2BINA

Human p53 core domain mutant m133l-h168r-v203a-n239y-n268d
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
195
structure length
183
Chain Sequence
VPSQKTYQGSYGFRLGFLHSSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQEVVRRCPHHERSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Structures of P53 Cancer Mutants and Mechanism of Rescue by Second-Site Suppressor Mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 42
structure length 183
sequence length 195
ec nomenclature
pdb deposition date 2005-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2binA00
4IJTA 4QO1B 5G4OA 2VUKA 2RMNA 3WTVA 4AGMA 1TUPA 3D08A 1HJCA 5AOLA 2WGXA 4GUOA 4L0YA 1TSRA 2BIOA 4AGNA 5ABAA 4G83A 5AOJA 4LOEA 2OCJA 3Q01A 5KBDA 5BUAA 3WTYA 1EAQA 3WTTA 2AC0A 3US0A 2ATAA 3IGLA 5A7BA 5AOKA 3QYMA 1GZHC 1UOLA 1CMOA 2BIPA 3ZMEA 3QYNA 2J1ZA 2IOOA 4IBWA 3WTXA 4LOFA 4IBQA 2ADYA 4LO9A 2J1YA 2IOIA 5AOMA 1EAOA 2J20A 2P52A 2H1LM 3D06A 4IBVA 1H9DA 5ECGA 3KZ8A 5AOIA 5LAPA 3Q06A 2IOMA 3WTUA 3US1A 1LJMA 2XWRA 3EXLA 1HU8A 2PCXA 2J1XA 5G4MA 3TS8A 2BIMA 4HJEA 5LGYA 4XR8C 2FEJA 2J21A 3D07A 4AGLA 4IBYA 3WTWA 4G82A 1IO4C 4AGQA 3VD2A 2X0VA 1HJBC 4L0ZA 3VD0A 3D0AA 3D09A 3D05A 1CO1A 2YBGA 4IBUA 4L18A 1YCSA 2MEJB 2GEQA 4AGPA 2J6WA 1GZHA 3IGKA 2BINA 2XWCA 4MZRA 1EANA 2J1WA 1KZYA 3Q05A 4A63A 2AHIA 3KMDA 5G4NA 3VD1A 1T4WA 4IBTA 4GUQA 4IBSA 4IBZA 4MZIA 3EXJA 2X0WA 3WTSA 2X0UA 4AGOA 3WU1A 5AB9A 2BIQA 4KVPA 1E50A
chains in the Genus database with same CATH superfamily
2P5WB 2ZOKA 5FAAA 4KQ3L 1G9NC 3KM1A 1IBGH 2AJXL 3I85A 1MRDH 3JV6A 4J3OD 4YHKL 1L3NA 5AVTB 5FYLH 1TLMA 4FHBD 1T5XB 4F27A 3LNIA 2A4ZA 5IGXH 1RZJC 2XZCH 3HJ0A 1DTUA 4IGBA 5EC1B 3SPGA 2VDPH 5D1ZI 2DLHA 2P5EB 1KNOA 3EYOB 3IDJA 2Z7UA 3QZBA 1E9QB 3OJVC 4AQ1B 4XC1H 1FZOB 3R4RA 4LAQH 1HESA 4WWKC 1NCWL 4U1HA 1PEZA 5JHLA 3BN9D 3G5WA 3BH8B 3TYFA 4KZ0A 4GIPD 4X5PA 2VTFA 2JB6A 5ADPH 3QCUL 2Z0UA 5CHNB 4L8DB 4XN2A 4FNUA 1RIUH 4UDUA 3W0WD 1U95A 1V10A 4L1HA 5JXED 1ITCA 1IGJA 4F7TB 4XODA 3DTXB 4CVXB 1BD2E 5C86A 1B0WA 4L9LC 2JI3A 4MNQE 5I2IB 4OV6F 4WKZA 3VFSB 3TTYA 4CC1A 1JSYA 3EJTA 1JI2A 1MLBA 2GITA 4OGYL 4EI6A 3BFWA 1JK8B 4CMHB 4ABVA 1MFEL 1N7ML 1KELL 2G4EA 1IAOB 1JYWA 5GGVY 2PTVA 2YRLA 4HJ0D 4J3UA 1YPZF 2I26N 1SUJA 1XFPA 2VN5A 4RGOL 3STZA 3U82B 4AL8C 1DQDH 3ALPA 4YQXH 4NENA 2DDQL 3GXPA 2F54D 4NQEB 4TQ8A 5D9SA 3QDMA 4N8PA 3NUKA 2NTFB 3HI5H 4XMZA 1TJXA 1WT5A 3O2VL 3QHFH 3FRPG 3VXUD 4PJBB 2X9YA 4DOHB 2Y1ZA 5E2TH 1UT2A 5AW9B 2H9GB 5L2JB 3N85H 4XTRC 4ODXA 2ZCZA 3VI4E 2CGZA 3QHTC 5C09B 4XP6L 1U93A 4F37K 2NY1C 1NGXA 3NCWA 2PETA 3EO1B 3IDNB 4EZLA 3D85B 2FB4H 2MQ0A 2H3KA 1O7VA 3NK4A 4JPVL 3C08L 2BO0A 5FO8B 3FU7B 3BGFC 1WWBX 1WA2X 3UGEA 5KSAA 2CMRL 1S3KL 3AGVA 3QUGA 2IDQA 1K5NB 1ZANH 4BINA 3SJVB 3BH9B 4P3DB 2CHDA 3EXJA 4Q4EA 1CD9B 1ZVSB 3PGCB 4YEFA 3TWCL 5JMOC 1HWHB 1Y0LA 4U1IB 1OGAB 2FVNA 4LF3B 3MNVA 2XYBA 1N59B 3HE7D 3BMWA 2F6AA 1DLHA 2GY5A 4PRIA 3OXSA 3FOLA 4FE9A 3NFNA 5JORA 1CFTA 3EW3B 9PCYA 4P23D 1BM3L 4ZO9A 2UYLA 1Z9MA 4AC2A 3SDCA 2E76C 3GO1H 2J8UA 4NZRH 5IJVA 3HS0B 4AJ0A 4WO4A 1FYTD 3RAJL 3NQIA 3FOMB 4A6YA 4GG6A 5JIQA 5CD3A 1NUDA 2HVJA 4HIXH 4ORZC 1UVQA 2W9DH 1XGUB 3DOHA 3QA3B 3QO1B 5D5MF 3FNKA 2X4PA 4WFFD 1MPAH 4RWHA 4XO8A 4CVZB 4WFGE 1YEDB 2VR6A 5EIIA 1CB4A 1ML0A 1NAMB 3MJ9A 4HOZA 2DMCA 3GXMA 4A2GA 3WNLA 1A6PA 4JM2A 1VFAB 4QHNB 5GISL 1N0XH 1NLBL 2V37A 2YBRA 5ETUB 4Y4FC 3GKWL 1NJ9A 1PX8A 4Y5YC 4DUVA 3BZDA 4BRVA 3OXRB 1ZLEA 2OMTB 1S7WA 3BO8A 5E2UH 3DGGA 4LMQI 1DBKH 2WINA 2E9JA 2C3GA 4OU3A 3EYFB 4HS3B 1F13A 2X89D 1WBXA 4NBXB 2R2BA 4UNTA 4ZQKA 2WYZA 3ZDYE 3FAXA 3OGCA 1S5IH 3UFIA 4E9LA 1XCTA 5FUOL 1VGKA 4XOAA 1A6AA 2XFXB 4ZFFA 5E2VH 4G6KL 1G9HA 2EO7A 3E8UL 3H6JA 3LCYA 1L3WA 1BFVH 3E1F1 1FH2A 2WWKO 3IJSA 3QWRD 4LHUG 5MEOB 3EJYC 1H8LA 5IKCB 2CG9X 1BHGA 3D5OF 5CLXA 1RZ7H 4L8CA 4I5BA 1UWXK 2UZIH 3LS5L 4PJXF 1SDDA 5EWIH 4GP5B 3RA7H 3SY0B 3ZE0E 2BDNL 3CXHK 3IAGC 5JTWA 3MUGA 5LJYH 4LRNL 1A9EA 1BPLB 4R97C 4ZTPL 2IG2H 5JW5A 7PCYA 5SWZE 5TQ0H 2XNAB 1JCKA 4PLNC 4BA8A 3OKMA 3DMMC 3ECBA 4X8JA 1NQBA 1QOKA 4Y8AA 1U8HB 2DWYA 3IMBA 1BAGA 2D7OA 5I0DA 5F9DC 1KTCA 3ARFB 4Z7OF 1Y6MR 2KS0A 3H3BC 4N20A 2BNRB 1IGFL 4JO3L 1WE5A 4R8WH 3WIHL 4MKTA 4JG0H 1BQHA 3K0WA 5GS0C 1KCSL 5JHBA 4BD4A 1WIPA 5HJGA 4OZGF 3ARVA 3L5JA 4N0YH 5I0YA 3FQ2A 4ILDA 1PF3A 2KUTA 1JUFB 3B8YA 4J3XA 4DKEH 2RR3A 4YMPA 2WP3T 4KY2A 1ETA1 3KCPB 4UOW0 3OKNB 5HGHB 1PLCA 3MRBB 2C3XA 6CGTA 1F6AA 1YZZA 3D3VA 3T3PE 2OZ4L 3EBGA 1PNDA 4PRNA 5ISZB 4MJ6A 3MLUL 4PJDF 1E27B 2QKIC 4QOKE 5HJBA 3NOIA 4KOCA 1QRKA 1V3KA 2ZP0T 4XVUC 4OI7A 5MEQA 2VDLL 3DJSA 3UEQA 1CLCA 4TVPE 5I5MA 1NICA 3BLBA 3I6KA 1G6RA 1OSZB 1IKNA 4BH8A 4A2DA 5DQJB 4UBDD 2XXCB 4Y2NA 4LPWA 4ZBJA 3TIEA 2E7MA 4IIQA 3SQBB 3QUXA 5IOPA 3F7KA 3R1GH 2HFFA 4OLXL 5F1SA 3MRGB 3HG5A 5GRYA 3LEVH 4JPSA 5I73C 1A1NA 2QZQA 3UTSE 5JHMA 2CO7B 4K5NA 2YAPA 2X4QB 3MLWH 1S7UA 3MLZH 5B4MC 5E03A 5E4AA 4ZFGH 3N2JA 1CBVH 4B9KC 4JQIH 2ISDA 4DEPC 1YNLL 1JHLH 1EA9C 1M1XA 4NI3A 2Q7AA 3KLHD 2H32B 1DJGA 4MVBC 2E8YA 4M7JL 3BMVA 3N6YA 5LGHH 1NM9A 4G72B 4OLVL 1UD5A 2GIYA 1QQDA 1AJ7H 