2BJ1A

Nikr in open conformation and nickel bound to high-affinity sites
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
132
structure length
132
Chain Sequence
MELIRFSISIPSKLLEKFDQIIEEIGYENRSEAIRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEIISSLHVHMDEHNCLEVIVVKGEAKKIKMIADKLLSLKGVKHGKLVMTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pyrococcus Horikoshii Nikr: Nickel Sensing and Implications for the Regulation of DNA Recognition
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transcription
molecule keywords NICKEL RESPONSIVE REGULATOR
total genus 37
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2bj1A01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2bj1A02
2BJ1A 2JXGA 1Q5VA 4ME7E 1ARRA 2K6LA 2HZVA 2PC6A 3QSIA 2K9IA 4D8JA 2GPEA 3QOQA 2H1OE 3LGHA 2HZAA 2BNWA 2CAXA 2F1FA 1BDTA 1MNTA 2WVDA 3H87C 1NLAA 3OD2A 2BNZA 2AY0A 1BDVA 2CPGA 3FMTA 2K29A 3BKTA 2WVCA 2CA9A 3VW4A 1ARQA 1P94A 2JXHA 3FT7A 1Q5YA 1B01A 3BKFA 2BA3A 4HV0A 2RBFA 3VEBA 2BJ8A 1PARA 1MYKA 2JXIA 3PHTA 3BKUA 1IRQA 1X93A 2CAJA 2WVFA 3VEAA 1EA4A 2BJ7A 1MYLA 2CADA 2FGCA 2BJ3A 2K5JA 1B28A 2WVEA 3GXQA 2BJ9A 2BSQE 1QTGA 2Y3YA 1BAZA 4FXEA 2K1OA 2WVBA 2NZCA 1U9PA 2KELA
chains in the Genus database with same CATH superfamily
2IBOA 1CSJA 3HULA 3K89A 4PQUA 1DZ5A 2F8MA 2JVRA 2XS5A 2QJ3A 3LUYA 4D8JA 1SB6A 3E3XA 2ACYA 5KTQA 2MSSA 3QT6A 2XWYA 4PG8A 2YKNA 2KXHA 4OV6A 3UD5A 2LA6A 5DO2A 3CO9A 2K7KA 1S49A 4N5SA 4N41A 4ZJOA 4C2MA 1TFYA 1N5SA 2KB2A 4UF4A 3T19A 3UNYA 3NBPB 1OQ6A 3RW7A 3T6JA 4ED8A 2AU0A 3AHPA 1WTBA 4FNHA 1IBLJ 2FVPA 1VLYA 5C25B 2LEBA 3CTRA 1Q7LB 2DGUA 2MHNA 1OPZA 4ZPAA 4QBUA 4ZVEA 4PAAA 4M95A 2EBEA 5D4NA 5HVFA 3DRPB 4IDKB 4DEZA 3CD6S 3OBIA 1S0NA 2KU7A 4HL9A 1KFSA 2NREA 4F4KA 2UVVA 2UXCJ 3O8WA 1UA0A 3M1VB 4A8WA 5J2NA 5KFSA 1H6KX 1YRTA 3D6HB 3ZC4A 1MSWD 3PR5B 3CCZA 3I96A 4N8NA 1Y5LB 1EHWA 2AJFE 5I3PA 3C3LA 2JC1A 1U6ZA 4RR5A 2JEFA 1GXUA 4USVA 4ZHRA 2IM0A 3EPIA 4C8ZA 4J9RA 1CS4B 1NH7A 4DV6F 4KGKA 1ZZNA 4P2SA 1C1CA 2F63A 3DN9A 4RBUA 1UWBB 1BY9A 4RU2A 1RAAB 2W4DA 4I2QB 4KGVB 4WPAA 2QFJA 1WOOA 3L7UA 4I2PA 1Q82T 1M5PC 5F9LA 3MTJA 4WF9Q 1JLFB 5JXSA 4JV1A 1RHJB 2WVEA 1JLCA 3SFGA 4LSNB 4MAKA 2UUAJ 1BAZA 5KG6A 2MLZA 3OL6A 1JLAB 4EBEA 3W7BA 2IM2A 2LXFA 1YSJA 2VG7B 2G0IA 3KJVB 3D28A 3FVYA 4E2FB 3MEEA 4AXIA 4GRSA 3W66A 4PABA 2QYGA 3CE8A 2KRRA 5CD4A 1EB0A 5KFNA 2YNGA 4LBPA 3JQJA 3Q8YA 4LRCA 2IDEA 1VBYA 1PKUA 3PO4A 2JRSA 3D0IE 1R6YA 1NXIA 2B6AA 2D9PA 2A2CA 1XERA 4LBIA 4QOTA 4DR2F 2KYZA 5B09A 4B3TJ 2BA3A 3LF0A 1KTQA 2W7AA 1UEVA 2HKEA 3G6VA 2L41A 1X93A 3Q0AA 5DM6Q 4EUVA 1N4LA 2XO7A 1TQLA 2VC0A 4OJHA 5DG7A 1PIEA 3K7RA 2YNIB 2C2ZB 3M8YA 1CJUA 4CLKA 3HT3A 3NMRA 3JQKA 2Y1JA 2ZH8A 3KHRA 2DJWA 3MM9A 1NB7A 2X51A 4JI6F 2J6UA 3W9HA 4A4JA 4RO0A 2V4JB 5M2PA 1QSLA 3EM1A 2HK3A 4AFFA 1U02A 1ZZFA 3ONQA 5B7WA 5L38A 2DO4A 3TA1A 3OLBA 3T1YJ 2VZ9A 2Y0SD 1KVJA 1T9WA 4NX9A 3G4SS 3D6MB 1HYSA 2RVJA 5DLFA 4C9DA 3SI8A 4ZLNA 4NRUA 1QE1B 2DNGA 3GONA 2OGUA 1B7YB 1NDLA 3DMJB 2I0XA 1KLMB 4H4KC 4RX6A 4OI0A 2RQ4A 4IKAA 3NRBA 3RAQA 2MZTA 4QIWD 1TFWA 3VZIA 4RW6B 3R5BA 3IXQA 3TWZA 2M2BA 3T6BA 2Y8WA 1RTHA 2J7UA 4HI1A 1C1BB 2W2OP 3DRSA 2XMAA 1LV5A 2H5IB 3CCWA 4HI2A 3IN5A 2DPIA 3I82A 2B6AB 3SCIE 2DR9A 5L8RC 3CCES 5AJ3F 2BJ1A 1Z2ZA 2QFIA 1HIYA 2ZOMA 8AT1B 3SCKE 3MR3A 4NYOA 2YQ3A 4A8KA 4ED2A 2JH3A 2VFUA 2LEPA 4OHZA 3M9OB 3ENWA 2YVSA 3NWGA 2PI4A 4IR9A 3KYLA 3ZNJ1 3SQOP 1OIAA 3MAAA 4C8OA 4X4PA 4IYQA 1JLAA 2FJWA 3W62A 3AXMA 5CYQB 4LSNA 1TL7A 2X3GA 2BABA 3FNNA 4JI7F 3N6NA 4ZVQB 3KKFA 1FDAA 3PYEA 4I2PB 4CIOA 1I3OB 1T8EA 2VV5A 4DV4F 2BJ3A 2K5JA 2CJAA 1B4SA 3DU6A 4I2QA 4DV7J 1DRZA 5BR8F 2DXEA 3BPDA 1TKTB 1JB0C 1TP7A 2IRUA 1XMQF 1C1CB 5HBMA 2LA4A 3OTEA 3KLIA 2YTCA 2IVFB 1DQ8A 4IG3A 1PBAA 4PXEA 4W92B 5KG4A 3OSNA 1UZDA 4KH0B 3W2WA 1N36F 2XS7A 3K8VA 4HDHA 3UFCX 4J9SA 3ZNUA 1JMTA 5L1JA 2L3MA 2OPSB 1IKWB 2C3PA 4DPOA 1MWQA 1GX6A 2HGLA 1RISA 1AXQA 1OY6A 2RSQA 2VOPA 2I5JA 1BHNA 3KDNA 3Q86A 1GTEA 2PMZD 2OTJS 3I4PA 5HROB 1WC6A 3IG1A 2NR0A 2OPPB 1QAXA 3K5PA 2KG1A 2E1CA 1PYSB 4J90A 1YRUA 3AODA 1X60A 2G0JA 4USTA 3GIRA 5HQ8A 4ILMA 2BKNA 1C0UA 1RTJB 4LREA 4BCAA 4TY9A 2BRKA 2K1OA 2BKPA 2GO9A 3KUGA 4RBVA 1FXRA 2CUYA 2ZC4A 1S6QA 9ATCB 4G1IA 4B9TA 1A9NB 2DK2A 5GAGU 2F65A 1Q16A 2KFYA 1RWPB 2QLXA 5KOXA 2QLFB 2ZKUA 3PJ9A 5KFIA 1B0PA 4YY3F 3CULA 2PDAA 1H7XA 2OMOA 1KOOA 2V94A 4ZIWA 4K4UA 1E6YB 2DH7A 1H2TZ 2HVZA 2LLZA 4LF6F 2YX4A 1GT8A 3KG4A 3O2IA 1ELOA 4NYPA 4Y2CA 4CO2A 4ZCIA 1U4BA 3PY8A 4UW2A 3NNCA 3DU5A 3KLFA 1IBKJ 4KJIA 2DRDA 3UCUP 2QA2A 3D0HE 3MXHP 2WK4A 1YG0A 3HKWA 3CJKB 5I42B 3AD7C 4DPYA 2CPZA 3AQPA 4F50A 2W4PA 2KJWA 1Q7YT 3GCWP 1DY3A 3UDVA 1FRHA 2DNMA 3PHEA 3VQSA 2E7WA 4TVAB 4QIVA 2K1RB 3HVAA 5LMNF 2OIHA 4JI2J 1S79A 3ILJA 1IBCB 4JI0J 1T94A 5CYMA 4OI2A 3NLCA 1R27B 1KVIA 1U7LA 5I3UB 3UNGC 1SUQB 4FVMA 2DR7A 4LVNP 4J9OA 4J9VA 3QJLA 2RILA 2BA9A 1PCAA 1XBWA 4OI4A 2HHSA 3MR2A 2IPOB 1KQGB 1V3SA 2RB7A 1SQFA 1OJ4A 3M2VA 2BQRA 1NHKL 1RHKB 3BYRA 5E3RA 4DR4J 4M5GA 3TVZA 1SKSA 2KZMA 3M6XA 5BJRA 4UOFA 5DQGA 1NJWA 1VBKA 1IVZA 2B7BB 5CXTA 2QL7B 4DSEA 2WB4A 1HMVB 5DZ7A 1J27A 2KKHA 2P8IA 3FK4A 4F4AA 3EX7B 1QDUB 1UVLA 5B0FA 5KT6A 4ETZA 4TN2A 1KTVA 5B0CA 3QRRA 2AQ4A 7FDRA 2Q79A 4ZCLA 1KD1T 1I94J 1LWXA 2HNZB 1DAXA 3MMBB 4C0OC 4J9LA 2ROEA 4LBHA 2CG8A 2JNJA 3PZPA 1JLGB 5I3UA 2UUCF 2HBQB 3C6UB 2MDAA 4IO9Q 5IC4B 3CMAS 1U45A 3BV8A 1RAIB 2MTLA 1ZTTA 2BQ3A 4B02A 2XMTA 1VRTB 4KRWA 2XCAA 1NUEA 2F3JA 4C8YA 1WACA 1NBEB 1TK0A 3I0SA 4CLZA 4GO7X 4RW4B 4U7UK 1S7IA 3W5ZA 1S0OA 3F56A 2E5LF 4JV5F 3W8PA 3BKUA 5L9XA 4URSA 3K2YA 2P5VA 2V2QA 2OUGA 5AJ3J 2VA3A 2DNLA 2W9CA 4M5LA 2YQ1A 1FDBA 3A12A 2ZBIA 3EZOA 4MK9A 5DS7A 1IWAA 1PBUA 3NGKA 4IUFA 1Q16B 1UEUA 1NH8A 2NUHA 3H90A 3KXDA 1X9MA 4NI2B 4QPXA 2LQBA 2R7XA 2CQCA 2QX0A 2VKRA 4RNNA 1RTJA 4WP8A 4X4QA 9RUBA 5IT4A 3HM9A 1IXKA 3L7PA 1HW9A 2HNYA 2CJYB 1YHQS 3R6LB 2UVWA 3RR7A 1YBAA 1TKZA 5LSRA 4RWXA 5IWAJ 1TL3A 2B51A 2QO3A 3CD5A 5HROA 4HR2A 3BH6B 4F26A 3M05A 2POKA 5D4LA 3IBCB 5A0YB 1TZ0A 2MKSA 3T5KA 1SKWA 1BQXA 4DR6J 2RHQB 4I6YA 3CW2C 4DR3J 4IRCA 2E44A 2F5GA 4DOZA 3TZYA 3V81A 2C2RA 2FVRA 3W2WB 1RQ0A 3QBCA 1BC6A 4ELTA 4A8OA 2J0WA 2W8LA 2UV8A 4A8XA 3TA0A 3H4DA 1KP6A 3DLKB 4I0WA 4MIBA 3IC1A 4OHVA 5CZXA 2RAQA 2XNRA 3SBMA 1VQ9S 2R8KA 4C0BA 3P4UB 1XN9A 2GQQA 5LMUJ 1ULRA 3OFGA 4A47A 2GZOA 1W7WA 3GPAA 2O67A 2OSRA 2W24A 1S1WA 4LJMA 4RNMA 4ECUA 3MOJB 1TL7B 4OX9F 3MM6A 1RWXB 5CYQA 2YKOA 4MIWA 4RW7A 5E3PA 5G4DA 1UW9A 1WF1A 1QVGR 4Q2MA 4BBYA 2CAJA 2FVCA 2XI3A 3G82B 3CJ0A 4CTAA 2VODA 3QGGA 3M2UB 3OV7A 3ZZPA 3DOMA 4HDGA 4DV0J 3D1OA 1OHNA 3W61A 3A8JA 3GYNA 4WXOA 3GV5B 1KHWA 5HLFB 1FNOA 3Q83A 1YGYA 4L6V3 3UR0A 1WSRA 1VQ5S 1KDNA 2C2KB 3GYXB 3D66A 5HQMA 3GE9A 2FLNA 4F2SA 1CVJA 4R5PB 4PQAA 1KQKA 1EETA 1NM2A 1WKLA 4MKBA 2ZJPQ 1RT3B 4DPTA 1C1BA 2HQDA 3DRSB 5D3GB 3NXZA 5JJBA 2HNDB 2RU9A 2P6SA 1GEHA 4TYAA 1K1QA 2GV1A 2YXLA 3N01A 5FIIA 5HMWA 4CH1A 3DRXA 2KG0A 4LMZA 3DDIA 4DS5A 1HLWA 2Z2LA 2JEJA 2FIUA 1NSPA 2HQFA 3DMJA 1P9QC 3AD9C 4O3SA 3DOKB 1QE1A 1U2CA 3CCSS 2HHQA 4GMKA 4F25A 1NJXA 4ZP6A 2RS2A 1NK6A 1RDRA 3THVA 2R2UA 3ETOA 2ZHBA 3PX4A 2OMLA 1NPRA 1V6HA 2MEWA 2XSFA 3WBZA 4ZLJA 3CCJS 2BJDA 2BVZA 4ECZA 1B0VA 2HAFA 1DTTA 3P8BB 2OSQA 4NA1A 2V4JA 2E29A 3ISND 3BSAA 5B0AA 3VHQA 5GMKa 1RP5A 4D3HA 4FF1A 3Q2TC 1F9HA 3MM9B 3GG1A 2V4QA 4JI5J 4IQMA 2F8EX 3FUYA 4O0IA 3LP2A 1NZAA 2ZUGA 3CD7A 2B4VA 1FEHA 3HD1A 4DZDA 5HQLA 5L39A 4KPYA 1RT7A 3JAMY 7AT1B 1LNQA 2CWXA 3D1HA 3PKYA 2M8HA 1DBDA 3CB4A 3LP1A 5KG0A 5J1EA 3BQ0A 1D09B 4O4RA 5MLCV 4DQSA 2WW4A 1I51B 3MD3A 3L3CA 2BJ7A 2X1FA 4ZVPB 1P1TA 1S9GA 4QJVA 1BUXA 2CPFA 4XDDA 1R43A 3FGVA 4KT0C 3T1AA 4MKYA 1FX4A 4IFVA 4DV0F 4ECXA 1L3VA 3NGUA 2JJ4D 1YRXA 2Q66A 1MN9A 2FYXA 4ZMMA 1VBZA 3DFEA 4F8RA 1WNEA 4ES2A 4YQWA 4ICLB 5I4MA 1O6XA 3HSGA 2BV3A 1SJ1A 4URQU 2NLWA 2LQ9A 4WP3A 3Q8RB 1JJ4A 2E1MC 1RWVB 3MM8B 2VJVA 5KFPA 3RJMB 2AY0A 4NLVA 2DT9A 3VWSA 1SIWB 3TW0A 2FQQB 2DGXA 4OYZA 3KLHA 1UWBA 3EPGA 1I94F 1JXEA 2EKNA 3PW2A 2KM8C 5HMXA 5F0WA 5EN1A 1CS4A 3MMAB 2HK2A 1PARA 2NXJA 2P6TA 2CQIA 4P7VA 2D1CA 4X65J 2DNNA 4NZ7A 1RBLA 1H73A 3S7RA 4RUAA 3KHGA 3ZTQA 2AMCB 3KHLA 5F8GA 2FZCB 3MCOA 4B9MA 3RB4A 4PRFA 3IS9A 3PRVA 2DNOA 2CZ9A 2DCUB 2K3IA 4M5KA 4N7TA 1SQGA 2C42A 2ASYA 2BW2A 4DR6F 3V4MA 2L48A 5J2NB 3S8SA 1JNRB 3M1VA 3EICA 1SIZA 3HJVA 4RPFA 2VASA 4WU2A 3T9NA 4DV3F 1B3TA 3A3NB 4IDKA 1K0VA 3AOAA 1JLBA 3ENQA 4V19J 3TVKA 2XBPA 5L9NA 1FJEB 2ACMA 4LF6J 5C25A 4FXWA 4M5IA 5K14B 4L72B 1ARQA 4Y3CA 3MURP 3WDOA 3QLHB 1VC0A 3R8YA 1KQFB 4I67A 4X66F 2ZZMA 4PR6A 1S77D 5ETOA 3QJPA 1T05B 2JBVA 1AROP 2YKNB 3R27A 3OJUA 2HHTA 1KN6A 4DCOB 2DISA 1VCTA 2JLEA 1WD6A 3GTYX 3HZEA 3FSYA 4JI2F 3HSJA 1HBOA 3VAHA 3IR5B 2OEKA 1Q8IA 3D4JA 1CEZA 3NEKA 4DL6A 1IKYB 2OPQA 4OZNA 3R5GA 1N0UA 1UCNA 3T1YF 2YH1A 2HHXA 4ITSA 1S12A 5HVHA 1D8ZA 1OYDA 2DO0A 1VISA 3HP6A 2H9ZA 1SH3A 3O1LA 1HQUB 2YNFB 1S76D 3C6TB 5HJYA 1WC5A 2QTWA 2IA0A 1L3SA 3W60A 2XS2A 4WYWA 1HBUA 1HNVB 2VB6A 1P94A 1GQEA 4NLYA 1TUWA 4BC9A 4B3MF 2R2SA 2C3OA 1XNQF 3BQ1A 4HKQA 2VDHA 2ROGA 4HEA9 4PZVA 2Z2ZA 1MMDA 2K06A 2D69A 2F7VA 3PDNA 3NNAA 5A8WB 3DOLB 3V5RA 5HL7Q 4YR2A 3P6YC 5C24A 2KFZA 1RT1A 2E1AA 3GFYA 4FP9A 3R3TA 2G13A 2YQ0A 2C3MA 2R42A 4N8OA 1L3TA 1RT2A 3OR2B 2XMKA 4YFUA 4EFAC 3QOQA 2D74B 4B9UA 1FK9B 3W9IA 1X8DA 2XY6A 1OY9A 1L3KA 1UJ6A 2G2ZA 2YWEA 4JV0A 2FZGB 5T7LA 5LSOA 1TV6A 1VIOA 3PO5A 2CNLB 4DFMA 2ALYB 4RNHA 1DLOA 4UOCA 5GAEI 4X4SA 2XLIA 1WOSA 1XK8A 1ZA1B 3BKFA 4P71A 3G8QA 4DX8H 1HKAA 2XO6A 2J6TA 2EFGA 1U1KA 5A8RA 3TJ8A 1KWMA 1X7VA 2BE2B 2VH7A 3SQGB 4DF4A 3BZQA 1BXNA 3M8WA 2PIIA 4K59A 1SCJB 4K5RA 4QIEA 3QGHA 4M5MA 1WEYA 3SIPB 2OFHX 3ISNC 2J9EA 4ZPWR 3SSQA 1WEXA 1Y5IB 2BE2A 2O01C 1IJFB 3GZ7A 3I4HX 4Y2IA 2DRBA 3IBWA 4JYAF 2W25A 2WAQD 2X3DA 1MLAA 1NRKA 3QZ8A 3DI6B 2R7QA 4JI1F 3L4BC 1TV6B 3Q8PB 2ZUAA 1UAWA 3TVYA 1X5SA 3MPDA 4O3OA 3ZZOA 3QYYA 5ETPA 4CO1A 2DNQA 3G6XA 3QIDA 1A7GE 2M52A 3S01A 2EC0A 1RT2B 2A2DA 3TAQA 2HFVA 3HPOA 3MFIA 3FT7A 3FRYA 3LA0A 1RT1B 5FLXU 1M1GA 4P2MA 5J2MA 3KK1B 3N28A 4NL5A 2V9KA 5A8WA 4DFKA 3U1NA 4DU8A 3QFWA 4L3KA 3OL8A 3KJQB 4HHHA 1XEZA 3ITHA 3AB4B 1T9XA 4CLYA 3RBEA 3J7Z5 1HNIA 4F04B 4ECYA 2EBGA 2WVBA 4KYZA 3NCPA 3TUJC 1HNVA 3MPWA 2ZH3A 3FEZA 2V8HA 3BR9A 4WXWA 5SUHA 3J7YI 3LALA 3C6TA 4QYZJ 3ET6B 1UTAA 4KV8A 1TKDA 4FYXB 4ZN1A 1HL6A 3K0JA 4ECQA 2K29A 3GFHA 4OI1A 2B7CB 1IKYA 2OPQB 2C2NA 3DLGA 3ZO7A 4PG4A 4CNYA 3LO3A 