2BJ3A

Nikr-apo
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
MELIRFSISIPSKLLEKFDQIIEEIGYENRSEAIRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEIISSLHVHMDEHNCLEVIVVKGEAKKIKMIADKLLSLKGVKHGKLVMTSTGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pyrococcus Horikoshii Nikr: Nickel Sensing and Implications for the Regulation of DNA Recognition
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transcription
molecule keywords NICKEL RESPONSIVE REGULATOR
total genus 37
structure length 135
sequence length 135
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2bj3A01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2bj3A02
2PC6A 1ARRA 2WVBA 2BSQE 2HZVA 1Q5VA 2AY0A 3QSIA 4HV0A 2BA3A 1MYKA 2BJ8A 1BDTA 3PHTA 2CPGA 3FT7A 1BAZA 2WVCA 3QOQA 1U9PA 2BJ7A 2K29A 2CAXA 2WVEA 4ME7E 1PARA 2CAJA 2BNZA 1NLAA 2K1OA 2BJ1A 2FGCA 4FXEA 2K5JA 2BNWA 3VEBA 1Q5YA 1P94A 2K9IA 2CA9A 2WVFA 3VW4A 1X93A 2NZCA 3LGHA 3H87C 1IRQA 2JXGA 1MYLA 2CADA 2Y3YA 1B01A 1BDVA 2KELA 3OD2A 2F1FA 1QTGA 3BKUA 2JXHA 2GPEA 2RBFA 2HZAA 1MNTA 4D8JA 1EA4A 2BJ3A 2WVDA 3VEAA 2JXIA 1ARQA 3GXQA 3BKFA 2BJ9A 3FMTA 3BKTA 2K6LA 2H1OE 1B28A
chains in the Genus database with same CATH superfamily
1Y00A 1Z2ZA 2I5JB 2B4VA 5ETOA 2J6SA 3ICLA 3TVYA 3CMES 4DR6J 1XBWA 2UVVA 2HHSA 4DL4A 1HNWJ 3M32A 3DOLB 2XY7A 2CPIA 2NXEA 2YNHB 3OXGA 5LM7E 2PMHA 1SQFA 2M70A 3MM9A 4Q8EA 1C4CA 2VICA 5FJ4A 2MMYA 4TU9A 5IM0A 3CCLS 5B0AA 4RNOA 3OR1A 1RT4A 4I0WA 3L7PA 1LWCA 1P94A 2HWIA 1EKRA 1H73A 2PSZA 5LJ5Y 1B7YB 3QIPA 4Y2MA 3H2UB 3HCXA 4IFYA 4RO0A 4Z7YA 4N41A 1MSWD 2N4CA 3G6VA 2KI2A 4R8UB 3EICA 1X4GA 3TUPA 5AT1B 2HQIA 3DOKA 3NBPA 4M5NA 3Q2SC 3KFWX 2GGPA 2NSBA 4PQUA 2NREA 5CXTA 2MYFA 2LQJA 2WOMA 1ZZFA 1TU0B 2V8DA 4FXVA 4JI3F 4ZS6A 1UEVA 1RTIA 1UL3A 2ROPA 3EMTA 3IWNC 1B3TA 5LMNF 1B64A 2CUYA 3BSAA 3WDOA 1CBKA 3AXKA 3KG4A 2Y1IA 4DR1F 4ITSA 1KOHA 3OFGA 1KQFB 