2ZNXA 4WI0A 3BPOC 4V1DB 4TKWA 3RP1A 5DC2A 5EZIL 4FN0A 1I3GH 1CQYA 1URLA 1DQQB 4XPHL 3HAEB 1M2VA 4XBPB 4JRXB 3N43F 2FX8L 5GSRB 1U8QB 4LLMA 2JVUA 5T1LA 4ZXBB 4WWKA 1U8CB 3P3UA 5GGTA 3K3QA 3VD2A 1U42A 1KPUB 4CADA 4NQVA 5DZLA 3V95A 2IDCA 1OKEA 4OM1H 2K3HA 5JW4R 3VYNA 3UTTD 3C5ZB 4UZGA 1KBBA 5A2KH 1KCLA 4KMTL 1A7NH 3M8OH 4ODVL 4M7KL 4OT1L 1HS6A 4Y4HB 2XWEA 4NLHA 1MY7A 4L9LA 4QRUB 2X4TB 4G7VL 5HVHB 1T2QH 2XPZA 3RGHA 4ZD3H 2R56H 3VXMD 1SOQA 2NXYB 1HNFA 1BGXL 2WLLA 3ECVA 3SDYL 4MX7A 1MCCA 2W91A 3ZZLA 5C08B 3CUPB 2VDOH 4YDKH 2V9QA 2VXVH 3VWKD 4PWJA 4RFEA 5FS5A 1AD0A 3L3KA 1NCAH 3GEFA 1ULVA 3WJLC 3RWIB 4N0CC 2IJ0C 3A6BL 4OLZH 4JGJA 3RX7A 3CH8A 3ZQ9A 5EG6C 4XAWL 1CJYA 1KJVB 1HT6A 3QORB 1CI5A 3OAYK 1MFUA 2HAZA 3SGEH 1KEMH 5E23A 4ZW7A 3GBNH 4PRDB 3IB4A 3L3OC 4YHYB 1OP5K 4MCYB 3DSFL 5EF0A 4OD1H 2KKQA 5ANMB 4Z3EA 4LGPB 4I1RA 4TQPA 3ME0A 1KF9B 5BV7C 2VISB 1RJYA 3D34A 1EFXB 4YVNA 4WUUD 3T0EE 1TVBA 3QJHA 2KQNA 5FK9B 3UPRA 4RMVA 3PRZA 4GSXA 2EICA 1KIRA 2A99A 2UXVA 4G2AA 4MRBA 5DRWA 3LEYL 2MCPH 3C5JA 4AJWA 2I9TA 4FZEH 4Z7NE 3IN2A 1BXXA 4PG9B 4LOFA 3LNGA 1WA1X 1FO0L 2VL5B 4KRNA 1MWAH 3HE6C 5C0BD 3P11H 3MUJA 3X3GH 5CXPA 5I6XB 2FBOJ 4HJIA 4HA1A 1HHJB 1I8KB 2DEWX 3R0MA 1NCHA 4L0PB 1CFQB 3EF4A 1R34A 2W80C 2EYSA 4JDTH 1OCRB 3X17A 2JWYA 5DRXB 4DO5A 5HYJD 3U0WL 5LNGA 2ARWA 7TAAA 1W0YT 4APQD 5I8CB 3S3CB 2G5BB 3ES6B 3UJJH 5TPWL 3KAAA 4NZFA 2KLRA 1ZIBA 3HHSA 2DBLL 4F8OA 2HRLA 4G5ZL 4WCYH 1A4AA 3MXWL 4UM9A 2R8SL 3C2SA 2JIXD 4HS6B 1KDJA 1NAML 5SV3A 4NJ9H 3TA3A 3QIBB 3V6ZB 4CNIB 4JHBA 1KFGA 1RERA 4KJWC 2XX0A 2HWZH 3BSZH 1GGIH 3INOA 4Y4FA 4MTMA 4CN6A 4MA8L 4Y5YA 1RSFA 1DO6A 4JFYB 3VG0L 4J4PC 1SOXA 3BVNA 2NUTA 3RNKA 4D0DB 3MRRB 4FXGA 2D3VA 3KYKL 4Y4KB 3WMSA 2DH2A 3IDMA 3AVEA 3BYYA 3VH8G 4XCFL 3VU1A 3IKCB 1BQKA 1NGYA 1MDAA 2NY6B 1EJOL 5EOQL 1XF2A 1JRHL 4QJ3B 4QAWA 5E4IA 4NO0D 3TZVD 1E67A 1X9UA 4EUPG 2C9XA 4MDRA 3SBPA 4P4KC 4AMKL 5F72S 2YRBA 1RJZB 1VF5C 3KJ4B 4X5WB 2TSBA 3HZVA 4TTGA 3FONB 4X6DA 3GIZH 3S4SB 2JCCB 5SX4I 2AMUA 5AW5B 1QZ1A 4AYGA 1XTLA 1WD9A 5K39A 1H8NA 3BQUC 1UADC 5IBUG 1YEEL 4JY6A 3KD4A 4BSJA 2EDTA 4OJCA 2VLMD 1BMWA 4Y19E 2HB0A 1HL5A 1DJXA 3O3UN 4CA4A 1N68A 3AS1A 2ENPA 2HT3D 2AK4A 4OZFA 1CR9H 1PY4A 2IH1A 2K6WA 3OX8A 4UILH 3F6JA 2F8OA 5ELIA 2JK5B 3DMMA 4JK0D 2VLKB 1G0XA 4HAKA 4BWWA 3L2NA 3W9EB 1ZOXA 3X3FL 2BVUA 1QO3A 3D2TA 3H4HA 3M17A 4HX1B 1VGEH 2I9LB 1NL0H 1CGXA 35C8L 4CAGA 4X6CE 4G6FD 2OJZL 1MDTA 2BFVH 4P57A 4L3EE 1P7QB 1XR9A 3W39B 3CFDB 3V0EA 2ICEB 2ADGB 5D4HA 3LSOA 5I1CL 2R0LL 1U8NB 4Z7QE 1J10A 3AS0A 4P5TB 4UTAH 2WW8A 4MSWB 2ZSWB 3V6OA 1TZHA 2IBGA 4X5QA 5F89B 4DKFH 3KW8A 1SM3L 2XN0A 2W60B 5B22A 3TLRA 4PV9A 3L7EA 1ED3A 4E41E 5ERWB 1NUGA 5DO2C 3H1ZA 5HTSA 1YNTB 3BCFA 4P59H 1RZFL 2GTWB 3RI5K 1N64L 1GZQA 1M9SA 3RVWD 1I82A 1BPVA 3PP3K 1S9XA 1SPDA 4ETQB 1FORL 3T77B 1OPGL 3KHQA 4OLYL 3GZPA 1LEKA 1F42A 4L37B 4DT2A 1KYOK 4IKJA 5H94B 5D2LF 4K9EL 4GAGH 4BZ1L 4U1MA 2QKIA 1UD8A 3EG9B 4P5MB 1FNEB 2I60H 3RIFF 2NT1A 5JHDD 5TD4A 2EIDA 2XPGA 3DSNB 3F12B 4M61A 4X0KA 5KSBF 2UXGA 4PJAB 3RGVD 2X4SA 5DXWA 2KDGA 3EBHA 2GEQA 4M5SA 5HHME 4MQTB 5C0AE 5F7HA 5MENB 1DEEB 5LQBL 2X7LA 4W9KC 5IHUL 3N40F 1E6JL 2XWCA 2NSQA 2J1WA 4G9FE 1H3UA 1ZT1A 3L1FA 3VAEA 4K94H 3OPZH 4RFOH 4G6MH 4LOUD 4XHQA 1QMUA 3U4KA 1S78C 2GIXA 4M5TA 4UAHA 5LAXB 2AS5M 3KR3L 1KXHA 3QSKB 1SJEA 2NPLX 1J9CT 2D7QA 4L3AA 1S9VB 4N22A 1NAKH 1P5VB 3DX6A 1O7DC 1E28B 1N2RB 2WN3A 4HHWA 1I3UA 3LKOB 1YY8B 3DO3A 3EO9L 3ECUA 2R0WL 3GSNA 4NKDB 4QO1B 4MXQD 2VUKA 1AI1H 1C5DA 5CR1A 5PCYA 5KYXB 2AXJA 3K72B 4HPOH 5D70H 4XMKH 3EBIA 1ZE3H 5A6IA 2XHNA 2EIJB 3LD8B 2AQQA 3PJNA 2NY0C 1J0JA 5LCVL 1JF6A 4FQ1H 1CDHA 1H0DA 1F6FB 2IAMC 4IU2B 3WO4C 4FFWD 1OTSC 3QUZB 4OKDA 1MCHA 1F1DA 1VAHA 5ES4B 2ODIA 2LV4A 4OUUB 3JTSA 3Q1SL 2CIIA 3JVFC 2OS7A 1IFHH 4M43L 1PLAA 4OM0L 2W92A 3EH3B 4JFPA 2VB5A 5BS0E 4HK3J 4W6WB 3GI9H 4GSQA 1LO5B 4UOJA 5I6MA 4PV8A 5KVGL 5B38B 1MI5B 4JBSA 4ZZKA 5EBMB 5I0VA 1K2DA 4XOBA 5I74C 4HALA 1SHSA 1U33A 3O8XB 1MIML 1MFAL 4HCRA 3MLYL 2MOVA 4HDIA 4UQEA 5HI4C 1OSEA 3E6FB 5KN5B 1ZXQA 1H3XA 2QPUA 3ASOB 3BCDA 2E7HA 4J8RA 3QRFM 1WAAE 2FGZA 3WIIH 1MUJA 1GTNA 2WIIA 1II4E 4FA6A 4MA7L 3NACH 4QTIH 3ULUF 2YD1A 1I1AB 2LU7A 4F2FA 1FLRL 1LO3H 1QFWH 1C1EL 1Q9LA 2AJUL 1DHKA 2ZCKL 5E6YA 1ZSDB 1I3VA 4E0RA 1XCQB 3QIUB 3BDBA 4MD0A 1ET8A 3VYPA 4G43A 3GS4A 2DWEB 1VFBB 2X1XR 2TSAA 1CICB 1MF2H 3P2DA 1MRFL 1D7BA 1XH3B 1CGTA 2QPFA 3SYQA 4MMZB 4JKMA 3L3OA 4I3GA 2QSQA 1LM8V 3RHWF 1Z66A 3ZIYA 3NJIA 3V9FA 3Q8EA 2EKSA 5GGVH 3NJHA 2BP0B 1KJ3L 3GFUA 1D6VH 1J5DA 3B7RL 3P0GB 1JXGA 1UM5H 4OJEH 5DJCA 3WKYA 1P4IL 1TKWA 1EGJA 5C0CD 1WLHA 4PP2B 2X3CA 4UIKL 4K3DH 2M1KA 4NO5A 1TQCB 3IDYB 3I6LD 4CW1B 3QDJE 3MVSA 3HE6A 1TQSA 3AM8C 3O6FC 4M1DH 1GKEA 4UMGA 4BYHA 2Y1AA 1X44A 3D39E 5I1JH 4GAJH 1A5FH 2QPSA 3VFGH 3ARTA 2WJ7A 1NEPA 3APMA 3DOSB 4N68A 4PH8A 4KUCD 1REIA 1UM4L 1SVBA 1MCPH 4MMXC 1YA5A 3C5SA 3MKKA 4J3OH 4FMVA 1UFUA 2AFNA 1O6VA 4CDGC 2VM9A 4WGWB 5DQDL 3FMGL 3Q44A 1T5KA 2YUZA 5D8JH 3NZHL 3LKSB 1HZKA 1UURA 4F58H 4MA3A 4XN7A 1AZUA 1D5RA 1Z0NA 3KWUA 4U1HB 1W72H 3IFLL 4NN6C 1KCKA 