DB 1WCQA 1EFXD 3QP3A 4ZZKA 1A7QL 3OQRA 4TF4A 4FADA 3VD1A 4Y2DC 3WKMH 4FYSA 5AQ0A 5LBSA 1QNZL 1V27A 3PWVB 4YEFA 3AZUA 3L17A 1MOEA 1LYQA 5JR1L 3RU8L 1FFNB 1WIUA 1CR9H 4HJEA 3NSCA 3LKOA 1OCRB 4LVHB 1Z9SB 1ZPUA 2OLDA 2R51A 3BXNA 4MCZA 4OCXL 3APCA 2DQIL 3AGVA 4X6EB 2V3FA 3GJFH 3QEHB 4G6FB 4QKTA 1QI3A 3ZYIA 1CDIA 1AY1H 4C56E 1YYLH 3MO1B 3CZEA 2FNBA 1S7XA 4LOUD 3UBXA 4HIHB 2VAAA 3RURA 5I1GH 2YPLD 1T7YA 4OLWH 4L1LA 15C8L 1L7TH 3WI9A 4DGIL 3FT9A 3GIZL 4YHML 2CMRH 3FTXA 4BKTC 5DJDB 3JWNG 4NQEB 1TJGH 1ZEAL 3ZKSD 3D0LB 4W4OC 3U0TA 1NCDH 1DJIA 2CJ3A 5AVRB 1AHWB 3FUFA 1D5IL 3SZ6A 3GIVA 2WYZA 3NCYP 5L8LB 3SGDI 1JMXA 1RU9L 3BP7A 1LQBC 4HZLB 1R3HA 1U9KA 5T1MB 5SX4H 3CSYB 1L7IH 7TAAA 1ZA6A 5T3ZH 3CLFL 4E68A 2A9NH 2APBA 3K6IA 4ZTOH 4G6FD 1J18A 3ZYZA 4JKPH 4LHUA 4P99A 1PIGA 1RUKL 4IOFD 4A37A 1DBML 2CO4A 3N1QC 4PWFA 4NN7C 5D1QB 1SYVA 1SQMA 4O58H 1PS3A 5D7HA 4I2XA 5C0CA 2NSQA 4TSAH 4YXLL 1ZGLA 4LASL 4NUJA 1NCUA 2Z34A 1KGCE 2Q87A 3B6SA 5KVFL 3MYJA 3RX7A 4X0NA 2WXLA 3K5SA 4NC1C 1IEAB 1JCKA 4N2GA 5TQ0L 2E0PA 1VEOA 5C0BB 2OX5A 4NKMB 3BDYH 1N5YL 3HS8A 1AXTH 3I84A 2JXMB 4WW1A 4RMWA 3C87A 1UKTA 4X4ZA 1TXKA 1M53A 1G7JB 3MNDA 1E4XL 2BRRH 1JWUA 4GAFB 2PW2A 4MB3A 4HS8H 5FGCE 3ZHKA 2Y5TB 4EI6B 1NDMB 3UZEC 1OF0A 2X4OA 2OXHA 4KRNA 4WW2F 1ZK5A 4IRZH 3ZKXC 2AQ3A 4JFHE 4P5TD 4JN2A 4LEXH 3QWOB 2X1PA 1QUPA 4EIUA 1IAIH 1G7LA 5I0WA 1PAZA 1QMUA 4FHBD 4FL4B 4FNQA 1IM9B 1GTFA 3BAWA 4Y5XC 5B39B 4KK5C 2XTSA 1S6NA 3FO9B 1N8ZB 5LGJA 1HQRA 3VSQA 4EEEA 3GJEA 4GQRA 4V11A 4WIQA 4HWBH 4X2UA 2ZUYA 4L8DA 3IVKA 4GUCA 3GDBA 3PJSA 1YUKB 5DURB 4CUCA 3DOSA 5GS0L 2KYIA 1HXMB 2HJFA 2FYVA 3QDMB 1XGUA 3ZQ9A 5FOBB 5GS1C 4O4YL 2FX7H 5BJTB 1ORQB 3L3DA 5IM7B 3SE9L 1UGNA 4OZGE 5CO1A 4N8VB 5B8CB 4H20H 1HKLH 4RMRA 2ED7A 3DWTA 1RJCA 2GIYA 1DVSA 4KXZI 4OZHA 5E8DL 2ENJA 2GT9B 3C5ZB 4W68A 2B2XH 2FT6A 2ZUQB 2FVNA 1AI1L 5FO8A 3CN1A 1UA7A 3VD7A 2NY7H 1NMAH 3C60A 1N70A 3VSVA 3TU6A 2O5ZL 4WFFD 2GI0A 3GSQB 3PAVA 3IMVA 2KT6A 3FQUA 1MXGA 1X4XA 4NT6A 4EIGB 1LXMA 1URLA 1MCOL 2OJZH 1ZJBA 2FJFB 2Y1VA 4HCIA 3STLA 3S36X 2FAUA 2YD3A 1OSYA 2FUQA 1SOKA 3H9ZA 3KG5A 4CN1A 5KYWA 1P7KA 4ZUTB 1FVEB 1GC1L 4GXFA 3ZDZB 3ESNA 1Z1WA 3WEOA 2P8LA 1E4WL 1B4RA 4OCRL 1V7MH 4I0CC 4AG4H 1J8RA 5K1JA 3HZYB 2DWDA 2JMRA 4AI7A 1B0IA 1T4KA 3IDXL 2IANB 1T1ZA 5H94A 5C8JB 1JNLH 2O61A 1BZEA 3DNKA 4O00A 2YPVA 1CE1H 3FTGA 5ILTL 2YD5A 2EYTB 2D03H 1PY0A 3JVGA 5BRZE 2NSXA 2A0LC 3I50L 4MXQC 1I4FA 2OYMA 3TBTB 1UYWL 2YJQA 3N04A 4KO7A 2J71A 3H6JA 4DK6A 1ERNA 4ZQTA 5DUPL 3UO1H 4R8WL 1I3VA 3UJJL 4PREB 3ZE0F 3LIUA 4HOMA 1SEQH 3SDXA 2AJXH 5IJCC 4ZUWB 1R3KA 5EFIA 3T0EC 4AUYA 4G7SB 1MZYA 2P28B 1HILA 3F6LA 1CGXA 4HCFA 1BVNT 4GW5B 3OPZL 2DIAA 4JREB 2CBOA 3HR6A 3ESMA 3HN3A 1DQIA 3ZL4H 4GY4A 4UIKL 1OM9A 1M7DB 4O9HH 3L3OB 2CLRA 1DQQA 4GG6A 5LBGA 2UZPA 3EHBB 3ARWA 3LN4A 1SVBA 1WWWX 3TJHD 3HE7B 4UANA 3KPMB 4YL9A 3WFEH 1C16A 1CFSA 3P2TA 3P3SA 3S3PA 1A1OB 3QO1A 4HFWB 3G5ZB 1PG7L 3FU7A 1EERB 4LSUH 4NZUH 5FYKD 5DK2B 4LBAA 4LCCA 1ZLVH 3P3TA 5DWPA 4NDMB 4KZEH 4UT7H 1L9RA 1NCDL 1I8KB 2DMBA 4XBPB 4LKCA 5JA9A 1IU1A 3TV8A 2R0ZH 3NH7H 3K2KA 4A55A 4M5ZL 1UOWA 1AGDB 2WBWB 3HZMB 1WK0A 1UOVA 3LPOA 3LKOB 4XNYL 2G2NA 4PJDE 4M56A 1ZVSB 3JSSA 4M5YH 1TYEB 3EFDH 3DX4A 3ZDYB 3NJGA 3L3HB 3VXRE 4WUKL 5E6RB 4MJJA 1QSEA 2VN4A 4OUOA 3S2AA 1VIWA 2GG1A 2PCFA 1U4EA 3UOAB 4YGVA 3F5WA 2OYKA 2IAMA 5ESVA 4M48H 1J9RA 3UCQA 1XF4A 3BP6A 1QZ1A 4YHYB 5SWQB 3VXTA 3WTWA 1DBMH 1PLGH 4K3HA 1S7SA 4OSUH 4MD4B 5IK3B 5E4EC 1OD7A 2J6WA 4KV5E 3ARFD 1BD2B 4K5NA 1A8JH 3HCVB 4OZIB 5ITFA 2P5WB 2VZUA 4FFZH 4Z7UF 1KIQB 3CVHH 3CXFA 4NAQA 5KVFH 4MDRA 5C0GB 1LNUB 4HD5A 1P4IH 1DFBL 1JGLH 5IMLA 4KVPA 3X13B 3VDAA 4GEIA 3SDDC 4RWHA 4XN4A 1F4WL 1CDCA 2H3KA 3JVGC 5E2TH 3HC0B 5D7SL 3P4MB 1AGFB 3BDYL 4ODXA 3Q06A 4F2EA 5ERWA 1HYRC 5E8NB 1CE6B 1QEWB 3NJXA 1XGYL 3F7VB 3AXLB 1JUFB 1G9ML 4ZFQA 3TO2A 5I6KA 5DA0B 3ZE2E 3ME0A 1P1ZB 1VDGA 4JFPB 4J28A 1DL7H 4U6HB 4U6XA 4ZFFA 4HUVA 3V0GA 1UEMA 1NOAA 2X70B 4AMKL 3EH1A 5I1CH 2W60A 5HYJE 1IRAY 4L8BA 1X6NA 2XN0A 5D1XB 1DUYA 3PP3H 4DKTA 2AKRB 2QQQA 3FO2B 4GW4A 1TJMA 3W11D 4IRZL 5IQOA 1E40A 3CVCA 4XP4L 4QMEA 1P5VA 4ISVB 2AJ3A 4TLUA 1FAIH 1GYWA 3QUYA 2APXA 5CLTA 3IT8D 3GBEA 5FO7A 1BVLB 5E2UL 4H8HA 4YDLC 5FYLH 4YLCA 1M2VB 2HFEA 5FF6B 2V6HA 3KYAA 1OARH 1C9SA 4JM4H 4LCIH 4WO4A 1S9KC 3NZUA 2C1OA 5IWLC 2GK2A 