4ME7E 2Q79A 2RU3A 1RT3B 1RSCA 2LKZA 1HMVA 1JXVA 1X60A 2OO4A 3DNCA 3FEYB 3UDCA 2XO6A 4DR3J 5DLFA 4NE9C 4L3KA 4D3HA 3NP5A 2J0QD 1RAIB 5H9FK 3M1VB 3TAMB 1LFPA 4WCEQ 4ED7A 2E5JA 4UW2A 1NDKA 4JI6F 3CE8A 2DNHA 5ETLA 2FLOA 2I1RA 4XPCA 3HKWA 3MOZA 1RABB 4FP9A 2RUSA 3WX8A 1N5YA 3FCHA 3IMQJ 2V9KA 4GVBA 1VQOS 4DV7F 2GNKA 2DHSA 2PFDA 5KG5A 2CJAA 2ZBIA 1T9WA 1YTYA 5KFHA 5D0EA 2E9RX 5KFPA 4W98A 3TARA 4ES1A 1U2CA 3AB2B 3C6TA 2DCUB 2GVDB 5D6GA 2N82B 1PSDA 3T1HF 1HNIB 2XMJA 1RACB 3S1TA 1TUWA 3LANA 1EB0A 2O66A 3TQEA 4B17A 4CI0B 4PCQA 1SJ1A 1TUGB 5I42A 3HK2A 3KLFA 2ZKTA 3AOBA 4WBFA 3UE2A 4JBCA 1GK8A 2HHXA 5C5JA 2XC9A 3HHKA 3LAKA 2BJDA 2GVDA 1PYTA 4OI1A 1HBMA 4MKYA 4OYXA 2JOQA 3GP9A 4CH1A 3D1OA 1WEYA 1REVA 2RHQB 1HW8A 2K8GA 1DLOA 3E3XA 4DSJA 1TP7A 1GQEA 2FHOB 1RWKB 1B0PA 3QT6A 2HQGA 3QJLA 2CNNB 1UJ5A 3M2VB 4I2QA 5ETRA 4CLYA 2AHOB 2ZUAA 3X3UA 2RQMA 3K5OA 2DNQA 1PAUB 5D3GA 4P6QA 2OSQA 2V50A 4KC5A 1F5CA 1S49A 4P74A 5AJ3F 5JMNA 1N33J 2EC0A 3ENWA 2JEFA 3I0RB 2AIRB 2B9WA 1T05A 3FQKA 4Y2KA 3H4DA 3JSRA 4NASA 3ZZUA 1HWKA 1CULA 1UMJA 3GSDA 1KOOA 4F50A 3LWLA 3FRYA 3QO9A 1FXRA 4K2XA 3UDLA 1VQ7S 1GMUA 1KWMA 1N52B 2D7SA 5DO2A 4ELTA 1WORA 4DN9A 2LEBA 3GFZA 2BACA 1IQTA 1Y5NB 1XK8A 3DGVA 4DZDA 1SV5A 2N3OA 2DR9A 4QU7A 3RR7A 3B82A 8ATCB 3NXZA 4L73A 3OHBA 2CQ4A 2BUNA 3FKBA 5GADU 4XAKA 4HT5A 1FRLA 1R89A 3UVJB 4A8OA 4BHQA 2IVMA 3GFXA 4I4BA 1PJ5A 4USHA 1LK7A 4KRWA 2XYGB 5KFIA 2RRBA 1REGX 1NH7A 2W4PA 2LXFA 3R7SB 3KHRA 2EKYA 3MM6A 3DI6B 4Y6IA 2EFNA 4URGA 4WFNQ 3KLGA 1F2GA 1HQEB 3DRSB 1HL6A 1SC1B 2OFHX 2ZEJA 1VJQA 5B7WA 7AT1B 2H3EB 2E9ZA 3MM5A 1RT4B 2HWHA 2CQ3A 2Z2MA 3GMGA 2H5EA 4WYLA 4CO3A 3CULA 4J9MA 2VDIA 4LRVA 4PR6A 2AGQA 4NRTA 3IBWA 2YKPA 1NAQA 3FSYA 3TR5A 2YNIB 3DRYA 2BOAA 3GYXB 3OD2A 5CH7B 4GC6A 1PO6A 2EFOA 3P45B 3HT3A 4D8JA 4Y34A 2WVDA 3RB4A 3CPWR 2FZCB 4TN2A 1N36F 3NGSA 3MGJA 1VLOA 2Z2LA 3BJYA 1CS4A 1U4BA 1RTDA 1ZZNA 