1G7PB 2JB6B 4KQ4L 4J4PA 2DW5A 3L4XA 3BAEH 2VXQH 1AACA 1S9YA 4ZFOB 5I82A 4QRRB 4RGNB 2J1ZA 1M6OA 2QV2A 1WO2A 4N2NA 4NPJA 2YGPA 1Q0YL 4F24A 1NC2A 4G3YH 3LZFH 3WUWG 3BN9C 3HA0A 1IGIL 4HUVB 3H9SA 1MFVA 3JXAA 2X6CA 4HKBB 4P4KA 2A77H 3V52H 1FNAA 3S36H 1EZVY 1JGEB 4JG1H 3TO2A 3MMEB 1JZ5A 3ULVC 3BD5A 1SFHA 5JXEC 2O61A 1LJMA 1AGDA 2YPLA 1U21A 1N9PA 2CUHA 1QYGL 2AI0H 3HFMH 5AENA 3BQUA 4IRSD 4L4JA 3STZB 4PLOB 5EZJA 3FAWA 3H56A 3ESMA 4NENB 3D48R 1DJHA 4EI5D 3ZO9A 1I4FA 2JQZA 4NDMA 5IFHH 3U9WA 5D7IF 4KJPC 2B59B 1BIIB 4JKLA 1QFOA 3BWUF 5DGQA 2C4XA 1HI6B 4H25B 4F8QA 3S88H 5IBTH 4NZUH 3BD4A 1XL4A 3GXDA 4BHUI 2HXAA 2VLRD 3AG3B 4HU2A 5D1ZB 1M1SA 3G7TA 1NGXB 4R84A 2PKDA 1MLCA 3JYCA 5I1EH 2DQFB 2GK2A 3OLEA 3EHBC 5DSCB 1JGLL 1AXTH 4FLHA 3W57A 1EEQA 5TGBB 3GB7A 2UWEF 2X1OA 2I5YL 3LAFA 5D7HA 4JHWL 4NEHB 2H26A 5CWSA 5T1MA 4BXSV 4OZHA 3K0YA 3QBTB 4X7DC 3ROOA 4RCAA 4AITA 1Y0LB 1L0QA 5LXVA 4W4OC 4I0PD 3MNVB 3QGVA 3WD5H 2KH2B 1E9OA 4PV1C 3OWEA 1HHKB 2JLLA 3OXSB 3K2IA 1IVLA 3QAZC 2O6CA 2ZD0A 4O2EA 4TUUA 1FGNH 3JQOB 4NZDA 4ES8A 1T5WB 1OAKL 4JY5L 3WN6A 3PHSA 1YEGH 2XTSA 4MGXA 3EYUL 5HDBB 2P8MA 4WO4B 5DFVD 2IANE 3HE7C 4A6YB 4GG6B 3RVTC 3BZ4B 5CD3B 3U1SL 2HVJB 4P46D 4HEMA 5TE7H 4ELKA 3HZMA 5E9DE 1OHZA 4H1LA 4KBPA 2GUOB 2YK1L 5G5DB 4YLBA 5EIIB 1YPZE 2DI8A 1QFWM 3W82A 3AB0B 1BVKA 2NY7L 4JE0A 4KNUA 3S5ZA 1QLRB 1ZV5A 4XE5B 5GGRY 3IJEA 4H8HA 3ATAA 3I2CL 1PS3A 4M5ZH 4S1SH 5HHVH 3EYSL 3OZLA 3QEHB 4QI3A 1F4WH 3INUL 5AYQA 5DZ9A 1OAXH 2RALA 4JR9H 2NCMA 4PTUA 3UX9B 4L8BA 5CSZB 3BO8B 4UCFA 1S7WB 4KV5E 4AT6B 1QSED 1UTDA 3MLVL 3PWPD 3FQTA 4WZ9A 2SODB 3O6LH 3P9WB 1YAZA 3CSYB 4QAMB 4WW2A 1WBXB 4IHBA 2R2BB 3P54A 3VQ2C 1AQ8A 4OV5B 3FFDA 5BVJB 1EXGA 1XGYH 1FL3A 1AG6A 1QFWI 3SD5A 4ZFFB 4B9GA 4L5FE 1UXSA 1N0LB 4Z7WB 1I9EA 3DI2B 2Z91A 5AVUB 4KKNA 3EFDH 4RWYH 1DSWA 3DPDA 3VXSD 4YPJA 1J8HD 4AYID 2VDMB 5FO7B 1HILB 2NY2D 2BS9A 1AO7D 3OAUL 5KS9F 1MW3A 1E5YA 2G30A 3DV6B 1UWGH 1W0WA 3TNNB 3BZFB 1FYTE 4HFUH 2NY5L 4JMXA 1A9EB 3WFCH 2WSDA 5JW5B 2QADB 3FTZA 3ZT7A 1S46A 1ZTXH 2WZ0A 3OKMB 3L16A 4OLWL 5IVOA 3ECBB 3N1GC 1MXDA 2K1MA 4WHTA 3GSQB 1J0HA 2QQQA 5F7DB 2R0KH 3PS6A 4M29A 1ZEAL 2H6OA 4CU7A 2CKBB 1BZOA 3UH8A 1MREH 2R51A 2AQPA 3G6JB 4IBSA 4P3CL 1U2HA 1VPOL 2B1AH 2X40A 4HJUA 3PWVA 4K73A 2CLZB 5INDB 5DF0A 3RUGB 3FCUB 1D7CA 3MA7A 3ZHDA 4X98A 3IFOB 5T5FL 1ICTA 2C1OA 5T33H 3TBVB 5DA0B 3QDGE 3WFEL 4MLIA 4I18A 1RD6A 1OAYH 4K2UL 5TE6H 3ZQWA 4GQ9H 1UH3A 4NQXB 5D55A 2FLRT 4KI1A 4MXVE 2AEIT 1NPJA 4FQLH 3SCMD 2RMNA 2YC1A 3GD1C 4YE4L 3CFCH 3ENEA 3JWNC 1SF5A 3RURA 5IQ7H 5IHZB 3TBSA 3QJQB 2I07A 5DC0A 4TNVF 4BFRA 4FQ2L 3VJ6A 4OLUL 4I4WB 3II1A 3LRGA 3QRGH 4NRZA 3OZ9L 4LDOB 5GJSH 5IMOA 3B1UA 4OTXH 4HWBL 4M1CC 3Q3GA 3BZEB 5FX3A 2FUQA 3O4LA 3UADA 5L7XL 2JJTC 5FA4A 5ABDE 1BECA 5I16A 5JW4N 2IC2A 4KRPD 4BH8B 2CLVA 2A4CA 3MODL 4L05A 3GLDA 2AV7A 3PHQA 4PJXE 5EUKA 5CP3H 4JFZL 4IIQB 3RTQD 1V7NL 1ZTXE 2IDTA 3MA9L 4BE5A 5K69A 4PJGA 1UXMA 3ETBF 5F21B 1NANH 3O6FA 2V3FA 3HB3B 3VGAB 1M53A 1KXTB 3KYOB 2H1LM 3KVQA 2H2SD 4M6OL 2Y7NA 3PIQB 5ACZA 4UBDC 4NQDA 3VXNB 1FIGL 5J57B 4O4YH 3RTLA 4OF0A 2NYYC 1N6QH 5D7JD 2WXPA 5MEPB 2E6PA 3OMIB 4HF5L 4KTGA 2BSDA 2M26A 8CGTA 5D1QE 5JYMA 1JYNA 1FAKT 5AQ0A 1C5CH 2Y2YA 2DIEA 5AVWB 2NDGA 3RVXC 3H7BB 3C6LC 2EABA 3WBDA 3RX8A 4AYEC 4ZS7L 3KLHC 4KI5D 2A6IB 4JM2F 4L2YA 1AOZA 4LLMB 2BOBB 3GSWB 2G2RA 5FC9A 3VGHA 2Y7QB 3D0AA 3UG5A 2UZPA 3L6FA 2DS4A 4FG0A 3NIGF 2DV6A 4WJ5A 3CSTA 4Q6IB 4LSQL 3RL2A 4CADB 3QI9C 2ESVE 4PBDA 1S7SB 4KUZL 4XC3H 5IMKA 5L8LB 5FGCE 1DQJB 3OKYA 4ZFOL 1CF8L 4IEFA 3LB6D 1EHLL 4PJDE 5E99L 3MGTA 3KLAB 3DPBA 4LSRH 1GJIA 4C8XA 1X5KA 1ZRUA 5F88A 5T1KD 4ZMPA 2GFBB 2D9CA 4LPXA 3TURA 4MX7B 5HDWA 1CG9A 4F20A 1MQKH 3F83A 1M2OA 4AIZA 2DD8H 1HSAA 5JXEA 1Q0XH 3QUKA 3FT4A 3U6XA 2FZ3B 4HSCX 3DXAD 4YBLB 3PWUB 4YIQA 3RFRA 4WFHD 3RX9A 1KBGH 2DQIL 3P02A 3DGCR 5D96C 1ZLWH 3T4YA 4AVJA 3STLB 3VGEA 1B0IA 5IVZA 2A9MH 4DKAA 1HZLA 5BRZA 1JZFA 1AQDA 1SMAA 4FGMA 1NBYB 3DX4A 4GW5B 1T0OA 1QFUH 2WWKT 4RMSA 4X4XB 3L9EA 2LE9A 4N2IA 2IDSA 2H6PA 4AYSA 3BRGC 3TEZA 3UAJC 3F7VB 4Z5RB 15C8L 3ME0B 3STBA 1BA9A 1QRNA 1L7IH 2BHUA 3JYBA 5FYKD 3OWRA 3DX8A 3H54A 1A7BA 3MOBH 3IGLA 2BW5A 2NNRA 1KIPB 5DJ0B 4M6NL 3WEAA 3AAZA 1YN7B 1GW6A 4N0UE 3BEVA 3BGFB 4P48A 4EN3B 1S9WB 4GQZA 3T8VA 1JJUA 1XAUA 3ZX1A 2YA0A 3C5JB 2AKRB 3L1OH 2I9TB 3A67L 2DYPD 2C4FU 3C60D 2X2IA 1W2KT 2FX9L 4GAYA 5IROC 4GEJA 5J5EA 3NJKA 4W4OA 4YZFE 4AEFA 1J9RA 3UYOD 3BP6A 5I26A 3DUHA 1NIDA 1BIHA 3VXOA 3N9GL 3RWCB 4WWID 5IB5A 4N1HB 4JJOA 1A4KB 4B50A 5F96L 4FABH 5I66A 3ARRA 5G4MA 1RU9H 4DGUA 4RISH 4AEHL 4PJEA 4HLZG 4ZAKC 1DUYB 1QD0A 4LQ1A 2V8LA 2GJJA 4JCLA 4ZX3A 2Y7LA 2N3JA 4Y9CA 2A6JB 2J88L 1PKQB 4M1GL 4GQPH 2P45B 3LKQA 4HWZB 1TXKA 4I2XB 5CP7B 3U0TA 3JWOL 4HIQA 4MCMA 1W8EA 3EZJB 3WEMA 1VKXA 4HMDA 1BVLB 1MCEA 3CDGA 4Y16D 4HC1H 3LH8A 3PWNA 3ZTDC 2FWLB 1MRCL 2HLFD 4WGVB 3G08B 1CL7H 1A1MA 2D31B 2A3TA 4P9HL 3Q05A 4HIHA 4U3CA 1KZYA 4Y4FB 5T3XE 4DP7X 4KH2A 1CLOL 3BYTA 1JXDA 2B4CL 3MROA 2XTJD 3HVNA 1LDPH 1T80A 4XVSH 3IDMB 1IL1A 4PQXA 1DSYA 2P49B 1JBJA 5TDPB 4KKLD 1FPTH 4NFDA 4G7QB 