1M56B 3W57A 4LOVA 3EH3B 5GS0H 4EAEA 5C0FB 4W9DC 5DVKA 5FW6A 4PAZA 2C9QA 1BXAA 3AQYA 4RZCB 3EDEA 1V10A 1FGNL 3IWVA 1A6TA 1UT9A 2IQ9L 3GMNB 3MACL 2JELH 3VH8B 5F9DC 1XR9A 4L2LA 3ZE2B 5D2NB 4HWEH 4FI7A 1L5GB 4ZS6D 1FGVH 3T4YA 5DJXB 2NW3A 1I7RB 4NKDB 3V55A 1VZHA 3WO4C 4PJIF 4JGNA 3UBXI 1QFWL 2YD2A 5E8DH 1E9PA 4GKSB 2XV3A 4XP9H 3VXRD 4CL7A 3X1BA 3QUMB 5D6DC 4AQEA 2L7JA 4ZFOA 1NMAL 3CFCL 1I9IH 3CQPA 1TTRA 1AO7E 5HD8C 3HAEG 4LLQB 1PEZA 2YOAA 3OR7B 3AWGA 1D7CA 2DLFH 2UY6A 1KT2B 4I18C 5EIIG 5EWIH 2HLFD 5GJTH 5CU5A 5F6IC 3G04A 2JJVA 4XNUH 4GAYA 1KV3A 3AS1A 4TUOA 2WCPA 3QI9A 1Y18A 1I85A 2RR3A 3QK0A 4I5BB 3IAPA 3ARTA 3DBSA 1SHXA 3EYFA 1QFWI 4P5TB 5D1QA 1FH5L 3UTQB 3LS4L 5C09D 4HWZA 2WLNA 3U9UA 1MCIA 2ATPA 2E7DA 2P42B 3H3PL 3MRQA 1CGSH 3FH5A 3MDJA 4JQXA 5E1QA 3HVDA 1WWAX 2BK8A 3ZGIA 3OMAB 1DJSA 3AREC 2I7SA 1RIVH 2OMWA 4Q9BA 3FQNB 3HIZA 3AABA 4LQFL 3WS6A 2OA9A 4U1SB 1A4JA 5GZOA 2DLEA 2N3JA 4P2CG 2C9RA 5CSZB 4AOFA 2NX5E 4Z7QF 3D50A 3D39D 2VLKE 4GKNB 1CL7I 1RZJH 4FXGC 1JK9B 3L3GB 3IMRA 4P2AA 4U6VL 5DJZB 4XNQA 1KFAH 1S7WB 3JWOL 4JFED 4P2RA 1RURH 1MF2H 4QRRD 1CBVH 3CXHJ 4PJ8B 4ZMWA 1NC2B 4X4XB 5I5JA 1NC4A 4HBQA 4MJ2A 4BGDA 5K9KA 3K7UA 3JXAA 2A6IA 5D70H 5J12B 1EAPA 4OT1L 1EHXA 1Q72H 2O26U 3PWLA 4WSJA 4KTEH 5KYWB 3KL3A 4PSRA 1YLBB 3NTCL 4GRWH 3ARDA 3GJFA 4NC1E 2X28A 4Z7AA 1BZ8A 1K5NA 5JPMC 2VWEC 4P46C 3V4PL 2DAVA 3U4KA 5JQHC 3N55A 1E42A 2GJ6D 4OH2A 5IHWA 3EZ8A 1T2JA 4EDXA 4F7MB 2X1WL 3GMMA 2J1KA 3QPQC 4Z9KB 3ZE1E 4HGWA 4CVZA 4BSJA 3TOPA 1V8HA 4Z95H 2GT9A 3DTDA 4FMKA 2IADB 1IE4A 1JGDA 5FHBL 5MERA 4U1KA 1D7FA 4XCFL 1U6AL 2R1WA 3RB7A 1H6TA 1XAUA 2VDOB 3GD1C 5IM7A 3DROB 1INEH 2CJUL 4L4JA 4PR5A 4FA6A 1U8PA 5J11C 1XGTA 3FB7B 1OK8A 3KXFB 5HYSB 1HESA 1CJYA 4Y7MA 4LSDA 2JTDA 3LH8A 3ARED 3DBXB 3BKCL 3GSVB 5CJ5A 1PG7X 1BFVH 4NM4H 5CKAA 2CLVB 4EUPA 5EU5B 4ZI8A 4FG6C 2B15A 2KMWA 3MUGA 3MX0A 5HPOA 5H37A 4N9OB 5AL8A 3KPRD 4FZEH 3PHOB 1SYSA 3LKRB 2K6YA 3T04D 5GGQH 1QSVA 2HFGL 1G9EA 2FDBP 2FEDD 4OFKA 5D8JH 3TJEH 1DQLH 2NY6C 4OSUL 5T1LB 4B3EA 3AMLA 2AEQL 3AU0A 3VO0A 4Z3HA 3D07A 4NO0D 3BT2L 2MOGA 4DKEH 3H2WA 1ACXA 3ARYA 4MS8D 3FHEA 5HD8D 3RI5K 3EH4B 1H3GA 3PAYA 2IPUG 2VDML 1HI6A 1QFPA 3OHXC 3Q13A 3VXMB 3I2CL 2E9GA 2VIRA 2VABB 1IGIL 2E4TA 1LK2A 2H0EA 3DV4B 4JR9H 3N43B 1HQ4B 1G7HB 4LRIC 5LB1A 2YO3A 5T5FA 3WTYA 5JYMA 2H32B 4DUXA 5JZ7C 5KJ7E 4XBGB 3H54A 2CO6A 5BRZD 1QW8A 3DYOA 2X4PB 2RHEA 1NCIA 2WWNA 4B0MM 3MV7B 3WENA 3NK4A 4ADGA 1GSKA 4OGYH 4F93B 1THCA 4UIMB 5JR1H 4L9LC 5EO0B 2PPCA 3B37A 4XMZA 3BFWA 2XWBA 2V9RA 4ODBD 3QHZH 2DDQH 4QHKI 2BVPA 4WFGD 2HLAA 4LCYA 4JAMA 2HG5A 3QR0A 1UZ6E 4CAGA 2FZ3A 3M17A 5LDSA 4KK9D 4HAFA 5D6DA 4JFQA 4Y19E 1EHAA 1MHPL 5CN2A 3G6AB 3WTSA 3L3JA 4F9PC 2NNXA 1PL3A 5F7NC 3VGAB 1E0OB 4KOCA 4BRVA 2J25A 2ZT9C 1QD0A 4Y4KB 1EZVY 5FYLL 4CILA 4DNLA 2A73A 1FC2D 1QP1A 1A14H 4MXQD 3DUUA 1M3IA 4BH8B 2XZAL 4P2QE 3D05A 4JCLA 4HSCX 1FI8C 2EXSA 4G7RB 4HC1L 3V0HA 2VQ1A 4NN7B 5D1QC 2DYSB 4MBOA 2PP8A 3ECQA 4U1IB 1Z9LA 4LSQL 1ACYH 2YZ8A 1PD1A 4Q56A 2RCSH 3ZK0A 4F7EB 1JZ2A 1LO5A 2XWCA 4NNYA 3QULB 3ABMB 4PGCA 2VLRA 3QG6A 1AGCA 1W8EA 3C8KB 4K8RD 4LKCB 4ONFH 4MNGE 4LGPB 3DI3B 4XP9L 4EF3A 4LF3B 1A9BB 1JGVL 1RKRA 1WCBB 2JKNA 1RCYA 3AUWB 4QRUB 4HJ0D 3TBSA 4U1GB 4RSYA 3R1GH 2F53B 1KCSL 3V9CA 1EGJH 4XPAH 3PWPA 1ETB1 4PJAA 3Q3GB 1TQCC 3U30C 3B9EA 3WGUB 1T4KB 1ZT1B 1A0QH 2CGZA 1M1XB 5D7JC 3B4NA 3GNMH 1RP8A 2QADC 4M1CC 1NIBA 1V7NL 2ZYIA 1HNGA 1KXTB 4TQEL 5F9JA 5DYOA 1DLFL 3QIUA 2X2UA 3QEQB 3QJUB 3LS4H 1GR7A 2DYPD 2CJSA 1KELL 3HE6A 4HIIB 2DQDH 4IKIA 5IFAH 1N68A 1RV6X 5IVZA 1IC5H 3NAAL 1NCWH 2AJSL 3KPSA 4LRIA 4QY8B 3FAXA 1ULVA 3QUMA 4NO3A 3UJTH 3JWDH 3PHQA 3ZXAC 1T0MA 1L0PA 2KH2B 2LFGA 1K6QL 2IDFA 1U8QA 1YEKL 3FYIB 3WFCL 1AC6A 1IBYA 3BP5A 4WWOA 5C0AE 5T3ZE 1MRDL 5IY5B 1RAMA 1I7RA 3ECWA 3QIUB 1KB5B 3CG8A 2FGZA 3LH2L 3MCG1 2AABH 1SQ2N 3BGFC 3BP7B 3BVNA 1UVQA 4XO9A 1RVFL 3ILQD 1U91B 1KTDB 2R2BA 5BZWB 2HT2D 5C08E 2BHUA 4R2GC 4Z7WE 4JFOB 1IC1A 4R97B 3DXAD 4KK5D 1MF2L 2MWCA 4MCNA 2ZONA 4GRLD 4LCWA 1CFQB 4NZFA 3RB5A 1UUNA 4XAKD 5FFGA 1FFRA 3K72A 3KM2A 5DJDA 1CLZL 3LN9A 1XSJA 2V9UA 1IAKB 2YPKA 3FZUC 3DOIA 3C5XA 5T3XE 2FWUA 3CFBB 4FFWC 3MLSL 1FVCA 2G5RA 4OVUA 5I1IH 2ZX8A 2PYED 4KTEL 4I0PB 1WZ1H 3MCLH 3QCVH 1NCNA 4NBYB 5DVPA 1QQDB 2J21A 1WS7A 5C0JB 3BSZH 2AJZB 3HZMA 2ZX9A 2ZNWA 4KK8D 4JREC 