4FBUA 3CO9A 3QJJA 3CJSA 4WP8A 5KFJA 1REVB 3O2IA 1DFDA 1YBAA 2LQ8A 1FKOA 4BC7A 4PEOA 1LEOA 1SB6A 4CP5A 1ZM4A 1EJ7L 1I1GA 5IWAJ 2AJFE 1JIHA 2FC8A 2JRSA 2G0JA 2VQFJ 1HARA 2W9CB 2KYZA 2A2BA 3IXQA 3A4TA 1JXEA 3TA2A 4ANEA 4OZ5A 4GKJJ 3BYRA 4NLUA 3QMQA 4F3QA 1PBAA 2MQQA 2KHDA 1OIAA 5IT9U 1K47A 2ILZA 4LF1A 3GILA 4OZ3A 3Q86A 1IBMF 2HGLA 4M5HA 6AT1B 4IUFA 3NAIA 4P7VA 1B01A 1X5SA 2CYYA 3HHLC 4DJBA 5B0DA 4ECVA 2DNNA 3G96A 3ET6B 4B9TA 4JUZA 4LF7F 1YRXA 3NY0A 4QR2A 5F8GA 4L74A 2B6AB 5LT5A 3OBIA 2AEJA 4DX7A 4A4JA 1IM4A 4NYZA 2P9GA 3OSPA 3UCUP 4ZN3A 2HFVA 3D6HB 4Q44A 4DL7A 1RA7A 3QRRA 4HHHA 3M7VA 1HHTP 2KM8C 1TK5A 4UY8T 5LSOA 3T6JA 3BR9A 4PXBA 1U26A 2AN7A 1JLQA 3UR0A 1HBNB 2H48B 2HNDB 4ZIVA 5CYQA 2KTQA 3C66A 1VS3A 2DNLA 3OR2B 2V2VA 1QJHA 3ZTQA 5ADZA 5F9NA 3PKYA 2BX6A 3MFHA 3G6YA 4QZVB 2DRAA 1S6QA 1TMJA 2EBGA 3VEBA 2YVSA 1D9DA 2XG8A 4KHMA 5E3PA 3U1NA 1CJVB 1IR2A 2CQ2A 4X4SA 1TKXA 3MAHA 3P8BB 3EXCX 3C46A 5LSRA 3IGVA 2KT2A 3OFEA 3OUYB 3CSKA 2PEBA 2BV3A 3JS9A 1U25A 3RB0A 2FUG9 1IR0A 1CJVA 1Y5IB 2OPQA 4O3OA 3G6XA 3GR0A 2DXFA 1U1OA 2E1CA 2YQ3A 4B3SF 5M2PA 5KTQA 3CJ2A 4NXMF 2J0XA 2MTLA 4DLEA 1UJ4A 2GIFA 2ZDOA 2C2DA 2X1FA 4HL9A 2L9NA 3CEDA 4LFBF 2YXLA 1VOMA 4ZPTR 4UZBA 1HI8A 4ECTA 1R43A 3KLGB 2J5AA 4PYDA 3NGKA 3LWMA 2DTJA 3M9OB 1U1QA 1U49A 4DX6A 1RU1A 2FJEB 4J37A 1WSVA 3KG0A 4WZMA 4XK8C 2W2OP 4IKAA 4FXWA 3MMBB 2UP1A 2OELA 1GMVA 2V2KA 3JXOA 5BR8J 2KZMA 2RAQA 1FKPA 1MROB 1JLCB 5KFOA 1LKZA 2RBFA 1U2RA 2EW9A 3DYAB 4RWWA 3HSDA 2V4JA 5E3AA 3ISZA 2F4VJ 4YOEA 2GQCA 4KV8B 1FX4A 1KVIA 3WC2A 4J9UE 1IKYA 1M1KT 4CZCA 1RWMB 5HSPA 3M1VA 1UVKA 4LF5J 3CJTA 3W2WA 5C25B 2XQCA 3THVA 3DRXA 4FYYB 4JI3J 2VBZA 2HHWA 4P2MA 2I8EA 4P2SA 2WVCA 1FRHA 5HATA 5DM7Q 3QOQA 1FKOB 2DRDA 3O3LA 4DR2F 4RNMA 1VBYA 4JYAJ 2CAJA 2QLJB 4ICLB 5KAKA 3FJ2A 2DNRA 4PYAA 1VQ6S 3C15B 2B8QA 2KZZA 5KFVA 1RE1B 2RRAA 2EFGA 3M2VA 1NH8A 3PCOB 3CD5A 4I2QB 1NSQA 5KFZA 