4Q52A 3ZLQC 4CBPA 1NGYB 1UC6A 4PM1A 2Y5TB 4TQEH 3OGOE 5AB9A 3UTQA 1P1ZB 3GRWH 4GXUM 1UM6L 3U0PB 1JHKL 3KXFB 2AXGA 4DGYH 3NA9H 2JJSC 5E9AA 4PW9A 1L0YA 2GJ6B 2XLLA 1Q72L 2V2WB 4KROC 1E2ZA 2X6MA 2J56A 2XUWA 3KYNB 3FH5A 1K8DA 4I3RH 3DBXB 3B56A 2BIOA 4MNGA 2D4DA 4EAEA 1HNGA 2VR4A 2VDML 3BP4A 4GBXB 3B5HA 3CU1A 4OZFG 1Z9PA 4KVCL 5C3LD 2QVTA 4IMKA 4DK6A 2KPWA 3VFTA 4R97B 1DBAL 1DBBH 5HYFA 4P9ML 3D7PA 4LDLB 1EAQA 3OX8B 4UI2A 3ZE1E 3NZ8A 2VM3A 1E2VA 2ZWZA 2ZXEB 3BKYL 4JPKL 2XZAL 1FRGH 2A74C 4M93B 2FX7H 4OF5A 4OZ4B 2EUZA 4S10A 2CKBL 1ORQA 2F53D 3S34H 2JMRA 1BOGB 1KC5L 4ZOBA 1ET7A 4GW4A 3LSOB 1QACA 5E56A 3O6KH 3ASNB 1WGVA 2XSKA 1CD1B 3TBWB 4OFKA 4QF1A 4R0LC 4DP0X 5BQ7B 2Z8WC 3GLZA 4IOFD 1J1XH 2C3VB 5LGJB 2ZKHH 3S3PA 1H5BC 4R83A 4P2AA 4UTBH 5T3ZE 5B39A 2NXZB 5MERA 1KBVA 4GG8A 4ZS6C 2DTML 3WN5C 1U36A 2C7FA 2J8OA 3IGAB 1T0MA 2LGNA 3P4MA 4YHOH 4W6YB 4Z77A 1UA6L 1JPGA 5DUJA 1NCDL 2BVTA 1FNGB 2VJXA 2CDGA 3L4VA 2WO2B 4X6EA 3RU8H 1LEKB 4P07A 2IF7A 3N41F 3L1EA 3GEWB 2BLFA 3HZYA 5E24E 3UTZA 1YC7A 3UPAA 4JO1H 4DVBB 2OTWA 3ARBC 1EEYA 4YN3A 3VFOA 4M61B 1GPOH 1CLZH 4LEOB 5AKRA 5FV1L 2AJVH 2JJTA 4PBWD 5IR1B 2X4SB 5CCGE 3GHEH 2J5LC 3VUAA 2W8CA 2H8PB 2VMCA 1Y18A 2X7LB 3PL6D 3QG6B 4WJKB 4H40A 1PLGH 3EZ8A 1DVFD 1ZT1B 2PO6D 5HDLA 4F2MB 5C0EB 5J9PA 4U1SA 2F7QA 2AQNA 3TYGL 1IEBA 5CGYD 2O5YH 4HXBH 4AGOA 4KMLB 4UB0L 1D6EB 3TNMA 5LLIC 1BV8A 4UT6H 3DX6B 3UGUA 1CDBA 2AJYL 1GS8A 1D9KC 3PQYA 5JPMC 1F2QA 2OMWB 4MZ2A 3T2LA 3UYRH 1F90H 2VNCA 5D7LD 3FU9A 3GSNB 4OVVA 3GRGA 1G9NL 1FZMB 5EU6E 4K7PY 2PYED 4GI6A 1HL9A 3BPOB 5I1KH 1EQWA 3LHAA 4PWFA 3C6LA 1X7TA 1RZJL 4Y5XB 1H19A 1OM3H 4Q4IA 3ET9F 2MQCA 5F1NB 5EEYA 1HKFA 4LEXL 1FGVL 2H0EA 2Y36H 3LZOA 1JWSB 2R83A 3KPNB 5FUZH 1MRDL 3R0NA 4FNQA 5FYLL 4NM8H 2CIIB 2CNZA 1HQ4B 1BJ1H 2WKGA 3QO0A 2R29H 3VYOA 3QI9A 5IGXL 2XZCL 4AQAA 3T4AB 3MREB 4ZMZA 2VDPL 3M88A 1Y6KR 2OR9H 3KPRA 4DP4X 2GAZB 4JL2A 4X9YA 3PGDB 3ESOA 1XVSA 5D2LE 4PV8B 1KB9J 4XC1L 1FVEA 3S8FB 1AYOA 5JIMA 1P4LA 3FTXA 4LAQL 2W59A 1K2DB 5A16A 3ATDA 3U9UB 5DJ8B 4UV4H 3CMOH 4YDJA 4JFQB 5ADPL 2O6DA 5KSBE 1OQXA 2X44D 3P4LA 1UATA 1KCBA 2KDYA 1RIUL 1SGKA 1MUJB 2WIIB 2G3NA 1QFPA 2WK2A 3BH4A 2AQ2A 5HGAB 4AL8L 4BUGA 3G6DH 4HKXB 4N28A 5LVEA 1KIUA 4ODUB 5IHBA 3MLTA 2EEAA 3D2UA 2OJEA 3CLWA 2VMJA 3DYOA 3QXAB 5BOJA 2AABH 2XWJA 2JKJA 4PRPA 4NAQA 2VDOB 5FHAH 4G43B 4N1CA 5H37A 2F08A 4XX5A 4DTGH 2JLPA 2WLIB 4G8GD 4OQ1A 5GXBB 3FO0L 2WIMA 3CCHB 4OJYA 4YVUA 5SWSA 3QHZH 2V8MA 5GS3A 1EDQA 4OIAA 1DQDL 2X4NA 3FB5A 4YQXL 4TS6A 4X83A 3UAJA 5JIHA 3ECQA 2EAEA 3MKGA 3ZTEA 3LIZH 4XCYB 1WHPA 1G7JB 3HI5L 5CFAA 3QHFL 4TOYL 1ZV2A 3QJUB 4GRLB 3VFMA 3KW7A 1YAIA 2VJ0A 4U3SB 1BQRA 3G3LA 3O45A 4WWOA 2ZXDA 1KTKE 2NDFA 3KS0J 2XXGA 1M9WA 3ORJA 3Q8AA 2EVJA 1W0VB 5JPNA 4X42A 3IT8D 1E4KA 5IMMA 3DNKA 1KLFB 1X9LA 4WUUA 5IROA 2FB4L 4ZPVA 3TBTA 4LDEB 3TFBA 3MQIA 1YNKH 2PCPB 3HJEA 4X6BA 2CO3A 4JFFE 2EC9U 2IV8A 5HDQH 2GSMB 2OMVA 4JFOB 1ZANL 2YZ1A 4XWOD 1QLFA 2QR0B 5IOKA 2Z31C 1MWAB 4ZAKA 1D5IL 3IRPX 5TQ2H 3V9EA 1SJHB 4JFDA 5C6PB 2ID5A 4FERA 4LCUB 1MEXH 2VITB 5DHXB 4IBLT 3BUIA 4WSGA 2OQJA 2NZ9C 1GGTA 4ZMYA 2WYIA 2HLEB 3PY9A 5EHFA 1EXHA 2BRRH 5DLLA 5EBGA 1TZOA 4F7MA 3GSRB 5BNXD 5F3BA 4NZRL 5DJAA 2A9NH 1BZ9A 4JFTA 3RWEB 5E2WH 5AOKA 2X4UB 4MJ5A 4HIXL 2W9DL 1IEAB 4HUNB 1MPAL 5F70A 4U1KB 5DD1H 1S9YB 1DBMH 3WFHB 1VENA 2DKSA 1N8OE 2VLJA 4BQ9A 1MFNA 3MV7B 3N06B 2NNAB 3S35X 2Q0ZX 2IH3A 1H3GA 1HE8A 1N0XL 3DX1A 2IEPA 3DI3B 3HG1E 3ROLB 3I9GH 3JWDC 2VSDA 2GKIA 4XMXA 4JJHA 1CFNA 3VXRD 4P4KB 4M9OA 2X9ZA 4Y2DA 3UYPA 1ZVYA 4YSAA 1PX3A 4TPRH 2I7OA 1DBKL 3VACA 1Q9WB 3N0AA 2BXZA 4PJBF 2D9QB 2D8KA 1NCGA 2YPLB 3FL7A 2OMZA 3B83A 4NQED 5DZJA 3CLFL 2F8XC 1BMGA 1JE6A 3NFPB 2WZPD 4MJJA 1C8QA 2DH3A 2J55A 1X5AA 3CQPA 3SEPA 1I4FB 4G82A 1AIFA 4DP9X 3UTPE 4QYOA 4EKJA 1I9RH 2FYVA 4EE2A 1AD9B 3MAWA 5E2VL 1IAKA 5C09D 5C9JA 1BFVL 2GI0A 1JG9A 1O5PA 3HZKA 1E4JA 4O51B 4WK0B 3TXAA 1RZ7L 3UERA 2A74A 4XXWC 4J27A 4EI5C 4NCC1 2ZT9C 5E6IA 1EWHA 5EWIL 4PJIA 5HJDA 1FG2A 1NEZG 3RA7L 4PJ9D 4WI2A 4JAMA 2OPCA 4HH8A 3U36B 2Y3NA 1Q38A 2IG2L 1YJDC 3NFSH 5TQ0L 1UZ8A 3W5NA 2HTLC 4J6RH 2CJUH 1OGAD 2NOYA 2R9HC 4MNQA 4RRPG 1HQRA 6TAAA 4ZT1A 2RJMA 1H5BA 3L9RB 1YDPB 2JKTM 3O9WD 4N90E 5KYWB 1RIHH 1TENA 3L4YA 3MRCB 2EE0A 4L4TB 3WN5A 4L1LA 2PP7A 1KTLA 4FFZA 5FEBA 3BVWA 3CZJA 2Q9OA 3MYZA 1RJLB 4R8WL 3FS9A 4FQXD 1UD2A 5GIRB 4LE8A 4F7CB 3VGBA 3IFPA 4JG0L 5AVZB 2RA1A 1J86A 2ED9A 1ZS8B 5HD8C 4JZJC 4OFIA 12E8H 3EJCA 5EBLB 2C5DC 4OIFA 3V8OA 3MLSH 4H2AA 4PWHA 4F7PA 4N0YL 1S5HA 4RAUA 3QEQD 2Z35A 3WFDH 2GIMA 1QWNA 4HUUB 1FUNA 4DKEL 1E6OL 4YGAB 1XT5A 4H1LG 1KPVA 2OW7A 3HZMB 3FN0H 3C9NB 5BZWA 2FH6A 3ARBA 1HWWA 1GOGA 2XY2A 4LK4A 1O6SA 1RUML 3TJPA 1RQ5A 3IRZA 1CE1H 1F11A 2Q3ZA 4GXUN 1YMMB 1VHPA 2KHAA 1HE7A 3HHRB 5GQBA 3BPNC 2WJ5A 2UY6A 3T0EC 2RGSA 4HT1H 1KXQE 2Q76A 2R15A 1UXLA 4PTUB 4Y2LA 2BP8A 4CRPA 1BLNA 1CVSC 4POUB 2F1AA 3FO1B 1E43A 2IXQA 3KL3A 1D9KA 3R1GL 3ZYJA 4CMMA 5JPMA 3SGKA 3FZUC 4Z7VE 3LEVL 4DCQB 4OGZA 3T2OA 3VTAA 2FWSA 1FL3B 1XEDA 1BW8A 1YMHB 3LHPL 4IRJD 1KJ2A 3MLZL 2HFGH 3MLWL 4MCZA 4EDWL 4LHUD 1KY7A 