4R5XA 3GTVA 3K72B 1A4CA 2OQJA 5DQDL 3TZVA 4HEME 2CO7B 5KZCB 4K3GA 2AMUA 2GHZA 4HH8A 4JRXB 4K3EL 1RUAL 1GGIH 3DO4A 3M1BB 4JFOA 3JYCA 2DWTA 2VDNB 2JE8A 4K7PH 3QAZB 4QJ3B 3VI4B 4CADB 4LEEA 1HAUA 4AQ1C 2VTFA 1J10A 1KJ2B 3UTSA 4AQAB 2FD6L 1IFHL 3DVGA 4P2RE 4IGBB 4BFJA 4LNRB 4C56B 3ZJAA 3PE9A 2QQNL 1PZSA 1CXLA 3NOIA 4N0UA 1H0DA 1A6VL 5GQBA 1XX9C 4H88H 1PF3A 5C2BL 4E9XA 3H7LA 4MMYB 1CGWA 4GSUA 5DDHB 4AVKA 4M4PA 3IWUA 1WIOA 2JIXD 3H3KA 4HK0A 1HHJA 4RQQA 1CGVA 3W81A 3WKPA 4EDXB 4MKMA 2HJKA 2OULB 4LLWB 1JHKH 3IFOA 1TUPA 4A2MA 1L9NA 3QA3A 3K8LA 2WB1A 2NSMA 4NEHB 2BSTA 2IH3B 3KBEA 1NCCL 2V5TA 1RHFA 1F5WA 2DMHA 1S5HA 3OKEA 4D94A 5GHWH 4MA7L 1V3JA 5JLZB 5JQIB 43C9B 4L3EA 4UTAA 1AZCA 3KPNA 3E8UH 1XB6A 1R47A 3UTZB 1FZKA 1XBRA 4WUUA 1KJ3H 1LEIA 2VL4A 2R9HC 1MHCB 1OQXA 1RIHH 5I66B 4L1DA 2B4CL 1MJ7H 1G1CA 3IJ7A 3GZPA 5IROC 4RWYL 3WDHA 3GRBA 5EU4A 4JS7A 5EC1B 1J5OL 5KS9E 3MRFA 1RK1A 1GXEA 1ZVYA 3UG3A 4BUQA 2F7RA 5PAZA 4K5MA 4QRBA 1ZHKA 3FMGH 4LT7A 4J6RH 1NANH 4UT6H 4FQ2L 5CEZE 3HS9A 4MA3A 2R4SH 4QLRA 3WD5H 5HHXL 5IF0A 4TULH 3FRPA 4DGYH 3KPQA 3WELA 2J6EA 5EF1A 3CFIC 4OI9A 2G9HA 4MAUL 2OYPA 2HN7A 3E1F1 2IWEA 1TTBA 2F19H 5DJCA 5EUKB 4R26H 1H6EA 4TLKA 2WZ0A 1MIEL 3CIQA 4P5TC 3U1QA 4ZXBD 1OY3B 2IADA 5MERB 2LU7A 1GGCH 1JZ6A 4HP5A 3EKCA 1XMWA 1ZPLA 4Y4FC 4AT6A 4Z18A 1A2YB 1N6QL 1RULL 4YDJB 3SYPA 5TF0A 4DIXA 3KM1A 1MELA 2ZAGA 5IOPB 4HWBA 4XO5A 4U1HB 4PJGE 2GTQA 3VXUA 2CRIA 4XMXA 2AJVH 1ADWA 3V0FA 2H1LM 3CH1A 2ITEA 4XBGA 4MQTB 4FEIA 2XVKA 1HFUA 3RILA 1M71B 3ZRSA 3MODH 1XCTA 1SHMA 1A7OH 4PV8A 5KOMC 2DB8A 3VXPA 3BUPA 1TLKA 2ODHA 3RNKA 2JJUA 2F54A 1FNEB 3ELAT 4TSBH 3O4OC 3KPLA 4XAKE 4ZW8A 2GITA 3MR9B 3RX5A 3WBDA 5EF2A 3R1GL 4QOKB 3R8BB 1USZA 3CZJA 3O6FA 1EO5A 2YD7A 1PAMA 3SPVB 5F70A 2I9LB 4P2OC 4F7PB 2DLHA 2NY3D 2FO8A 3OGCA 4Z8FL 3LMJL 5F7MC 3U36A 4PJAF 4Q9RH 2CBMA 5FV2A 4GKOA 2HKFH 2YUVA 4JBSA 4X0KB 5KSBA 1LO3L 2EIZB 4AYID 1ET7A 2PW1A 5CCHE 2EDEA 4S2SA 5KSAB 2CHWA 1MW3A 1G7LB 4Z0XB 2P80A 2KBGA 3U6XS 2C34A 1PJWA 3OLGA 4OIIL 1Z5LA 1I7TB 1WFJA 1F3JB 4TLTA 1FLTX 4ZMXA 3EJZD 2IALA 1C08B 5CJQL 2EDYA 3ECVA 3TH2T 3FDWA 5KUKA 5FFOA 4HLJA 5HI5C 4PWEA 3GYRA 2CDGB 4J27A 5BNXD 4HV8B 3ZR5A 3QEGL 4B9IA 1JVKA 2ZXCA 2ZSWB 1R5IB 4Y9GA 3DKHA 1YNLL 3NIDF 5KBLA 1IBGH 4Y88A 1I3RA 3FCTB 3LKNA 1R6VA 3N0AA 4PVBA 1AYOA 1H8SA 1S3KL 1UD5A 2YA0A 3EIFA 3R4RA 5FYKU 5T1DH 1R17A 1S7RA 3BPCB 2J5LB 4WHYH 3TIEB 5F7UA 2EDDA 3WLWD 5ACLA 3BZEA 1YEGH 4ODXB 4A7SA 4XWOD 1FSKC 4GKLA 4JFQB 4PP2B 5DUML 2BW5A 3KWUA 2PR4H 4I3RH 3WDJA 3OAUH 5KWYC 4PV1C 2IOIA 4NHUB 4FJYA 3GEFA 4RFNB 1MFAH 1DJZA 4BZ2H 2PCPA 2VLLA 1SUHA 3SDXB 1ZIAA 1FF5A 2XWBB 3PIQA 5ISZA 4HALA 4GLRH 5GJSL 1I3RB 3FCTA 3X1FA 2WZPD 1VPOL 4LL9A 2H9GB 4KRPD 3HCVA 4OZIA 5I0XA 4BD4A 3QAQA 3B7UX 2AITA 4OB5H 2PPDA 4NQSB 3WTTA 4HXAL 4WI5A 3QJFA 3QIBC 2YN3A 2VLMD 4P3CL 1SLXA 2FT8A 4YIQB 3F12A 1T21A 4M6AA 5LWYH 3KH3A 3Q48A 2EUWA 1KGXA 3ZLQC 3ZDWA 3U7YH 2AQSA 3KWWB 1X5HA 3ILEA 43CAB 3M7OA 3QG6B 1PG7W 3HKFA 1YEEH 2PO6B 4JRXD 3ZN6A 4TUJA 4OF7A 4P4RA 2GAZA 4JJ5A 3SGKC 1ADQL 2J7LA 1UOKA 3WEBA 5J0BA 4JGMA 5K9OB 5LGKA 5KANI 5HHME 5GGVL 4KH2A 4PJAE 3PIQB 2GCYB 2XPGB 1GGBL 4F91B 1DYZA 2AV7A 3LNGA 5ISZB 3T0ED 2ADFH 1J11A 1M2OA 3S5LA 3NQIA 4NC2B 4OVVA 1KIPA 3PABA 4RDQG 3TCXA 2IFFL 4G6JL 4JHWL 4K55A 3A4EA 3IFNL 5DZVA 2IPTL 1JN6B 5AUMA 1OTTD 1TZOA 2FYYA 5DRXB 4X4YA 5B7MA 5J11B 5DK0A 5T3XL 3U0WH 2HTKD 2E7LA 3GZQA 4JG5A 5AVUB 2WZPA 3LVTA 3UJIL 3OVUB 1CG9A 3NFSH 4F7KA 4HUUA 2EEXA 5MI0C 1F3RB 4HUMB 5LN4A 2EKSA 1X5IA 2YKKA 1T1XA 3O41B 4FQHB 3WN5C 3I9AA 4H0LC 1HZHL 3SDDA 12E8L 5JPNB 4ZUWA 4FYQA 3NZ8B 5IJDC 1RZGA 1E5BA 3A3YB 4DOHE 4J3VA 5M95B 4HKBA 3QJHB 2FCBA 3VQ1C 1E7VA 4AVIA 1DLHA 3IDNA 4JVWA 5AVQB 4UNVA 4G8IB 4X6CB 4PJ9D 5D2NC 3QUZB 5EZLA 3IKKA 5C0AA 3TONA 3F7VA 3DX1A 4DW2L 1MIMH 4ENED 3R8QA 1XR9B 1V55B 4FN0A 3MREA 2OMYB 1AZNA 4I1NB 5ISZE 3QWRD 4ODSL 4P3DB 4XN8A 4ZX4A 4JG0L 1BMWA 2YRZA 3N1MC 4GW1A 1O7SA 2B14A 3VWJB 2VO5A 1A3RH 3VRJA 4FXTA 3U2SB 1T1YB 3BUIA 5EOCL 1KGIA 1MWAA 4WKZA 1DBKL 3CFBA 1EZSA 3SGEH 5BPPA 2DTMH 4PRPE 2MCAA 5C0FA 1B6UA 2VOTA 1BPLB 1VERA 2X6UA 3EFFB 1YC7A 4HJTA 2AXJA 4PJCE 1TU2A 2DYPB 1TZ8A 4OM1H 3WD5L 3ZPDA 1DZBA 2HLEB 3MRIB 4PQXA 5GGSY 5EEXA 4MNHA 4OI8A 3JT0A 4DVBA 2J1WA 3E3QC 1ZLUH 1WG3A 1DJWA 2Z4QB 5IVNA 1ZT7B 3O45B 3F84A 5HGAB 3IE9A 1A21A 3P9MA 