1RK8A 4F4YA 2KELA 2C3MA 3UCGA 1EIYB 1VI7A 2CZ4A 4LF2A 3MF5A 4IH5A 1PC5A 4A8WA 2B9XA 2FC9A 3OL7A 5EN1A 4BS2A 2X1GA 1UZDA 3DRPA 4JV2A 5A8RA 1JLFA 3W3SA 1SJRA 4DEZA 4DSEA 1Q86T 5THWA 4OZ0A 1UA0A 5C2GA 1P27B 3DU5A 3I4PA 3MR2A 3P49B 4FF3A 4NA2A 1KVKA 4KGVB 4C8KA 4OIXA 1DBDA 4NI2A 4MJWA 2ZE2B 2JZ5A 1FNOA 3M8RA 3DN9A 3SQGA 4TXSA 1T9TA 2AF6A 2Z2ZA 4YR0A 2D3OR 2CVEA 2HRTA 4B3TF 4BWMA 4PG5A 4RU2A 3OW2R 3LH2S 2N4DA 2C2EA 2QEXS 4JI4J 3ENQA 4DX8H 3MM8B 5FLXU 2R8IA 2FJAB 4UOGA 4CLZA 2Y9HA 3QJPA 2HZAA 2VQEJ 4QWAA 4S0MA 4ZPBA 4ZPAA 1ZAVA 1S79A 2OMLA 2DHGA 5DQHA 1QAIA 3R7NB 1JK9B 2JFKA 4P2XA 3N6LA 3MCNA 1X4BA 2XMWA 5KFUA 2RQ4A 4RZRA 1HR0J 1M1HA 2LQ9A 3BGFA 2LA4A 5IWAF 3OHAA 4MH8A 2Y0BB 1J5EF 2LLZA 5B08A 1VHIA 2FJXA 1KSPA 5GAEU 2IM0A 1O0PA 2V0NA 2UUCJ 2XBPA 1QY7A 2ZH3A 4QIFA 3H25A 2J0WA 1X31C 1KQGB 2NXJA 3R7BB 2EC2A 4P73A 3K8WA 5T7LB 1H2TZ 1QAJA 2F9JA 1QSSA 1TZ0A 3NS5A 2CPZA 1YVFA 5KG4A 3GQCA 2VPWB 4C9DA 1WC6A 5E3RA 2UUWA 2MKSA 5ETVA 2KKHA 4C98A 4JV1A 1PYSB 3IP0A 1CSJA 3MMBA 5KG1A 4IQMA 3ULHA 3KJNB 1HNWF 2DGUA 2ACYA 1CJKB 4DR5J 4N47A 1U1NA 2UXCJ 4LF8J 2P6SA 4OJHA 5ETQA 1ARRA 1UFLA 2QO3A 3N9UC 3EGNA 3X1LB 2GHWA 2XGPA 3MHYA 2HQCA 2VB6A 1V5IB 5IM0B 4DF8A 2D3ZA 4QU6A 1SI9A 1UW9A 4CO0A 1RAHB 1NHKL 3HFZB 3DLEB 2ASDA 2VPYB 5K14B 2GZOA 3EGZA 5A0YB 4ED6A 1L3SA 1UVJA 4P75A 2I5JA 1OPIA 5DQIA 2APOA 2XY6A 1IVZA 3U02A 2HHUA 2FTRA 2X1BA 1HPZB 5HVGA 4KH0B 4YEAA 5A0YA 1YJTA 4OHVA 3DLBA 1AFIA 2PI4A 1I94J 2X3GA 3CCQS 1FT8A 3BR8A 1U02A 2R3VA 4A8YA 2P5VA 1HWJA 1HI1A 2XI2A 3OR2A 4A8XA 4E98A 1NB2A 2XMUA 3I5BA 2NZ4A 1N4LA 2HVZA 3WC0A 3OV7A 2VQEF 2BQUA 3NOCA 4XDCA 2AD9A 3QT8A 5CCLA 1BQNA 1NHUA 3A8IA 3WQPA 4O3PA 2F9DA 1C4AA 4K5SA 3I55S 5CYJA 1S0OA 2V63A 4DV1J 3QQCD 1B70B 3W9JA 1YJ7A 3OQ2A 1WUUA 1J2VA 5D0RA 3ENAA 7FDRA 2VC1A 2XS7A 2BYCA 3ITHA 4X62J 4DV0F 3DDIA 3DOKB 3DOLA 1OG7A 1MW7A 4RW4A 3N6NA 2Q6CA 2W4CA 2DGSA 5DDQC 1K0TA 1RLCL 