1HBOB 1M1KT 3CGIA 1RZMA 4K4XA 4K0KF 2Z57B 3MDFA 2JXIA 4RW8A 1CJTA 1U0HA 3DGPA 1ZOTA 3NS7B 1O5JA 2V50A 2AWZA 3M4XA 4TLRA 4WFYA 1VS3A 1IJEB 2GHWA 2HWHA 4USKA 1F9EB 2GJIA 4UQTA 2HVHA 2BM1A 2GC8A 4LUBA 4A8FA 3QLHA 2HHUA 4OZJA 4DPUA 2RRBA 4F4ZA 4KHPJ 1HNWF 1D3WA 3UDLA 4TY8B 1SH0A 3AXKA 1JXLA 1CJKB 5IS2A 1BD6A 2HAIA 3AH6A 2YKPA 3A3OB 3EGNA 2FJAB 3MEDB 4DUTA 3DRRB 5ITHA 2MGZB 1HR0F 1FFGB 3ZZRA 8RUCA 4X62J 1EQMA 3A3PB 4HH1A 2NPFA 2K7JA 1W25A 4FYWB 5EDWA 2E9RX 1GK8A 1RHRB 2UUAF 1EIYB 3D6TB 1F3VA 3HHKA 1LWEB 2M70A 3TEGA 4LFAJ 2XMJA 1KFDA 2GMJA 1FKPB 2PO4A 3CCLS 4FYVB 3M30A 1N36J 1P6TA 2HW3A 2N4CA 1U1NA 2ZEJA 3U1MA 2IY5B 1A0OB 5B0EA 1FRIA 1Y3KA 4P2FA 4R0EA 1SC1B 2C2MB 1RAFB 4IG0B 4P52A 2R7OA 1FXDA 2A6OA 2DGVA 2V63A 3BO3A 2YPYA 5KFZA 2Q6BA 4B08A 3ZFVA 4ECVA 1NKCA 2XHCA 2FC9A 4OYWA 4X4TA 3BBBA 1IUJA 4NLDA 3LWMA 1JNZB 1X9WA 4DV4J 3KLHB 4PG5A 4OLOA 4XO0A 2E5LJ 1VYAA 2J8AA 1K0TA 3Q2SC 4TNOA 3EDRB 2JEIA 1QUPA 2QN6B 3H98A 2X1BA 1ZPVA 3UQSA 1UVNA 2RDDA 3T1HF 1D1UA 3BKTA 2QGFB 3KK3A 4DR7F 5IT9Y 1PILA 2CQ0A 1TUGB 1FRLA 2HZCA 4IFVB 5IFMA 4Y65A 2RDJA 4DV2J 1REVB 1YJNS 2AJ1A 3Q8SB 1Q0NA 3BGFA 2ZE2B 3FRZA 3PX6A 2DRAA 1FWLA 2ZZTA 4NXNJ 1KNZA 1W2BR 4B9LA 4Q0BA 1AFJA 2LP4A 2LVWA 3KJFB 4JI6J 1CC7A 2CQBA 2Y3YA 1ACMB 5JVGQ 1YITS 3HHDA 4Z7YA 3G5OA 3OVBA 1RT7B 1JJHA 4MMOA 4RU9A 2CRLA 2AW0A 1VQPS 3SV4A 3C46A 4YOEA 4I69A 3WHIA 2ZH7A 1HPZB 3QO9B 5CZVA 1YDLA 4QW8A 2FLOA 2ZWPA 2BX6A 2EG1A 4DI6A 2GFFA 2RU3A 3EGVA 4Q5VA 2PFFB 2NUUG 1ZA2B 1HBMA 4QIGA 3TYTA 3C19A 4EWTA 3OR1A 2RT3A 8ATCB 3UVJB 4DL3A 1J5OB 1SBRA 2UU9F 1WC1A 3OUYA 1QSYA 3H5XA 1SQEA 4L74A 2B4UA 3OTOF 2RH3A 3SDEB 1T02A 2KTQA 5J2PB 3ILLA 4JOUA 3OL9A 3JYTB 1BQNB 4J9QA 3PFOA 3OHAA 4USMA 1F1BB 3NG8A 1NDKA 4P75A 3SSRA 4DCPB 2R7SA 2AJQA 4DQQA 4X4NA 4ZCMA 2N82B 1IM4A 3KFWX 4N76A 1HHQA 4W4MA 3GIIA 4CYUA 5D3GA 4OX8A 3GQCA 2DGWA 2EC2A 1OS5A 2M4MA 1S1VB 2W8KA 3HJFA 2RQKA 1HQEB 3NL0A 3V6DA 5CABA 2JEGA 1QM9A 4GKJF 3LJPA 4R8UA 1U1LA 2IVYA 2F4FA 3IR7B 2RBFA 3MR5A 4LFBF 3G87A 4M63A 2VFRA 3AAWB 5EHHA 1VQSA 5KOWA 1NU4A 2CPIA 3KK2A 3QPIA 3G9CA 1U25A 2NXEA 2RIJA 2MKJA 4M5DA 1HNZJ 4CTAB 3R1HA 2XG8A 2XZDB 4HVZA 3KHHA 1RJJA 1AT1B 4EK2A 1MG7A 4GVBB 5GMDA 2IDLA 3CCQS 2CNKB 1RWMB 4PWWA 4O3QA 1RWOB 1Q53A 3MR7A 2ZD1A 3QT5A 2IAJB 1F5AA 5E41A 5H1SV 4X64J 2UVUA 4K5SA 2R8JA 3H8YA 3MAQA 2ROPA 1NK5A 2HHVA 1IBLF 2MQMA 1LWFB 2I9SA 2LXUA 1R8BA 2EWHA 3I0RB 5ETRA 5DJBA 2JDJA 5KFBA 3DLKA 1X4EA 2E66A 3VGTA 2N7CA 5DM7Q 2UUWA 4PYDA 2HWIA 4P2XA 3OL7A 1HI1A 2J6SA 5FDLA 3V4IB 3VEAA 1VIXA 3D7SB 4NWBA 4OZLA 3V81B 3PIOQ 3H5UA 1SC3B 1T3OA 4GC6A 1N5YB 1VQ8S 3KTQA 4KY3A 5H9EJ 4IOCQ 2RD5C 1H98A 5HK4A 4DS4A 4LF7J 3R1LA 4MKAA 4CZCA 4HACA 1KRPA 1GMVA 2VPWB 2BR0A 4DUZJ 4F67A 1T95A 3E8OA 3HHLB 3KG0A 2FPHX 3BGUA 1SC6A 3VF0B 4DR1F 1RTDB 4E0DA 4DV1F 2VHGA 3WX8A 3HHLC 3GMGA 4ID5B 4WFAQ 1S5ZA 4ZVSB 3G96A 2R7UA 4K4WA 1SPBP 3H0PA 2ZFHA 1I5OB 3RTVA 1LXJA 4LRAA 1FWPA 4OHXA 4ES3A 1J5EF 4MT1A 2FHKA 2QRRA 2F40A 3OQ2A 4I1TA 3SEOA 2AGQA 4IFYB 4CO4A 5LM7E 4U8YA 5AXNA 4I7FB 4NA2A 4X84A 5E3QA 3QWPA 4MFBB 4BWMA 3KLEA 2QEXS 3J80U 2H51B 2MZJA 5LL6d 4ANDA 2BQUA 2W2PP 3NWRA 1G7CB 2EFVA 1HD0A 2Q2KA 1SV5A 2HRYA 3I87A 4NLGA 4DX6A 4RW4A 1VQKS 1UP1A 2KDOA 3QSIA 3TUZC 1WI8A 2W7PA 5HI7A 1IM6A 5HATA 3K17A 4ZCKA 2C2EA 4IOAQ 2AF6A 3TNVA 2OAUA 3KUEA 2LECA 3LGHA 3HT0A 1G2EA 3TX8A 4QWEA 4ZVTB 2M5YA 4J9UE 4K8RA 3ZTPA 4LF5J 3CT9A 4JI8F 3ZZYA 1Y7PA 2DIUA 4UY85 3OFFA 2CPGA 1NKBA 2B8QA 4OI6A 4PWDB 3CDAA 1JLGA 1FJCA 3MMBA 2EG2A 3JSYA 3OFEA 1NCLA 3I5BA 2XYPB 3EJMA 4MYUA 2B0GA 5IQ6A 4B3RJ 1FKOB 1YBTA 2BUNA 3BH7B 3F73A 2V9WA 3DHWC 2IJRA 2NXCA 2ZOFA 3TRGA 2AP6A 2RS8A 3M8RA 1DFDA 2DR5A 4CT8A 1HWJA 2ILZA 1PG5B 3M8QA 4DG1A 2C3YA 1U49A 2J7WA 2HFSA 3QFHA 1QJHA 4TYBA 4QQBA 2H48B 5KFDA 1ZAVA 4ZPVR 1VBXA 3LPEA 2M7SA 2U1AA 4IRDA 2XYGB 4B3MJ 5DGBA 2V67A 2XB2D 3OVAA 3G8SA 3Q22A 1FKOA 1GTHA 1MNTA 2AX0A 3I9ZA 4QWBA 2M9KA 3IMQJ 1RTIA 2EW9A 4ZN3A 3BJYA 3IA0A 1S99A 2B9WA 1JLEB 3JSBA 4NLRA 4YR3A 2JXHA 1N6QA 3W2VA 4AXJA 3BSCA 2BJ8A 1WORA 3TUPA 2O66A 2V8PA 1HWIA 3UCGA 2AEFA 3BM7A 3FBEA 3CJKA 1YZ7A 2DEIA 2V6AA 5I42A 4QU7A 2G9OA 1DARA 1WEZA 4DSJA 1RHMB 3CJRA 2HFOA 3AOBA 3HXMA 4W90B 4OIXA 2MJUA 3LP0A 4NLPA 3FCWA 1X4CA 3DGVA 1RCXB 1P1LA 3H5SA 3RAMA 3VAFA 2KT3A 2YWHA 1X31C 4K2XA 4NE9C 3J81U 4DLGA 4Y6IA 3UE2A 3TZZA 5IWAF 3OD2A 2NXNA 2QG9B 4DPXA 5KFCA 4QR1A 2OD4A 3NGTA 4ZVHA 3CJ8A 4CM0A 4QWDA 4GKKJ 2XLKA 3Q8VA 2GW8A 3OVSA 1HNZF 2CKWA 3KNAA 4MH8A 3UW1A 2UP1A 3VR1A 1I6JA 3S1TA 1UJ5A 3EZ5A 1R6VA 1S48A 2MLXA 2CPJA 3VAGA 4ID5A 4PG7A 3V2UC 2ZJQQ 4ANCA 3W3SA 1FWKA 4OZ1A 2OPPA 4F3QA 2ZH6A 1FDDA 3HHLA 3P96A 1PAEX 2QYCA 2HVIA 1UPMB 2I5JB 2XWXA 1B7FA 5AE1A 2U2FA 5H9EK 1FFSB 1U24A 2OPSA 3NS5A 2HS4A 3O3LA 1C0TB 1GNKA 2DR6A 5KG1A 3RG6A 1S1XA 1UW4A 2EFOA 2RUGA 2WHOA 3VQTA 2P9GA 1QY7A 4L75A 3SXLA 3KLIB 1S57A 2OI2A 4HV0A 5HBMB 3I55S 2H54B 2LMIA 2UXDF 1V5VA 3VVTA 4JI1J 1TKTA 1LW2B 3D3CJ 4JI0F 1LWFA 2KL8A 5KT7A 1R0AB 1RCOB 1EP4B 4KFBB 4EGLA 4KKOB 1JK9B 4FPRA 5LXYA 1X4HA 2ZD1B 4WYLA 3IRXA 3TX0A 1NSKL 2MKYA 1H74A 3FQKA 2J76E 3DXBA 3A4TA 4Y00A 2PEBA 3SFUA 4IH5A 1NJYA 2FVSA 2FY1A 4OV1A 1K1SA 4JV5J 3MAAB 1F9FA 2CQ4A 4M5DB 2B4OA 1U09A 5A8KB 2UXBJ 2RUSA 1BDTA 1BE4A 1RT4A 1YJUA 2CG4A 2CYYA 2NSCA 2YNHA 3IAM9 2IM1A 1R7IA 4CLTA 4NCGA 2MY7A 4ZJQA 1L3UA 2W9AA 3OTDA 2CPXA 3BF4A 2WVCA 3VAIA 4W98A 2E1RA 3HFVA 3IFEA 1AFIA 2KN4A 1I1GA 2QA4G 2MKHA 3V6DB 1HR0J 4IQXA 4DMZA 4K50A 4PEOA 5B0BA 2A1BA 5EX3A 4TU8A 3D6FB 4DR5F 3QRQA 3TJAA 1W2IA 1RTHB 2UZAA 2GO8A 1B28A 4RW6A 3VAKA 4J9PA 1H3DA 4URGA 1LK7A 4DQRA 1N8RT 3GXQA 3G2XA 2VJUA 2HLUA 2HQCA 1IQZA 2UVRA 1S97A 2V2KA 5F8NA 5CYJA 4KTQA 3ZTRA 3D3BJ 1R3NA 1H38A 3POTB 3JTPA 4HTIA 4J5OA 6AT1B 2F8HA 2RKIB 4PPZA 4AQYJ 4DHVA 4DR5J 4ZK7M 1VQOS 3A13A 1HYSB 3OUYB 2EEYA 3R7NB 1PJ5A 4S0MA 4DWIA 3R2DJ 2GVZA 2W2NP 2GMHA 2DH8A 5L46A 1J5OA 3Q8QB 3IAS9 3ZTSA 4C48A 1RXOB 5ETTA 4DQIA 4MJWA 2RE1A 1S0VA 3H2UB 2XGPA 2VQFF 2VG6A 3CC4S 1G1XA 1XQIA 3E01A 1XTZA 4MK8A 1JLQB 4YB5A 4ELVA 3JSMB 1KKHA 1X5OA 3VTIA 4AQYF 2VQEF 1RKJA 3QO9A 1M5OC 2E9TA 4LR9A 2NYHA 2MQLA 4WIQA 1CJUB 3HFZB 4Z37A 1HNXF 3CJ4A 4LR7A 1CBKA 3C15A 3CJ3A 3QATA 2AX1A 4ED1A 1UL3A 2B3TB 2GQ2A 3EUNA 5ETKA 5D0HA 2MQPA 1N32J 5ETVA 1YWXA 2V8GA 3IM9A 1Z1ZA 4QWAA 2PMHA 3PJWA 1N5TA 3BGLA 3MR6A 4CLWA 2YWFA 2APOA 4OYPA 4CM2A 4X64F 3CEDA 2R2RA 2AV5A 1NKEA 3BBFA 3R5JB 2YNGB 2XC9A 2WONA 1KC8T 4QR0A 3QJJA 1REVA 2O5DA 3RGIA 1M5HA 1X4AA 3M2RA 3R5AA 3OW2R 1RYRA 3MEEB 2KXNB 1VRQC 2DITA 4FBUA 1S1TB 2CNOB 1REGX 1VHFA 4F0KA 4DV5J 5FJ4A 3EVWA 1IR1A 4DV3J 1U2FA 4ETXA 2HEKA 3HFKA 4HH0A 4R25A 4B17A 2B43A 4BHQA 3IWXA 2DVIA 2AYEA 4YHHF 5A6PA 1Y3JA 2W9BA 2DYAA 1TL4A 3M6WA 4KBIA 4ZOSA 2QC3A 4Q45A 1FA0A 4TXSA 4DZ6A 2NZCA 4EBDA 2PI5A 2B5JA 2CNNB 3RAXA 2FVQA 1KLNA 4K4VA 1WDTA 2GVDA 4YB6A 5CAAA 2H3AA 4MK7A 1VHIA 2JZ5A 4AL6A 2ZVIA 3A8IA 1Y4ZB 1HWKA 1FE4A 2V2ZA 3H4BA 3M30B 1XMOF 3GYGA 2DIVA 1E6VA 3CDUA 3GR1A 4DR3F 2ASDA 2NQPA 2ZDOA 2L9WA 3C14A 1NK0A 1EX8A 2OKQA 5T41A 4BWJA 1LWCB 2DBBA 2P9EA 1N56A 2J0QD 3C16B 3DRRA 2V2VA 2A2BA 1X5PA 1SL0A 4YUDA 1CJKA 3AFGA 1HA1A 4B3SF 2BJ9A 4LF9J 2PE8A 4J9KA 1DTQB 4WE1B 3NBPA 1FERA 4NEZA 3PXGa 3JAMU 1D8YA 4ELUA 1UFWA 2DGQA 5KFEA 3NNHA 4U7UD 2VU5A 1XMBA 3LH2S 2I8EA 1K47A 5C2CA 1N52B 5L1LA 3BGRA 2BE7D 1RB0A 1S6OA 1SJQA 2CQHA 3ZXWA 2XSJA 2H1OE 3BN7A 4RUCA 2JWNA 1ZETA 1X9SA 4LF8F 4RW8B 4O44B 1RWNB 1ZM3A 4K7QA 5HAOA 4LF9F 2XHWA 4PQUB 4C8LA 1OY8A 4M94A 1F6TA 1YK9A 3HK2A 1Q5YA 4JI5F 1R0BG 1S6PA 1WELA 1RT6A 2CPHA 4Y0FA 5BYQA 3K58A 4ECWA 5K9FA 1QLNA 2CVEA 3KOAA 2WVFA 4Y2AA 2LEAA 2YY3A 3A8KA 3WQPA 2CJBA 1XWLA 4FXEA 3H2LA 1VK8A 1AB8A 1S59A 2DTJA 1IKXA 1EKRA 1M1HA 3TEHB 2ZVSA 1GXTA 1CG2A 1HNIB 2J9CA 4H4MA 4NASA 4NLXA 3D9BA 4OZ5A 2VFVA 4ZP9A 4XPCA 1RKIA 4TU7A 4XDCA 2VPZB 3EMTA 1NSAA 3MCMA 3OHBA 3ILIA 3FCHA 5IM0A 2CPEA 1KHVA 4DCJB 4DFPA 4Q43A 4DUZF 2QL9B 2YKMB 4LIRA 5LSLA 3EGZA 2AYMA 5J2MB 3FZBA 2LFVA 2RNEA 1KOHA 4L76A 2IVMA 4C98A 4AAIA 1S6UA 4U8VA 2ZITA 3PHTA 3SYZA 3GP9A 1RHUB 4WFNQ 1FKAF 1WDDA 2D3UA 4ES1A 4WZMA 5ETMA 2MQOA 4USIA 1R8HA 2EK1A 4OX9J 3LTOA 3BQ2A 2C3UA 1EARA 2BW7A 3W65A 3AQOA 2BACA 4B3OA 1OMSA 2X1AA 2H4YB 1HNXJ 1RWWB 3PKMA 2O1PA 2OO4A 2AN7A 4B3RF 1OSDA 3HVTB 1Y9OA 1P9YA 2PC6A 4LQ3A 1NDPA 3WC2A 1WHVA 4A8QA 3U7JA 3M9MB 2Q6CA 3CWJA 4PXBA 2D3OR 1TL1B 1TUVA 2CQ1A 3JTNA 4ZJLA 2XY5A 3BREA 5KFJA 2V68A 3HVTA 3CCMS 2ZWOA 1M5KC 4AT1B 4K4SA 2DHHA 1U2RA 2ZBCA 3CC2S 4ILRA 5KAKA 3FQLA 4EEYA 2I38A 4F3OA 4C0HA 1MYKA 5T7LB 4YR0A 4DV1J 2D3O1 4X4VA 1HW8A 4A48A 1FK9A 4K2JA 3DM2B 4C3KA 2OH2A 1LEOA 2ZJRQ 1N34F 1D9DA 2HLTA 2WSEC 3LPYA 3MEGA 3P5TL 3VGUA 5EX0A 1FTRA 4KAIA 2YKMA 3GSDA 1SKRA 5AE3A 3DOLA 3G6YA 2BANB 4AUKA 1KS2A 2K8GA 1F2HA 1TKXB 2LDIA 1S0MA 3AJ1A 2RQCA 2VUGA 4PYAA 1M5SA 2CQDA 3OTOJ 3GIKA 2ERRA 1FJGF 2MQQA 3G6ES 3GJQB 2JX2A 3QSYB 3F44A 1RWKB 2B9XA 4WIIA 4AL7A 4CLPA 3AJDA 1NHUA 1CLFA 4OL8A 3IGNA 5EUHA 1HQUA 2YNFA 5HMYA 5LT5A 1XR5A 1ZM2A 3QT7A 3QAUA 3KNGA 2DR8A 3J7A1 2E9ZA 1S6PB 4X62F 4DBQA 3D68A 5HO4A 2HPUA 1W26A 4E8UA 3OPKA 2Q3PA 4NLWA 4BS2A 3SZ2A 4Q8EA 2IFXA 5CQGA 4O44A 3QIPB 2HHWA 2HQGA 3CDWA 2DH9A 2HHHF 1QAYA 1X5TA 1T05A 2IIHA 3HVWA 4CDIA 5GADU 4U95A 2V34A 3FMWA 4J37A 4C7QA 4M1KA 3RR8A 1VFJA 2I1RA 1T9VA 4DX7A 5C7PA 1Q81T 3DLLQ 4JB8B 1DTQA 4WE1A 4EI2A 5K14A 4YB1P 5J2QB 1FO1A 3B4MA 1YJTA 4X65F 1EQ0A 3VEBA 2V8DA 5K8OA 3BS9A 5LJ3Y 1OWXA 3W8GA 3ICLA 3NCQA 4HTJA 1P27B 4C8NA 3C8YA 3C16A 4WTYA 4LSZB 1RAEB 5IV3A 4F3MA 3PYDA 1CULB 2NZ4A 5KG7A 3FC9A 1N0VC 3QMQA 1IR0A 1BWVA 3C14B 3T1HJ 3LW5C 3I31A 5K8PA 4TKTA 3HX9A 3EYZA 2RMLA 1AYEA 4H4OA 5LJ5Y 2HQIA 3ISZA 1T3NA 4ENOA 5DGAA 2JOQA 5ETQA 3FBCA 3L95X 4XAKA 4EMDA 4X4RA 1TR0A 3CDEA 4DR1J 3KLGA 1U1OA 2IRYA 1X4GA 3GJRB 4XTTA 3OTBA 2HMIA 2MHEA 2LXIA 3MMAA 4EZ6A 1PC4A 3ZZ0A 3P45B 3T3FA 4IRKA 1CPZA 1BQMA 2PGCA 3PEHA 4NLUA 3VW4A 3W5YA 4DV7F 1YIJS 5IT9U 1XR6A 2XMMA 1WC0A 1CJVB 1SIWA 4HHUA 4CRJA 3RZAA 1MROB 1NPKA 2W9BB 2BKOA 1OO0B 2IC3A 3MM8A 4H4KA 4MYTA 4JI7J 2HRUA 2VQEJ 3CMES 2GQCA 4KQZA 2XGQA 1SVDA 3JQMA 5DG9A 4A8YA 2VBYA 3BO2A 3NAHA 3IR6B 3RYLA 4Y34A 1S1TA 1QTGA 3UPFA 3TZWA 3EXYA 1ZAXA 2ILYA 1XMQJ 4M5JA 4O3RA 4FF2A 1XNRJ 1N88A 2YBVA 1X0FA 1UVMA 3M2RB 5CCLA 1UKUA 1RAOA 3HHLD 2WONB 4DR2J 3KMSA 4OX6A 1HWLA 2LYVA 1O0PA 3QNWB 1TVRA 1HI8A 3H42A 4ZVGA 5KFOA 3QZ7A 5J1EB 2BYCA 2CJKA 1VQNS 2H4WB 3LP1B 1MWYA 3RW6A 4RL1A 3ADAC 4C8KA 2GGPB 3PX0A 3UN2A 2Q1LA 1VGYA 2D41A 2W2MP 3W64A 1T9UA 3CC7S 2IYGA 