4B6ZA 2HT4D 3D4CA 4XN1A 4LNVA 2BDNL 3ULSB 2GSIA 3W2DL 4GNKB 1MCQA 3TWYA 4UT9L 1FV1A 2YARA 2YXFA 1IQDB 1TU2B 2DYPA 1RULH 1DR9A 2I7OA 4L37B 4NENB 3IJHA 4LPCA 3KNBB 3CMGA 1AZRA 2BERA 1QWNA 1WBZA 4NOBA 4W9LC 5E99L 5IB3A 4KKAD 4P23B 1DANT 4CBPA 5IB1B 3REVB 1KCWA 4I0KA 4I9WD 5HVHC 2P5EA 2VKXA 1E2VA 3EOTH 5EBLB 3TO2B 2YGOA 3QI9B 3E80A 4I5BA 3KPSE 1HEJC 2MFNA 4Q6YA 4WW1B 5ID1A 5E6ID 3H0TA 3S3CB 2GVYA 1I1RA 2ATKA 4U3XA 1IARB 3VTMA 2UY6B 2WSKA 1W6WA 1D9KC 5ENWB 5CLWA 3LZFH 3WJLA 3JZ7A 4I0PD 1YMME 1NFIB 1AYRA 3GSNH 4JW3A 4LOEA 1I85C 1H0DB 1RFDL 2FX9H 2A6IB 1IM9D 2CQVA 4HDIB 2D3NA 1BF2A 4JHUA 2VQTA 3II3A 3VXQA 4GMSL 3JWNH 2IQAB 1ZV2A 3LMJH 4EDWL 3QXDB 1QHPA 3BKYL 3SCMD 3OXSB 4JMXA 3RTQB 1TNMA 2HKFL 4S0HA 3I75B 3F62A 3WGVB 3GZKA 4WDIB 2AK4D 2VZOA 3K1KC 4OQTH 4APXB 1E3XA 4L3EE 4KQ4L 1BOGA 1E3ZA 3KGUA 2EDQA 4NJ9H 5ID0A 1HL5A 1NCTA 1WGVA 3BSHA 3IDIA 1KBVA 2EYRB 1RH8A 4WI4A 1VAHA 3VXSE 2CDEA 1DSFL 1AR1D 5BVPL 1WTGT 5CJQH 4JUTA 5C0CE 2W07A 4JZJC 5TK2A 1GHFH 2SODB 4K94C 4WO4B 4NNXA 3RFZA 4V1DD 5EIIB 4E9QA 4EIBA 4CC4A 3BPNC 1YN6B 3C6LC 1AIFB 4X6BA 1E5YA 4M43L 3KW7A 4DN3H 4IMLA 2HRPL 3PDOA 4X6DF 3CC5A 3RKPA 3OGCB 4KROD 4XO8A 5JPMA 4YHLH 2ARJB 2DQIH 2VQUA 3QEQD 3FH8A 1Z0NA 2Q86B 3A21A 1S3KH 3B2UD 5KAQF 2O5XH 4OUUB 1UA6L 1IAII 4QXGH 4CSTA 3AY4C 2YRLA 5DLLA 3HAEA 2F0CA 3D51A 3WXWH 3O0RL 3G5WA 5DUMH 4ICXA 5A2KH 3AGWA 3P02A 4CC1A 3LQAL 3W5MA 5JHDA 1XGQA 4PG9A 1UACH 3CMOL 1KJVB 3B2DC 1F0LA 1IGMH 5TE6L 3RVXC 4Y5XA 1MLBA 1J0JA 2QKIC 3LKQB 1TJIL 4ABQA 2J3SA 3FB8B 2BP0B 4J6IA 2VDPL 1FL5B 3KXFD 1NEUA 1BMGA 4EE2A 5IZ7A 2KLTA 1R3KB 5EFIB 5IR1A 5IFJB 3W3BA 3D85A 4RMVA 4OGXL 5E8EB 2V2WA 5F9WB 3WHXA 1K3IA 4RFOL 3AS3A 3FT0A 2VABA 4P23D 1L7IL 5JOFB 3GLZA 2V3EA 2P8MB 3R4DA 1EEYA 4N3TA 5CINH 3RGHA 3UTTB 4W6XB 4BFKA 3D3VE 5ICXA 2EZ0C 5J6GA 4AVHA 4L3ED 3OKDB 4TV3A 3U2IA 2BCMA 3FO0L 4F8NA 4X4MA 3NGBB 3X12B 3LH9A 1P69B 4MJ6A 2XZQL 3BWUF 2DQUH 2XVBA 2HJFB 2DQFA 4G72B 5BMFH 4Y5VA 4XCYA 1JZ8A 2VXSH 2F61A 5DWUH 4K9EC 3FT2B 4WFHD 4MBRA 3L4XA 4AJ0A 2AQQA 2ADFL 2G30A 5CGYC 1CF1A 2HTLC 2X2JA 4PU2A 4Z6AT 3M8OL 4PJFF 4QRPD 5GGTA 1BQHA 3C6SB 4JRYA 4GQZA 4UAOC 2QSVA 3DYPA 1NC2A 3NFSL 1IEBA 2ITDA 2KERA 1ZHNB 3DGCR 1GY2A 1ZVHA 4Y8AA 5DQ9A 1FUNA 2O30A 1ZOXA 1MRFL 2CRZA 4IYKA 1CTOA 1A6ZB 1GYCA 3IXTA 2WQXA 5DI8A 2W0KA 5IJVB 1A7RH 2PPEA 5DTFA 5IB2A 5FLUA 1YEDB 1PDKB 1Q4NX 1RIUL 1JDAA 3F58L 3LOWA 4Y9CA 1BIIA 5EMYA 4F7PA 2XV0A 1Z3GL 2NDFA 5BZZA 3S8GB 1EZLA 2E47A 3FT2A 1RERA 3FUNA 4MXWL 4N1EA 4XMVA 3UGEA 5IQ7L 3SE4C 4NCC1 4HKXA 3QO1B 1KXVA 2A74A 3SDCA 3X1GA 2Z8SA 3T1FA 3TV3L 4BFIA 5BUGA 3ARBC 4AIXA 9CGTA 2WO2B 4JPVH 4IDJH 4PWKA 3VXPB 4EN3A 3QS2A 5JIQA 1RZKC 1YN7B 4GG6B 1QFWM 2VDQH 1ETZB 5H37H 1FLRH 1DVFD 2MRYA 4JKWA 4H2CA 1CO1A 1UADC 5HHQA 4UT6A 1KCLA 1OCWH 2QLVB 3LN5B 3Q3GA 4ORGA 3HMXH 5DVOA 3U48A 3VXME 2ADGA 2Z8RA 4XRCA 4ZFZA 1D5XA 3K91A 3FQXB 5AD0B 3OAZK 3S7GA 2X1XR 4K23H 5I1HL 4JM2D 1ES0A 1BIIB 4Z0BL 3U1SH 3GSRB 4PLKC 3RWDA 4NNYB 2DEYX 5LGYA 3O6ML 4LHUD 2CK2A 2EVIA 5BW7C 1W0WA 3MV7E 4AQ1B 1OAYL 3BEWB 5GZNC 3UPCA 3O0LA 2O5YH 3N44F 3RDTD 4IMKA 4E9SA 5CP3A 3T8XA 2XWTA 2XG4B 3CZLA 3FT1A 1BFOA 3EO1A 3TA3D 3GSNB 4E41E 5JIDA 3US0A 2CG9X 4FXLA 1OE1A 3QR2A 4PTUA 4M5TA 4G70B 1JHLL 3PP3K 2ZSVB 2APFA 3MNZB 1E28B 4LSVL 1E8ZA 4IKLA 4PW9A 1U8HB 2WVVB 3FO1B 1Z9SA 4LP5A 4NQCD 4Q4IA 3UCRA 1EJ6A 1IAIM 2WYHA 2WO4A 1ZVNA 3U7WH 5AG8A 1CD1B 3RDJA 3EGXB 2N7BA 3L08A 1VJSA 3ZHFA 3KAAA 1L9MA 5F96H 4PJFE 3V52H 1GCYA 4JY6B 5FECA 4KK9C 3GSNL 2X05A 4G59C 1AO7D 1DVXA 3T9WA 3KL0A 3OJ2C 4JM2A 1EPFA 1QLEB 4E5XA 3OR6A 5I6NA 1X5FA 1VA9A 4HPOH 1AGBA 2WNGA 2PTTA 4MB1A 4XCEB 4HG4K 3P11H 3BKYH 5ILTH 3B5GA 4JO2H 3PGDA 2V5MA 3FHAA 3Q2CA 4M6MH 2A1WL 6FABH 4PGDB 1Q9LB 1FORH 4NO3B 3ATAA 1M6OA 3SE8L 3VMOA 1ML0A 4O2CB 5IB5B 4C83A 4GUOA 2QGBA 2EVHA 3L4VA 5JHDD 1BQ5A 4BK4A 3HE6B 4BQ6A 3CSYA 1Q9WA 4M7KL 4PP2A 4HS6B 1FPTH 3L95B 3BLPX 4TOYH 1A4KA 1ZE3H 3BZ4A 3CFEA 3JV4B 3WDIA 4MMXB 1N7MH 3ARBD 1MREH 1HL4A 1JWSA 1NGYA 4Q7DA 3SYCA 5IV2B 3L5WB 3LS5L 5C0BE 2EVFA 1AHMA 3SN6N 1WZAA 2HRPH 3LPPA 4IGBA 4W6WB 1DE4B 2OMNA 5JOEA 3QG7L 2Q9OA 3ZZLA 1DJGA 2BIHA 1UA6H 4AM0Q 2QBWA 3IRCA 4GI6A 2FEDC 5JMRA 1G7PB 3ATBA 1BFSA 4LLDB 2Y5QA 3VRLE 4LSUL 2R9HD 4NZUL 1KTCA 2Z4QA 4FG6D 1FFNA 3QRFM 1JPGB 2CD0A 3LQAH 1BM3H 4G43B 4MQ7B 1BBJB 4AW7A 3W0WA 5I6OA 5CCKH 2VDRL 2RALA 