1RHRB 2YTCA 4RNNA 1NPRA 1RHUB 3QAUA 5KFBA 4Q0BA 4DV3J 4C4WA 3G86A 3NMAA 2PDAA 2ZWPA 1RTDB 1N6QA 4ECUA 1S6PA 2R7WA 1F9HA 3RZAA 3AD7C 4KPYA 4HI2A 4EU0A 2QA2A 4O4RA 3RU0A 3VWSA 2MKJA 2PO4A 2XEXA 2Z4PA 3K5PA 4NOHA 3ILJA 4OZ2A 4JI0F 2E5IA 1F5BA 2W2PP 4MFBA 4OX8A 2EFPA 1NJXA 1N6QB 3N5BA 4HI1A 3M32B 4UUXA 2WW8A 2ZBCA 3PO4A 3EUNA 4ID5A 1IKXA 1X9WA 4KIAA 5I3QA 1R8BA 4GC7A 1RGVA 4B3SJ 3L7OA 2FIUA 1Y10A 4ZP6A 4HT7A 2R2UA 1UAWA 2GX8A 2CXEA 3TVZA 5HL7Q 3G5OA 2PN6A 4EYHB 3IWXA 3ITHB 1RAGB 1U2FA 1FFSB 2CRLA 2U2FA 5K8NA 5ITHA 2ZD1B 1KHVA 4U6PA 5EDWA 3OTOJ 4ER8A 1YK9A 4LRFA 2MQ8A 2H54B 2GVZB 1TQLA 2PC6A 2HAFA 3UCZP 2E9TA 4NPOA 2PD1A 4LF6J 2G9OA 1RBOB 3V4IB 2ACMA 3FVYA 1GMWD 1JLBB 4IG0B 5IQQA 2QA4S 1FRIA 5A8KB 4ED3A 3W8PA 2HQFA 2Y8WA 5G0RA 3V2UC 4C0OC 3R2CJ 2OPSA 4DPWA 2CQIA 2OEKA 4FNIA 5BR8F 3IRWP 1KLMA 3BGRB 2WK4A 1JQGA 3QSYB 3NNCA 2PA3A 2DGQA 3TX8A 3OXFA 2ZJRQ 1YSJA 2JNJA 2BZ2A 1BXNA 2KL8A 4M1KA 4NMLA 1WEXA 2OH2A 3MCMA 4DFMA 2P8IA 4HVZA 3KLIA 1MU2B 4ID8A 4NLPA 4URQU 2H65B 5ETPA 4U8YA 4GMKA 3PW5A 1KRPA 2R7TA 2JHEA 3TUJC 4DXLA 5KT7A 4QQBA 3SZ2A 5H9EK 2ERRA 1NKBA 1IBMJ 5KOWA 4TY9A 4FPRA 2JSXA 1WC5A 4UQGA 2ZH6A 3NS7B 1T9VA 1RBLA 1S9EB 4NCGB 1L3UA 1BLUA 2VFRA 3DLHA 2HHTA 1HA1A 2KJVA 3I82A 3OTEA 2ZHAA 1M0SA 1MG7A 3PIOQ 4DQQA 3KLHA 3A8KA 2EKNA 1XJWB 4C0HA 4DU8A 4WFYA 1SL0A 2DGVA 2CNOB 1GTHA 4DN0A 1F3FA 1Q8BA 2MJNA 2H5JB 4WFZA 5FLXY 4IR1A 1O5JA 4MK9A 3VAHA 4AUKA 2L48A 2XMTA 5L9XA 1Q16A 2D69A 3UD4P 1ZPVA 4I7FB 4DPXA 2BXJA 1RCOB 2NLWA 3ZZPA 3BDEA 3PRDA 2YWEA 1K9MT 4KHPJ 2W24A 1ZS6A 1OSCA 2CG8A 4DV4J 3W62A 1S1UB 2DJWA 1N48A 4XIUA 2FY1A 2Y0SD 3IS9B 4K59A 2LEAA 4OHWA 4F0HA 2KFZA 2FHJA 4W90B 4C97A 2CJBA 4DG1B 1WF1A 2AWZA 3HFKA 3EVWA 2V8VA 3NGTA 2WAQD 9RUBA 4LF7J 5E3QA 3NO7A 2NPIA 3CGIA 4LRDA 4NL5A 3CJ5A 4DPTA 2KFYA 4B3MJ 1U6ZA 2R2TA 3QFHA 2DGTA 5KFQA 2DO0A 2DHHA 4ZVGA 1O8BA 4IOBA 3UDEA 3PR5B 1GFWB 3OUYA 3MUVP 