3G86A 1Y10A 2IMOA 1FI4A 4I56A 4NLOA 3C15B 4PXCA 2NS1B 5KT2A 4DV5F 5KG5A 2PD1A 4U6PA 3PW0A 2X1GA 1TVRB 2L9DA 2FD2A 4F2RA 4LFCJ 3THPA 4XPEA 2R2TA 1K8AT 1T7PA 4KHPF 2CJXB 5G0RB 1VJWA 1WG1A 2MZSA 3E01B 5KFUA 5EWEA 3CJQA 3NY0A 2Z8QA 1DURA 3K57A 4OYOA 1ARRA 3H5YA 1Z2LA 1QTNB 3EVOA 2YX7A 4ECRA 2UXDJ 2A6MA 1VMBA 2PA8D 3GSIA 5DQIA 3I6PA 1OG7A 1FF2A 3TJ9A 4ALZA 5HMZA 5KFKA 4NXMF 2RKIA 5E5NA 2VONA 3POTA 1UVJA 2IC3B 4DJBA 3D5MA 4JV2A 1WF0A 1G6BA 1ZBTA 1TELA 1UETA 2CQPA 2CJQA 4O3PA 2N7YA 5D78A 4CH7A 5KFWA 4EZ9A 3GFXA 1BQMB 5GADI 1YJWS 2EXUA 4XIUA 3QQCD 2HMIB 3RU0A 3RUBL 3NKYA 1RT3A 1HNWJ 2W4CA 1WG5A 3PG9A 5F8HA 4LF4F 1IWGA 4AD6A 3EZUA 4OZ2A 1FX2A 3GG0A 2GS8A 3KLGB 3TAMB 5K8NA 5D4PA 2FLPA 5FLXY 4LRVA 3RB3A 2KT2A 1U8SA 2DHAA 3DDKA 4CT9A 3CF5Q 4Z2XA 4NCGB 4H4OB 1CC8A 1LK5A 2B56A 2CJ9A 3GJSB 2YNHB 3PACA 1M90T 3HKZD 1WKJA 4DX5A 2IA6A 4YS2A 5A8KA 4N47A 1TAQA 2ZOGA 3M2UA 3THTA 1CULA 4K0KJ 4JYAJ 2DKOB 4CLSA 3FDSA 1PYTA 5D4OA 3DLBA 3H40A 2A10A 3CNQP 1H0HB 1DJ0A 4B9SA 1MU2A 4RZRA 4LIWA 5J2QA 4DLEA 4X2BA 2DNRA 4KKOA 4F4YA 4OMFG 1UZHA 1WTFA 1WC3A 3O5TB 4U96A 5GMEA 5F8LA 1GMWD 1LW2A 3KLVA 1R0AA 2UUCJ 4ZPCA 3P49B 1QSSA 4G1PA 2ALZA 4FBTA 2J8SA 3HLUA 4NMLA 4P10A 1RHQB 2VL1A 4BC7A 2CQGA 2F9DA 5RUBA 3EWGA 1SJ3P 1URRA 2E5IA 3QIPA 4EO6A 1YTYA 3EVMA 2ZHOA 1RBOB 1S1XB 2KKEA 5ADZA 2UUBJ 4C97A 1FNMA 1C0TA 1C4AA 1UVIA 1T9TA 2HS0A 3A1YG 4KH1B 5AT1B 5CD4H 3MUMP 5E2QA 3TARA 1S4FA 4G65A 1YX2A 2PT0A 3EDQB 3NOCA 4WKYA 2EFNA 2D3ZA 4O4GB 5KFMA 4A8SA 1R8AA 3SSSA 1FEEA 1D9FA 1Q4RA 2KJVA 2Y1IA 3IM8A 1F3FA 2C28A 4LR8A 1TK8A 1WF2A 1YBUA 1IN0A 3GLJA 4ED5A 1TKXA 4CO0A 1VC6A 3I32A 5K8MA 4NI2A 3ZZUA 1VR6A 2LU2A 2FHJD 2B8PA 1VRUB 3LAKA 2DNHA 1VK3A 4NMXA 3VZHA 4Q8FA 3K5OA 4FS2A 1Y00A 3K8WA 1RT5A 5GAEU 3K5NA 4M8LA 1WJ9A 1RK8A 4N56A 3G71S 5AXMA 3DM2A 2JVOA 1BWEA 1NDCA 2W7OA 1F0XA 2CVIA 1UVKA 2VC1A 2KOEA 2NYIA 1S4EA 1P8GA 3CVKA 4CLLA 1H2VZ 1VQYA 2GX8A 3GWCA 4ZPTR 4A46A 3I0SB 2YWGA 5HVGA 2MZ1A 4TQSA 2IYIA 3TAPA 4C4WA 2MYFA 3CCUS 1TU0B 5F3TA 5K20B 2FJVA 1FHTA 1T11A 4G1QB 1VRTA 3VGSA 1L5UA 2BRLA 5ETNA 4DFJA 4DR4F 4CNZA 1N5VA 3T5LA 4QR2A 1TL1A 3GJTB 4OYAA 2YKQA 3ILOA 4Z7CA 2JFKA 1RTZA 2R4FA 3TP2A 5J1PA 4WCEQ 2ADCA 1HHTP 3C6UA 2KZZA 2PMWA 5KFFA 3DNCA 6FDRA 5DDRC 1RTIB 3E51A 4PCQA 1RI7A 1H72C 1QAIA 4LFCF 2HNZA 3AY0A 1Q5VA 2HZVA 1K44A 3F41A 2E7VA 3HSDA 3VV2B 4B3OB 3R2CJ 2QLJB 2MB0B 2FHMA 2KVIA 2O3DA 5U47A 3PRBA 4RUHA 5M2UA 3B4DA 3HDSA 1VDHA 4QZVB 4MKVA 2BMBA 4F0HA 4TU9A 3DLHA 3D67A 2CA9A 1YKWA 4N77A 3B78A 1FD2A 3JXOA 3M8QB 2BZ2A 2ZBRA 3F0NA 2QE5A 3N79A 4DG1B 3MF5A 3OJSA 1AUDA 4DSKA 1AA1B 3O44A 4FYDA 4Q2LA 1TAUA 3JSRA 4HLBA 2OPRB 5EGYA 2C22A 1VI7A 1FFWB 2AKWB 3PTWA 2HFZA 3RRKA 3SCJE 4RNOA 4J9NA 2R3VA 2KFNA 4AE5A 4J91A 2MXYA 3N5FA 1N33F 2KT5A 2UXBF 4YMEA 2QIFA 5CYMB 2ZH2A 4H4MB 5CH7B 1IKVB 3M6UA 3NMAA 1HBNB 3PM9A 4MIAA 1T9YA 2K1RA 3SMZA 4UT4A 1XJWB 5DLGA 3WC0A 3T9ZA 1NO8A 4CH0S 5IXUA 1U48A 5CHCB 3BPSP 1K9MT 6FD1A 4FXDA 3H87C 2L08A 2LKZA 3MM5A 3MPUB 2Y9HA 4GKKF 4FF3A 2MPUA 1AW0A 1EZZB 2C2DA 2KO1A 2Z56B 5C2GA 1H2UX 4QWCA 2KHDA 1SV5B 1LQ9A 3CCTA 4UOHA 2XMWA 3J7YU 1R89A 1SL2A 5DRKA 3RB0A 3NOGA 5KFAA 2YWKA 3CJTA 3P5BP 5A6WA 1E6YA 4P7TA 2DHSA 1Q95G 3IWNC 4DSLA 5IZHA 2YKAA 3MMCA 2XSJB 4QCLA 1AUSL 2GAGC 1OYEA 2GCFA 3BGRB 1S1UB 1LFWA 2PEHA 4JBCA 3KUHA 1S6QB 4DDFA 2OJ3A 1U9PA 1R0CB 1FRXA 3DHXA 4NYZA 4WK3A 3BO4A 2JXGA 1H7WA 4ANEA 1UPPA 1UEKA 3EGWB 1C0UB 4OJ3A 5KFTA 1FTCA 4IO1A 4DL2A 4USHA 2J0XA 2Z0GA 2HS3A 2QL5B 1C2PA 3AA8A 3HD2A 2AYBA 1B64A 3UCZP 3IG1B 1RTDA 2BOAA 2WOMA 1LWCA 1XIQA 1WKKA 2GMLA 2YH0A 4U67Q 4EO8A 2MY8A 3OT9A 4CWBA 3VGVA 1DHMA 1IKWA 2G4BA 1E6VB 1N5YA 1NMEB 2LQJA 4C8MA 3ULHA 2C2OB 3V4IA 5FDLB 3J7ZT 2PA3A 3IO1A 4F7VA 4ECSA 2FY8A 5E33A 2FJXA 1VQMS 4FKXA 3CJ2A 3PYGA 4KHMA 4WFXA 4NCAA 4IG3B 2G0CA 2RF2B 3R7SB 5A2QU 4LSLB 2ZM6F 3PW4A 2GVDB 2OTLS 1YJRA 4KIAA 4ZVOB 3VAJA 2B5JB 1Q8LA 2KH9A 3Q24A 2K9IA 4USWA 4YN3B 1JQGA 3CIZA 3TR5A 1U8WA 3DYAA 4DU7A 3R7BB 3WIUA 3V6HA 4LT6A 4C11A 2V0NA 5JMNA 3TZXA 1N33J 2GJFA 1O51A 4GVBA 3UI3A 2M8DB 4J9MA 3BBCA 5F9NA 4GC7A 2ATCB 2MQNA 2OFGX 3NGRA 3X3UA 3IBFB 2UUBF 1V5IB 2WSCC 4JI4F 4K4ZA 1JWWA 3J81j 3CJ5A 3KK2B 3ZZZA 5D77A 5E3CA 1TK5A 1FESA 1GAOA 2PFDA 3UR3C 2BSQE 4O3NA 3KWMA 1F5BA 4CCHA 1SKUB 4C3LA 3V6KA 1DQAA 3HVRA 1Q86T 1FXLA 5IOLA 2VICA 1S1VA 3PEJA 3GCXP 4F4XA 5LXRA 4JI3F 4AYBD 3OLAA 3QGIA 2AHOB 3A8EA 1Y11A 3FBFA 5GAHI 1XNRF 1FJGJ 2GNKA 3PJXA 4WK1A 2FB0A 3FSXA 4O0NA 5C42B 1FVSA 3C66A 3W5XA 4NLSA 3FMTA 2DY9A 4RKUC 4YHHJ 1B0TA 1KLMA 4FXVA 4HHJA 4UUWA 2XZTB 4RBTA 2AEMA 5IC6B 3AB2B 4CLFA 5J2PA 1T0TV 3HHEA 1JLQA 3HHNB 2FJBB 2VG6B 1HI0P 2MZQA 2OELA 4CO5A 2ZH9A 3PW5A 2ZH4A 1EA4A 1O8BA 3UVJA 4ED4A 2F4VF 2EPIA 1HBMB 2CZVC 1WHYA 2GVZB 5KT4A 4PKDB 4TQRA 2G1DA 4ZP8A 2FZKB 2JL9A 1CQMA 2XNQA 4DN9A 3G8TA 1N54B 1WUUA 2JHEA 2QZ8A 1TMMA 4DXLA 4K4TA 3O6QA 1HPZA 3H25A 4U9RA 5C42A 2YNIA 2JFDA 2J9DA 3R5DA 1RBAA 2IJNA 1XNQJ 1OQ3A 1KR4A 1FD8A 1RAGB 2J9DE 1NLAA 1QTMA 3CCVS 3MPYA 2MZRA 2RDIA 2GHVC 2UU9J 1SC4B 4KGXB 3LANA 3TANA 4UUXA 1NPPA 2LDYA 2H3EB 4NPOA 1N5QA 2V4RA 1IBMF 4Q0BB 5DETA 1MYLA 3H20A 1RT4B 2BM0A 3OXGA 3UD4P 3GV8B 2R7TA 3NGSA 2BE9B 1RYSA 4K4YA 4ZKAA 2VFTA 4ER8A 2E5JA 2H65B 2QT7A 1XMOJ 2BDPA 4GO5X 1HARA 3KJVA 2VG7A 3I5CA 1B01A 5M2RA 2WB1D 4DL7A 5D0GA 3TUIC 1NK9A 4QU6A 1JLCB 4DUYJ 1VLOA 2KHCA 3MUTP 1IBMJ 3IRXB 1YZ6A 1JLFA 4KSEB 4C11B 1NLKL 2HQ3A 3DYAB 2K2PA 4X4OA 1EP4A 3DXSX 4KFBA 2R7RA 3VALA 1MMLA 2XY7A 3AT1B 3WZ0A 2AGOA 2GIFA 5D0EA 4B3SJ 5LOQA 4RWWA 3IGVA 2ASJA 2LQ5A 1SI9A 5BYSA 2HHPA 3FMBA 3Q23A 2FTRA 1G3OA 2HVEA 3PRDA 4FDFA 2RF2A 2M3DA 4LSLA 3CIMA 1SJRA 1RU2A 1FVQA 2B4PA 3U27A 1RA6A 4ZHRB 4DUYF 2GA7A 2RRAA 4EYIB 2XZWA 2Z2YB 3EE3A 3MHYA 4UTGA 1JIHA 2FGCA 2SXLA 3DRYA 4YEAA 4NXNF 4DL5A 4DR7J 2DGSA 1J5EJ 2XMUA 2VBWA 2VKZG 5KFXA 4LRBA 1ZYQA 1PSDA 2WCXA 2N3LA 4Y28C 4ZP7A 2XLJA 1LWEA 4NXMJ 4UZBA 3BEGB 2LU1A 3LGNA 2HRTA 1WC4A 4ILLA 4M5NA 2CIMA 4Q7AA 2QV6A 2WOMB 3DRPA 4OJGA 5JVHQ 4P74A 1SL1A 1FDNA 2MGZA 2HGMA 2CAXA 2ABYA 3MWBA 4FS1A 2VOOA 4DL4A 2BNZA 5CCMA 4CQ1A 4UQGA 4LVOP 3FSIA 4ZA1A 2OLWA 1ZM9A 2ASLA 5GAGI 1WI6A 2RJZA 2J0SD 1YJ9S 1UA1A 1RLCL 4P9SA 4NZ6A 1S1UA 2QMXA 2DNPA 3SCLE 2ZBQA 3IRWP 2HHHJ 3BDPA 2H5EA 3MMCB 1Q79A 3HO1A 3E2EA 2B9EA 3FCVA 3D0GE 3BB5A 1OPIA 4LRDA 5AE2A 2E1PA 1CJTB 2BJEA 3DGPB 3HF5A 1MNEA 2J5AA 4PWDA 4DSFA 1MWZA 3DLGB 3R97A 1F2GA 3TQ1A 3LP0B 1BMQB 2AZ1A 4FYYB 3TOQA 3M9NB 4CP5A 2XCPA 3K59A 1T03A 4KV8B 3MZIA 1APSA 3LOUA 4KB7A 2IRXA 5L1KA 4BLGA 3BSOA 3MM5B 3L7OA 3FFIB 4OZ3A 2ATLA 1U47A 3QAEA 5THWA 5BYRA 3UWTA 3MCNA 4G3IA 2JLGA 4USJC 1ZPWX 2MKCA 1DQ9A 2GAHC 4HT5A 3Q8UA 1ICEB 3CPWR 2W01A 1HBNA 1IKVA 3OXLA 3W2VB 3PNIA 3WX4A 2HFUA 1JLEA 1N6QB 3NNEA 3LGMA 4O23A 4ZDNA 2IMWP 4NEYA 4GKJJ 1WOPA 4R0JA 5IT0A 2OPRA 5F3ZA 2EVZA 4WJBA 1D0EA 3WIVA 2KI2A 3GV7B 1WG4A 2DXFA 4PXDA 1LW0A 1X4BA 4E98A 4MJKA 3DC2A 3IP0A 1RUSA 2AEJA 3PCOB 4KGMA 4NOHA 2N3OA 5EWFA 1YLXA 4ED7A 1NHVA 3DCAA 3BN4A 3UDCA 1G4CA 3RRGA 3MGJA 1Q1KA 3LAMA 1WHXA 2XTJP 2AZ3A 3VAMA 3J81Y 2F1FA 4F36A 1M5VC 4LFAF 2HSEB 3AOCA 1EJ7L 5ETSA 3GIMA 1FCAA 2D9OA 2EFQA 2RQMA 3DI6A 4QYRA 2QMWA 2AGPA 1XC9A 2EK6A 5E3AA 3GU0A 4ZVFA 3JYTA 5D0RA 2ZHAA 4FVCA 5ETLA 2HBRB 2PSZA 4ZIVA 4H54A 3JS9A 2CFXA 3W9JA 3I56S 2OEJA 4IOBA 3SQGA 1R8CA 2FHOB 3M8ZA 5A8RB 5HN0A 3K5LA 1A6LA 4G1QA 3V6JA 3TI0A 1HFEL 2C1EB 5SZTA 4I68A 2VD3A 1PAUB 4WBFA 5KFGA 2V69A 1YI2S 4LQ9A 3OFHA 5DQHA 3M8PA 4EBCA 4DQPA 2GIQA 3TQEA 3JSMA 4ZS6A 2E5HA 3K5MA 4KR0B 4LFBJ 2N4DA 4LF1A 2HBZB 3PFEA 2FJDB 3LWLA 4WFZA 1NK4A 1RA7A 1RT5B 2WBRA 5J1NA 1SXLA 4MFBA 5DZ6A 3UN3A 4AL5A 2YPZA 3BGOP 4I7FA 4LRFA 3KLEB 1RAHB 1VRUA 4FKYA 4IFYA 1QAJA 3QWUA 4LF8J 4V19X 2Y1LB 3FKBA 4OLPA 1IRQA 4EYHB 2HBYB 3ENVA 1UJ4A 1KONA 2KVQE 3FBBA 2ZM6J 3FEYB 3W1YC 5B08A 1MMNA 1V9OA 4UOGA 1LFPA 2PN6A 1PJ6A 5B0DA 5F8JA 2Y8YA 2DNZA 3Q89A 2XULA 2ZBPA 4O4GA 4F0MA 4DPWA 2D7SA 2MSTA 4HACB 4OYBA 4DN0A 4HYKA 1Q8KA 3PW7A 3KMQA 4ERDA 4DV6J 3CCRS 1NSQA 3PV8A 3UO0A 2VBZA 4OHWA 1EAYC 3FJ2A 3RBZA 2HIQA 1S7HA 4ID8A 2E5GA 4XK8C 2WRMA 2DHGA 2QSWA 4USUA 3U02A 5LMNJ 1SH2A 1U1MA 2QLWA 3M6VA 5KFQA 1BGXT 3KJNB 1ITPA 1U6FA 1D9AA 2VG5B 3MEKA 1J2VA 3ELHA 4RUBA 2NPIA 3RBXA 3M32B 3MUVP 2HYIB 2AD9A 4YDDB 3HZGA 1RGVA 1X0PA 3I0RA 3NP5A 5KFYA 1UFLA 3CD0A 4L3NA 3ZTOA 4C6AA 1FRMA 5KT3A 2IAJA 3CMQA 4FN5A 3AD8C 1MU2B 3D54A 1VJQA 5L1IA 2P9CA 1YVFA 3N6LA 1AZSB 1JLBB 4FNIA 4IH7A 4UZCA 1U1PA 2VPYB 2GJ2A 3ETMA 2YX1A 4KO0A 5AXKA 1FT8A 2CDRB 5GVQA 1UWAA 2R9LA 1HD1A 2AJ0A 2XEXA 3N6MA 1HQ2A 2X7IA 3CDBA 1TMJA 4ECTA 2VF3A 2DD8S 5C5JA 5D6GA 1MW7A 2QLBB 4PG6A 4F4WA 3IR7A 5CA5A 3IS9B 3TA2A 3MTKA 5F8IA 4R8UB 1VC5A 3CJSA 1RADB 3TAMA 2L9NA 3NAIA 1HQEA 2ZNYA 5K5MA 2LQ8A 4RW9B 4CLUA 3HCXA 5DG8A 3CUNA 3HSZA 4OYMA 4CYUB 4NZ0A 2ADLA 2CQ2A 2G1HA 2ZKTA 4TLQA 5BR8J 4JI8J 2A0FB 3OXFA 3MCSA 3VVUA 3H2VE 4V1Ak 2OP5A 2MKKA 1HHSA 1BQNA 3S6EA 1JKHA 5HP1A 2K6LA 2WSFC 2R8IA 2M88A 2DY1A 3SDEA 1NZ8A 1U0SA 4KE5A 2HG4A 4NRTA 1C4CA 2VFSA 3GILA 2F9JA 2Z58B 5F0UA 1SJ4P 4ICLA 1NAQA 2DNYA 3MECB 3OR1B 4ZITA 2J7KA 3HI9A 2W1BA 4RLEA 3CSKA 2AT1B 4PUOA 1GFWB 1FRJA 1GXLA 1MN7A 3MI7X 3MM7B 5HANA 4KGZB 3MAHA 1S9GB 2IHR1 2FC8A 2G2YA 2JLFA 5G0RA 5KT5A 1PC5A 3CO0P 3NCRA 2BEFA 4P72A 2UUTA 1VOMA 1YQHA 2CZ4A 3DLEA 2OHDA 1S9FA 1VQ6S 4QYZK 4X4UA 1XR7A 3VCDA 2UV8G 2Q43A 4FZVA 4WP9A 2OD6A 2GHPA 1S9EA 3UD3P 2G2OA 1PJ7A 2Z30B 3D1QA 4I64A 3KG1A 1ZAWA 4QIFA 4DL0C 4ED0A 1S9EB 5KFRA 4WKRA 2GGPA 2HURA 4ME7E 3LP2B 3N5BA 1KBRA 3RB6A 3C2PA 1ZM4A 5D8HB 1Y0HA 2EKYA 2HGNA 4WWSA 2GPEA 1YJVA 2FGOA 5KFLA 3QRPA 1FE0A 2CWKA 2EI5A 3DLEB 2A3JA 2R7WA 4WTOB 3RBDA 1K73T 3UDEA 3M8SA 2IM3A 3T5JA 1WHWA 1RLDA 1ROFA 3PR4A 1BDVA 3US5A 2ZE2A 2VIHA 3NGDA 1DTTB 2IJFA 3MM7A 1NEEA 2P2CB 4OZ0A 4EU0A 3MMJA 5H9FJ 4A8MP 3FEXB 1V3RA 3PVXA 4PUOB 2FUG9 3MECA 3KK3B 1GMUA 3ENAA 1X4DA 5KG3A 1URNA 4Q44A 2ADBA 2HWTA 2FDNA 4HT7A 3DOKA 1Z4UA 3JB9k 5AXLA 1HWUA 1JKHB 1F5CA 1MROA 2Y1RI 4ED6A 5E0OA 5HP1B 1CJVA 3OSPA 4B9NA 4FPIA 4ZLLA 2VDIA 1RABB 2NXUA 4YB7A 2F4VJ 1PGZA 3R6GB 3HMJG 4KHRA 2HNDA 3MD1A 2XM3A 3UN5A 4IG0A 3NS6A 1EETB 4RW9A 4R5PA 2WVDA 2MMYA 1ZS6A 2XYHB 2ZDPA 3N0VA 2V8VA 1JJ2R 5IQQA 2I6WA 2KM8B 4LF5F 1NB2A 1RSCA 5IV4A 2Y0BB 5KG2A 5HLFA 1U6BA 1FKPA 1JX4A 4ATNA 4YY3J 3J7AN 4RJVA 3KDOA 5D15A 3DOMB 4J7CA 2XI2A 5E7OB 4NLQA 2BXJA 4OYXA 4PWUA 2A18A 4FF4A 3G82A 3B6BA 1VQ4S 4B9VA 4NA3A 4KO0B 5DDOC 2WZ1A 1IR2A 3NO7A 3MEDA 1AZSA 4RW7B 1UMJA 4ZPDA 1VQ7S 3MM6B 1Q8BA 1S10A 1S1WB 3BDEA 