4PMEA 3I6LE 4I9XA 1JZ3A 3VD2A 3SDAB 3SBRA 1ZXKA 4GXUN 4YXHH 3L6FA 2QTEA 2I26N 5B38B 5I5RA 5K9JL 2B1AL 5CAYB 4XAWL 4OIAA 5F89A 4L4VA 2V7NB 1CD9B 3L4ZA 3EO9H 2XXCB 3QXUA 3ALPA 4UCFA 3G6DH 4IIQA 5F1IA 5IQ9B 5CINL 5F71A 3QARA 3NDZE 1GJUA 2F18A 1JTTA 3QDME 1XF5A 1MWAH 1XIWA 2BIOA 2EH8H 3MCKA 2FWLB 2D7MA 3CC1A 4CMHC 5GSVA 2MPAL 2XZQH 1DN2A 3SJVB 3SEPA 2A6JA 3W82A 2R69A 1QSFB 3SOBH 1NCGA 1XGPA 2IDSA 4X5XA 3JYBA 1DBAL 5EOQL 4N20A 3GHEH 4MNGA 2UZYB 5JA8B 4R8WH 1KLUA 3UJJH 5F21B 1P4BL 2AJXL 2JWYA 5IB1A 3RWJB 4ANWA 1S7QB 4LHUB 3FL7A 1K8DB 4NM8H 1W16A 3WKYA 3DX2A 1DQTA 4L3CB 4XPGH 1OGTB 1MRCL 2H2SC 4QRQA 3ZL4L 5EU4B 3L5HA 2BP0A 4NOFA 5C0IA 1RZIA 3P0YH 4JDTL 2PXYB 3X3FL 4IS6A 4NPKA 3K74B 4GI8A 4PGBA 1JL8A 1NFDF 2EXYC 5MI0B 1ZLUK 3SBPA 5I8OL 5L88H 3LZOA 1OSPL 5DMJB 3VQMA 3K8MA 5FYLE 2R29H 2RIKA 1FFOA 4QO1B 1PG7H 2WGNB 5JLZA 3NSDA 2GBVA 3I6LD 4MRBA 1E3FA 2JCCA 4P48A 3HG4A 3PGCB 1N0LA 2H2PC 5F1SA 3FPXA 4XPBH 1ACZA 1G7JA 4JDZB 3BXNB 4R4BB 1KTJA 4LEOB 4MZIA 5EIIA 1KEGH 3DPBB 1NTDA 4H26B 1IKNA 4LE8A 3P4OB 4OCXH 3X3GL 4R0LB 4XX5A 1BYNA 3MN8A 4XNYH 3NCJH 1HXYA 3SYOA 3EYFB 4P5TA 1Q0XH 1XWVA 4LLMA 1QRNE 1P9MC 1YYLL 3NJIA 5AVTB 5DDHA 4N0FB 5EU3B 1WAAE 2ESVB 4FQQA 4ODVH 4Y2NA 4ZPVA 4XOBA 2FECL 3H9YA 3Q8EA 3L1OH 2VLKA 4KJPD 3EJYC 4KPHL 4JFFE 3OXSA 4HCRL 1ZD6A 5DYFA 1NBYB 1AMYA 3C2SA 4Y4FA 3ZSTA 4NPJA 1K85A 2ZCKH 1IBHA 3MBEA 1NL0L 1EBPA 4H5SA 4FYTA 5KVMC 1EDYA 2FT7A 4JO4L 5IHUL 1RU9H 2EDRA 3CVHL 3G6JB 5AZ2L 3OKOB 4ZW6A 1OP9A 2Y7QA 1P4IL 1JGLL 1YUHB 5ENWA 1J7VR 1Z9MA 4LPXA 3P1VA 1NUFA 5DCCA 1LO0L 3DETD 3LY6A 3TVMD 5IVXB 3NDYE 2OMTA 2GHWB 5FYKL 2LGNA 4OCLC 4ZTOL 1P2CA 4N0RA 5E7FA 1XSKA 2Y23A 3LXCA 4B9ZA 2BVTA 5FM4A 4OV5A 5D5MB 4N22A 4FQJH 3GPEA 1EAPB 2Y2WA 4HT1H 4LSVH 2IH1A 2VXVL 3O6FC 2WZAA 5EC2A 1BZDA 3UADA 3V4VB 3U9WA 9PCYA 1OSEA 4MDJA 5DXWA 1XF3B 4JZOA 32C2B 2BSED 2TRYA 1GL4B 1QA9B 3FQWA 2G5BA 2OMBA 3V6OE 1MJJB 1J1OH 1UKSA 1TQBB 1CMOA 2AXFB 3B2XA 4TUJB 3Q6GH 3BFQG 5IB4A 1NFDE 5ACZA 1UKQA 3FQUB 1DSWA 1PX8A 5DURD 1PCXA 4H1LH 4LU5H 4PPTA 3TBVB 5IJVA 3OJVC 3LHPH 1QVOB 3VWJC 4DN4H 1KF9B 2DY2A 4QRAA 2EDFA 4LOFA 3CLEL 4YZWA 5E2UH 5AW5B 5M7QA 1E2ZA 1KPVA 1ZHNA 2IMMA 5FEBA 4YZFE 3TCLB 4M6ML 4ZJ9A 1NCJA 4NAMA 2IWKA 1AY1L 2UYLB 3QIUD 3TZVD 3E2HC 1RURL 2JI1A 5I17B 4M6NL 4LARH 5I1GL 3BWUC 1V3MA 3DMMB 4QRSB 4AKQA 4OLYL 3QWRA 3SKNA 4QAMB 5HHOD 5DHYB 1QO3A 2W94A 4HLZH 2NYYC 2CUAA 2YSSA 4XN2A 1UWFA 2YAQA 4YK4C 5C0DA 3SKOB 2RB8A 1U3JA 2CH8A 3RKDC 4QTHB 4MD4A 2VGLM 2WKOF 3NTCH 4AENB 2NXZB 2HFFB 1SY6H 4JM2F 1J5CA 5C0AB 5I17A 2JFCA 3DOSB 3UDWC 2A38A 4XC1L 4PM1A 2I27N 2FBOJ 1U58A 3BI9X 5CM1A 2Y0SA 4Q0XL 2A4ZA 1KPVB 4I7ZC 5HVHB 3LVEA 1E2WA 2YS4A 3P2BA 3AG4B 3MBED 5D93C 2AK4B 4JZJB 2UYLA 5HYJB 2JKWA 3O11A 4Z95L 4YSQA 3JWOC 4M1GH 3TBTA 1T1XB 1YZZA 3ARRA 4ZZFA 3CVDA 4NN5B 3KCPA 4WWKC 3K4AA 1YEJH 3ARDC 4P04A 3II2A 2AAAA 3ABGA 5JOPD 1U2CA 3DVNB 4LLUA 4HFUL 2I07B 4NDMA 3R7RA 4NQXB 4E9WA 3L13A 3ULUL 4YXHL 5GRVK 2ZUTA 4KZDL 4MD5A 2NNCA 5KSBB 5F88A 4WK0B 2OZ4A 1A1OA 5DQJA 1RIVL 5DRXA 4NQTA 4TVPH 3CBRA 3AY2A 5CEYB 3G6DL 4OZFA 2B3IA 2N0KA 1AXTL 3FO1A 5TF1L 1EGJA 1LM8V 5KSVA 2WXKA 1KB5H 1S7XB 3ULVC 3DUUB 3L5WA 2EIEA 1JNNL 4GO8A 4HMCA 1L3WA 2X88A 2GJ6E 3NPZB 3QUYB 4HG4J 4I89A 1CDGA 1ASOA 3TJEL 4QJ4B 5C9JB 5HHPA 3CZFA 2OSYA 4X8XA 4KNSA 1XF1A 2HA1A 4JQIL 5C71A 1JFQL 3LNEA 1JPTL 3OAWA 2EXTA 4NXSA 2E9JA 2ZUQC 1L9SA 1MZZA 4QGYA 5D1QE 3RG1C 1P4BH 4AE1A 2MOQA 1KLFA 4GUPB 5DGRA 5KBNC 5E00A 5I8KL 2C7FA 2XA8L 2XNAA 3T3PF 2YD1A 3QJHA 1RLBA 1IBZA 3ATEA 35C8H 1G9HA 2R15A 2EUZA 4YPJA 4XHJC 1RZPA 4LL4A 1EQWA 1IAMA 1AGFA 1NBVL 2LLLA 3DX8B 2FEJA 3OX8B 1CLVA 4KV5F 4OZGF 4FQHA 4ZX6A 1LE5A 1TQTA 3QIWD 4BQ9A 4Y9FA 3MBWB 1LD9B 4HIXH 4MJ5B 1BLNB 4GRWB 4JY6A 2J5WA 1KB3A 5D4IA 2J88L 1D6VL 2HVJB 2ZOKB 2Y24A 5IMLB 4NQEA 1QSFA 4TNFA 4HJIA 2DI7A 1TYJA 5I1LB 1SHWA 3QORA 3GIVB 3WUWA 5IT2H 3DI2B 4LLQA 1LWJA 4UT9A 2B5IB 4QLWA 4GSQA 5EG6C 1JYXA 3VXMD 2UVEA 3HC4L 4N90D 1KENL 1IAOA 5HJ3B 1VENA 3QUML 4UB0H 4I0PA 4YSCA 3VFRA 1NEZG 4JEGB 3GI8H 4U1MB 1HKLL 1KEGL 5AOMA 2BRQA 1MJUL 3MMEA 3WLBA 4O02L 1GGTA 2COQA 2VO8A 5GS1B 1FG2A 5ECJE 4HEPG 2J8UE 4UQ3B 4IRSA 2OSLA 3KHOA 3NFNB 3STZA 2W07B 4PRIA 2ALWA 2XN9B 1E50A 3GLAA 3IB4A 2A6KB 2Y69B 1BFVL 4NM4L 1TTUA 3RVUD 5DJAA 4AYFB 1F6AB 1FFQA 3QEQE 4JFXA 3FU9A 4L3CA 5A2JH 4HUCA 1ZY9A 2WC7A 