2X3DA 3M9MB 1X5OA 4QOTA 5EHHA 1IKXB 3HHLD 3G8QA 3DKDA 3V5RA 3P6YC 2YWHA 3D66A 1K1SA 4I6YA 3SCKE 2MQPA 3KYLA 1AW0A 3H4BA 4HDGA 3KJVB 2PA8D 1HNZF 1SPBP 4OL8A 4HEA9 1B0TA 1CJTA 3A8EA 5LXYA 1NKCA 4WXOA 3EZ5A 1NK6A 4LFCF 2BRKA 1N36J 2K3KA 4B9SA 1S1WB 4IOAQ 4NZ0A 1HNVA 2ZOMA 2IBOA 3A3OB 2O3DA 3J7A1 2QSFA 4C0BA 3MD1A 4LR7A 5J1EB 5CZXA 5CD4A 3GIMA 1RT5A 2DRBA 3RR8A 4DV5F 3CJ3A 1EKSA 5EX0A 1SL1A 2NYHA 3VHQA 2YQ1A 2B6AA 5GADI 4DL0C 3OVSA 4DWIA 4LRBA 1RP5A 4V19J 2DPIA 1VK8A 2GIRA 3O1LA 1IXKA 1S9GA 3IBCB 2WSFC 4PKDB 7FD1A 4JV5F 1BD6A 3S6EA 4EMDA 4R8UA 4ELUA 2KXHA 1M5SA 1RADB 1RT5B 1SUQB 2XTJP 3DGPB 1X9MA 3S7RA 2OTJS 2M5YA 3GV8B 2NXNA 4YFUA 2HG4A 1H72C 3I5CA 1GXTA 2ZFHA 1X7VA 4OI6A 3AOAA 3BQ1A 4YHHJ 4FF2A 1YIJS 2V4QA 5KFLA 4WWSA 2HGNA 2H51B 2ADBA 4DOZA 3US5A 2ZNYA 2A18A 2FHMA 1AXQA 3VVTA 3KNAA 1HWUA 4ECRA 4O3SA 1OQ3A 1BDTA 1KR4A 5LMUJ 1KC8T 1AA1B 2FD2A 2GQ2A 3CCTA 4M63A 5KFTA 3T1HJ 2CQGA 3FNNA 1VQSA 5I3UB 4WKRA 1C0UA 2PEHA 4OJ3A 1FFWB 2BJEA 1J5OA 4OJ1A 1VQPS 2VDHA 4BDPA 2BQRA 1N54B 3C14A 3MAAB 3KG1A 2UVUA 3L7UA 3R1LA 1SC6A 2D3UA 2FHJD 4RUHA 5J2QA 1VQLS 1MROA 2VH7A 3DLEA 1I3OB 2X1AA 1L5UA 4F25A 4XO0A 1SKRA 1XMBA 3BM7A 2DYAA 1R8PA 3L95X 4OV1A 5ETTA 5C24B 5I42B 5GAGI 1NK0A 1T7PA 1FDBA 1YRUA 2HNYB 2ZH2A 1FTCA 2CQPA 3D0HE 1GT8A 2W8KA 3Q8YA 2ZM6F 1R31A 1CC8A 2R7XA 3MWBA 4ZLPA 5K20B 1RB0A 4LIWA 2MQLA 2AGOA 1UCNA 2ADLA 1VCTA 1VRTB 1FA0A 3IGNA 4TY8A 3JSYA 4HH1A 4O44A 3T1YF 2V9WA 5DDOC 4TKTA 1LV5A 2JJ4D 3HKZD 4OMFG 4O3QA 2WVEA 4JI2F 3UR3C 1WG5A 5DZ7A 4KKOA 2H3AA 2XCAA 3QIDA 4Z7CA 1LXNA 1S4EA 2FGCA 1IBKF 2P6TA 3DC2A 3R5BA 4BBYA 1RBAA 2M8HA 1JLAA 1RAAB 3M8QB 2GC8A 5M2RA 4CTAA 2XSJA 2BW2A 5ETNA 4FYDA 1ZOTA 2ZOGA 2XM3A 4IOCQ 3JYTA 1VQNS 1UFKA 1S1TA 2HNZB 3ADAC 2CJQA 4K50A 3EZOA 5E33A 4C8MA 2L9WA 2N3LA 2FHKA 4MKVA 2DB1A 3CUNA 1QSYA 5DG8A 3HVRA 3HPOA 4F02A 1XR7A 3LP2B 2DH8A 3MD3A 2C42A 4MIBA 4KBIA 2AYGA 2V4RA 4PABA 