2E7XA 1BLUA 4TY8A 1RWUA 2EFPA 1LXNA 5A76A 5LMUF 1U1RA 1X4FA 7FD1A 4Y2KA 4G6VB 1FJ7A 2VBXA 2AYGA 3TO8A 1NJIT 1KVKA 1RU1A 1RE1B 1GX5A 2DGTA 3M32A 1WWHA 2HFNA 4OFZA 4OHYA 2MLYA 2VG5A 2CXEA 3J80Y 1KSPA 2BBEA 4P73A 3R9LA 4CI0B 5F8MA 1KQSR 1U0HB 5DDQC 5H9FK 1UFKA 4I6AA 2FLLA 3B54A 1QD1A 5I3QA 2R7VA 4I4BA 1Y5NB 3GB0A 4L73A 1PO6A 3PIPQ 2V5HG 3L9ZA 3I5AA 2DPJA 4IR1A 3W63A 2QA4S 2VQFJ 5A0YA 2DB1A 2DXDA 3DDNA 3ET6A 4YDXA 3ZZTA 5GAHU 4OX7A 2DHXA 1NJZA 4LF4J 2MQ8A 3R5CA 2ZH1A 1F60B 3T5HA 2Z4PA 3AJ2A 1TL3B 2KELA 2ZC3A 1B99A 1TKZB 2AJ2A 2NCKL 3BYPA 3RRHA 2I2YA 1TTHB 4OI3A 2HNYB 5KFVA 2ZNZA 3H7HB 1M0SA 2XQCA 2VA2A 4BDPA 4UY8T 5JUMA 3JTOA 1QVFR 2BOPA 3ITHB 2B9YA 3MOZA 1RAJA 3DLJA 2K3KA 4CO3A 2BANA 1NNDA 3T41A 4QPTA 2CPYA 4OJ1A 2KYXA 2WW8A 3KK1A 3D2WA 3M7VA 4LF7F 3AA9A 1U1QA 2ZZNA 3MEGB 1IQTA 2GIRA 2MKIA 5BXIA 2RHSB 2CDQA 3N4WA 4QW9A 1NK7A 4JI3J 2W9CB 2WTFA 1U26A 1GMWA 4NLTA 4JI4J 2HVDA 2M0GB 1ZTWA 2QA1A 3GR0A 2QMUB 1FNXH 5HJXA 1JXVA 1Q78A 4I6WA 4JUZA 5MAOA 4WZQA 1LOUA 1GH8A 1R8PA 3IWLA 3L09A 3BR8A 3M8PB 2Z2MA 1WSVA 4WU3A 3I9V9 4GVLA 4X66J 1V3ZA 3B8HA 5EWGA 2XMVA 1ZH5A 4JP8A 5HSPA 1S72S 2AJ4A 4MTPA 4P6QA 1YJ7A 2HZAA 3FZ2A 1FRKA 2R8HA 4B3TF 4Y2MA 3QT8A 3OTCA 2HIYA 2R8GA 4M5HA 1N34J 1N32F 4F02A 2CQ3A 1JJCB 3GIJA 1SJFA 2DCLA 3B82A 1DLOB 2KXFA 3LQVA 1LKZA 4DSIA 4OQJA 2H5JB 4KC5A 2NSBA 1VQLS 5T14A 1QUVA 1HMVA 2CADA 2DGOA 5DDPC 4YP3A 1OSCA 1IBKF 1KEKA 4U7CA 2AIRB 2JC0A 2IBKA 4NCBA 1EKSA 2H1YA 3BSNA 3GFZA 2OEMA 2VPXB 2MJNA 3OR2A 3DKDA 2ZH5A 3M2VB 5A2QY 3CXCR 1LW0B 3P3DA 4DF8A 1TL5A 5C24B 4ZVUB 4ZVRB 1PYOB 2UXCF 4DV2F 2BNWA 5IM0B 2KRBA 3H59A 3QGPA 4IH6A 1SUQA 1RACB 5FD1A 2COLA 4OYIA 2W2QP 4KPCA 4PPDA 2YWWA 2DNKA 5F41A 2LCWA 1IKXB 2QSFA 4ZPBA 3N9UC 3SV3A 4ED3A 1B70B 1HBUB 1N48A 2CPDA 1NK8A 3U1LA 4C3MA 2RRNA 4LF2A 2JSXA 4WFBQ 2DEJA 3FFIA 3EXCX 3PYFA 3X1LB 5B0GA 4ZLPA 1CQNA 4RNFA 1R31A 1RT6B 2WBMA 3MPVA 3KLFB 1T03B 3MFHA 4D3GA 2FJEB 2FHJA 5KFHA
chains in the Genus database with same CATH topology
2BJ1A 2JXGA 1Q5VA 4ME7E 1ARRA 2K6LA 2HZVA 2PC6A 3QSIA 2K9IA 4D8JA 2GPEA 3QOQA 2H1OE 3LGHA 2HZAA 2BNWA 2CAXA 2F1FA 1BDTA 1MNTA 2WVDA 3H87C 1NLAA 3OD2A 2BNZA 2AY0A 1BDVA 2CPGA 3FMTA 2K29A 3BKTA 2WVCA 2CA9A 3VW4A 1ARQA 1P94A 2JXHA 3FT7A 1Q5YA 1B01A 3BKFA 2BA3A 4HV0A 2RBFA 3VEBA 2BJ8A 1PARA 1MYKA 2JXIA 3PHTA 3BKUA 1IRQA 1X93A 2CAJA 2WVFA 3VEAA 1EA4A 2BJ7A 1MYLA 2CADA 2FGCA 2BJ3A 2K5JA 1B28A 2WVEA 3GXQA 2BJ9A 2BSQE 1QTGA 2Y3YA 1BAZA 4FXEA 2K1OA 2WVBA 2NZCA 1U9PA 2KELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJ1 A;  2JXG A;  1Q5V A;  4ME7 E;  1ARR A;  2K6L A;  2HZV A;  2PC6 A;  3QSI A;  2K9I A;  4D8J A;  2GPE A;  3QOQ A;  2H1O E;  3LGH A;  2HZA A;  2BNW A;  2CAX A;  2F1F A;  1BDT A;  1MNT A;  2WVD A;  3H87 C;  1NLA A;  3OD2 A;  2BNZ A;  2AY0 A;  1BDV A;  2CPG A;  3FMT A;  2K29 A;  3BKT A;  2WVC A;  2CA9 A;  3VW4 A;  1ARQ A;  1P94 A;  2JXH A;  3FT7 A;  1Q5Y A;  1B01 A;  3BKF A;  2BA3 A;  4HV0 A;  2RBF A;  3VEB A;  2BJ8 A;  1PAR A;  1MYK A;  2JXI A;  3PHT A;  3BKU A;  1IRQ A;  1X93 A;  2CAJ A;  2WVF A;  3VEA A;  1EA4 A;  2BJ7 A;  1MYL A;  2CAD A;  2FGC A;  2BJ3 A;  2K5J A;  1B28 A;  2WVE A;  3GXQ A;  2BJ9 A;  2BSQ E;  1QTG A;  2Y3Y A;  1BAZ A;  4FXE A;  2K1O A;  2WVB A;  2NZC A;  1U9P A;  2KEL A; 
#chains in the Genus database with same CATH topology
 2IBO A;  1CSJ A;  3HUL A;  3K89 A;  4PQU A;  1DZ5 A;  2F8M A;  2JVR A;  2XS5 A;  2QJ3 A;  3LUY A;  4D8J A;  1SB6 A;  3E3X A;  2ACY A;  5KTQ A;  2MSS A;  3QT6 A;  2XWY A;  4PG8 A;  2YKN A;  2KXH A;  4OV6 A;  3UD5 A;  2LA6 A;  5DO2 A;  3CO9 A;  2K7K A;  1S49 A;  4N5S A;  4N41 A;  4ZJO A;  4C2M A;  1TFY A;  1N5S A;  2KB2 A;  4UF4 A;  3T19 A;  3UNY A;  3NBP B;  1OQ6 A;  3RW7 A;  3T6J A;  4ED8 A;  2AU0 A;  3AHP A;  1WTB A;  4FNH A;  1IBL J;  2FVP A;  1VLY A;  5C25 B;  2LEB A;  3CTR A;  1Q7L B;  2DGU A;  2MHN A;  1OPZ A;  4ZPA A;  4QBU A;  4ZVE A;  4PAA A;  4M95 A;  2EBE A;  5D4N A;  5HVF A;  3DRP B;  4IDK B;  4DEZ A;  3CD6 S;  3OBI A;  1S0N A;  2KU7 A;  4HL9 A;  1KFS A;  2NRE A;  4F4K A;  2UVV A;  2UXC J;  3O8W A;  1UA0 A;  3M1V B;  4A8W A;  5J2N A;  5KFS A;  1H6K X;  1YRT A;  3D6H B;  3ZC4 A;  1MSW D;  3PR5 B;  3CCZ A;  3I96 A;  4N8N A;  1Y5L B;  1EHW A;  2AJF E;  5I3P A;  3C3L A;  2JC1 A;  1U6Z A;  4RR5 A;  2JEF A;  1GXU A;  4USV A;  4ZHR A;  2IM0 A;  3EPI A;  4C8Z A;  4J9R A;  1CS4 B;  1NH7 A;  4DV6 F;  4KGK A;  1ZZN A;  4P2S A;  1C1C A;  2F63 A;  3DN9 A;  4RBU A;  1UWB B;  1BY9 A;  4RU2 A;  1RAA B;  2W4D A;  4I2Q B;  4KGV B;  4WPA A;  2QFJ A;  1WOO A;  3L7U A;  4I2P A;  1Q82 T;  1M5P C;  5F9L A;  3MTJ A;  4WF9 Q;  1JLF B;  5JXS A;  4JV1 A;  1RHJ B;  2WVE A;  1JLC A;  3SFG A;  4LSN B;  4MAK A;  2UUA J;  1BAZ A;  5KG6 A;  2MLZ A;  3OL6 A;  1JLA B;  4EBE A;  3W7B A;  2IM2 A;  2LXF A;  1YSJ A;  2VG7 B;  2G0I A;  3KJV B;  3D28 A;  3FVY A;  4E2F B;  3MEE A;  4AXI A;  4GRS A;  3W66 A;  4PAB A;  2QYG A;  3CE8 A;  2KRR A;  5CD4 A;  1EB0 A;  5KFN A;  2YNG A;  4LBP A;  3JQJ A;  3Q8Y A;  4LRC A;  2IDE A;  1VBY A;  1PKU A;  3PO4 A;  2JRS A;  3D0I E;  1R6Y A;  1NXI A;  2B6A A;  2D9P A;  2A2C A;  1XER A;  4LBI A;  4QOT A;  4DR2 F;  2KYZ A;  5B09 A;  4B3T J;  2BA3 A;  3LF0 A;  1KTQ A;  2W7A A;  1UEV A;  2HKE A;  3G6V A;  2L41 A;  1X93 A;  3Q0A A;  5DM6 Q;  4EUV A;  1N4L A;  2XO7 A;  1TQL A;  2VC0 A;  4OJH A;  5DG7 A;  1PIE A;  3K7R A;  2YNI B;  2C2Z B;  3M8Y A;  1CJU A;  4CLK A;  3HT3 A;  3NMR A;  3JQK A;  2Y1J A;  2ZH8 A;  3KHR A;  2DJW A;  3MM9 A;  1NB7 A;  2X51 A;  4JI6 F;  2J6U A;  3W9H A;  4A4J A;  4RO0 A;  2V4J B;  5M2P A;  1QSL A;  3EM1 A;  2HK3 A;  4AFF A;  1U02 A;  1ZZF A;  3ONQ A;  5B7W A;  5L38 A;  2DO4 A;  3TA1 A;  3OLB A;  3T1Y J;  2VZ9 A;  2Y0S D;  1KVJ A;  1T9W A;  4NX9 A;  3G4S S;  3D6M B;  1HYS A;  2RVJ A;  5DLF A;  4C9D A;  3SI8 A;  4ZLN A;  4NRU A;  1QE1 B;  2DNG A;  3GON A;  2OGU A;  1B7Y B;  1NDL A;  3DMJ B;  2I0X A;  1KLM B;  4H4K C;  4RX6 A;  4OI0 A;  2RQ4 A;  4IKA A;  3NRB A;  3RAQ A;  2MZT A;  4QIW D;  1TFW A;  3VZI A;  4RW6 B;  3R5B A;  3IXQ A;  3TWZ A;  2M2B A;  3T6B A;  2Y8W A;  1RTH A;  2J7U A;  4HI1 A;  1C1B B;  2W2O P;  3DRS A;  2XMA A;  1LV5 A;  2H5I B;  3CCW A;  4HI2 A;  3IN5 A;  2DPI A;  3I82 A;  2B6A B;  3SCI E;  2DR9 A;  5L8R C;  3CCE S;  5AJ3 F;  2BJ1 A;  1Z2Z A;  2QFI A;  1HIY A;  2ZOM A;  8AT1 B;  3SCK E;  3MR3 A;  4NYO A;  2YQ3 A;  4A8K A;  4ED2 A;  2JH3 A;  2VFU A;  2LEP A;  4OHZ A;  3M9O B;  3ENW A;  2YVS A;  3NWG A;  2PI4 A;  4IR9 A;  3KYL A;  3ZNJ 1;  3SQO P;  1OIA A;  3MAA A;  4C8O A;  4X4P A;  4IYQ A;  1JLA A;  2FJW A;  3W62 A;  3AXM A;  5CYQ B;  4LSN A;  1TL7 A;  2X3G A;  2BAB A;  3FNN A;  4JI7 F;  3N6N A;  4ZVQ B;  3KKF A;  1FDA A;  3PYE A;  4I2P B;  4CIO A;  1I3O B;  1T8E A;  2VV5 A;  4DV4 F;  2BJ3 A;  2K5J A;  2CJA A;  1B4S A;  3DU6 A;  4I2Q A;  4DV7 J;  1DRZ A;  5BR8 F;  2DXE A;  3BPD A;  1TKT B;  1JB0 C;  1TP7 A;  2IRU A;  1XMQ F;  1C1C B;  5HBM A;  2LA4 A;  3OTE A;  3KLI A;  2YTC A;  2IVF B;  1DQ8 A;  4IG3 A;  1PBA A;  4PXE A;  4W92 B;  5KG4 A;  3OSN A;  1UZD A;  4KH0 B;  3W2W A;  1N36 F;  2XS7 A;  3K8V A;  4HDH A;  3UFC X;  4J9S A;  3ZNU A;  1JMT A;  5L1J A;  2L3M A;  2OPS B;  1IKW B;  2C3P A;  4DPO A;  1MWQ A;  1GX6 A;  2HGL A;  1RIS A;  1AXQ A;  1OY6 A;  2RSQ A;  2VOP A;  2I5J A;  1BHN A;  3KDN A;  3Q86 A;  1GTE A;  2PMZ D;  2OTJ S;  3I4P A;  5HRO B;  1WC6 A;  3IG1 A;  2NR0 A;  2OPP B;  1QAX A;  3K5P A;  2KG1 A;  2E1C A;  1PYS B;  4J90 A;  1YRU A;  3AOD A;  1X60 A;  2G0J A;  4UST A;  3GIR A;  5HQ8 A;  4ILM A;  2BKN A;  1C0U A;  1RTJ B;  4LRE A;  4BCA A;  4TY9 A;  2BRK A;  2K1O A;  2BKP A;  2GO9 A;  3KUG A;  4RBV A;  1FXR A;  2CUY A;  2ZC4 A;  1S6Q A;  9ATC B;  4G1I A;  4B9T A;  1A9N B;  2DK2 A;  5GAG U;  2F65 A;  1Q16 A;  2KFY A;  1RWP B;  2QLX A;  5KOX A;  2QLF B;  2ZKU A;  3PJ9 A;  5KFI A;  1B0P A;  4YY3 F;  3CUL A;  2PDA A;  1H7X A;  2OMO A;  1KOO A;  2V94 A;  4ZIW A;  4K4U A;  1E6Y B;  2DH7 A;  1H2T Z;  2HVZ A;  2LLZ A;  4LF6 F;  2YX4 A;  1GT8 A;  3KG4 A;  3O2I A;  1ELO A;  4NYP A;  4Y2C A;  4CO2 A;  4ZCI A;  1U4B A;  3PY8 A;  4UW2 A;  3NNC A;  3DU5 A;  3KLF A;  1IBK J;  4KJI A;  2DRD A;  3UCU P;  2QA2 A;  3D0H E;  3MXH P;  2WK4 A;  1YG0 A;  3HKW A;  3CJK B;  5I42 B;  3AD7 C;  4DPY A;  2CPZ A;  3AQP A;  4F50 A;  2W4P A;  2KJW A;  1Q7Y T;  3GCW P;  1DY3 A;  3UDV A;  1FRH A;  2DNM A;  3PHE A;  3VQS A;  2E7W A;  4TVA B;  4QIV A;  2K1R B;  3HVA A;  5LMN F;  2OIH A;  4JI2 J;  1S79 A;  3ILJ A;  1IBC B;  4JI0 J;  1T94 A;  5CYM A;  4OI2 A;  3NLC A;  1R27 B;  1KVI A;  1U7L A;  5I3U B;  3UNG C;  1SUQ B;  4FVM A;  2DR7 A;  4LVN P;  4J9O A;  4J9V A;  3QJL A;  2RIL A;  2BA9 A;  1PCA A;  1XBW A;  4OI4 A;  2HHS A;  3MR2 A;  2IPO B;  1KQG B;  1V3S A;  2RB7 A;  1SQF A;  1OJ4 A;  3M2V A;  2BQR A;  1NHK L;  1RHK B;  3BYR A;  5E3R A;  4DR4 J;  4M5G A;  3TVZ A;  1SKS A;  2KZM A;  3M6X A;  5BJR A;  4UOF A;  5DQG A;  1NJW A;  1VBK A;  1IVZ A;  2B7B B;  5CXT A;  2QL7 B;  4DSE A;  2WB4 A;  1HMV B;  5DZ7 A;  1J27 A;  2KKH A;  2P8I A;  3FK4 A;  4F4A A;  3EX7 B;  1QDU B;  1UVL A;  5B0F A;  5KT6 A;  4ETZ A;  4TN2 A;  1KTV A;  5B0C A;  3QRR A;  2AQ4 A;  7FDR A;  2Q79 A;  4ZCL A;  1KD1 T;  1I94 J;  1LWX A;  2HNZ B;  1DAX A;  3MMB B;  4C0O C;  4J9L A;  2ROE A;  4LBH A;  2CG8 A;  2JNJ A;  3PZP A;  1JLG B;  5I3U A;  2UUC F;  2HBQ B;  3C6U B;  2MDA A;  4IO9 Q;  5IC4 B;  3CMA S;  1U45 A;  3BV8 A;  1RAI B;  2MTL A;  1ZTT A;  2BQ3 A;  4B02 A;  2XMT A;  1VRT B;  4KRW A;  2XCA A;  1NUE A;  2F3J A;  4C8Y A;  1WAC A;  1NBE B;  1TK0 A;  3I0S A;  4CLZ A;  4GO7 X;  4RW4 B;  4U7U K;  1S7I A;  3W5Z A;  1S0O A;  3F56 A;  2E5L F;  4JV5 F;  3W8P A;  3BKU A;  5L9X A;  4URS A;  3K2Y A;  2P5V A;  2V2Q A;  2OUG A;  5AJ3 J;  2VA3 A;  2DNL A;  2W9C A;  4M5L A;  2YQ1 A;  1FDB A;  3A12 A;  2ZBI A;  3EZO A;  4MK9 A;  5DS7 A;  1IWA A;  1PBU A;  3NGK A;  4IUF A;  1Q16 B;  1UEU A;  1NH8 A;  2NUH A;  3H90 A;  3KXD A;  1X9M A;  4NI2 B;  4QPX A;  2LQB A;  2R7X A;  2CQC A;  2QX0 A;  2VKR A;  4RNN A;  1RTJ A;  4WP8 A;  4X4Q A;  9RUB A;  5IT4 A;  3HM9 A;  1IXK A;  3L7P A;  1HW9 A;  2HNY A;  2CJY B;  1YHQ S;  3R6L B;  2UVW A;  3RR7 A;  1YBA A;  1TKZ A;  5LSR A;  4RWX A;  5IWA J;  1TL3 A;  2B51 A;  2QO3 A;  3CD5 A;  5HRO A;  4HR2 A;  3BH6 B;  4F26 A;  3M05 