1ACYL 3ZYJA 4UT7L 3G5YA 2APVA 3WSQH 3V4PA 1HEZB 3GI9H 4WNQB 4LCWE 3KDPB 3BQVA 3RX9A 1ITBB 2FQGA 1FA4A 3V4VL 3HZVB 4KDTC 2CRMA 4OCRH 5I28A 3FN0L 3WHE1 4LCUB 1YPZF 4PFEA 4NKMA 3OKLB 5F2FA 5INDA 3HRPA 4UTBL 3T0EB 1Y1DA 3QUXB 1LO0H 5H4ZA 1IGIH 1JYVA 2Z8WC 4GXUM 4Z3EA 2FWOA 1CICC 1JD9A 1TTCA 4HETA 4OQ1A 1CE1L 3HJ0A 3VFPB 5KVDE 4HXBH 2D03L 3VXRA 4I4WB 2PO6D 5IR1B 5IFJA 2Z3FA 5JW4R 3H42H 2ERJC 2AANA 5BXFA 2ID5A 4DPBX 2YAPA 4YDJA 3DO7A 4PJ5A 4D9LL 3PP4H 5MENB 4NKQB 3DO3A 4EUPG 2HMIC 3UO1L 3P73B 5K93A 2PPAA 4U3CA 5IFAL 2E7HA 1THAA 1DFBH 4R3SB 2ZCLL 3HC0A 3GMMB 4NRYB 1F4WH 3EYVA 1BBJA 4K7FB 1YNTB 5D7SH 3ZKND 2O6EA 3BOVA 1NGWB 4OLZH 5E6IC 1YEKH 1Z0MA 2W9LA 1EFXB 1FO0L 4YDLB 4QEGA 3CLEH 4UM9A 4PRAB 2VITA 2AHIA 4A38A 4DFHA 2XFGB 1MCDA 4NZ8A 4PLOB 1G4RA 4WY7H 5CCJA 3CU1A 1CU4L 4FQIL 2B1HL 3BDBA 5GSRB 2SEBA 2EIBA 5EC2B 1GIGH 2M83A 3AY4A 5FUOH 3K6NA 4WF7A 3U6XA 1S46A 2OMWB 1TKWB 4K5PA 1X5XA 4JHVA 1UC6A 4YBLB 2F9BT 3HG5A 3AROA 4LSQH 4P8QA 4NJAH 3CZNA 2UX6A 1JE6A 2IAMC 1DBJH 2NTFB 4JL2A 3VFUA 3X12A 3KYMA 1AXIB 3PUCA 1GYUA 2E8ZA 1VKXA 4GKNA 2YLHA 1GZQA 5DZPA 5J89A 1F6LL 4M5ZH 1UOLA 1XAKA 2X0UA 1XZ0A 1JZFA 1NAML 1NC4D 5G4NA 3Q9QA 4U1SA 2FWSA 4WHTA 4XC1H 2ENPA 4WO0A 5HYFA 2BWDA 3WJMA 4J3OD 1CTMA 3CN3A 5IGXH 1LDPL 4Q0XH 4PCYA 3UTTA 4M8RA 2LHAA 4DK5A 1SZNA 5F7WC 1D3CA 3KHQA 3RFRA 1DQML 1NINA 1FZOB 3RTQA 5IBLD 4LVOC 4Z5RA 2Z8VC 1NFIA 3SDDD 2GJZA 4G6MH 2VNCA 2NPLX 1G7QB 3IPFA 2NTFA 1RK0A 3DOHA 4QOKD 4IKJA 3U9PL 2ESVA 4FQQB 3GSXB 5JHLH 4J3OC 3QEUB 4HC1A 1MCWM 1CLCA 3OR7A 1T0NB 3UTOA 5KS9B 5DHYA 3IJSB 5C2BH 3CFDB 4Z7VF 5IW1B 3V0DA 3PNWA 5IESH 2VCOA 2YKLH 4JFDA 4P07A 5DJ8B 3L4CA 4HKXB 2V5RA 1UWEH 2CO6B 3UZVA 1KB5L 1IFGA 2AV1A 4KC3B 4P2QD 1BZ7B 3D7PA 1NJ9B 2VDKH 4Z1PA 2B9BA 3TLRA 2JSFA 3WUWG 2OTUB 1KN4H 3IXTB 3S37H 5E1AB 2DEWX 4KRPB 2XWTB 5D7IB 5A43C 1D5MB 3B1TA 1NFAA 5INCB 1RY7B 4NPYA 3FT4A 1P84K 1S7VA 4HCGA 3TFKD 1Q9OA 3GSVA 3G08B 3UYRH 1F42A 4KK8C 1X7SA 3VTAA 4C47A 4NRXB 2MCMA 3TH4T 2OW6A 1CLZH 2NY6B 4E9YA 4RGND 4J12A 4LQFH 1J1XL 1U8PB 3KCPB 3T3MB 2Q8AH 1VFAB 4WTQA 2YMXL 4UQ2A 3C8HA 5DRNA 1XBDA 4Q14A 4AEFA 1KBGL 2WKGA 5C0RL 2H26B 1JAEA 3R7QA 4QOKA 4XP6H 6PCYA 1L0QA 3BRGC 4ILDA 5DJ8A 3OLIA 1KJMB 3UMTA 3QRGH 3D69B 5T1KB 2VJ8A 3MUGB 3WAKA 3BPLB 5CJOL 5FYJH 2VKWA 1PYWB 3LB6D 3TPUB 4AIZA 4YDIL 5IIEB 3VDBA 2J88H 3ARBA 4WU7A 2CHXA 4DP7X 4Z7NB 3JWNE 2FATL 4NWUL 2VC2L 2DOCA 1ZT4B 1QBBA 4L8SB 4CVUA 2GSGB 4QXUH 4TM9A 3MACH 4U2ZA 3VTTA 4A6YA 2LE9A 3RPKA 3GJFB 4ZMYA 4FQ1L 1BDYA 3PQYB 3D69A 1LTXA 4M4RB 4BFIB 2CCVA 4KKQA 1A7NH 4DKFL 2ADIA 4UU9B 5E8NA 2QQNH 3W37A 4HF5H 4DEPC 4UQ2B 4XO4A 5E8PB 3QPKA 4L48A 1OAKL 5I6XB 3EOAB 2EUVA 4RZKA 5J8OA 3OKNB 4ZO9A 2Y25A 4LXFA 1Z5LB 5TFSH 3GKWH 2AJYL 3WNLA 5F0PB 1NH6A 3MAWA 5HVGB 1WP6A 4UZSA 3TO4C 3UC0H 3DJZA 3MGTA 3QISA 5EZJA 1B3JA 4OD2B 4XN5A 5EO9B 3Q8CA 5BV7L 2WK2A 5GZOC 3E6HA 1JYWA 2BCKB 1BZOA 5ICZA 4UQDA 8FABA 3HE7C 2D3LA 1RK7A 1TFHA 3FF7A 1MCFA 1NAMB 3DHPA 3OKKB 4A68A 4ZNEE 5KYXA 1VLXA 3SZKC 3L4WA 2KQNA 1IJ9A 4JANA 3WO4B 4TVPD 5D7JD 1CD1A 3D18B 1GH7A 2BFVL 3MRRA 5CN1A 5F97E 3MV9A 3LIZH 4JFWA 3M7FB 3GXTA 4YGVB 5KVGH 4GP8B 5AWNL 3UAJD 1VFBB 3RNQA 1ZTXE 5F9AC 4M7JH 3SJVD 3V6ZB 4Q6IC 4R90H 4R2GB 4JM2C 4KNQA 1OGAB 4M7ZC 4XE5B 2QV2A 1T5XB 4BIKA 1A25A 4Z8FH 2HFGH 3K6FA 4NX0A 3ZTJG 1GTNA 2H8PA 2D2OA 1PCSA 1CLYL 5HHMD 3QQ4A 1F4HA 2HWZL 1UD8A 3VXUD 4HOXA 3BT2H 3EJSA 4ZSOE 2A6DA 4NQVA 3P0VL 2NNRA 4X6CA 3VG9B 4U4IA 5ABDE 3CCHA 4YHYC 5GGRB 1F2XK 2WWOA 4L4TE 2F6AA 5JIPA 3VA2C 2IBZX 4LFHG 5I6PA 2WTOA 3S3SA 1CYXA 1BBDL 1KTLB 1XB8A 1ZMYA 2GBUA 2QGCA 3ATDA 2H1PL 3AAZB 4P2OA 4ANUA 4NUMA 4ZMOA 2W65B 4BZ1A 3TYGH 2UY7B 1RZ8B 3HI1A 2AJUH 2BVOB 1NICA 4RGOL 3N50A 2CXGA 3QQ4B 1OTUD 2A83B 4MAUH 4X9HA 3IM1A 2FSEA 4IU3A 3TN0D 3IDJA 3L54A 3VFWA 4WUUE 1YDPA 3D4ZA 1AD9A 2FYYB 3I6KA 1YMHB 4D0CA 3HNTL 4H7VA 3CHPA 3L7EA 1KEMH 1A1NA 1X9QA 3I3DA 1CICB 4BUHA 2W0FB 3U4BH 1BJMA 4Y1SA 1PPIA 2X1OA 4PJCA 3BZDA 4YGAB 5E1HB 3NCWA 3OLEA 1RUQL 4FA7B 2VE6B 5J12C 4KXDA 5JZ7D 4L5FL 2CLZA 3VFVB 2XG4A 4Z3IA 2I60H 2VN5A 2KI6A 4JPWH 2FJHA 5SWSA 2AGJL 2CDEB 2MHAB 4QO1A 1DBBL 2ZD0A 2GSIB 4I85A 4UM9B 4EOWL 2BOLA 2MNWA 2VZVA 1L6PA 1G6RH 4MQ7A 4ONHB 1EZVX 1EXGA 5J13B 2VQ1B 1E8WA 3PY9A 4EXKA 3NP4A 2VM9A 1NWPA 2EZ0D 4NIYE 4KDWA 5CFAA 1YEEL 4X6FA 2WXHA 2WIIB 4JE4B 2WXGA 3RWCA 4WEBL 1XIWC 