5GS2H 3RWJB 4ZFGL 1CBVL 2R2EA 3QC5X 1CYWA 1DYZA 4JQIL 3S2CA 1RCYA 3H53A 1JHLL 2NY0B 2JJWA 5KVEE 2IAMB 3L5IA 4IBYA 4KKAD 5CCHE 4UWQB 3WO4B 2ZCLH 1HJBC 1T7YA 3QFJE 3QQXA 2BNQD 1P5UC 2P7TB 3QW9A 5LGHL 3U4AA 3G5VB 1QW8A 5I76A 3IS1X 1AJ7L 4QRPB 4DVRH 2UVEA 1DQKA 4B60A 5CFHA 3QXVA 4WU7A 2NMSA 3P40A 1E30A 5F9OH 2PCYA 2BY2A 1ZHBB 2VDQH 3ARFD 4Z3IA 5FDWA 1RK1B 4J28A 3GRBA 3MV8B 3WG7B 1LDSA 3AWGA 2BNRD 3HI6H 2QPDB 4C56D 4FHKA 2QTVA 2X6AA 3GMLB 5IESH 1XGZA 1DJSA 2OL3A 2ZX5A 4FZ8H 3PWVB 2GBVA 4YHIB 4DW2H 3TX4A 5K1VA 4I0CC 4WRLA 2VW7A 2EDQA 3T0WA 4XCNB 4X98B 5EB9A 1A7NL 4B3VA 3M8OL 4WO0A 3TBYA 5HY9B 2GB2A 2BZ7A 4ZODA 1XH0A 3VRLE 5BVPH 5DJDB 5J1AA 3ZRSA 4ODTH 1KLUA 1BBJA 1T2QL 1YQ2A 2FRGP 2YARA 4YL9A 4ZD3L 2P4AB 2R56L 1QI5A 3ZE2B 1G94A 2WWMD 2YC1B 3IDUA 3LDBB 1F18A 4PLJC 4CSTA 5FO9A 3NSJA 2O5XH 4NQCB 3GPSA 4QLRA 2VDOL 1JHTB 4X4ME 1KG0A 4YDKL 3VXPA 4BA0A 2VXVL 2C3WA 3U2SB 1SEQH 4M7LH 4N2CA 1WGOA 3VJ6B 2VABA 3QT2A 2PR9A 2EDYA 4Y1SA 3SCMC 4KK8C 1O9VA 3BGMB 4MDIB 4OLZL 1I1FB 3B9KC 3GUTB 5EUOB 1OAUH 2YAMA 4E9SA 2X5PA 5HHQB 3ILDA 3DRQA 1G4RA 3Q3GB 1A2YB 3EOAA 4WWPA 1DCLA 1I3RA 2HJLB 2BSSA 3I3EA 4PVNA 4ZX6A 1W8OA 2QVIA 4HG4K 3GBNL 4XP4H 2C8NA 3P1VA 2CLVB 1CLYL 3FO2B 3ZRFC 2PTTB 4OD1L 4XE0A 4M8VA 5KS9E 5F7MC 4FKHA 4FFTA 4EEEA 5J6HB 1WRFA 4BJLA 5LNEA 2IO5A 3O6FB 3KPTA 5DURB 3S7GA 5J11B 1BJMA 2EIKB 4IBVA 1J12A 3RWHA 4N2KA 5TF1H 2NX5D 2ROYA 4NO2B 2ZJSH 2APFA 2F58H 3T65A 4NQDB 2VXTH 3VFPA 4W1TA 3RTQC 2MCPL 4FZEL 5DUBA 4V1DD 5CEZD 2L7JA 2Z31A 4MMXB 1MWAL 1RZQA 4JRYE 1SLWA 3P11L 1IFRA 3X3GL 2CIKA 2YEZA 4DN3H 2CCLA 3REWB 4C4KO 3B3IA 1M56B 1EUTA 3CHOA 1YYCA 3LH2L 4NC1E 4ZXBD 5E6ZA 2Y6SD 2ZUSA 1KZQA 3VU2A 2MIZA 5EFIA 5D7JC 4R5XA 3IMTA 4G1EA 2PWEA 2BS8A 4JFXA 1NMAH 4XBGB 3EAKA 4JFWA 4I88A 1CYGA 2NSXA 2XQBH 4H5SB 3IETA 3R4DA 2FH8A 1INQA 1XGPA 3CSGA 3RWDA 5I28A 4MA1C 4WCYL 3X12A 5IHLB 5IMKB 1NGWA 1FFNA 1MFDH 4WW2F 3DRTA 3I6GB 1B4TA 1NFKA 3O3DA 4NJ9L 2ZP8A 4NQSA 3QWOA 4PJ8C 1TQVA 2YA2A 5FECB 1Q8MA 3UTSA 2WVSA 4H8WH 2HWZL 3BSZL 1W72B 5KANI 1T2XA 1F4AA 1ZLDA 3O11A 4UUJA 5KVFH 5I6PA 2ARJA 4N86A 4FXLA 5HI5D 1N12A 3SE4C 5I71C 1B3JA 1CG9B 2CE6A 2J73A 2FJUB 3MX0A 3W0WB 5BO1H 1K8IA 2AK1H 1U8MA 1WICA 2O26U 3EOBA 5HPMB 5I1LA 2WUBH 3MNWA 4GUOA 3HR5B 1GC1C 3LQAC 4N5EC 3KNBA 5TK2A 3VFWA 3WO3B 3K6SB 1EXUB 3FB8B 4ZYKB 3T4YB 3KPPB 4X9BA 5I8EA 2B1HH 2Z4QB 1RURH 5C0ND 4NKIH 1COBA 4P0DA 5E94A 5IVZB 1P53A 1LTXA 2MSPA 3GIZL 2E56A 1RLBA 1S7XA 5AAMC 3R7QA 3QR2A 4GH7B 4KAQH 4QXTA 3OD3A 3NG5A 2YS4A 3KYMA 3MU3A 2F54B 1OARH 1XTMA 1YY9C 4OGAC 2RD0A 3O3EB 4UV7H 3VXUB 1KLGA 1JPTH 4MAYD 3WV0A 3LZQA 4XGZB 3EHBB 1YC8A 2J12B 1CR9L 4L1BA 4C57C 1F3DJ 3ULAB 1M7IA 4Z8FL 4UILL 3SODB 2J1YA 5IMLB 1HXMA 1PD6A 4KKPA 3OB0K 2VAJA 1PVHA 3NIGE 1YLBB 1X6LA 1VGEL 2BOCB 1NL0L 3DVGB 3V7MA 5MI0C 1NFDF 1NEUA 3BZ5A 3TTSA 4NFCA 4TUOB 1QTPA 2PR4L 2YD2A 4Z95H 4UTAL 3OR6B 4IOIA 2VMEA 1MWOA 3VXTA 5I66B 4ZX4A 3RZCD 5I0WA 4DKFL 2A2QT 1HIMH 1R5WA 4JZJA 5B1JC 4XBMA 2NNXA 1S8DA 4PJEB 1B88A 2ATPB 3M07A 4UT7H 2XI9A 1NC4D 3F2LA 3HE7B 4PJHE 3VRIB 5CBAA 5E9NA 1DP0A 1YVLA 3BUYA 4P59L 5I1AA 3VSVA 4P2RE 4FQIH 1BVZA 4LDCA 1LD9B 3ULSB 1NWPA 5CZRA 2FBJH 1NCWH 4WNSA 1VKXB 3AG2B 5E7FA 1N26A 2GSGB 2V6HA 1FLTX 2J6WA 5CSBA 3S96A 3WGVB 3NSCA 5FA3A 3ELQA 1MW0A 3OG4B 4GAGL 4F8PA 3T0EA 3PE9A 4WDIA 3HNTH 1HX0A 4HV8A 3U2IA 3MRKA 2R2HB 4HIHB 4L29A 5KYUA 1QHPA 1X5MA 3WTSA 1P9MC 2I60L 1Z9LA 4RX4D 3CE1A 3UACA 4ZQTA 2XRAH 4C4UA 1UYWH 2LTQC 1IUZA 2VXUH 4BELD 2JCCF 3JZYA 3P3SA 1I8MA 4R4BB 4YXKH 2E4TA 4N87A 3RIAK 1MFEH 1KELH 4AZ8A 3FBKA 2ERJC 1A3ZA 1FI8C 2JCWA 1W15A 3DROB 3UTQB 3B5GA 4K94L 3ZTJG 3IVKB 4RFOL 2YN5A 4G6ML 5IK3B 2VIRA 4M8QA 2VYRE 2DDQH 4UM8A 2WLJA 1JZ2A 3IJHA 4GUPA 3ULUD 3TT1H 4RMUA 3SDAD 5IB1B 4KKCC 3I75B 4ZOCA 1A8JH 2IPUK 3WHXA 4CSSA 3BKJH 3CMGA 4KK6C 4AV4A 4MNGB 4U33A 4FQJH 3WS3B 1P5UA 2AQ3A 3AJ7A 3BP4B 3DA0A 4DGIH 1E5UI 1XAKA 1AI1L 1IM3A 5KBDA 4MKMA 2B20A 4FX5A 4HPOL 4JFUA 5D70L 2VMFA 4R2GD 4XMKL 5FM4A 3ARZA 3WTTA 4AEIH 4HKZA 4MZ3A 1HH6A 2R27A 2DM2A 3E8VA 3V4PA 4FQ1L 4K7PH 1E8WA 4UIMA 1NOLA 1UKTA 3QJRB 3SO5A 4AH2A 2PW1B 5AW6B 3HBGA 5AVYB 1Q90A 3BFOA 3KDPB 3BDYH 4JKKA 4BQBA 3T8MA 1AHWC 1IFHL 5DMKA 1QSFD 1AIZA 4GYBA 4P2OA 3MJGX 2E6JA 4LFHG 1UWFA 5KW9H 1WA0X 4KJYB 4HOWA 2EDRA 3FT0A 3FUMA 3GI9L 2OMNA 4JX0A 2K6ZA 3L2LA 1WTLA 2PNDA 2TRYA 1SMOA 2NW2A 4GIOA 3MYJB 1Z5LB 3I9IA 2ZG2A 1G5AA 4GG8B 1MCNA 2C1PB 1OW0A 5LGYA 3SYPA 2FEJA 1G9MH 4BFJA 1MCOL 3D07A 3WIIL 4Z77B 3HG2A 2VR9A 3CTTA 4QTIL 3K2MC 4U49A 3DTUB 3GJFA 4FJYA 4Y19A 5IIEB 5HHOE 2EEFA 1LO3L 1QFWL 4LLQB 1AP2B 4KXCA 4UF7C 3TCTA 2DJUA 1GZPA 3B9KA 5D6DC 2OJ1A 2ICWA 2F15A 3QUYC 4P2CG 3UTZB 3DX2A 3OTTA 3SDDD 2BHFA 4XXDB 2FHBA 2KZ1B 2OTWB 3IK2A 3V5HB 3OQ3B 2HLAB 1NLBH 1FN4B 1U6AH 1QNIA 2KERA 4J2QA 1MF2L 4XP1H 2Y23A 2ALWA 3WSQH 3NJNA 3MHZA 4URKA 4X6CA 1AXIB 2QMKA 4WNJA 3T5WA 1NPUA 2DWDA 5C07D 5CD5D 1M71A 2YOAA 1HYSD 4L3EA 4TF4A 5GGVL 3QRBA 4G9DB 5BW7A 1MAKA 3WNKA 4BKTC 5IFJB 1QA9B 5CEXB 1D6VL 3L48A 3MBEC 2MHAB 3SPVA 2RCSH 4UINH 1UM5L 4E41A 1EPFA 4LARH 3LOWA 2FQGA 5CN2A 3PQYB 4K3DL 4DZ8B 3RWFA 2IADA 1KPRB 