A;  2POK A;  5D4L A;  3IBC B;  5A0Y B;  1TZ0 A;  2MKS A;  3T5K A;  1SKW A;  1BQX A;  4DR6 J;  2RHQ B;  4I6Y A;  3CW2 C;  4DR3 J;  4IRC A;  2E44 A;  2F5G A;  4DOZ A;  3TZY A;  3V81 A;  2C2R A;  2FVR A;  3W2W B;  1RQ0 A;  3QBC A;  1BC6 A;  4ELT A;  4A8O A;  2J0W A;  2W8L A;  2UV8 A;  4A8X A;  3TA0 A;  3H4D A;  1KP6 A;  3DLK B;  4I0W A;  4MIB A;  3IC1 A;  4OHV A;  5CZX A;  2RAQ A;  2XNR A;  3SBM A;  1VQ9 S;  2R8K A;  4C0B A;  3P4U B;  1XN9 A;  2GQQ A;  5LMU J;  1ULR A;  3OFG A;  4A47 A;  2GZO A;  1W7W A;  3GPA A;  2O67 A;  2OSR A;  2W24 A;  1S1W A;  4LJM A;  4RNM A;  4ECU A;  3MOJ B;  1TL7 B;  4OX9 F;  3MM6 A;  1RWX B;  5CYQ A;  2YKO A;  4MIW A;  4RW7 A;  5E3P A;  5G4D A;  1UW9 A;  1WF1 A;  1QVG R;  4Q2M A;  4BBY A;  2CAJ A;  2FVC A;  2XI3 A;  3G82 B;  3CJ0 A;  4CTA A;  2VOD A;  3QGG A;  3M2U B;  3OV7 A;  3ZZP A;  3DOM A;  4HDG A;  4DV0 J;  3D1O A;  1OHN A;  3W61 A;  3A8J A;  3GYN A;  4WXO A;  3GV5 B;  1KHW A;  5HLF B;  1FNO A;  3Q83 A;  1YGY A;  4L6V 3;  3UR0 A;  1WSR A;  1VQ5 S;  1KDN A;  2C2K B;  3GYX B;  3D66 A;  5HQM A;  3GE9 A;  2FLN A;  4F2S A;  1CVJ A;  4R5P B;  4PQA A;  1KQK A;  1EET A;  1NM2 A;  1WKL A;  4MKB A;  2ZJP Q;  1RT3 B;  4DPT A;  1C1B A;  2HQD A;  3DRS B;  5D3G B;  3NXZ A;  5JJB A;  2HND B;  2RU9 A;  2P6S A;  1GEH A;  4TYA A;  1K1Q A;  2GV1 A;  2YXL A;  3N01 A;  5FII A;  5HMW A;  4CH1 A;  3DRX A;  2KG0 A;  4LMZ A;  3DDI A;  4DS5 A;  1HLW A;  2Z2L A;  2JEJ A;  2FIU A;  1NSP A;  2HQF A;  3DMJ A;  1P9Q C;  3AD9 C;  4O3S A;  3DOK B;  1QE1 A;  1U2C A;  3CCS S;  2HHQ A;  4GMK A;  4F25 A;  1NJX A;  4ZP6 A;  2RS2 A;  1NK6 A;  1RDR A;  3THV A;  2R2U A;  3ETO A;  2ZHB A;  3PX4 A;  2OML A;  1NPR A;  1V6H A;  2MEW A;  2XSF A;  3WBZ A;  4ZLJ A;  3CCJ S;  2BJD A;  2BVZ A;  4ECZ A;  1B0V A;  2HAF A;  1DTT A;  3P8B B;  2OSQ A;  4NA1 A;  2V4J A;  2E29 A;  3ISN D;  3BSA A;  5B0A A;  3VHQ A;  5GMK a;  1RP5 A;  4D3H A;  4FF1 A;  3Q2T C;  1F9H A;  3MM9 B;  3GG1 A;  2V4Q A;  4JI5 J;  4IQM A;  2F8E X;  3FUY A;  4O0I A;  3LP2 A;  1NZA A;  2ZUG A;  3CD7 A;  2B4V A;  1FEH A;  3HD1 A;  4DZD A;  5HQL A;  5L39 A;  4KPY A;  1RT7 A;  3JAM Y;  7AT1 B;  1LNQ A;  2CWX A;  3D1H A;  3PKY A;  2M8H A;  1DBD A;  3CB4 A;  3LP1 A;  5KG0 A;  5J1E A;  3BQ0 A;  1D09 B;  4O4R A;  5MLC V;  4DQS A;  2WW4 A;  1I51 B;  3MD3 A;  3L3C A;  2BJ7 A;  2X1F A;  4ZVP B;  1P1T A;  1S9G A;  4QJV A;  1BUX A;  2CPF A;  4XDD A;  1R43 A;  3FGV A;  4KT0 C;  3T1A A;  4MKY A;  1FX4 A;  4IFV A;  4DV0 F;  4ECX A;  1L3V A;  3NGU A;  2JJ4 D;  1YRX A;  2Q66 A;  1MN9 A;  2FYX A;  4ZMM A;  1VBZ A;  3DFE A;  4F8R A;  1WNE A;  4ES2 A;  4YQW A;  4ICL B;  5I4M A;  1O6X A;  3HSG A;  2BV3 A;  1SJ1 A;  4URQ U;  2NLW A;  2LQ9 A;  4WP3 A;  3Q8R B;  1JJ4 A;  2E1M C;  1RWV B;  3MM8 B;  2VJV A;  5KFP A;  3RJM B;  2AY0 A;  4NLV A;  2DT9 A;  3VWS A;  1SIW B;  3TW0 A;  2FQQ B;  2DGX A;  4OYZ A;  3KLH A;  1UWB A;  3EPG A;  1I94 F;  1JXE A;  2EKN A;  3PW2 A;  2KM8 C;  5HMX A;  5F0W A;  5EN1 A;  1CS4 A;  3MMA B;  2HK2 A;  1PAR A;  2NXJ A;  2P6T A;  2CQI A;  4P7V A;  2D1C A;  4X65 J;  2DNN A;  4NZ7 A;  1RBL A;  1H73 A;  3S7R A;  4RUA A;  3KHG A;  3ZTQ A;  2AMC B;  3KHL A;  5F8G A;  2FZC B;  3MCO A;  4B9M A;  3RB4 A;  4PRF A;  3IS9 A;  3PRV A;  2DNO A;  2CZ9 A;  2DCU B;  2K3I A;  4M5K A;  4N7T A;  1SQG A;  2C42 A;  2ASY A;  2BW2 A;  4DR6 F;  3V4M A;  2L48 A;  5J2N B;  3S8S A;  1JNR B;  3M1V A;  3EIC A;  1SIZ A;  3HJV A;  4RPF A;  2VAS A;  4WU2 A;  3T9N A;  4DV3 F;  1B3T A;  3A3N B;  4IDK A;  1K0V A;  3AOA A;  1JLB A;  3ENQ A;  4V19 J;  3TVK A;  2XBP A;  5L9N A;  1FJE B;  2ACM A;  4LF6 J;  5C25 A;  4FXW A;  4M5I A;  5K14 B;  4L72 B;  1ARQ A;  4Y3C A;  3MUR P;  3WDO A;  3QLH B;  1VC0 A;  3R8Y A;  1KQF B;  4I67 A;  4X66 F;  2ZZM A;  4PR6 A;  1S77 D;  5ETO A;  3QJP A;  1T05 B;  2JBV A;  1ARO P;  2YKN B;  3R27 A;  3OJU A;  2HHT A;  1KN6 A;  4DCO B;  2DIS A;  1VCT A;  2JLE A;  1WD6 A;  3GTY X;  3HZE A;  3FSY A;  4JI2 F;  3HSJ A;  1HBO A;  3VAH A;  3IR5 B;  2OEK A;  1Q8I A;  3D4J A;  1CEZ A;  3NEK A;  4DL6 A;  1IKY B;  2OPQ A;  4OZN A;  3R5G A;  1N0U A;  1UCN A;  3T1Y F;  2YH1 A;  2HHX A;  4ITS A;  1S12 A;  5HVH A;  1D8Z A;  1OYD A;  2DO0 A;  1VIS A;  3HP6 A;  2H9Z A;  1SH3 A;  3O1L A;  1HQU B;  2YNF B;  1S76 D;  3C6T B;  5HJY A;  1WC5 A;  2QTW A;  2IA0 A;  1L3S A;  3W60 A;  2XS2 A;  4WYW A;  1HBU A;  1HNV B;  2VB6 A;  1P94 A;  1GQE A;  4NLY A;  1TUW A;  4BC9 A;  4B3M F;  2R2S A;  2C3O A;  1XNQ F;  3BQ1 A;  4HKQ A;  2VDH A;  2ROG A;  4HEA 9;  4PZV A;  2Z2Z A;  1MMD A;  2K06 A;  2D69 A;  2F7V A;  3PDN A;  3NNA A;  5A8W B;  3DOL B;  3V5R A;  5HL7 Q;  4YR2 A;  3P6Y C;  5C24 A;  2KFZ A;  1RT1 A;  2E1A A;  3GFY A;  4FP9 A;  3R3T A;  2G13 A;  2YQ0 A;  2C3M A;  2R42 A;  4N8O A;  1L3T A;  1RT2 A;  3OR2 B;  2XMK A;  4YFU A;  4EFA C;  3QOQ A;  2D74 B;  4B9U A;  1FK9 B;  3W9I A;  1X8D A;  2XY6 A;  1OY9 A;  1L3K A;  1UJ6 A;  2G2Z A;  2YWE A;  4JV0 A;  2FZG B;  5T7L A;  5LSO A;  1TV6 A;  1VIO A;  3PO5 A;  2CNL B;  4DFM A;  2ALY B;  4RNH A;  1DLO A;  4UOC A;  5GAE I;  4X4S A;  2XLI A;  1WOS A;  1XK8 A;  1ZA1 B;  3BKF A;  4P71 A;  3G8Q A;  4DX8 H;  1HKA A;  2XO6 A;  2J6T A;  2EFG A;  1U1K A;  5A8R A;  3TJ8 A;  1KWM A;  1X7V A;  2BE2 B;  2VH7 A;  3SQG B;  4DF4 A;  3BZQ A;  1BXN A;  3M8W A;  2PII A;  4K59 A;  1SCJ B;  4K5R A;  4QIE A;  3QGH A;  4M5M A;  1WEY A;  3SIP B;  2OFH X;  3ISN C;  2J9E A;  4ZPW R;  3SSQ A;  1WEX A;  1Y5I B;  2BE2 A;  2O01 C;  1IJF B;  3GZ7 A;  3I4H X;  4Y2I A;  2DRB A;  3IBW A;  4JYA F;  2W25 A;  2WAQ D;  2X3D A;  1MLA A;  1NRK A;  3QZ8 A;  3DI6 B;  2R7Q A;  4JI1 F;  3L4B C;  1TV6 B;  3Q8P B;  2ZUA A;  1UAW A;  3TVY A;  1X5S A;  3MPD A;  4O3O A;  3ZZO A;  3QYY A;  5ETP A;  4CO1 A;  2DNQ A;  3G6X A;  3QID A;  1A7G E;  2M52 A;  3S01 A;  2EC0 A;  1RT2 B;  2A2D A;  3TAQ A;  2HFV A;  3HPO A;  3MFI A;  3FT7 A;  3FRY A;  3LA0 A;  1RT1 B;  5FLX U;  1M1G A;  4P2M A;  5J2M A;  3KK1 B;  3N28 A;  4NL5 A;  2V9K A;  5A8W A;  4DFK A;  3U1N A;  4DU8 A;  3QFW A;  4L3K A;  3OL8 A;  3KJQ B;  4HHH A;  1XEZ A;  3ITH A;  3AB4 B;  1T9X A;  4CLY A;  3RBE A;  3J7Z 5;  1HNI A;  4F04 B;  4ECY A;  2EBG A;  2WVB A;  4KYZ A;  3NCP A;  3TUJ C;  1HNV A;  3MPW A;  2ZH3 A;  3FEZ A;  2V8H A;  3BR9 A;  4WXW A;  5SUH A;  3J7Y I;  3LAL A;  3C6T A;  4QYZ J;  3ET6 B;  1UTA A;  4KV8 A;  1TKD A;  4FYX B;  4ZN1 A;  1HL6 A;  3K0J A;  4ECQ A;  2K29 A;  3GFH A;  4OI1 A;  2B7C B;  1IKY A;  2OPQ B;  2C2N A;  3DLG A;  3ZO7 A;  4PG4 A;  4CNY A;  3LO3 A;  1HBO B;  1M1K T;  3CGI A;  1RZM A;  4K4X A;  4K0K F;  2Z57 B;  3MDF A;  2JXI A;  4RW8 A;  1CJT A;  1U0H A;  3DGP A;  1ZOT A;  3NS7 B;  1O5J A;  2V50 A;  2AWZ A;  3M4X A;  4TLR A;  4WFY A;  1VS3 A;  1IJE B;  2GHW A;  2HWH A;  4USK A;  1F9E B;  2GJI A;  4UQT A;  2HVH A;  2BM1 A;  2GC8 A;  4LUB A;  4A8F A;  3QLH A;  2HHU A;  4OZJ A;  4DPU A;  2RRB A;  4F4Z A;  4KHP J;  1HNW F;  1D3W A;  3UDL A;  4TY8 B;  1SH0 A;  3AXK A;  1JXL A;  1CJK B;  5IS2 A;  1BD6 A;  2HAI A;  3AH6 A;  2YKP A;  3A3O B;  3EGN A;  2FJA B;  3MED B;  4DUT A;  3DRR B;  5ITH A;  2MGZ B;  1HR0 F;  1FFG B;  3ZZR A;  8RUC A;  4X62 J;  1EQM A;  3A3P B;  4HH1 A;  2NPF A;  2K7J A;  1W25 A;  4FYW B;  5EDW A;  2E9R X;  1GK8 A;  1RHR B;  2UUA F;  1EIY B;  3D6T B;  1F3V A;  3HHK A;  1LWE B;  2M70 A;  3TEG A;  4LFA J;  2XMJ A;  1KFD A;  2GMJ A;  1FKP B;  2PO4 A;  3CCL S;  4FYV B;  3M30 A;  1N36 J;  1P6T A;  2HW3 A;  2N4C A;  1U1N A;  2ZEJ A;  3U1M A;  2IY5 B;  1A0O B;  5B0E A;  1FRI A;  1Y3K A;  4P2F A;  4R0E A;  1SC1 B;  2C2M B;  1RAF B;  4IG0 B;  4P52 A;  2R7O A;  1FXD A;  2A6O A;  2DGV A;  2V63 A;  3BO3 A;  2YPY A;  5KFZ A;  2Q6B A;  4B08 A;  3ZFV A;  4ECV A;  1NKC A;  2XHC A;  2FC9 A;  4OYW A;  4X4T A;  3BBB A;  1IUJ A;  4NLD A;  3LWM A;  1JNZ B;  1X9W A;  4DV4 J;  3KLH B;  4PG5 A;  4OLO A;  4XO0 A;  2E5L J;  1VYA A;  2J8A A;  1K0T A;  3Q2S C;  4TNO A;  3EDR B;  2JEI A;  1QUP A;  2QN6 B;  3H98 A;  2X1B A;  1ZPV A;  3UQS A;  1UVN A;  2RDD A;  3T1H F;  1D1U A;  3BKT A;  2QGF B;  3KK3 A;  4DR7 F;  5IT9 Y;  1PIL A;  2CQ0 A;  1TUG B;  1FRL A;  2HZC A;  4IFV B;  5IFM A;  4Y65 A;  2RDJ A;  4DV2 J;  1REV B;  1YJN S;  2AJ1 A;  3Q8S B;  1Q0N A;  3BGF A;  2ZE2 B;  3FRZ A;  3PX6 A;  2DRA A;  1FWL A;  2ZZT A;  4NXN J;  1KNZ A;  1W2B R;  4B9L A;  4Q0B A;  1AFJ A;  2LP4 A;  2LVW A;  3KJF B;  4JI6 J;  1CC7 A;  2CQB A;  2Y3Y A;  1ACM B;  5JVG Q;  1YIT S;  3HHD A;  4Z7Y A;  3G5O A;  3OVB A;  1RT7 B;  1JJH A;  4MMO A;  4RU9 A;  2CRL A;  2AW0 A;  1VQP S;  3SV4 A;  3C46 A;  4YOE A;  4I69 A;  3WHI A;  2ZH7 A;  1HPZ B;  3QO9 B;  5CZV A;  1YDL A;  4QW8 A;  2FLO A;  2ZWP A;  2BX6 A;  2EG1 A;  4DI6 A;  2GFF A;  2RU3 A;  3EGV A;  4Q5V A;  2PFF B;  2NUU G;  1ZA2 B;  1HBM A;  4QIG A;  3TYT A;  3C19 A;  4EWT A;  3OR1 A;  2RT3 A;  8ATC B;  3UVJ B;  4DL3 A;  1J5O B;  1SBR A;  2UU9 F;  1WC1 A;  3OUY A;  1QSY A;  3H5X A;  1SQE A;  4L74 A;  2B4U A;  3OTO F;  2RH3 A;  3SDE B;  1T02 A;  2KTQ A;  5J2P B;  3ILL A;  4JOU A;  3OL9 A;  3JYT B;  1BQN B;  4J9Q A;  3PFO A;  3OHA A;  4USM A;  1F1B B;  3NG8 A;  1NDK A;  4P75 A;  3SSR A;  4DCP B;  2R7S A;  2AJQ A;  4DQQ A;  4X4N A;  4ZCM A;  2N82 B;  1IM4 A;  3KFW X;  4N76 A;  1HHQ A;  4W4M A;  3GII A;  4CYU A;  5D3G A;  4OX8 A;  3GQC A;  2DGW A;  2EC2 A;  1OS5 A;  2M4M A;  1S1V B;  2W8K A;  3HJF A;  2RQK A;  1HQE B;  3NL0 A;  3V6D A;  5CAB A;  2JEG A;  1QM9 A;  4GKJ F;  3LJP A;  4R8U A;  1U1L A;  2IVY A;  2F4F A;  3IR7 B;  2RBF A;  3MR5 A;  4LFB F;  3G87 A;  4M63 A;  2VFR A;  3AAW B;  5EHH A;  1VQS A;  5KOW A;  1NU4 A;  2CPI A;  3KK2 A;  3QPI A;  3G9C A;  1U25 A;  2NXE A;  2RIJ A;  2MKJ A;  4M5D A;  1HNZ J;  4CTA B;  3R1H A;  2XG8 A;  2XZD B;  4HVZ A;  3KHH A;  1RJJ A;  1AT1 B;  4EK2 A;  1MG7 A;  4GVB B;  5GMD A;  2IDL A;  3CCQ S;  2CNK B;  1RWM B;  4PWW A;  4O3Q A;  1RWO B;  1Q53 A;  3MR7 A;  2ZD1 A;  3QT5 A;  2IAJ B;  1F5A A;  5E41 A;  5H1S V;  4X64 J;  2UVU A;  4K5S A;  2R8J A;  3H8Y A;  3MAQ A;  2ROP A;  1NK5 A;  2HHV A;  1IBL F;  2MQM A;  1LWF B;  2I9S A;  2LXU A;  1R8B A;  2EWH A;  3I0R B;  5ETR A;  5DJB A;  2JDJ A;  5KFB A;  3DLK A;  1X4E A;  2E66 A;  3VGT A;  2N7C A;  5DM7 Q;  2UUW A;  4PYD A;  2HWI A;  4P2X A;  3OL7 A;  1HI1 A;  2J6S A;  5FDL