5B3JE 4NKIH 3MLVL 1CUOA 5I71C 2RACA 1KFGA 2CIKA 2Y2YA 5F3HB 2ATAA 4N2CA 3PF2A 2LAAA 5MEND 1NKGA 2QL1A 3OB0H 1IAKA 3ZE0E 2WQSA 2QDVA 5F8QC 1PZ3A 3D5OF 4OJAA 3U9PH 3UL4A 4Y5YC 2F1AA 5KG9B 1QUNA 2PWDA 3RUGF 3S97C 4IU2B 3ORJA 2VAJA 4X50A 3V9FA 1E4KA 3IEAA 4XBEH 4UTAH 1YJDH 2VR5A 3I2CH 1BM7A 4G8FB 5GSVB 3PWVA 3QFJE 5DD3L 5K1VA 4DGVH 4YS4A 4CMMB 3BAKA 2XWDA 4U1NB 3QEGH 4FHJA 1FE8H 1W72L 3A24A 3ZT6A 2XKNB 3HA0A 2ICEB 3BKMH 3H9SD 1FV1B 1HZHH 3ETSA 4TQEH 4YO0A 2VN3A 5EO1B 1RJYA 4NNPL 4HIIA 3TBYA 3B2UC 3L3DB 5FYKE 4OLXH 5CR1A 1KELH 1WRFA 5CD3B 1BREA 2VSKB 3LQZA 3DJSA 3QPXH 2R56L 3WIHL 3Q5YA 4M61B 2QSCH 4F2MA 3BISA 4G6KH 1DQKA 4FNLH 4ONOA 3SGJA 5AOKA 3FU3A 3IFLH 1UQSB 3GF8A 1BJ8A 1WZKA 3JV5A 4I3SL 2XBTA 3CVHA 3N41B 1OP3K 1MHEA 3INUL 4BXVA 4TYUA 1HNFA 1KBGH 1HC1A 1MJJA 4XCNB 3EYOB 3VW3L 2NY5H 2PWHA 3BIAX 3EYQC 1BZ7A 1NC4B 1P5UB 3O2DA 4A7GF 2OL3B 1TEFA 2PCYA 4U33A 4YDNA 4X8JA 1YEIH 1PLAA 1EEZA 4H8WC 2DLIA 3P77B 3VVWA 5IVXA 3C9NA 3U7YL 5BS0A 2LVCA 4HC1H 1WSST 3O6FB 1Q9OB 4PS3A 4X4XA 4EZMA 3U79A 4F7TB 4FP8L 3RFZC 1CZ8H 3GTTA 3LQZB 2VL5B 2E86A 3QRBA 3QJZA 1QFOA 5D93B 1SN5A 3CSBA 4Z7UA 1KZQA 3QXDA 3VACA 2BNRD 1D9KD 1HDMB 3G6JA 1R24B 1WUNT 2ZJSH 1EHLL 1HZLA 3RGBA 2J1YA 3T1WA 3Q2VA 3A4AA 2ZCHL 5JUEL 5F7YC 3BUBA 5FKAA 1OAKH 3S3BB 1BJ1H 1NANI 1JNHA 3TURA 4JG1H 4N2BA 4OD1H 2J1XA 3MRDA 3EFOA 2O1AA 2X7LA 4AT6B 2LU4A 1HSAA 5GGSA 1GZHA 1TZIA 3BD3A 1NLBL 3QDGD 4L3FA 3WIHA 1ZGLM 5F7BA 4PN6A 2EO9A 4PG2C 3Q1SH 5DJCB 4PI0A 5DC2A 2C9VA 1XHHA 1DLFH 2QKIA 4C56A 4RGMB 5EA0L 3S36L 5AENA 4JAMB 2DWSA 1WS8A 2GUOB 1J0ZA 3WEXB 1U3HC 4XXCC 3WFDH 1IC5L 1IIIA 4DP1X 2X6BA 4QD2E 3D34A 3JQOB 1MW0A 3UPRB 5FC9A 4H40A 5IP4A 4FI8A 2VZ1A 3T5WA 4BWWA 1HL8A 4LCVA 3ZMNA 4F2ME 4P2RB 2BNQE 4E41B 5EIVA 2WLJA 3BEWA 5ANHA 1XZ0B 3BW9B 3A6BH 4HKJA 3FQTB 4WTXA 1RVFH 2VMEA 4XP5H 1BQSA 1QFUL 1F4XH 4QCIA 1MCJA 3QJFB 2O4EA 1GJIA 1KSRA 3S9DB 3LD8B 2NQDA 3IETB 3UTSE 1B0RA 1XL6A 4J3SA 3E8UL 5TDNA 1MCPH 4K4KA 1AQDA 1GOGA 2N1TE 3C09C 4ORGB 3VFOB 1KJ3L 3BYYA 1LP9B 2A73B 4RLDA 4LSTL 4QHNA 2HVKA 5DMIL 2W88A 4J4PD 3TP4A 2G75A 4OJYA 1QWHA 3EYQD 2XN9D 3CIAA 1E9QB 2YWYA 1HHGA 3D8MA 3GLDA 4QF1B 3D9AH 4GS7C 5KYUA 1QSED 3BSZL 1JMZA 2C4FU 1I1AB 4L8SA 1Z6JT 3D0AA 1ODAA 3DECA 4DETA 3ZZSA 1UH2A 5LQBH 2VSMB 3IDMA 3ECBA 2H47C 1J88A 4JZJA 1TPXB 3KLLA 5E99H 2P24B 2ICWJ 3EH5B 5GRUL 4G1MB 4PGDA 4S11A 3WNJA 1YHPA 1PDKA 4XHJD 1X4ZA 1L0YA 2ZG1A 3GXMA 4FQXB 3PHQB 2FO4A 3T77A 3RE0A 5I1AA 5FGBC 1J0IA 1HE8A 4R26L 4H1LA 4ODWB 5LO7A 2X41A 5F44A 3MJ7A 2Q20A 4XXWC 3UPAA 1QLEH 1JDDA 4D8PA 5DTFB 3KPRB 5C86A 4F7CA 3HNSH 1ND0A 3X14B 4F8LA 2P46B 2GK0B 3GS7A 2EKSB 2R23B 3GGWA 3MA7B 4MDIA 3VGAC 3AQZA 4HD9A 5IEKB 2F58L 1KXTA 3ET9F 5B1AB 4IBTA 4OCWH 2JQMA 4GMSH 1SLUA 5C09A 2K6WA 3V4LA 3PWPD 1NFDA 2AJVL 3R06A 3QIBB 1BQRA 1FFPA 3L2NA 3RX8A 4BE6A 1I82A 1NJ9A 1WCBA 4ZRGA 3RLSA 5GS3A 1W2KT 1E6JH 5J6HA 4RRPG 2CUMA 2WD0A 4XMTA 3BP4A 1KIUB 1A7OL 5L2KD 1FNEA 4O51B 5AKTA 4FC3E 4RGNC 5T5FH 5BW7A 1H8LA 3H9SB 2YFNA 4WEEA 4MA7H 4JFXB 1BSIA 1SBSL 4Q6IB 5BVPH 4B9GA 3D4YA 5AKRA 3H56A 5DRWA 4DJMA 2EUXA 1CBJA 3V0VA 4DGVL 3O6KL 3OAYK 1NOLA 4P9MH 2TSBA 5JNYA 3B34A 3UEQA 2OTWB 4RWYH 3MHZA 1I8MB 2DBLH 4W9CC 5ANMA 3CFJA 3FJTA 1E27A 4NO5B 5K9QG 1IGTB 4PRDB 5HDRA 2IO5A 2J72A 4UUJB 4QXGL 3AG3B 5GRJL 2HG0A 3ELQA 1F1GA 3L16A 4P9HH 4NFBA 5FKPA 4JGUA 3TVMB 1QBAA 2JJTA 3QPXL 2R56H 3CHSA 3PREA 4MQXD 5CZXC 4FGMA 4TUKH 4BELD 2V7HA 4OCYL 2KL6A 2EXWD 2EYSB 2FH8A 3L9YA 3NN8A 4BKSC 2WZ6A 1TYRA 3WEAA 4HX1B 4Y5YB 3GXUB 3MBXH 4G9DA 5IKCB 1D5BA 4WUUD 2C5DC 3WIAA 1MIEH 3F7PC 4FS0A 5GGRA 1GKOA 5C0AD 2WQAA 4LVEA 2OKMA 4XVUD 1NC2D 1S8DB 5HI4D 4YXKH 3FFOA 4EVNB 3AAZA 4P2OB 4RDQF 1WA2X 5MEOA 1GC1C 3BAIA 1DFXA 2KC0A 4RAVB 3M07A 1QLFB 3IDGA 4OLVH 3T8MA 3RUGA 4MHHI 3EJJX 1A6TB 5HHOB 3DPDA 1EUTA 4LF3A 2ZKMX 2APTA 4ICWA 1VPOH 1X7QA 5DJXA 4EN3C 3MODL 2K8MA 3C12A 3O8XC 2OQJB 3TZVB 1NKOA 1J8HA 1MHCA 2FR4B 3MRLA 3Q6FB 4YZFF 2ZJSL 1OAYH 3VYOA 1S9WB 1VACA 3PAUA 4WCYH 3PL6D 3KPPA 5HI5D 1PY9A 3MJ9H 3V6ZA 2YUWA 2YEZA 2VXQH 4HH9B 1C12B 2EIMB 4UQEA 3QNZA 1S8DA 3WNNA 5E95B 4R4FL 4PRAA 1LO3H 4YE4H 4OF5A 5AOLA 1OCOB 4LBEB 1P7QA 3BDXA 3Q1SL 2KS0A 4ZXBC 2JIXA 2GUYA 4KTGA 2W0PA 2QVIA 1T83A 3SQBB 1ZGLB 3LKSB 1ED3A 2EEBA 3QO0B 4RISH 4TQ8A 2W95A 4XBMA 4XTRD 4JLRB 3D09A 4RNRB 1J1PL 3LNHA 3NMEA 2A9ML 4GFXA 4HEMA 4WRLA 