3WLBB 3RY6C 5JW4Q 3VG9C 2VW4A 4F9PC 5CGYC 5I1JL 1TYEB 3JVGC 4GAJL 1NFIA 1A5FL 2J44A 5B1BB 3C6LB 3VFGL 2R1YA 2H47C 5J06A 4N6RB 1AKJD 4TSBH 4L4VD 1G7MB 1K85A 4JPQA 4UU9A 2ZKYA 1QFHA 2ZOTA 3BFQG 3CHPA 1MCPL 4PIBA 3VGGA 4LB8A 1R3KB 5IVXB 3DJTA 4BFOA 5ICYB 4RA0C 2IBZY 4LSDA 1OB1A 4LNRB 2TRHA 2JELH 2DM7A 1SXSA 4AQEA 5DHEA 3Q6GH 4UQDA 8FABA 4O02B 1F58H 1ZVNA 5D8JL 2P8PA 3MFFB 4PJ8A 1U8JB 2K45A 2Z6FA 2Z9TA 5DD0H 3T6QC 4IRZH 3TFKC 4A2HA 4G9FA 3UTOA 4NGHH 4RZCA 4ADJA 4JGMA 5JZ7D 2X9WA 4WEMB 4PJFE 5JNYB 5DJZA 2X1WL 4LCIH 3PUCA 3LY6A 1W72L 1PAMA 4Y1AA 3SE4A 2QQLH 4R6UA 1CYXA 3UTTB 3BAEL 4A7VA 2VXQL 2FNWA 2Y2TA 5CF3A 3QQ9C 3BIBX 3QZWA 5DVMA 3KPQA 4LLUA 2WQUA 4MBOA 3PUUA 3DDGA 4AUYA 3D0LB 4G3YL 5J8OA 4W9LC 4JJ5B 3ZSTA 3ARDC 1IMHC 43C9A 3FQXB 2E7BA 1RH8A 2G3ZA 3GIVA 1CICD 1H6TA 5D96B 5E8DH 1L9OA 4AGLA 4E9RA 2OJEB 1AE6H 1QI4A 5H37G 5FCSH 2A77L 3V52L 1OZUA 1RP9A 3V4VH 5K1JA 3S36L 4EDXB 2PYEE 2LR4A 1B6UA 2GTZB 3S5LA 3VWKB 4BZYA 4F2EA 5C0JA 2AI0L 3CH1B 2FTAA 3HFML 3NIDB 5HHNB 5AAMA 3VMNA 2RFXB 3FO9A 4O2FA 2HMIC 5FLVA 4NLAA 3IS0X 4H0GA 1NDMA 1FHNA 1FNFA 4R90H 1BM7A 3KWWB 5IFHL 2OULB 5B7FA 1FSKC 5IB4B 5BS0A 4E9QA 2BM3A 2BSRA 3EJSA 2BHYA 3WXWH 3CHRA 2E6QA 2GJZB 4IBTA 4NYLA 4O5LH 1FZKA 3ZUNC 3FUHA 5LG6A 1S3RA 2P3YA 1A7QL 3DJZA 4LIQL 3S88L 5E8OA 3RE0A 5IBTL 4NZUL 1UWEH 1XIWC 5IV2A 4N26A 1A64A 3GLEA 3I02A 1Q9KA 1TTGA 5C7ZA 1OWRM 4OF6A 4Q9CA 4WUUB 2WKOA 1G7QB 5I1EL 3MRDA 2R23B 1WAAA 3P0YH 1AXTL 1MCWW 1HYRC 5AZUA 4ELDA 4H26A 4X6BB 3FTGA 2MFNA 1H3VA 3EH2A 3KM2A 2W0FB 2WBKA 1UD3A 1QLFB 5B1JA 3M1OA 2FL5B 2B3IA 3OR7A 4ZAKB 4EIGB 4IGBD 3HFFA 1T1WB 1OSPL 1I9JH 3FPYA 2ITCA 2ZPKH 4P99A 1PZ5A 1PIFA 3G9VA 3WD5L 3PAYA 2HA1A 3FCTA 3MNZA 1YG9A 3GS0A 4AVIA 1FGNL 2EYRB 1V7MH 1CDUA 4XWOC 5F9AC 1R3HB 3DYMA 4MS8C 1Z9SB 4F7MB 5TDOA 4APQB 1SRDA 4KTYA 4NQTA 1JNNL 3NSFA 1NA8A 3WHE1 3LKNA 4ODVH 2D3NA 3IDIB 3DHJA 4XNXH 5TE7L 5LG1A 4ZDHB 2AJ3A 4YDMA 3OHXC 4JVPA 2YLKA 5E8PB 1P9MA 4RBPK 1A1OB 2HSIA 5H35A 3FTWA 4NP9A 1U2YA 2BSTB 5CBEA 4QRFA 4FC3E 4R4FL 1QAWA 3QDJA 5B1KA 3JTBA 4QR7A 3WIFB 4M5ZL 4S1SL 1JV5A 1F4WL 3SKJL 2ORBH 3D39A 3OKDA 1OAXL 4HS8H 4JR9L 2ADIA 3DVNA 3RPBA 5BJTA 1I7ZB 3PWJB 3SBRA 1CFNB 1LXMA 4OD2B 3UIYA 4FTVE 4DP1X 3EUUA 1QPPA 5CINH 3CHSA 1AMXA 2F74B 2J21A 5JDSB 2OMZB 3QDMD 2X4OB 3PNWA 1KENH 5ID1B 5D1QC 2P5WE 4NO0B 3TZVB 5ENWB 1WDAA 2JXMA 4Q8BA 4W9DC 1Z5YD 3CC5A 1EO5A 2H0JA 4F8NA 4LGSB 3RPIA 1XGYL 5I1DA 3W11D 3DSFH 4BCXA 4BK5C 4XAKD 3HKZA 2B5IC 2P5EE 1CFVH 5JO5B 4EIBA 2XIBA 4LBEA 1F5WA 1TTBA 3T0AA 3VFNB 3EFDL 4RWYL 1ZDSA 5CJXC 4U05A 1EANA 3TO4C 2VC2H 2AAVA 3A22A 5DK3A 3UCQA 4XNYH 3J8F7 1NBVH 4PJIB 1JNHA 1FG2B 5KSAD 4TVSa 4K15A 1UWGL 1YHPA 1HHIA 4HFUL 3PNRB 3WFCL 3WE6A 3GSVA 3VE0B 3CVIL 1KB5A 1UZ8B 3F84A 4OW6A 4R0LB 2A6DA 2FO8A 3BHBA 5GGQL 4ODWA 1ZGLM 4AYFA 4N8VA 2WXQA 2MCMA 4PRID 3CU7A 4OZIB 3X14B 3RGBA 4G6FB 1H5BB 1OD9A 2CRYA 2R0KL 3E9UA 2QSCH 2DLEA 2MTAA 5G4OA 2X2HA 3QXWA 1MREL 3AXHA 1GR7A 5IP4A 1V27A 3WN5B 4JCWA 3WLWC 2X1PA 3WS6A 3PWLA 1HC1A 1NGZB 2CKNA 3SDCD 1F4YH 1NGPH 1A6TA 4GRMA 3IFPB 2NY4D 4WO4D 3IN0A 5LBSH 1IJ9A 5T33L 3N44F 5TE6L 1G1KA 4WNQA 2CDEA 3B2UD 4O9HH 4G5ZH 3MXWH 1S5HB 4RAUB 2EINB 4FQLL 5EEUA 5KZCD 5IEKA 2G75B 5IQLA 5D6DA 3LJ3A 3QUYA 3CFCL 4PJBE 2APBA 4DOHE 4JM2D 5EU5B 5IQ7L 5F7LB 1FH5H 1ZIAA 1AS8A 1RULH 1TEYA 2GI7A 4NKQB 4E5XB 1M7DA 1GOHA 2DQEH 1BEXA 1XSKA 3CK0H 1OCCB 1XGRB 3QRGL 2J5LB 1IM9A 1T7VA 2D03H 2VO8A 1XQ4A 2UY6B 3BWAB 4HISA 4GP8B 2Q76B 2VN3A 3IJYB 5GJSL 1WFOA 2EE3A 3H2QA 4OTXL 4ELMB 4CJ1A 1EJOH 4C47A 1JRHH 1AGFA 5JHDB 5C6WH 4G8IB 3H4FA 1RHHB 3MBEA 3RGVB 3B34A 5EN3A 3LQMA 1PTZA 4WFEE 1CPUA 3BPLC 1HL8A 3IDGB 1PYWB 4AMKH 3SJVE 1SMDA 2HZHA 5B21A 4ZTOL 1MFCH 4I3SH 1HDMA 4YE0A 4WJG3 4DFHA 4OFYA 4CMMB 4EQ2A 1OK8A 1SUHA 3MR9A 2K6YA 3HI1A 3J7HA 3ZK0A 5K9JH 4ZOAA 5C7XH 4D2NA 2XXFA 4MCZB 2OYKA 4F9PA 1YEEH 3BJ91 5IB2A 4AYMC 3JVGA 4BFIB 3H3PH 4L8SA 3WNIA 4YSDA 4DEUA 5F7EH 4I89A 4O4YL 3L3IA 2UZXB 4NUPA 5HJ3B 3CHQA 3KLDA 2IANA 1N6QL 1CO1A 4DP8X 2P43B 3RILA 4L3CA 2IPKA 3UDWC 1C5CL 5E9DA 3U6RA 1ZGLP 3G6JF 1YPZA 5KUKA 1JXJA 3P9MA 4WU7B 3RUGF 4J1UA 5C0GB 3NCBB 3MDJA 4Y7MA 4O02L 3CZEA 5FDWB 2X0WA 4TNWF 4U6XB 4TUJB 4G1MB 1DJWA 2FR4A 2OL3B 2D7TH 3K6NA 1UB5A 1SM3H 5AD0A 3QPQC 1PJWA 2QFRA 5CJOH 4OJDH 1SN5A 4N24A 4XC3L 5DS8A 2NQCA 4TNVK 3TBYB 3ISYA 2FSDA 1KEGH 2OMYA 3CFUA 4WW1B 1RZFH 4NNYB 2PWDA 3ARDA 5EO1B 3SOBH 2OSLA 3K2KA 4JG9A 2H41A 4LCCC 4BGDA 3D3VD 3O2DA 1MVYA 4HH9B 1MQKL 5F8QC 2HFEA 4F33A 1B6DA 1ETZA 1NCNA 2VM4A 1CTOA 2DD8L 1KG0B 1Q0XL 2O5ZL 4GKZA 1T03H 4P5SA 1HHHB 2AP2A 2VABB 1KWKA 4IJ3C 5H4YA 1YEJH 2QGCA 3ETSA 4B3EA 2WWMC 1KBGL 3HC3L 3NK3A 4LLYA 3MLRH 4D0BB 3DRQB 5LQBH 3E6HA 3EOAB 2A9ML 1AR1C 1E6JH 1ZT7B 1O0VA 2VKWA 1I3RB 3QUXD 5HGBB 2OX5B 1QFUL 2X09A 4FJ6A 2COVD 4MQXC 5DEGA 5L9DL 1XIWA 2J20A 3SE6A 3D06A 4XPTH 4AV0A 3KR3H 1L7IL 4KZCA 1Z0MA 5LUMA 4I9WE 3MOBL 3UO8B 2OBGA 3PREA 2LW3A 4LASH 5CILH 1NINA 3Q06A 3RWHB 3QDGA 4B9JA 4ZO6A 5IQMA 5JIPA 1T6VN 2XV2A 2R0WH 4A7GF 5KYYA 1TYRA 3VFPB 3GBEA 5C0CB 4BSVA 3L1OL 4Z76B 2CHZA 3T3MF 5LBGA 1U92A 1OCZB 3GTTA 1EBAA 4XNUH 4BQ6A 