A;  3V4I B;  3VEA A;  1VIX A;  3D7S B;  4NWB A;  4OZL A;  3V81 B;  3PIO Q;  3H5U A;  1SC3 B;  1T3O A;  4GC6 A;  1N5Y B;  1VQ8 S;  3KTQ A;  4KY3 A;  5H9E J;  4IOC Q;  2RD5 C;  1H98 A;  5HK4 A;  4DS4 A;  4LF7 J;  3R1L A;  4MKA A;  4CZC A;  4HAC A;  1KRP A;  1GMV A;  2VPW B;  2BR0 A;  4DUZ J;  4F67 A;  1T95 A;  3E8O A;  3HHL B;  3KG0 A;  2FPH X;  3BGU A;  1SC6 A;  3VF0 B;  4DR1 F;  1RTD B;  4E0D A;  4DV1 F;  2VHG A;  3WX8 A;  3HHL C;  3GMG A;  4ID5 B;  4WFA Q;  1S5Z A;  4ZVS B;  3G96 A;  2R7U A;  4K4W A;  1SPB P;  3H0P A;  2ZFH A;  1I5O B;  3RTV A;  1LXJ A;  4LRA A;  1FWP A;  4OHX A;  4ES3 A;  1J5E F;  4MT1 A;  2FHK A;  2QRR A;  2F40 A;  3OQ2 A;  4I1T A;  3SEO A;  2AGQ A;  4IFY B;  4CO4 A;  5LM7 E;  4U8Y A;  5AXN A;  4I7F B;  4NA2 A;  4X84 A;  5E3Q A;  3QWP A;  4MFB B;  4BWM A;  3KLE A;  2QEX S;  3J80 U;  2H51 B;  2MZJ A;  5LL6 d;  4AND A;  2BQU A;  2W2P P;  3NWR A;  1G7C B;  2EFV A;  1HD0 A;  2Q2K A;  1SV5 A;  2HRY A;  3I87 A;  4NLG A;  4DX6 A;  4RW4 A;  1VQK S;  1UP1 A;  2KDO A;  3QSI A;  3TUZ C;  1WI8 A;  2W7P A;  5HI7 A;  1IM6 A;  5HAT A;  3K17 A;  4ZCK A;  2C2E A;  4IOA Q;  2AF6 A;  3TNV A;  2OAU A;  3KUE A;  2LEC A;  3LGH A;  3HT0 A;  1G2E A;  3TX8 A;  4QWE A;  4ZVT B;  2M5Y A;  4J9U E;  4K8R A;  3ZTP A;  4LF5 J;  3CT9 A;  4JI8 F;  3ZZY A;  1Y7P A;  2DIU A;  4UY8 5;  3OFF A;  2CPG A;  1NKB A;  2B8Q A;  4OI6 A;  4PWD B;  3CDA A;  1JLG A;  1FJC A;  3MMB A;  2EG2 A;  3JSY A;  3OFE A;  1NCL A;  3I5B A;  2XYP B;  3EJM A;  4MYU A;  2B0G A;  5IQ6 A;  4B3R J;  1FKO B;  1YBT A;  2BUN A;  3BH7 B;  3F73 A;  2V9W A;  3DHW C;  2IJR A;  2NXC A;  2ZOF A;  3TRG A;  2AP6 A;  2RS8 A;  3M8R A;  1DFD A;  2DR5 A;  4CT8 A;  1HWJ A;  2ILZ A;  1PG5 B;  3M8Q A;  4DG1 A;  2C3Y A;  1U49 A;  2J7W A;  2HFS A;  3QFH A;  1QJH A;  4TYB A;  4QQB A;  2H48 B;  5KFD A;  1ZAV A;  4ZPV R;  1VBX A;  3LPE A;  2M7S A;  2U1A A;  4IRD A;  2XYG B;  4B3M J;  5DGB A;  2V67 A;  2XB2 D;  3OVA A;  3G8S A;  3Q22 A;  1FKO A;  1GTH A;  1MNT A;  2AX0 A;  3I9Z A;  4QWB A;  2M9K A;  3IMQ J;  1RTI A;  2EW9 A;  4ZN3 A;  3BJY A;  3IA0 A;  1S99 A;  2B9W A;  1JLE B;  3JSB A;  4NLR A;  4YR3 A;  2JXH A;  1N6Q A;  3W2V A;  4AXJ A;  3BSC A;  2BJ8 A;  1WOR A;  3TUP A;  2O66 A;  2V8P A;  1HWI A;  3UCG A;  2AEF A;  3BM7 A;  3FBE A;  3CJK A;  1YZ7 A;  2DEI A;  2V6A A;  5I42 A;  4QU7 A;  2G9O A;  1DAR A;  1WEZ A;  4DSJ A;  1RHM B;  3CJR A;  2HFO A;  3AOB A;  3HXM A;  4W90 B;  4OIX A;  2MJU A;  3LP0 A;  4NLP A;  3FCW A;  1X4C A;  3DGV A;  1RCX B;  1P1L A;  3H5S A;  3RAM A;  3VAF A;  2KT3 A;  2YWH A;  1X31 C;  4K2X A;  4NE9 C;  3J81 U;  4DLG A;  4Y6I A;  3UE2 A;  3TZZ A;  5IWA F;  3OD2 A;  2NXN A;  2QG9 B;  4DPX A;  5KFC A;  4QR1 A;  2OD4 A;  3NGT A;  4ZVH A;  3CJ8 A;  4CM0 A;  4QWD A;  4GKK J;  2XLK A;  3Q8V A;  2GW8 A;  3OVS A;  1HNZ F;  2CKW A;  3KNA A;  4MH8 A;  3UW1 A;  2UP1 A;  3VR1 A;  1I6J A;  3S1T A;  1UJ5 A;  3EZ5 A;  1R6V A;  1S48 A;  2MLX A;  2CPJ A;  3VAG A;  4ID5 A;  4PG7 A;  3V2U C;  2ZJQ Q;  4ANC A;  3W3S A;  1FWK A;  4OZ1 A;  2OPP A;  4F3Q A;  2ZH6 A;  1FDD A;  3HHL A;  3P96 A;  1PAE X;  2QYC A;  2HVI A;  1UPM B;  2I5J B;  2XWX A;  1B7F A;  5AE1 A;  2U2F A;  5H9E K;  1FFS B;  1U24 A;  2OPS A;  3NS5 A;  2HS4 A;  3O3L A;  1C0T B;  1GNK A;  2DR6 A;  5KG1 A;  3RG6 A;  1S1X A;  1UW4 A;  2EFO A;  2RUG A;  2WHO A;  3VQT A;  2P9G A;  1QY7 A;  4L75 A;  3SXL A;  3KLI B;  1S57 A;  2OI2 A;  4HV0 A;  5HBM B;  3I55 S;  2H54 B;  2LMI A;  2UXD F;  1V5V A;  3VVT A;  4JI1 J;  1TKT A;  1LW2 B;  3D3C J;  4JI0 F;  1LWF A;  2KL8 A;  5KT7 A;  1R0A B;  1RCO B;  1EP4 B;  4KFB B;  4EGL A;  4KKO B;  1JK9 B;  4FPR A;  5LXY A;  1X4H A;  2ZD1 B;  4WYL A;  3IRX A;  3TX0 A;  1NSK L;  2MKY A;  1H74 A;  3FQK A;  2J76 E;  3DXB A;  3A4T A;  4Y00 A;  2PEB A;  3SFU A;  4IH5 A;  1NJY A;  2FVS A;  2FY1 A;  4OV1 A;  1K1S A;  4JV5 J;  3MAA B;  1F9F A;  2CQ4 A;  4M5D B;  2B4O A;  1U09 A;  5A8K B;  2UXB J;  2RUS A;  1BDT A;  1BE4 A;  1RT4 A;  1YJU A;  2CG4 A;  2CYY A;  2NSC A;  2YNH A;  3IAM 9;  2IM1 A;  1R7I A;  4CLT A;  4NCG A;  2MY7 A;  4ZJQ A;  1L3U A;  2W9A A;  3OTD A;  2CPX A;  3BF4 A;  2WVC A;  3VAI A;  4W98 A;  2E1R A;  3HFV A;  3IFE A;  1AFI A;  2KN4 A;  1I1G A;  2QA4 G;  2MKH A;  3V6D B;  1HR0 J;  4IQX A;  4DMZ A;  4K50 A;  4PEO A;  5B0B A;  2A1B A;  5EX3 A;  4TU8 A;  3D6F B;  4DR5 F;  3QRQ A;  3TJA A;  1W2I A;  1RTH B;  2UZA A;  2GO8 A;  1B28 A;  4RW6 A;  3VAK A;  4J9P A;  1H3D A;  4URG A;  1LK7 A;  4DQR A;  1N8R T;  3GXQ A;  3G2X A;  2VJU A;  2HLU A;  2HQC A;  1IQZ A;  2UVR A;  1S97 A;  2V2K A;  5F8N A;  5CYJ A;  4KTQ A;  3ZTR A;  3D3B J;  1R3N A;  1H38 A;  3POT B;  3JTP A;  4HTI A;  4J5O A;  6AT1 B;  2F8H A;  2RKI B;  4PPZ A;  4AQY J;  4DHV A;  4DR5 J;  4ZK7 M;  1VQO S;  3A13 A;  1HYS B;  3OUY B;  2EEY A;  3R7N B;  1PJ5 A;  4S0M A;  4DWI A;  3R2D J;  2GVZ A;  2W2N P;  2GMH A;  2DH8 A;  5L46 A;  1J5O A;  3Q8Q B;  3IAS 9;  3ZTS A;  4C48 A;  1RXO B;  5ETT A;  4DQI A;  4MJW A;  2RE1 A;  1S0V A;  3H2U B;  2XGP A;  2VQF F;  2VG6 A;  3CC4 S;  1G1X A;  1XQI A;  3E01 A;  1XTZ A;  4MK8 A;  1JLQ B;  4YB5 A;  4ELV A;  3JSM B;  1KKH A;  1X5O A;  3VTI A;  4AQY F;  2VQE F;  1RKJ A;  3QO9 A;  1M5O C;  2E9T A;  4LR9 A;  2NYH A;  2MQL A;  4WIQ A;  1CJU B;  3HFZ B;  4Z37 A;  1HNX F;  3CJ4 A;  4LR7 A;  1CBK A;  3C15 A;  3CJ3 A;  3QAT A;  2AX1 A;  4ED1 A;  1UL3 A;  2B3T B;  2GQ2 A;  3EUN A;  5ETK A;  5D0H A;  2MQP A;  1N32 J;  5ETV A;  1YWX A;  2V8G A;  3IM9 A;  1Z1Z A;  4QWA A;  2PMH A;  3PJW A;  1N5T A;  3BGL A;  3MR6 A;  4CLW A;  2YWF A;  2APO A;  4OYP A;  4CM2 A;  4X64 F;  3CED A;  2R2R A;  2AV5 A;  1NKE A;  3BBF A;  3R5J B;  2YNG B;  2XC9 A;  2WON A;  1KC8 T;  4QR0 A;  3QJJ A;  1REV A;  2O5D A;  3RGI A;  1M5H A;  1X4A A;  3M2R A;  3R5A A;  3OW2 R;  1RYR A;  3MEE B;  2KXN B;  1VRQ C;  2DIT A;  4FBU A;  1S1T B;  2CNO B;  1REG X;  1VHF A;  4F0K A;  4DV5 J;  5FJ4 A;  3EVW A;  1IR1 A;  4DV3 J;  1U2F A;  4ETX A;  2HEK A;  3HFK A;  4HH0 A;  4R25 A;  4B17 A;  2B43 A;  4BHQ A;  3IWX A;  2DVI A;  2AYE A;  4YHH F;  5A6P A;  1Y3J A;  2W9B A;  2DYA A;  1TL4 A;  3M6W A;  4KBI A;  4ZOS A;  2QC3 A;  4Q45 A;  1FA0 A;  4TXS A;  4DZ6 A;  2NZC A;  4EBD A;  2PI5 A;  2B5J A;  2CNN B;  3RAX A;  2FVQ A;  1KLN A;  4K4V A;  1WDT A;  2GVD A;  4YB6 A;  5CAA A;  2H3A A;  4MK7 A;  1VHI A;  2JZ5 A;  4AL6 A;  2ZVI A;  3A8I A;  1Y4Z B;  1HWK A;  1FE4 A;  2V2Z A;  3H4B A;  3M30 B;  1XMO F;  3GYG A;  2DIV A;  1E6V A;  3CDU A;  3GR1 A;  4DR3 F;  2ASD A;  2NQP A;  2ZDO A;  2L9W A;  3C14 A;  1NK0 A;  1EX8 A;  2OKQ A;  5T41 A;  4BWJ A;  1LWC B;  2DBB A;  2P9E A;  1N56 A;  2J0Q D;  3C16 B;  3DRR A;  2V2V A;  2A2B A;  1X5P A;  1SL0 A;  4YUD A;  1CJK A;  3AFG A;  1HA1 A;  4B3S F;  2BJ9 A;  4LF9 J;  2PE8 A;  4J9K A;  1DTQ B;  4WE1 B;  3NBP A;  1FER A;  4NEZ A;  3PXG a;  3JAM U;  1D8Y A;  4ELU A;  1UFW A;  2DGQ A;  5KFE A;  3NNH A;  4U7U D;  2VU5 A;  1XMB A;  3LH2 S;  2I8E A;  1K47 A;  5C2C A;  1N52 B;  5L1L A;  3BGR A;  2BE7 D;  1RB0 A;  1S6O A;  1SJQ A;  2CQH A;  3ZXW A;  2XSJ A;  2H1O E;  3BN7 A;  4RUC A;  2JWN A;  1ZET A;  1X9S A;  4LF8 F;  4RW8 B;  4O44 B;  1RWN B;  1ZM3 A;  4K7Q A;  5HAO A;  4LF9 F;  2XHW A;  4PQU B;  4C8L A;  1OY8 A;  4M94 A;  1F6T A;  1YK9 A;  3HK2 A;  1Q5Y A;  4JI5 F;  1R0B G;  1S6P A;  1WEL A;  1RT6 A;  2CPH A;  4Y0F A;  5BYQ A;  3K58 A;  4ECW A;  5K9F A;  1QLN A;  2CVE A;  3KOA A;  2WVF A;  4Y2A A;  2LEA A;  2YY3 A;  3A8K A;  3WQP A;  2CJB A;  1XWL A;  4FXE A;  3H2L A;  1VK8 A;  1AB8 A;  1S59 A;  2DTJ A;  1IKX A;  1EKR A;  1M1H A;  3TEH B;  2ZVS A;  1GXT A;  1CG2 A;  1HNI B;  2J9C A;  4H4M A;  4NAS A;  4NLX A;  3D9B A;  4OZ5 A;  2VFV A;  4ZP9 A;  4XPC A;  1RKI A;  4TU7 A;  4XDC A;  2VPZ B;  3EMT A;  1NSA A;  3MCM A;  3OHB A;  3ILI A;  3FCH A;  5IM0 A;  2CPE A;  1KHV A;  4DCJ B;  4DFP A;  4Q43 A;  4DUZ F;  2QL9 B;  2YKM B;  4LIR A;  5LSL A;  3EGZ A;  2AYM A;  5J2M B;  3FZB A;  2LFV A;  2RNE A;  1KOH A;  4L76 A;  2IVM A;  4C98 A;  4AAI A;  1S6U A;  4U8V A;  2ZIT A;  3PHT A;  3SYZ A;  3GP9 A;  1RHU B;  4WFN Q;  1FKA F;  1WDD A;  2D3U A;  4ES1 A;  4WZM A;  5ETM A;  2MQO A;  4USI A;  1R8H A;  2EK1 A;  4OX9 J;  3LTO A;  3BQ2 A;  2C3U A;  1EAR A;  2BW7 A;  3W65 A;  3AQO A;  2BAC A;  4B3O A;  1OMS A;  2X1A A;  2H4Y B;  1HNX J;  1RWW B;  3PKM A;  2O1P A;  2OO4 A;  2AN7 A;  4B3R F;  1OSD A;  3HVT B;  1Y9O A;  1P9Y A;  2PC6 A;  4LQ3 A;  1NDP A;  3WC2 A;  1WHV A;  4A8Q A;  3U7J A;  3M9M B;  2Q6C A;  3CWJ A;  4PXB A;  2D3O R;  1TL1 B;  1TUV A;  2CQ1 A;  3JTN A;  4ZJL A;  2XY5 A;  3BRE A;  5KFJ A;  2V68 A;  3HVT A;  3CCM S;  2ZWO A;  1M5K C;  4AT1 B;  4K4S A;  2DHH A;  1U2R A;  2ZBC A;  3CC2 S;  4ILR A;  5KAK A;  3FQL A;  4EEY A;  2I38 A;  4F3O A;  4C0H A;  1MYK A;  5T7L B;  4YR0 A;  4DV1 J;  2D3O 1;  4X4V A;  1HW8 A;  4A48 A;  1FK9 A;  4K2J A;  3DM2 B;  4C3K A;  2OH2 A;  1LEO A;  2ZJR Q;  1N34 F;  1D9D A;  2HLT A;  2WSE C;  3LPY A;  3MEG A;  3P5T L;  3VGU A;  5EX0 A;  1FTR A;  4KAI A;  2YKM A;  3GSD A;  1SKR A;  5AE3 A;  3DOL A;  3G6Y A;  2BAN B;  4AUK A;  1KS2 A;  2K8G A;  1F2H A;  1TKX B;  2LDI A;  1S0M A;  3AJ1 A;  2RQC A;  2VUG A;  4PYA A;  1M5S A;  2CQD A;  3OTO J;  3GIK A;  2ERR A;  1FJG F;  2MQQ A;  3G6E S;  3GJQ B;  2JX2 A;  3QSY B;  3F44 A;  1RWK B;  2B9X A;  4WII A;  4AL7 A;  4CLP A;  3AJD A;  1NHU A;  1CLF A;  4OL8 A;  3IGN A;  5EUH A;  1HQU A;  2YNF A;  5HMY A;  5LT5 A;  1XR5 A;  1ZM2 A;  3QT7 A;  3QAU A;  3KNG A;  2DR8 A;  3J7A 1;  2E9Z A;  1S6P B;  4X62 F;  4DBQ A;  3D68 A;  5HO4 A;  2HPU A;  1W26 A;  4E8U A;  3OPK A;  2Q3P A;  4NLW A;  4BS2 A;  3SZ2 A;  4Q8E A;  2IFX A;  5CQG A;  4O44 A;  3QIP B;  2HHW A;  2HQG A;  3CDW A;  2DH9 A;  2HHH F;  1QAY A;  1X5T A;  1T05 A;  2IIH A;  3HVW A;  4CDI A;  5GAD U;  4U95 A;  2V34 A;  3FMW A;  4J37 A;  4C7Q A;  4M1K A;  3RR8 A;  1VFJ A;  2I1R A;  1T9V A;  4DX7 A;  5C7P A;  1Q81 T;  3DLL Q;  4JB8 B;  1DTQ A;  4WE1 A;  4EI2 A;  5K14 A;  4YB1 P;  5J2Q B;  1FO1 A;  3B4M A;  1YJT A;  4X65 F;  1EQ0 A;  3VEB A;  2V8D A;  5K8O A;  3BS9 A;  5LJ3 Y;  1OWX A;  3W8G A;  3ICL A;  3NCQ A;  4HTJ A;  1P27 B;  4C8N A;  3C8Y A;  3C16 A;  4WTY A;  4LSZ B;  1RAE B;  5IV3 A;  4F3M A;  3PYD A;  1CUL B;  2NZ4 A;  5KG7 A;  3FC9 A;  1N0V C;  