3RL1A 3CFKA 3KCWA 4A66A 4DPAX 1MNUH 3DVGB 5C0EB 2ZP8A 4M62L 4KKZA 1OGPA 3KNBA 1TTAA 1KB5A 3TNMB 4WHCA 1NDGB 5J3HC 1JXJA 4FFTA 1RHHB 5EEWA 1SMDA 3VI4A 2PTVA 5E6IA 3F65A 5G5DB 4ANXA 4OCSH 4AQAA 1AGEB 1R3IL 1SXZA 3HRZA 2B1OA 2WYIA 4Y5XB 3VFPA 1QPPA 3GO1L 4PHZA 3VH8A 2VDQL 3N91A 3H6AA 1GVIA 3K3QA 2D4DA 2WQWA 3UYPB 2WP3T 4N5EC 1RUML 4U6YB 2BIPA 4HJGB 5SWSD 3ZO9A 1XF5B 1B0GB 1C5BH 1SUJA 3EHBD 3HZKB 2OI9B 3S5LG 3K6SA 2ZF8A 2JJSC 3ZX1A 4GOSA 5ITBH 5TQ2L 1C1EL 2DWDB 2A9CA 5HTSA 4IRSB 1MCWW 4M7ZB 1KN2L 3IPBA 3W0WE 3I9IA 4IIQB 4O5LH 3O3DB 3S35L 4YSEA 1O7VA 1AS8A 3DX0A 5I6MA 1RK1B 1XF3A 3QXVA 3ZT7A 2CR6A 3JTTA 4X5QA 3LS5H 1Y07A 4G9FD 1FO0B 4JG0H 1KJ2L 1SOXA 3FO9A 5DVNA 4EI0A 3D0VB 5AVZB 4ZMLA 4AYDC 4HXAH 4R9HA 3QCTH 3QG7H 5ADPH 2O5YL 5KVGE 3FQTA 2NY5C 5LWYL 2BMKA 4R7DB 4JB9H 4DTGH 43C9A 1K72A 4EBQH 4V1DA 4PYHA 4V2BA 3VWKD 2NNAB 1NLDL 3O3AA 3B2MA 1JWUB 2FNWA 3NBNA 1SMOA 5H35B 1MPAH 4FABH 2G60L 4LSRL 3QUKB 1ZCRA 5KEZA 1LWRA 3O2VL 4I1RA 1FL6A 2J12B 2Z0UA 4UBDD 3TYFA 4AJWA 1UJTA 3CNKA 3DX7A 3BC9A 5ALBL 5D7IA 3O2WL 2E9WA 1QASA 5D71H 2E7BA 3FB6B 4MJIB 5E8OB 5JORB 4KO5A 1JG9A 2DZEA 2XJLA 4N8VG 4PWHA 1ECYA 3QEUA 3WO3B 2LQRA 1IGCH 3L3OA 3LKQA 4N26A 2AQ2A 4P49A 3WOVA 1H3PL 1IKFL 3HNSL 1QX1A 3CPUA 3PJNA 3ZE2F 3FRPB 2QKIB 1MFUA 4ZFOL 1HJBC 3MJ6A 5CBAA 3MLTA 3FU8A 2W9DH 4L8DB 4RMQA 3IVKB 3L5XH 2QVTA 1QRNA 2AK4E 1RJZB 4FQLL 2NY1B 3UAJA 1P84J 1E9QA 3BVUA 4XPFH 3MJGX 2MPAH 2G3MA 1JF6A 3CN4A 4LEOA 4ABWA 3DDFA 5H35A 2FHCA 2BWIA 2Q0ZX 1QSFD 4HIPA 5D2LE 5T5FL 2XIIA 1UXSB 1EANA 5I66A 4NUQA 4N6QA 2IDUA 1XCQA 5B4MD 2ZKHH 1AZUA 3S4SB 4QXTB 1AACA 4RMUA 1VKXB 4CKVX 4KRLB 4NPYB 4FX5A 2F8OA 4QCIB 3T3MF 4QXVA 4S10A 3GBDA 5A2CA 3BAXA 3N6YA 2Q6WB 5BS0E 3I9GH 1VFBA 4AV4A 1NUGA 4CW1A 4GBXB 3FRUB 5AB1A 5SX5H 3DRTA 3FSWA 2AFNA 1A64A 1WAAA 4IOIB 4N0CC 4Y4HD 1DBKH 5DZ9A 2E6PA 4U1JB 1OSPH 3PPEA 4GSDL 4PJBA 5IEHA 2YMOA 1KDIA 4WJG3 3KLHC 2HCZX 4ZQKA 3S5YA 3SPVA 3BZFA 3IGAA 3VFMB 2A99A 4Y5VB 2WLZA 1MSPA 3SKJL 5F1KC 1H3VA 1EO7A 3ABZA 3HBGA 5FM5O 4QTHA 2VDPB 3QJOA 4ZO8A 1YY8B 3FTSA 1G84A 5DFVC 4RH4A 3T4AC 3JV6B 5T33H 5I24A 1Z9OA 4Y2DD 3UXFA 3T2NH 3TFBA 4OCMC 3VGHA 1E65A 3H4FA 4OGAC 1VGEL 1N59A 4DF9A 4I13B 2ZXBA 4G6AC 2NQ3A 3MSPA 1AJ7H 3SIKA 2E59A 3EJTA 1EDHA 3O0RH 5IHHA 1M9WA 4D0DA 5I74B 3L1OL 4KMQA 3OG4B 4S0SD 2CCLA 2PUQT 4Z7WB 1MWAL 1UACL 2D9QB 2EH8L 2E8YA 2F7PA 4Z7VB 2HMID 4QY8A 2H8PB 3HE6D 1KCVH 3WFHB 5I76B 1BXXA 5I16B 2EE0A 5IBUB 3ZDYF 4TNWK 2NR6D 4MXVF 4WFHE 1T7ZA 5BO0D 4JDEB 3SKMB 1MFEH 1JF1B 1QO3B 2CHZA 3GHEL 1PW3A 3BRDA 3GTNA 3HG1E 5FLVA 4FAAB 3ULVE 1MFVA 1WWCA 2F53A 5TDNB 4N2FA 3LEVL 4RFOH 4OBRA 3FT3A 2O6DA 3ZTNH 4DVRH 4MX7B 1MRCH 1TITA 3WLWC 1JRHL 5SWZD 2P7TA 4WU5A 3NACL 3VX1A 3HBZA 2ZUUA 3TBSB 2DQMA 2EKJA 4GT0A 4HT1L 2WXPA 4KQ4H 5HHOA 4P4RB 4F24A 1NMCC 4G82A 4KJWD 4NT6B 4L8BB 2R0WL 3QZWB 1URZA 2E74C 2R29L 5K59F 1ZVSA 5MEOB 3AT8A 1PKOA 5C6WH 2MNJB 1KWKA 1P4LB 5L9DL 2YWZA 3QNFA 5JXAH 3EAKA 1ECZA 4TPRH 4ZMVA 2OZNA 4F33B 1R4XA 4M43H 2UV3A 1MQKL 2XJKA 2Y7OA 4FQXA 2MTPA 5B21A 1G1YA 5JIIA 3CBJB 3M86A 4B53A 5I1KH 2CU9A 3V4UL 3V10A 1XSIA 1OTSC 3WAJA 1OT1A 4TUOB 4RGMC 2W92A 2PTTB 3B83A 5HDBF 3VFRB 3NCJL 1A7RL 4ADIA 1TO5A 1U36A 1NMBL 4LBEA 3GPSA 4Y1AE 2D3JA 3RGVD 4ZMTA 5DMKA 4HPYL 5MENE 5F7DA 3G3LA 3HN5A 4HGKC 4KPHH 1HOCA 5DK3A 1T89A 1QLRA 4XVSH 1OOAA 4PJAB 3GMPA 3IJ8A 3BUQA 3L3OC 3ROLB 1OP4A 4BQ8A 2E46A 2UY7A 3TV3H 2IXQB 1ZS2A 2EVJA 3LEYL 3VRIB 1TG8A 3F5WB 4K71C 4U1LB 4LLYA 4A2LA 4IDJL 1KOAA 3R18A 2HTKC 3G5YB 4S1DC 4DCQB 3H55A 4N9GB 5FM8A 1I1FA 1J9SA 4G80B 5E00B 1J12A 3GQFA 2RQEA 4GIOA 5ANME 2LVEA 4JB9L 5BRZB 5EU6A 5EDSA 5F6HJ 3GUFA 3HR5B 3P30H 3AM8A 2WXOA 1KTRL 2CO7A 1UJ3A 4L1SA 1A6WH 3QZPA 4QTIH 5B1JC 4RAVA 3GMNA 1HNYA 2BVYA 3RNQB 3VUAA 4LLYB 1BAGA 2XU9A 1OAZH 4Z0BH 3LB6C 5F9WC 5C0JA 2HZHA 1AR1B 1FFPB 3GLEA 4R83A 1N6VA 3AQDA 1OGAA 3O6MH 5I5IA 3FU7B 3AUVA 3OF6D 3ZGHA 3TA4D 2UVFA 3WUZA 1W72B 2YK1L 2UXVA 3ULUH 1AKJA 4IIZA 5EUOF 4ISVA 4DUWA 3A4FA 2IXQA 4IW4C 2OP4L 3V0JA 5C6PB 4JDVA 5ES4B 1MAMH 1T0PB 2FQFA 4A39A 4XB8A 2ATPB 3NA4A 2LAGB 4IS6B 2A83A 4NUGH 3VX0A 2X87A 8PAZA 4WGWB 5BRQA 2HUEA 3CZGA 2BNUA 2R7EA 4TNVF 1ETA1 5ID0B 1EJFA 2UWEB 2OJ1A 3I6KB 1WGOA 4XPTL 1YEFL 4TNEA 2FL5A 3LNFA 4GLRI 4P23C 3WU1A 4XNDA 3H7BA 4NUPA 1WO2A 2V7NA 4DP2X 5EN3A 3T2OA 1JPTH 5E8OA 2DQGH 4OLYH 3BAJA 1IZJA<