3T8XB 4Y8DC 5TTRA 3OKOA 5KVDH 2CIKB 3WTWA 1KTDA 1USZA 3AT0A 3O41A 4D9LL 1SEBA 2HN7A 1HXKA 3WKQA 2IALB 3VI4F 3EH1A 4Q9RL 5T1LD 2ZAIA 4JDEA 4WWKD 3UIZA 4I9XA 4FABL 3UZQB 3VDCA 5EFIB 3KE0A 2GVYA 5ISZE 1RU9L 1THCA 2ZQKA 4RISL 5CUSH 4G1EB 1VACA 4RMRA 1RZIB 2CRZA 4D9RE 4XMVA 4M3JA 1H3PH 3IETB 1SLUA 3GMOB 1INQB 4GUQA 3OHXA 4WEUD 3GHBH 5C70A 2F68X 4PJXA 1NGWB 2W5PA 1MFAH 2Z1PA 3DRTB 4AG4H 4NQSB 3SHSA 3QWOB 4HC1L 1CE6B 4UT9A 2X12A 3UTSB 1BBDL 4QHUA 4R7NA 3HMXA 3HHMA 1CL7L 1QX1A 3EADA 4IJTA 3F7QA 4WAFA 1DVUA 3Q8FA 1KTRL 3FCSB 3LRHA 1LDPL 1FLRH 4XVSL 1SLXA 3MZGB 1R3LB 1U8MB 1FPTL 5CN3A 4L0YA 5AEAA 2K78A 1RZ8B 5D1QA 3W9DA 4TQEL 3MNWB 1N19A 3BN3B 1X5IA 2CLRA 3GRWL 4PHXA 4AW7A 3VFWB 3Q2VA 5HI5C 5BZDA 3NA9L 4V1DE 3F8UB 4XTRD 3TV3H 3WTYA 3K2UL 1BF2A 2ADFL 1BZEA 2NY1D 4JRXE 5EOTB 4IRSB 1IQDA 1S7XB 3LV3A 3EH5B 1KJ3H 4FLOA 1BX2B 2OR7A 5DDHB 1C16A 4I3RL 1E3ZA 1UOLA 3KYMB 4PJ7B 3TO4A 3FRPA 4EI5B 4LCWA 1E40A 3K74B 1QKZH 3AW5A 2ESVA 5FW6A 5C0NC 1HXYA 1IC1A 5J3HC 5FIEA 3APFA 2FE0A 1XF4A 4YBHA 1BG1A 1DBBL 5AOMA 1J0YA 3ZDYF 1TU2B 3CDCA 5KVGE 3PDOA 4PJDA 4ZI8A 4PCTA 2VN6A 2VLRB 3T0XA 1FRGL 1DDHA 2FX7L 1X5HA 3MZTA 2Y06H 4JN2B 4GLRH 4NN5C 3VNYA 2BMKB 3GMNA 4MAYC 3AMKA 3S34L 1BF5A 3QAQA 5HYSB 4S2SA 5C08E 1TR7A 3O6KL 1OVZA 1FNLA 2B1OA 4IOIB 4K8RD 3VXTB 2WXLA 3T08A 4G5AA 1TJIH 3QEGH 1R5WB 4LL4A 2ZKHL 3ZE0F 3KH3A 4ANWA 5F6IC 3FMGH 2EO1A 4ORGB 4KO9A 5KG9A 3MFGB 4WIQA 4UM9D 2NTSP 5CBAB 4YHZH 3KS0H 3TA3D 3BUYB 4BFFA 2J7LA 4YHOL 2AMGA 4YSEA 5HPOA 3LXBA 1JZ6A 3CQFA 3L95A 4Y4FD 3WDIA 3ERXA 4UQ2A 4KQ4H 4QD2E 3RU8L 2YPVA 4ZOEA 4JDVA 4BDVA 4PW4A 3HPLB 1SLVA 3BPNB 4QDGA 5K33A 3EO0A 4P46B 3MRKB 4L29B 4N0UA 2OMXA 1MJJB 2DYSB 4JO1L 4NPYB 1ZA6A 1SDAB 2RACA 2OMUA 2Z8VC 1RZGA 1CIUA 3CDYA 2P5PA 3QNZB 1GPOL 5I5RA 1CLZL 2AJVL 4XH2B 2Q7NA 3RNQA 1I8MB 1Y6NR 2CK0L 2VLLB 3GHEL 4LPTA 1DJYA 4EUPH 4CN1A 1QP1A 4K5OA 2XN9E 1PLGL 2EXWD 3DIFA 1JK9A 2P46B 1NIBA 2FEEL 1QSEB 3EJYD 5JLZA 1IVTA 1JGVH 2VIRB 1NH6A 2O5YL 1K4DB 3BAWA 4GUPB 4HXBL 4K7FA 3ULUH 2IDFA 5TE4H 4UT6L 2XKNB 3FSZA 1KXVC 3FTUA 4G70B 1NFDE 1DUZA 2AK4D 1AXSB 3BI9X 3UYRL 1F90L 5F7AA 2Y22A 1M05B 3UDWA 1P5UB 3Q2NA 3F7LA 4HSAC 1E7VA 4EZMA 5I6NA 4C4KT 2AAAA 5EU4B 1BWMA 3DMMD 3ULUC 5I1KL 3SDAC 2YSSA 1TVHB 2VCOA 1NGQL 4OQTH 3CFJB 1OM3L 3ZMEA 4N25A 4ENZA 3QJVB 1GGCH 3VXSB 4PRBA 4IBWA 3GTNA 4D9QD 3L1GA 1PZAA 4H44C 1JGLH 2B8OT 4Y5VB 1EERB 2Y36L 4AH2B 3QQNA 1KGCD 3MXVL 2XACC 4M7LT 1AO7B 5FUZL 2EQDA 4TSAH 3BSGA 4NM8L 4BFNA 5GS0D 4R2GC 1I85C 1Q9OA 2OL3L 2R29L 3KPOA 3QE5A 1J05B 2D7NA 2OR9L 1I1YA 2VDQB 2O1AA 5K9QG 4MD4A 3BT0A 3MRFB 1T21B 1ZLVK 3KDMB 5AB0A 2GQHA 2WBXA 3HG3A 4FP8H 1P6FA 1V8HA 4R96B 1CD0A 4UV4L 1HEZA 2HVKA 3CMOL 4R4NC 5D6CB 3V5KA 2WM0A 3IEAA 4Z7UB 4LCCA 2ZOLA 2Q3AA 3B2VH 2JCCE 4X80H 1OSYA 5EV7A 5GRUH 3BUPA 3ESVF 1KIQA 2B9AA 3FK3A 1GYVA 4L1SA 4POZD 3ZHLA 5AZEL 2Z64C 3FQRA 2HRHA 2PTUA 4HCGA 3GJFB 4JO5A 4ZUUB 3G6DL 3ML9A 3SCMB 1MH5A 1AOHA 3A3YB 3AG1B 3SPHA 2X2YA 3B9KB 5EU3A 1ZHKA 2AV1B 1EX0A 3ZDZF 1R5IA 3MOAH 2AABL 2J1KA 1OGTA 3EGDB 4HIIA 4TUKL 2CPCA 5FHAL 4AQOA 3NJVA 2ITEA 4DTGL 1OCWH 4HMEA 3HC4H 4ZPTA 4PBVC 5B8CC 2BVOB 2VLKE 2CD0A 4WHCA 4AIOA 5BCAA 3QHZL 1MZZA 2Y2WA 5JOEA 5B4MD 4ZUWB 2BNUB 3G5YB 3O0RH 2IWKA 3LIZL 5K93A 4YXHH 2WCSA 3ZL4H 3AROA 3TCLA 3EOTH 3CFIC 3OJDB 4MVBD 4PUBH 4KRPB 3TPKA 1S7TA 4LU5H 1Z7JA 2BVPB 3RTQB 1JAEA 3M46A 4HJGA 5EC2A 2DQUL 1MJ8H 1R6VA 3IU3A 5FGBC 4OAWA 5TDNB 3D25B 1WS7A 2Y5QA 1C8PA 1JN6A 1IGYA 4FDWA 1A14L 3QXDB 1DCEA 2MPVA 5FV2A 4AKQA 4IKIA 1YNKL 4GXVH 2F8IA 2R1YB 4EQ3A 5HDQL 3B9VA 4G11A 5I18H 3EJRA 2FIKA 5D7JB 2WY3B 1N8ZA 2NY5H 4HGKC 4P5KA 5L2KE 3N0PB 5TQ2L 3QUMH 5DMGD 4AOFA 4AENA 3SKOA 4OLWH 1G7IB 3ZR5A 1AGEB 2JE8A 3HRZC 4E42B 1MEXL 2VWEC 1U41A 5A2CA 3LNEA 2AJZA 2PCFA 2Z7WA 4HU8A 4Z7NF 2VMDA 2CK2A 1VEMA 4MA1B 1FFOA 4Y1TA 2BRRL 2J25A 5HHMB 4FQQA 5A2IH 1GCFA 4PD4J 2C34A 2WMPA 1WCBB 5MENE 1ROCA 4UYPA 2WNWA 1QR1A 5J12B 3CDZB 4GKSB 2HP4A 3FF8A 4HIJB 5GGSA 3TVMC 3FB7B 4RZCB 5JOPD 3NTCL 5E2WL 5DJZB 3BP7A 4M4RA 3NSDA 4PB9H 1R1CA 2N1KA 4Y1AB 3JWDL 4N2EA 2WQWA 4LP8A 4GLRI 5MHSD 1UKSA 5I71B 5JOFA 4I77H 1DBML 5DUPH 3CN2A 1YECL 2G9HA 4LLUB 4N0CD 3B6SB 3U4BL 2JSFA 2BVQB 4Q9QH 4WV1C 5EU6A 1OGSA 5T1KB 3W56A 5C0DA 3I9GL 4UTBA 1WS8A 1T83C 3UBXG 3T2QA 3ZW3A 1VDGA 3ESPA 1KT2A 5F3HA 1FZJB 4BXVA 4Z78B 1HH9B 4U6VH 4TPRL 4N5UA 3V0JA 4Y89A 2AEOA 2AXFB 4OCRH 3S5LB 5DHVH 3DXAB 1L0PA 1MJ7H 3FO9B 6PAZA 2CRIA 5SWQA 4G42A 2PXYA 2WCGA 1H3TA 4HIPA 3FTVA 1L5GA 1UQSA 1TQWA 1DZBA 4O00A 5BS0B 1XO8A 2EDBA 3BIKA 1FCCA 3FN9A 4JFZH 1I9RL 3HLKA 2EXYC 5KSVA 4JGNA 5D2LA 4MQ7A 1K4CA 4BEIA 5GS1A 1MJUH 3PV6A 2E7CA 2OFQA 3HE6D 3WJJC 3N40P 1MI5E 1R24A 1JL8A 3LZLA 2DAVA 1Q9KB 4F91B 1FIGH 4L9DA 1XXFC 5KSBA 1CC3A 1CDYA 2FO4B 3U46A 1OEZW 4HF5H 3D6GA 2LAGB 2H1XA 3NFSL 4H26B 4HUCA 4BFGA 3BEWA 3MBWB 1IZKA 2UX6A 5DHYA 1B90A 3U83A 2DYPB 1R3IH 1T0NA 4OCYL 1SHWA 4JKPH 4CSZA 1RIHL 3F04A 1G4MA 2YWYA 1YSOA 3LRKA 3SSGA 1H6FA 5GJTH 5BO0D 3IMSA 5DRZA 1U58A 3FCTB 1JWUA 5C3TA 1A0QH 3FYEB 4B96A 3BAKA 3RWGA 4KJWD 2CALA 1V3JA 3V6FA 3HLAB 4X6CF 3GXTA 1UH2A 1QG3A 1VCAA 5JHLH 4Z3GA 5TDOB 