3QMQ A;  1IR0 A;  1BWV A;  3C14 B;  3T1H J;  3LW5 C;  3I31 A;  5K8P A;  4TKT A;  3HX9 A;  3EYZ A;  2RML A;  1AYE A;  4H4O A;  5LJ5 Y;  2HQI A;  3ISZ A;  1T3N A;  4ENO A;  5DGA A;  2JOQ A;  5ETQ A;  3FBC A;  3L95 X;  4XAK A;  4EMD A;  4X4R A;  1TR0 A;  3CDE A;  4DR1 J;  3KLG A;  1U1O A;  2IRY A;  1X4G A;  3GJR B;  4XTT A;  3OTB A;  2HMI A;  2MHE A;  2LXI A;  3MMA A;  4EZ6 A;  1PC4 A;  3ZZ0 A;  3P45 B;  3T3F A;  4IRK A;  1CPZ A;  1BQM A;  2PGC A;  3PEH A;  4NLU A;  3VW4 A;  3W5Y A;  4DV7 F;  1YIJ S;  5IT9 U;  1XR6 A;  2XMM A;  1WC0 A;  1CJV B;  1SIW A;  4HHU A;  4CRJ A;  3RZA A;  1MRO B;  1NPK A;  2W9B B;  2BKO A;  1OO0 B;  2IC3 A;  3MM8 A;  4H4K A;  4MYT A;  4JI7 J;  2HRU A;  2VQE J;  3CME S;  2GQC A;  4KQZ A;  2XGQ A;  1SVD A;  3JQM A;  5DG9 A;  4A8Y A;  2VBY A;  3BO2 A;  3NAH A;  3IR6 B;  3RYL A;  4Y34 A;  1S1T A;  1QTG A;  3UPF A;  3TZW A;  3EXY A;  1ZAX A;  2ILY A;  1XMQ J;  4M5J A;  4O3R A;  4FF2 A;  1XNR J;  1N88 A;  2YBV A;  1X0F A;  1UVM A;  3M2R B;  5CCL A;  1UKU A;  1RAO A;  3HHL D;  2WON B;  4DR2 J;  3KMS A;  4OX6 A;  1HWL A;  2LYV A;  1O0P A;  3QNW B;  1TVR A;  1HI8 A;  3H42 A;  4ZVG A;  5KFO A;  3QZ7 A;  5J1E B;  2BYC A;  2CJK A;  1VQN S;  2H4W B;  3LP1 B;  1MWY A;  3RW6 A;  4RL1 A;  3ADA C;  4C8K A;  2GGP B;  3PX0 A;  3UN2 A;  2Q1L A;  1VGY A;  2D41 A;  2W2M P;  3W64 A;  1T9U A;  3CC7 S;  2IYG A;  3G86 A;  1Y10 A;  2IMO A;  1FI4 A;  4I56 A;  4NLO A;  3C15 B;  4PXC A;  2NS1 B;  5KT2 A;  4DV5 F;  5KG5 A;  2PD1 A;  4U6P A;  3PW0 A;  2X1G A;  1TVR B;  2L9D A;  2FD2 A;  4F2R A;  4LFC J;  3THP A;  4XPE A;  2R2T A;  1K8A T;  1T7P A;  4KHP F;  2CJX B;  5G0R B;  1VJW A;  1WG1 A;  2MZS A;  3E01 B;  5KFU A;  5EWE A;  3CJQ A;  3NY0 A;  2Z8Q A;  1DUR A;  3K57 A;  4OYO A;  1ARR A;  3H5Y A;  1Z2L A;  1QTN B;  3EVO A;  2YX7 A;  4ECR A;  2UXD J;  2A6M A;  1VMB A;  2PA8 D;  3GSI A;  5DQI A;  3I6P A;  1OG7 A;  1FF2 A;  3TJ9 A;  4ALZ A;  5HMZ A;  5KFK A;  4NXM F;  2RKI A;  5E5N A;  2VON A;  3POT A;  1UVJ A;  2IC3 B;  4DJB A;  3D5M A;  4JV2 A;  1WF0 A;  1G6B A;  1ZBT A;  1TEL A;  1UET A;  2CQP A;  2CJQ A;  4O3P A;  2N7Y A;  5D78 A;  4CH7 A;  5KFW A;  4EZ9 A;  3GFX A;  1BQM B;  5GAD I;  1YJW S;  2EXU A;  4XIU A;  3QQC D;  2HMI B;  3RU0 A;  3RUB L;  3NKY A;  1RT3 A;  1HNW J;  2W4C A;  1WG5 A;  3PG9 A;  5F8H A;  4LF4 F;  1IWG A;  4AD6 A;  3EZU A;  4OZ2 A;  1FX2 A;  3GG0 A;  2GS8 A;  3KLG B;  3TAM B;  5K8N A;  5D4P A;  2FLP A;  5FLX Y;  4LRV A;  3RB3 A;  2KT2 A;  1U8S A;  2DHA A;  3DDK A;  4CT9 A;  3CF5 Q;  4Z2X A;  4NCG B;  4H4O B;  1CC8 A;  1LK5 A;  2B56 A;  2CJ9 A;  3GJS B;  2YNH B;  3PAC A;  1M90 T;  3HKZ D;  1WKJ A;  4DX5 A;  2IA6 A;  4YS2 A;  5A8K A;  4N47 A;  1TAQ A;  2ZOG A;  3M2U A;  3THT A;  1CUL A;  4K0K J;  4JYA J;  2DKO B;  4CLS A;  3FDS A;  1PYT A;  5D4O A;  3DLB A;  3H40 A;  2A10 A;  3CNQ P;  1H0H B;  1DJ0 A;  4B9S A;  1MU2 A;  4RZR A;  4LIW A;  5J2Q A;  4DLE A;  4X2B A;  2DNR A;  4KKO A;  4F4Y A;  4OMF G;  1UZH A;  1WTF A;  1WC3 A;  3O5T B;  4U96 A;  5GME A;  5F8L A;  1GMW D;  1LW2 A;  3KLV A;  1R0A A;  2UUC J;  4ZPC A;  3P49 B;  1QSS A;  4G1P A;  2ALZ A;  4FBT A;  2J8S A;  3HLU A;  4NML A;  4P10 A;  1RHQ B;  2VL1 A;  4BC7 A;  2CQG A;  2F9D A;  5RUB A;  3EWG A;  1SJ3 P;  1URR A;  2E5I A;  3QIP A;  4EO6 A;  1YTY A;  3EVM A;  2ZHO A;  1RBO B;  1S1X B;  2KKE A;  5ADZ A;  2UUB J;  4C97 A;  1FNM A;  1C0T A;  1C4A A;  1UVI A;  1T9T A;  2HS0 A;  3A1Y G;  4KH1 B;  5AT1 B;  5CD4 H;  3MUM P;  5E2Q A;  3TAR A;  1S4F A;  4G65 A;  1YX2 A;  2PT0 A;  3EDQ B;  3NOC A;  4WKY A;  2EFN A;  2D3Z A;  4O4G B;  5KFM A;  4A8S A;  1R8A A;  3SSS A;  1FEE A;  1D9F A;  1Q4R A;  2KJV A;  2Y1I A;  3IM8 A;  1F3F A;  2C28 A;  4LR8 A;  1TK8 A;  1WF2 A;  1YBU A;  1IN0 A;  3GLJ A;  4ED5 A;  1TKX A;  4CO0 A;  1VC6 A;  3I32 A;  5K8M A;  4NI2 A;  3ZZU A;  1VR6 A;  2LU2 A;  2FHJ D;  2B8P A;  1VRU B;  3LAK A;  2DNH A;  1VK3 A;  4NMX A;  3VZH A;  4Q8F A;  3K5O A;  4FS2 A;  1Y00 A;  3K8W A;  1RT5 A;  5GAE U;  3K5N A;  4M8L A;  1WJ9 A;  1RK8 A;  4N56 A;  3G71 S;  5AXM A;  3DM2 A;  2JVO A;  1BWE A;  1NDC A;  2W7O A;  1F0X A;  2CVI A;  1UVK A;  2VC1 A;  2KOE A;  2NYI A;  1S4E A;  1P8G A;  3CVK A;  4CLL A;  1H2V Z;  1VQY A;  2GX8 A;  3GWC A;  4ZPT R;  4A46 A;  3I0S B;  2YWG A;  5HVG A;  2MZ1 A;  4TQS A;  2IYI A;  3TAP A;  4C4W A;  2MYF A;  3CCU S;  1TU0 B;  5F3T A;  5K20 B;  2FJV A;  1FHT A;  1T11 A;  4G1Q B;  1VRT A;  3VGS A;  1L5U A;  2BRL A;  5ETN A;  4DFJ A;  4DR4 F;  4CNZ A;  1N5V A;  3T5L A;  4QR2 A;  1TL1 A;  3GJT B;  4OYA A;  2YKQ A;  3ILO A;  4Z7C A;  2JFK A;  1RTZ A;  2R4F A;  3TP2 A;  5J1P A;  4WCE Q;  2ADC A;  1HHT P;  3C6U A;  2KZZ A;  2PMW A;  5KFF A;  3DNC A;  6FDR A;  5DDR C;  1RTI B;  3E51 A;  4PCQ A;  1RI7 A;  1H72 C;  1QAI A;  4LFC F;  2HNZ A;  3AY0 A;  1Q5V A;  2HZV A;  1K44 A;  3F41 A;  2E7V A;  3HSD A;  3VV2 B;  4B3O B;  3R2C J;  2QLJ B;  2MB0 B;  2FHM A;  2KVI A;  2O3D A;  5U47 A;  3PRB A;  4RUH A;  5M2U A;  3B4D A;  3HDS A;  1VDH A;  4QZV B;  4MKV A;  2BMB A;  4F0H A;  4TU9 A;  3DLH A;  3D67 A;  2CA9 A;  1YKW A;  4N77 A;  3B78 A;  1FD2 A;  3JXO A;  3M8Q B;  2BZ2 A;  2ZBR A;  3F0N A;  2QE5 A;  3N79 A;  4DG1 B;  3MF5 A;  3OJS A;  1AUD A;  4DSK A;  1AA1 B;  3O44 A;  4FYD A;  4Q2L A;  1TAU A;  3JSR A;  4HLB A;  2OPR B;  5EGY A;  2C22 A;  1VI7 A;  1FFW B;  2AKW B;  3PTW A;  2HFZ A;  3RRK A;  3SCJ E;  4RNO A;  4J9N A;  2R3V A;  2KFN A;  4AE5 A;  4J91 A;  2MXY A;  3N5F A;  1N33 F;  2KT5 A;  2UXB F;  4YME A;  2QIF A;  5CYM B;  2ZH2 A;  4H4M B;  5CH7 B;  1IKV B;  3M6U A;  3NMA A;  1HBN B;  3PM9 A;  4MIA A;  1T9Y A;  2K1R A;  3SMZ A;  4UT4 A;  1XJW B;  5DLG A;  3WC0 A;  3T9Z A;  1NO8 A;  4CH0 S;  5IXU A;  1U48 A;  5CHC B;  3BPS P;  1K9M T;  6FD1 A;  4FXD A;  3H87 C;  2L08 A;  2LKZ A;  3MM5 A;  3MPU B;  2Y9H A;  4GKK F;  4FF3 A;  2MPU A;  1AW0 A;  1EZZ B;  2C2D A;  2KO1 A;  2Z56 B;  5C2G A;  1H2U X;  4QWC A;  2KHD A;  1SV5 B;  1LQ9 A;  3CCT A;  4UOH A;  2XMW A;  3J7Y U;  1R89 A;  1SL2 A;  5DRK A;  3RB0 A;  3NOG A;  5KFA A;  2YWK A;  3CJT A;  3P5B P;  5A6W A;  1E6Y A;  4P7T A;  2DHS A;  1Q95 G;  3IWN C;  4DSL A;  5IZH A;  2YKA A;  3MMC A;  2XSJ B;  4QCL A;  1AUS L;  2GAG C;  1OYE A;  2GCF A;  3BGR B;  1S1U B;  1LFW A;  2PEH A;  4JBC A;  3KUH A;  1S6Q B;  4DDF A;  2OJ3 A;  1U9P A;  1R0C B;  1FRX A;  3DHX A;  4NYZ A;  4WK3 A;  3BO4 A;  2JXG A;  1H7W A;  4ANE A;  1UPP A;  1UEK A;  3EGW B;  1C0U B;  4OJ3 A;  5KFT A;  1FTC A;  4IO1 A;  4DL2 A;  4USH A;  2J0X A;  2Z0G A;  2HS3 A;  2QL5 B;  1C2P A;  3AA8 A;  3HD2 A;  2AYB A;  1B64 A;  3UCZ P;  3IG1 B;  1RTD A;  2BOA A;  2WOM A;  1LWC A;  1XIQ A;  1WKK A;  2GML A;  2YH0 A;  4U67 Q;  4EO8 A;  2MY8 A;  3OT9 A;  4CWB A;  3VGV A;  1DHM A;  1IKW A;  2G4B A;  1E6V B;  1N5Y A;  1NME B;  2LQJ A;  4C8M A;  3ULH A;  2C2O B;  3V4I A;  5FDL B;  3J7Z T;  2PA3 A;  3IO1 A;  4F7V A;  4ECS A;  2FY8 A;  5E33 A;  2FJX A;  1VQM S;  4FKX A;  3CJ2 A;  3PYG A;  4KHM A;  4WFX A;  4NCA A;  4IG3 B;  2G0C A;  2RF2 B;  3R7S B;  5A2Q U;  4LSL B;  2ZM6 F;  3PW4 A;  2GVD B;  2OTL S;  1YJR A;  4KIA A;  4ZVO B;  3VAJ A;  2B5J B;  1Q8L A;  2KH9 A;  3Q24 A;  2K9I A;  4USW A;  4YN3 B;  1JQG A;  3CIZ A;  3TR5 A;  1U8W A;  3DYA A;  4DU7 A;  3R7B B;  3WIU A;  3V6H A;  4LT6 A;  4C11 A;  2V0N A;  5JMN A;  3TZX A;  1N33 J;  2GJF A;  1O51 A;  4GVB A;  3UI3 A;  2M8D B;  4J9M A;  3BBC A;  5F9N A;  4GC7 A;  2ATC B;  2MQN A;  2OFG X;  3NGR A;  3X3U A;  3IBF B;  2UUB F;  1V5I B;  2WSC C;  4JI4 F;  4K4Z A;  1JWW A;  3J81 j;  3CJ5 A;  3KK2 B;  3ZZZ A;  5D77 A;  5E3C A;  1TK5 A;  1FES A;  1GAO A;  2PFD A;  3UR3 C;  2BSQ E;  4O3N A;  3KWM A;  1F5B A;  4CCH A;  1SKU B;  4C3L A;  3V6K A;  1DQA A;  3HVR A;  1Q86 T;  1FXL A;  5IOL A;  2VIC A;  1S1V A;  3PEJ A;  3GCX P;  4F4X A;  5LXR A;  4JI3 F;  4AYB D;  3OLA A;  3QGI A;  2AHO B;  3A8E A;  1Y11 A;  3FBF A;  5GAH I;  1XNR F;  1FJG J;  2GNK A;  3PJX A;  4WK1 A;  2FB0 A;  3FSX A;  4O0N A;  5C42 B;  1FVS A;  3C66 A;  3W5X A;  4NLS A;  3FMT A;  2DY9 A;  4RKU C;  4YHH J;  1B0T A;  1KLM A;  4FXV A;  4HHJ A;  4UUW A;  2XZT B;  4RBT A;  2AEM A;  5IC6 B;  3AB2 B;  4CLF A;  5J2P A;  1T0T V;  3HHE A;  1JLQ A;  3HHN B;  2FJB B;  2VG6 B;  1HI0 P;  2MZQ A;  2OEL A;  4CO5 A;  2ZH9 A;  3PW5 A;  2ZH4 A;  1EA4 A;  1O8B A;  3UVJ A;  4ED4 A;  2F4V F;  2EPI A;  1HBM B;  2CZV C;  1WHY A;  2GVZ B;  5KT4 A;  4PKD B;  4TQR A;  2G1D A;  4ZP8 A;  2FZK B;  2JL9 A;  1CQM A;  2XNQ A;  4DN9 A;  3G8T A;  1N54 B;  1WUU A;  2JHE A;  2QZ8 A;  1TMM A;  4DXL A;  4K4T A;  3O6Q A;  1HPZ A;  3H25 A;  4U9R A;  5C42 A;  2YNI A;  2JFD A;  2J9D A;  3R5D A;  1RBA A;  2IJN A;  1XNQ J;  1OQ3 A;  1KR4 A;  1FD8 A;  1RAG B;  2J9D E;  1NLA A;  1QTM A;  3CCV S;  3MPY A;  2MZR A;  2RDI A;  2GHV C;  2UU9 J;  1SC4 B;  4KGX B;  3LAN A;  3TAN A;  4UUX A;  1NPP A;  2LDY A;  2H3E B;  4NPO A;  1N5Q A;  2V4R A;  1IBM F;  4Q0B B;  5DET A;  1MYL A;  3H20 A;  1RT4 B;  2BM0 A;  3OXG A;  3UD4 P;  3GV8 B;  2R7T A;  3NGS A;  2BE9 B;  1RYS A;  4K4Y A;  4ZKA A;  2VFT A;  4ER8 A;  2E5J A;  2H65 B;  2QT7 A;  1XMO J;  2BDP A;  4GO5 X;  1HAR A;  3KJV A;  2VG7 A;  3I5C A;  1B01 A;  5M2R A;  2WB1 D;  4DL7 A;  5D0G A;  3TUI C;  1NK9 A;  4QU6 A;  1JLC B;  4DUY J;  1VLO A;  2KHC A;  3MUT P;  1IBM J;  3IRX B;  1YZ6 A;  1JLF A;  4KSE B;  4C11 B;  1NLK L;  2HQ3 A;  3DYA B;  2K2P A;  4X4O A;  1EP4 A;  3DXS X;  4KFB A;  2R7R A;  3VAL A;  1MML A;  2XY7 A;  3AT1 B;  3WZ0 A;  2AGO A;  2GIF A;  5D0E A;  4B3S J;  5LOQ A;  4RWW A;  3IGV A;  2ASJ A;  2LQ5 A;  1SI9 A;  5BYS A;  2HHP A;  3FMB A;  3Q23 A;  2FTR A;  1G3O A;  2HVE A;  3PRD A;  4FDF A;  2RF2 A;  2M3D A;  4LSL A;  3CIM A;  1SJR A;  1RU2 A;  1FVQ A;  2B4P A;  3U27 A;  1RA6 A;  4ZHR B;  4DUY F;  2GA7 A;  2RRA A;  4EYI B;  2XZW A;  2Z2Y B;  3EE3 A;  3MHY A;  4UTG A;  1JIH A;  2FGC A;  2SXL A;  3DRY A;  4YEA A;  4NXN F;  4DL5 A;  4DR7 J;  2DGS A;  1J5E J;  2XMU A;  2VBW A;  2VKZ G;  5KFX A;  4LRB A;  1ZYQ A;  1PSD A;  2WCX A;  2N3L A;  4Y28 C;  4ZP7 A;  2XLJ A;  1LWE A;  4NXM J;  4UZB A;  3BEG B;  2LU1 A;  3LGN A;  2HRT A;  1WC4 A;  4ILL A;  4M5N A;  2CIM A;  4Q7A A;  2QV6 A;  2WOM B;  3DRP A;  4OJG A;  5JVH Q;  4P74 A;  1SL1 A;  1FDN A;  2MGZ A;  2HGM A;  2CAX A;  2ABY A;  3MWB A;  4FS1 A;  2VOO A;  4DL4 A;  2BNZ A;  5CCM A;  4CQ1 A;  4UQG A;  4LVO P;  3FSI A;  4ZA1 A;  2OLW A;  1ZM9 A;  2ASL A;  5GAG I;  1WI6 A;  2RJZ A;  2J0S D;  1YJ9 S;  1UA1 A;  1RLC L;  4P9S A;  4NZ6 A;  1S1U A;  2QMX A;  2DNP A;  3SCL E;  2ZBQ A;  3IRW P;  2HHH J;  3BDP A;  2H5E A;  3MMC B;  1Q79 A;  3HO1 A;  3E2E A;  2B9E A;  3FCV A;  3D0G E;  3BB5 A;  1OPI A;  4LRD A;  5AE2 A;  2E1P A;  1CJT B;  2BJE A;  3DGP B;  3HF5 A;  1MNE A;  2J5A A;  4PWD A;  4DSF A;  1MWZ A;  3DLG B;  3R97 A;  1F2G A;  3TQ1 A;  3LP0 B;  1BMQ B;  2AZ1 A;  4FYY B;  3TOQ A;  3M9N B;  4CP5 A;  2XCP A;  3K59 A;  1T03 A;  4KV8 B;  3MZI A;  1APS A;  3LOU A;  4KB7 A;  2IRX A;  5L1K A;  4BLG A;  3BSO A;  3MM5 B;  3L7O A;  3FFI B;  4OZ3 A;  2ATL A;  1U47 A;  3QAE A;  5THW A;  5BYR A;  3UWT A;  3MCN A;  4G3I A;  2JLG A;  4USJ C;  1ZPW X;  2MKC A;  1DQ9 A;  2GAH C;  4HT5 A;  3Q8U A;  1ICE B;  3CPW R;  2W01 A;  1HBN A;  1IKV A;  3OXL A;  3W2V B;  3PNI A;  3WX4 A;  2HFU A;  1JLE A;  1N6Q B;  3NNE A;  3LGM A;  4O23 A;  4ZDN A;  2IMW P;  4NEY A;  4GKJ J;  1WOP A;  4R0J A;  5IT0 A;  2OPR A;  5F3Z A;  2EVZ A;  4WJB A;  1D0E A;  3WIV A;  2KI2 A;  3GV7 B;  1WG4 A;  2DXF A;  4PXD A;  1LW0 A;  1X4B A;  4E98 A;  4MJK A;  3DC2 A;  3IP0 A;  1RUS A;  2AEJ A;  3PCO B;  4KGM A;  4NOH A;  2N3O A;  5EWF A;  1YLX A;  4ED7 A;  1NHV A;  3DCA A;  3BN4 A;  3UDC A;  1G4C A;  3RRG A;  3MGJ A;  1Q1K A;  3LAM A;  1WHX A;  2XTJ P;  2AZ3 A;  3VAM A;  3J81 Y;  2F1F A;  4F36 A;  1M5V C;  4LFA F;  2HSE B;  3AOC A;  1EJ7 L;  5ETS A;  3GIM A;  1FCA A;  2D9O A;  2EFQ A;  2RQM A;  3DI6 A;  4QYR A;  2QMW A;  2AGP A;  1XC9 A;  2EK6 A;  5E3A A;  3GU0 A;  4ZVF A;  3JYT A;  5D0R A;  2ZHA A;  4FVC A;  5ETL A;  2HBR B;  2PSZ A;  4ZIV A;  4H54 A;  3JS9 A;  2CFX A;  3W9J A;  3I56 S;  2OEJ A;  4IOB A;  3SQG A;  1R8C A;  2FHO B;  3M8Z A;  5A8R B;  5HN0 A;  3K5L A;  1A6L A;  4G1Q A;  3V6J A;  3TI0 A;  1HFE L;  2C1E B;  5SZT A;  4I68 A;  2VD3 A;  1PAU B;  4WBF A;  5KFG A;  2V69 A;  1YI2 S;  4LQ9 A;  3OFH A;  5DQH A;  3M8P A;  4EBC A;  4DQP A;  2GIQ A;  3TQE A;  3JSM A;  4ZS6 A;  2E5H A;  3K5M A;  4KR0 B;  4LFB J;  2N4D A;  4LF1 A;  2HBZ B;  3PFE A;  2FJD B;  3LWL A;  4WFZ A;  1NK4 A;  1RA7 A;  1RT5 B;  2WBR A;  5J1N A;  1SXL A;  4MFB A;  5DZ6 A;  3UN3 A;  4AL5 A;  2YPZ A;  3BGO P;  4I7F A;  4LRF A;  3KLE B;  1RAH B;  1VRU A;  4FKY A;  4IFY A;  1QAJ A;  3QWU A;  4LF8 J;  4V19 X;  2Y1L B;  3FKB A;  4OLP A;  1IRQ A;  4EYH B;  2HBY B;  3ENV A;  1UJ4 A;  1KON A;  2KVQ E;  3FBB A;  2ZM6 J;  3FEY B;  3W1Y C;  5B08 A;  1MMN A;  1V9O A;  4UOG A;  1LFP A;  2PN6 A;  1PJ6 A;  5B0D A;  5F8J A;  2Y8Y A;  2DNZ A;  3Q89 A;  2XUL A;  2ZBP A;  4O4G A;  4F0M A;  4DPW A;  2D7S A;  2MST A;  4HAC B;  4OYB A;  4DN0 A;  4HYK A;  1Q8K A;  3PW7 A;  3KMQ A;  4ERD A;  4DV6 J;  3CCR S;  1NSQ A;  3PV8 A;  3UO0 A;  2VBZ A;  4OHW A;  1EAY C;  3FJ2 A;  3RBZ A;  2HIQ A;  1S7H A;  4ID8 A;  2E5G A;  4XK8 C;  2WRM A;  2DHG A;  2QSW A;  4USU A;  3U02 A;  5LMN J;  1SH2 A;  1U1M A;  2QLW A;  3M6V A;  5KFQ A;  1BGX T;  3KJN B;  1ITP A;  1U6F A;  1D9A A;  2VG5 B;  3MEK A;  1J2V A;  3ELH A;  4RUB A;  2NPI A;  3RBX A;  3M32 B;  3MUV P;  2HYI B;  2AD9 A;  4YDD B;  3HZG A;  1RGV A;  1X0P A;  3I0R A;  3NP5 A;  5KFY A;  1UFL A;  3CD0 A;  4L3N A;  3ZTO A;  4C6A A;  1FRM A;  5KT3 A;  2IAJ A;  3CMQ A;  4FN5 A;  3AD8 C;  1MU2 B;  3D54 A;  1VJQ A;  5L1I A;  2P9C A;  1YVF A;  3N6L A;  1AZS B;  1JLB B;  4FNI A;  4IH7 A;  4UZC A;  1U1P A;  2VPY B;  2GJ2 A;  3ETM A;  2YX1 A;  4KO0 A;  5AXK A;  1FT8 A;  2CDR B;  5GVQ A;  1UWA A;  2R9L A;  1HD1 A;  2AJ0 A;  2XEX A;  3N6M A;  1HQ2 A;  2X7I A;  3CDB A;  1TMJ A;  4ECT A;  2VF3 A;  2DD8 S;  5C5J A;  5D6G A;  1MW7 A;  2QLB B;  4PG6 A;  4F4W A;  3IR7 A;  5CA5 A;  3IS9 B;  3TA2 A;  3MTK A;  5F8I A;  4R8U B;  1VC5 A;  3CJS A;  1RAD B;  3TAM A;  2L9N A;  3NAI A;  1HQE A;  2ZNY A;  5K5M A;  2LQ8 A;  4RW9 B;  4CLU A;  3HCX A;  5DG8 A;  3CUN A;  3HSZ A;  4OYM A;  4CYU B;  4NZ0 A;  2ADL A;  2CQ2 A;  2G1H A;  2ZKT A;  4TLQ A;  5BR8 J;  4JI8 J;  2A0F B;  3OXF A;  3MCS A;  3VVU A;  3H2V E;  4V1A k;  2OP5 A;  2MKK A;  1HHS A;  1BQN A;  3S6E A;  1JKH A;  5HP1 A;  2K6L A;  2WSF C;  2R8I A;  2M88 A;  2DY1 A;  3SDE A;  1NZ8 A;  1U0S A;  4KE5 A;  2HG4 A;  4NRT A;  1C4C A;  2VFS A;  3GIL A;  2F9J A;  2Z58 B;  5F0U A;  1SJ4 P;  4ICL A;  1NAQ A;  2DNY A;  3MEC B;  3OR1 B;  4ZIT A;  2J7K A;  3HI9 A;  2W1B A;  4RLE A;  3CSK A;  2AT1 B;  4PUO A;  1GFW B;  1FRJ A;  1GXL A;  1MN7 A;  3MI7 X;  3MM7 B;  5HAN A;  4KGZ B;  3MAH A;  1S9G B;  2IHR 1;  2FC8 A;  2G2Y A;  2JLF A;  5G0R A;  5KT5 A;  1PC5 A;  3CO0 P;  3NCR A;  2BEF A;  4P72 A;  2UUT A;  1VOM A;  1YQH A;  2CZ4 A;  3DLE A;  2OHD A;  1S9F A;  1VQ6 S;  4QYZ K;  4X4U A;  1XR7 A;  3VCD A;  2UV8 G;  2Q43 A;  4FZV A;  4WP9 A;  2OD6 A;  2GHP A;  1S9E A;  3UD3 P;  2G2O A;  1PJ7 A;  2Z30 B;  3D1Q A;  4I64 A;  3KG1 A;  1ZAW A;  4QIF A;  4DL0 C;  4ED0 A;  1S9E B;  5KFR A;  4WKR A;  2GGP A;  2HUR A;  4ME7 E;  3LP2 B;  3N5B A;  1KBR A;  3RB6 A;  3C2P A;  1ZM4 A;  5D8H B;  1Y0H A;  2EKY A;  2HGN A;  4WWS A;  2GPE A;  1YJV A;  2FGO A;  5KFL A;  3QRP A;  1FE0 A;  2CWK A;  2EI5 A;  3DLE B;  2A3J A;  2R7W A;  4WTO B;  3RBD A;  1K73 T;  3UDE A;  3M8S A;  2IM3 A;  3T5J A;  1WHW A;  1RLD A;  1ROF A;  3PR4 A;  1BDV A;  3US5 A;  2ZE2 A;  2VIH A;  3NGD A;  1DTT B;  2IJF A;  3MM7 A;  1NEE A;  2P2C B;  4OZ0 A;  4EU0 A;  3MMJ A;  5H9F J;  4A8M P;  3FEX B;  1V3R A;  3PVX A;  4PUO B;  2FUG 9;  3MEC A;  3KK3 B;  1GMU A;  3ENA A;  1X4D A;  5KG3 A;  1URN A;  4Q44 A;  2ADB A;  2HWT A;  2FDN A;  4HT7 A;  3DOK A;  1Z4U A;  3JB9 k;  5AXL A;  1HWU A;  1JKH B;  1F5C A;  1MRO A;  2Y1R I;  4ED6 A;  5E0O A;  5HP1 B;  1CJV A;  3OSP A;  4B9N A;  4FPI A;  4ZLL A;  2VDI A;  1RAB B;  2NXU A;  4YB7 A;  2F4V J;  1PGZ A;  3R6G B;  3HMJ G;  4KHR A;  2HND A;  3MD1 A;  2XM3 A;  3UN5 A;  4IG0 A;  3NS6 A;  1EET B;  4RW9 A;  4R5P A;  2WVD A;  2MMY A;  1ZS6 A;  2XYH B;  2ZDP A;  3N0V A;  2V8V A;  1JJ2 R;  5IQQ A;  2I6W A;  2KM8 B;  4LF5 F;  1NB2 A;  1RSC A;  5IV4 A;  2Y0B B;  5KG2 A;  5HLF A;  1U6B A;  1FKP A;  1JX4 A;  4ATN A;  4YY3 J;  3J7A N;  4RJV A;  3KDO A;  5D15 A;  3DOM B;  4J7C A;  2XI2 A;  5E7O B;  4NLQ A;  2BXJ A;  4OYX A;  4PWU A;  2A18 A;  4FF4 A;  3G82 A;  3B6B A;  1VQ4 S;  4B9V A;  4NA3 A;  4KO0 B;  5DDO C;  2WZ1 A;  1IR2 A;  3NO7 A;  3MED A;  1AZS A;  4RW7 B;  1UMJ A;  4ZPD A;  1VQ7 S;  3MM6 B;  1Q8B A;  1S10 A;  1S1W B;  3BDE A;  2E7X A;  1BLU A;  4TY8 A;  1RWU A;  2EFP A;  1LXN A;  5A76 A;  5LMU F;  1U1R A;  1X4F A;  7FD1 A;  4Y2K A;  4G6V B;  1FJ7 A;  2VBX A;  2AYG A;  3TO8 A;  1NJI T;  1KVK A;  1RU1 A;  1RE1 B;  1GX5 A;  2DGT A;  3M32 A;  1WWH A;  2HFN A;  4OFZ A;  4OHY A;  2MLY A;  2VG5 A;  2CXE A;  3J80 Y;  1KSP A;  2BBE A;  4P73 A;  3R9L A;  4CI0 B;  5F8M A;  1KQS R;  1U0H B;  5DDQ C;  5H9F K;  1UFK A;  4I6A A;  2FLL A;  3B54 A;  1QD1 A;  5I3Q A;  2R7V A;  4I4B A;  1Y5N B;  3GB0 A;  4L73 A;  1PO6 A;  3PIP Q;  2V5H G;  3L9Z A;  3I5A A;  2DPJ A;  4IR1 A;  3W63 A;  2QA4 S;  2VQF J;  5A0Y A;  2DB1 A;  2DXD A;  3DDN A;  3ET6 A;  4YDX A;  3ZZT A;  5GAH U;  4OX7 A;  2DHX A;  1NJZ A;  4LF4 J;  2MQ8 A;  3R5C A;  2ZH1 A;  1F60 B;  3T5H A;  2Z4P A;  3AJ2 A;  1TL3 B;  2KEL A;  2ZC3 A;  1B99 A;  1TKZ B;  2AJ2 A;  2NCK L;  3BYP A;  3RRH A;  2I2Y A;  1TTH B;  4OI3 A;  2HNY B;  5KFV A;  2ZNZ A;  3H7H B;  1M0S A;  2XQC A;  2VA2 A;  4BDP A;  4UY8 T;  5JUM A;  3JTO A;  1QVF R;  2BOP A;  3ITH B;  2B9Y A;  3MOZ A;  1RAJ A;  3DLJ A;  2K3K A;  4CO3 A;  2BAN A;  1NND A;  3T41 A;  4QPT A;  2CPY A;  4OJ1 A;  2KYX A;  2WW8 A;  3KK1 A;  3D2W A;  3M7V A;  4LF7 F;  3AA9 A;  1U1Q A;  2ZZN A;  3MEG B;  1IQT A;  2GIR A;  2MKI A;  5BXI A;  2RHS B;  2CDQ A;  3N4W A;  4QW9 A;  1NK7 A;  4JI3 J;  2W9C B;  2WTF A;  1U26 A;  1GMW A;  4NLT A;  4JI4 J;  2HVD A;  2M0G B;  1ZTW A;  2QA1 A;  3GR0 A;  2QMU B;  1FNX H;  5HJX A;  1JXV A;  1Q78 A;  4I6W A;  4JUZ A;  5MAO A;  4WZQ A;  1LOU A;  1GH8 A;  1R8P A;  3IWL A;  3L09 A;  3BR8 A;  3M8P B;  2Z2M A;  1WSV A;  4WU3 A;  3I9V 9;  4GVL A;  4X66 J;  1V3Z A;  3B8H A;  5EWG A;  2XMV A;  1ZH5 A;  4JP8 A;  5HSP A;  1S72 S;  2AJ4 A;  4MTP A;  4P6Q A;  1YJ7 A;  2HZA A;  3FZ2 A;  1FRK A;  2R8H A;  4B3T F;  4Y2M A;  3QT8 A;  3OTC A;  2HIY A;  2R8G A;  4M5H A;  1N34 J;  1N32 F;  4F02 A;  2CQ3 A;  1JJC B;  3GIJ A;  1SJF A;  2DCL A;  3B82 A;  1DLO B;  2KXF A;  3LQV A;  1LKZ A;  4DSI A;  4OQJ A;  2H5J B;  4KC5 A;  2NSB A;  1VQL S;  5T14 A;  1QUV A;  1HMV A;  2CAD A;  2DGO A;  5DDP C;  4YP3 A;  1OSC A;  1IBK F;  1KEK A;  4U7C A;  2AIR B;  2JC0 A;  2IBK A;  4NCB A;  1EKS A;  2H1Y A;  3BSN A;  3GFZ A;  2OEM A;  2VPX B;  2MJN A;  3OR2 A;  3DKD A;  2ZH5 A;  3M2V B;  5A2Q Y;  3CXC R;  1LW0 B;  3P3D A;  4DF8 A;  1TL5 A;  5C24 B;  4ZVU B;  4ZVR B;  1PYO B;  2UXC F;  4DV2 F;  2BNW A;  5IM0 B;  2KRB A;  3H59 A;  3QGP A;  4IH6 A;  1SUQ A;  1RAC B;  5FD1 A;  2COL A;  4OYI A;  2W2Q P;  4KPC A;  4PPD A;  2YWW A;  2DNK A;  5F41 A;  2LCW A;  1IKX B;  2QSF A;  4ZPB A;  3N9U C;  3SV3 A;  4ED3 A;  1B70 B;  1HBU B;  1N48 A;  2CPD A;  1NK8 A;  3U1L A;  4C3M A;  2RRN A;  4LF2 A;  2JSX A;  4WFB Q;  2DEJ A;  3FFI A;  3EXC X;  3PYF A;  3X1L B;  5B0G A;  4ZLP A;  1CQN A;  4RNF A;  1R31 A;  1RT6 B;  2WBM A;  3MPV A;  3KLF B;  1T03 B;  3MFH A;  4D3G A;  2FJE B;  2FHJ A;  5KFH A; 
#chains in the Genus database with same CATH homology
 2BJ1 A;  2JXG A;  1Q5V A;  4ME7 E;  1ARR A;  2K6L A;  2HZV A;  2PC6 A;  3QSI A;  2K9I A;  4D8J A;  2GPE A;  3QOQ A;  2H1O E;  3LGH A;  2HZA A;  2BNW A;  2CAX A;  2F1F A;  1BDT A;  1MNT A;  2WVD A;  3H87 C;  1NLA A;  3OD2 A;  2BNZ A;  2AY0 A;  1BDV A;  2CPG A;  3FMT A;  2K29 A;  3BKT A;  2WVC A;  2CA9 A;  3VW4 A;  1ARQ A;  1P94 A;  2JXH A;  3FT7 A;  1Q5Y A;  1B01 A;  3BKF A;  2BA3 A;  4HV0 A;  2RBF A;  3VEB A;  2BJ8 A;  1PAR A;  1MYK A;  2JXI A;  3PHT A;  3BKU A;  1IRQ A;  1X93 A;  2CAJ A;  2WVF A;  3VEA A;  1EA4 A;  2BJ7 A;  1MYL A;  2CAD A;  2FGC A;  2BJ3 A;  2K5J A;  1B28 A;  2WVE A;  3GXQ A;  2BJ9 A;  2BSQ E;  1QTG A;  2Y3Y A;  1BAZ A;  4FXE A;  2K1O A;  2WVB A;  2NZC A;  1U9P A;  2KEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...