1ZS2A 4JQVC 5DD6B 5AYUH 1R17A 3MLSL 4J4PD 3WCYA 3WFDL 1TITA 3CFEB 4ANUA 2VO5A 1XGQB 4Z7QF 4KZDL 2FQDA 3QULA 3NGBC 4FQHA 3FN0L 4YDIH 5GZNC 1G9EA 2WUCH 4W9JC 4QHPA 1NC2D 4EVNB 1MCRA 2AANA 1K72A 3CFKB 3MUHL 5DJ2A 1JZDC 4DHLA 3H9SD 2IWFA 1CE1L 3C6SA 5E5UB 4WHDA 2MCAA 4P4KD 3ISWA 5EU7E 2C9SA 4HT1L 2ERJB 3OKDB 1U8LA 3I9PA 2CRMA 3VH8A 2ADIB 5GRWA 1WF5A 3SD2A 2YPLD 4XMTA 3UL4A 4JFFA 4RQQB 3BQUD 4GMTH 3F5WA 1J5CA 1F6LL 2JTYA 1L9QA 4AXWA 1U8KA 4RNRA 1MCIA 3SB3A 1T04A 1UH4A 3GMQA 1UCBH 4HD5A 2CPUA 3QQ4B 3DX9A 2N59A 3NCJH 2JXMB 2HCZX 5I0ZA 2EVIA 4NKOA 3NZSA 5I1DB 5DFAA 4RGMC 3RPIB 5EN2B 1P2CA 1URZA 4PMFA 3EDEA 1KYAA 2Z0BA 3TN0C 2HFGL 5LDSA 5AVVB 1QASA 3V0VB 3FQNB 3PDGA 2FK9A 4GO6B 5A2JH 4NOFA 2ZTBA 2Z3FA 5C1MB 3E1ZA 3FT3B 2ZCLL 3FULA 5EF2A 1EZVX 4JPIA 4P4RB 4E9TA 3ARGC 1AHWB 3ZR6A 3GSOA 3LN4A 1I85A 1UD4A 4A55A 3A67H 4DVRL 3MCKA 4E9YA 3BVVA 1GVIA 1OWWA 1WBZA 3U30C 1TPXC 1QBMH 4QRRE 4RGNE 5F9OL 1X7SA 5DO2D 4N8VG 4AJVA 5CAYB 2VDQL 1T4KB 2JF1A 3HG1A 2A9CA 1PW3A 5EEWA 5DO8A 3HI6L 2QLVB 2X70B 1L6PA 1HJCA 5F96H 2F53B 3GGWB 1SVCP 1A9BA 2DMBA 4WWNA 4FZ8L 4DPCX 1KWGA 1X3DA 3CN3A 4DW2L 2NLJB 2VSMB 1UB6A 3DHPA 4ZJ9A 4GXFA 2QPEB 1VZIA 1AANA 1A6TB 3IKKA 4A6YH 2WAHA 3QIWC 4GSUA 5BVPL 1P4BH 4HPHA 1F3DH 1X5JA 3HN8A 3C2AL 3ATBA 4I48A 4QHLA 4IK7A 4UQ3A 2CCWA 5JIDA 4J3OG 2LT9A 1XF5A 3LPFA 5IEKB 3MJ9H 5FB8A 2DY2A 2DOCA 3QUYB 5CKGA 2Q86B 3VO0A 4N4YB 2F5BH 2J6EA 2O5XL 3BD3A 1JDAA 1T1XA 2EIBA 5IJDC 1NCCH 3APNA 1SEQL 4M7LL 3VDBA 1JYVA 1MHCA 2B4CH 4NM4H 2XCMC 2MRYA 1IM9B 4N2BA 2A83A 1S78D 4FKKA 1MHEB 4HULB 3HVDA 4JM2C 3CVHA 2FJGB 4Z3FA 4FRWA 1CZ8L 5AALA 5GZOC 5IW1B 2CGYA 4XP4L 1N67A 3QQ3A 2PCXA 4FCAA 5IWLC 1P6AB 1EUUA 3DUSA 4F93B 2L7QA 1IBBA 2ATKA 3MR9B 1ZDQA 4OFQA 5I17B 3OLGA 3VG9B 3D18B 4K71C 1F97A 4A2EA 4Q14A 5TF1L 5GGRA 3WDHA 2EH7H 2EACA 3A5VA 1CI3M 3L7FB 4KKZA 2F58L 2VDMH 2J71A 1FNHA 2VXTL 4A66A 4NRXB 3L3IB 2A4EA 3OKLA 4PTTB 1F41A 5HDBE 3ASWA 5D7LB 4KPHH 3BKCL 1NKRA 5ICZB 2IPKB 3UZEC 2DI9A 5ID0A 1CT8A 1OP3H 4FFYA 3BVUA 5F7WC 3HRZA 4DN3L 5EO9A 3U6RB 2ZXBA 2APTA 2H5UA 1YPZB 3ILPB 1GJWA 4QHMB 4ZW8A 2B0SH 5AUMA 4L4VA 4FMKA 3VXQB 2PLTA 1NMCC 1YN6B 4NSKB 3LKRA 4JO2H 4XZUB 5D7IA 1KXQA 2P42B 4HCIA 4D3CH 4CU6A 3TVMA 1ZGLB 3CIQA 3FU6A 2XQBL 3F3HA 1LP9B 2WD0A 4JE4B 5AD0B 3M7FB 1C7TA 1EFQA 1JV2B 3FT2A 2F18A 3NYKA 4YK4C 1SOKA 1MELA 1BVOA 4NQUA 1MFDL 2DTMH 3G04A 4OKVA 3VA6A 1DFBH 4Z7VA 1E8ZA 1LEIB 1GW0A 4WV1A 5LWYH 4H8WL 4FI8A 3T71A 1E0OB 1GC1L 3DLQR 1NCDH 5ABAA 1AZRA 2ARJQ 5KVFL 1CGUA 3L3GA 2IH8A 3O3AA 5EUOF 3DETC 4NN7B 4Z7WE 1ETZB 5CIPA 2ZSVA 1W9XA 2AK1L 2OXHB 2GG1A 2YLHA 1SXZA 3QFJA 2WUBL 4N2FA 4XNZB 4FL4C 3U6XS 4F7EB 1SY6A 2Z92B 3O4LD 3OKKA 3QP3A 4XN8A 3DX3A 1G6RH 1Z6JT 1VCBC 4HAFA 3S48A 3DV4A 3V4VB 2B1HL 1RURL 4NKIL 3HKFA 3E6HB 4G8GB 2XT1B 3V0AC 5IBLC 4D8PA 1ZK9A 3WJJA 3O6FD 5DEGB 4KAQL 2XV0A 5D5MB 3QPKA 4OF3A 4PS7A 2B9BA 3G6JE 3VX0A 3MRPB 5FYKL 4X5RA 4PVBA 3WJMA 4MYPA 32C2B 4NQDD 4UV7L 5AL8A 1JPTL 3RUGE 4IHOA 2WVUA 2WZAA 2VAAB 3ZHKA 3X1NA 1D5MB 4YWGH 2CDFB 4XN9A 4XMPH 2OZNA 3M1BB 4UZSA 5DZVA 1L6ZA 1TEFA 2WSPA 4LMQE 4QJ4B 5DRNA 1RZJH 2A73A 5L0QC 1IBDA 4J3OF 1GH7A 5GRJH 5DJXA 3LS4H 3D09A 3ILQD 1KTDB 1FGVH 4KO7A 4W9EC 4X4MA 5DYOA 4A67A 4ZZFA 43CAA 1ILUA 1C12A 4FNLL 4Z95L 8PAZA 3GDBA 5EPMB 4YX2H 5GGTH 1TJGH 3KPMB 4HZLA 4UQAA 1U3HA 1HIML 1OANA 1Q94A 4BH7B 5D7KE 3MO1A 5GSVA 5F1IA 1JZIA 4JQVA 4IU3A 4MMYA 1JF1A 4W81A 2EYTA 5E51A 3L3HA 4UT7L 5DK2B 5GRVL 2P8LB 1LMKA 2VQ1A 1WZKA 1L9MA 1S4IA 1ZY9A 2VL4A 4FQIL 5GZNA 2FBJL 4M48H 1JZHA 1ZHNB 4R26H 5KS9A 2X6VA 3TBBA 4PGEA 2WXIA 1CU4L 4GKNA 5A2AA 1A65A 1AH1A 3ATEA 4BKLA 1A66A 3HNTL 4XNQA 3C6EA 2ZKXA 3LN9A 3ULVD 1ZPUA 2P47B 1D7FA 4AL8H 5ADOL 3EJQA 1ND0B 2XRAL 4BUHA 1UYWL 2VXUL 4NNXA 3WUWA 3RX5A 3G6AB 3GZQA 3IAQA 4YXKL 4Z7OB 4RIRA 3X13A 4JRYA 1ZMYA 3W9DB 1W6WA 4KJPD 2CLRB 2N4IA 1FDLH 2Y7SA 4Q6YA 3FO0H 5BRZD 1RL1A 2EDHA 3A4AA 3MRQB 3UBFA 3VXRB 2C9UA 4UAOC 2XG5B 3TH3T 2DQJH 3PJLA 4LVOC 3TN0A 3TPUB 2B5IB 2QVMA 3GSXA 3LMJH 4OZGB 4LBAA 1OF2A 3TT1L 3AADB 3EFFB 4FXTA 3T3ME 1QRND 4JN1L 5IF0A 1O7SA 3LV3B 4CBZA 2VE6A 4H4NA 4TOYH 3BKJL 1C16B 1LEGA 5FYLE 3EHBD 3LZPA 4QGYA 4Z0XB 2P24B 2YD0A 4LCWB 4FQJL 4KV5F 4X99B 5A3IC 3D12B 3FFCE 1HXYB 4DGIL 3ARGA 3EYVB 2P48B 2WVVA 3NIFB 2QGEA 3V0FA 5E6RB 4AEIL 3KZ8A 1AGBB 1A47A 4LKCB 1T1YB 2MKLC 1ADQA 5MP6H 4K7PL 2FWOB 1OV8A 2NSMA 1YEFL 3PPEA 2VC2B 3ARYA 2WGNB 1D5ZA 3VI3B 1Z9OA 3BDYL 4EO5A 2ZYHA 4PJ9B 3GMNB 3KBEA 5GGUA 1F0LA 5HGDA 3RB7A 1SHMA 3GSUB 3BSHA 4U1JA 3MLXH 1HOCB 1RK0B 4H8PA 3F65A 1D5IH 5KW9L 1XSJA 1CDIA 4L48A 3O3BA 4IS6B 4ERSH 4YSQA 3WKNA 4A2LA 3EJPA 1JTTA 1IGTA 3RVTD 3QIWA 4HKJA 3PXJA 4QWWC 2WTRB 2BC4B 3O9WB 1AYRA 4J3VA 3V2AR 1ZHLA 2Y3AA 2MPAL 1E4WH 1LWHA 1T3FA 1UJ3C 2ZWNA 1S7VA 3O4OB 5A2LH 4E9WA 2BS71 1EVUA 4FQXB 2H0FA 4PU2A 1G9ML 4H88H 4K8RC 4IK6A 2JKNA 6FABH 5I75C 3CN0A 1U8PA 1UT9A 2HPTA 1R9FA 4X0NA 3WYRA 3DKHA 4UQ2B 1EVTC 1MCQA 4H0IA 1RKRA 3QEQB 3EO0B 4QCIB 4LLDB 4BZ2A 3TA3C 3WY4A 1SBSH 1I7TB 2C9RA 2VGLM 3N43B 9CGTA 5IUSA 1ZA6B 3RB5A 5E4OA 1RZGB 3BE1H 5FOBA 1U6AL 1U3NA 5GZOA 1XZ0A 4XP1L 3V55A 1FFTB 1X7QB