1S6OA 4ECQA 2OPQB 4F8RA 3AY0A 1Q7LB 4OYZA 1PG5B 1WDDA 2WOMB 3I87A 4LR9A 3KLIB 5IV3A 2VKZG 4CIOA 5E5NA 4ZVRB 3H40A 1ITPA 2ZZTA 2KG1A 3DMJA 2KG0A 1TR0A 5ETSA 2FJVA 5EGYA 1UFWA 2YKOA 4B3RF 3KKFA 1VRUB 5J2MB 1OWXA 2GA7A 3CJ8A 4IFYB 4I67A 2DEJA 2EXUA 2RS2A 1QE1B 3ZZ0A 2HURA 1X4EA 3KLVA 1IM6A 1U6FA 1S10A 1CPZA 2RSQA 3FCVA 4Q7AA 3W8GA 4NWBA 4LF4F 5JXSA 3QT5A 2BR0A 2AY0A 2KRBA 1P6TA 1LWXA 4K2JA 3NRBA 3RW6A 1U7LA 2V2ZA 2VU5A 4ZP8A 3OVAA 3PFOA 5AXNA 2C3PA 1KDNA 2AYMA 5AE1A 4ED5A 3T6BA 4J5OA 2VG7B 4AYBD 1J5OB 3KDOA 1QM9A 1CLFA 4KQZA 4ICLA 3MZIA 1BUXA 1HBUA 2IJFA 4DV2F 1H7XA 1R27B 3Q83A 1XTZA 4YR2A 2ZH9A 5F3ZA 3D1QA 3EXYA 4RUBA 4WPAA 2DGWA 1G4CA 1HW9A 1V3ZA 4OV6A 1WHYA 2MSTA 3C16B 3ISND 2R7OA 4QYZJ 4CLWA 3A3PB 1FDNA 1NSPA 1S1TB 2HNZA 3W7BA 1SCJB 2IAJB 1WKKA 1BWEA 1C2PA 3MAAA 2Y1JA 4C3KA 1LW2B 3RRHA 4KAIA 1S57A 1X5PA 4USJC 4RW4B 4GKKJ 3B54A 3LQVA 4LREA 3UO0A 3D3BJ 1S0MA 1WJ9A 3VALA 3RB6A 4J9SA 1T9XA 2RJZA 2ZE2A 2OPSB 3ZTPA 2J0SD 4WIIA 1HR0F 3QIPB 1A9NB 3V6KA 1VRQC 1HNVB 3KUHA 2RH3A 1QTGA 2IJNA 3BZQA 3NCPA 3QO9B 4GRSA 1N0VC 4KO0B 5KFAA 4J9KA 1IR1A 3FEXB 1QTNB 1PC4A 3C6UB 2W7OA 4Y00A 3LTOA 1FESA 3Q8VA 4OZ1A 1BMQB 1M5VC 1PBUA 5F9LA 2OGUA 1NK9A 3IFEA 4CWBA 3D9BA 4LJMA 4J9PA 1NO8A 2CJKA 4LSZB 4M5KA 4RW9B 4X66J 3CCMS 3I31A 1BE4A 5DM6Q 1QAXA 4NCAA 4NA1A 1SKWA 2HVHA 4EBEA 2JEGA 1U9PA 4TNOA 4CM0A 3J7Z5 3MDFA 5HI7A 2PMZD 4ZHRB 5KT5A 3RTVA 1NZ8A 3OLAA 2QMXA 4X64F 1RWPB 2MGZA 1IBKJ 3ZTOA 5E2QA 2R42A 3GZ7A 4FKXA 4DQPA 4JI2J 3K58A 1KS2A 5K9FA 4ALZA 4M5DA 1X4AA 4K4TA 4K4YA 3M6XA 1YQHA 1YI2S 5CQGA 5IT4A 4F0KA 4Y0FA 4ECZA 3V6HA 1T03B 1VC5A 4H4KC 2J76E 2A6OA 5D3GB 4KGZB 4MT1A 5D15A 3GLJA 5EWEA 3M30B 3QWPA 5B0FA 4IRKA 1NHVA 1W7WA 4PWDA 2RB7A 1G6BA 3OTDA 3P4UB 4NA3A 4CCHA 1JLCA 5HQLA 4GVLA 2B51A 1HQ2A 1VBZA 4DFPA 2M7SA 5GAGU 1F60B 2QA1A 1HBMB 1XQIA 1D9AA 1ZBTA 2IM1A 3I4HX 3T5LA 1RWNB 1O6XA 2CQCA 4IQXA 4ES3A 2J6UA 3MTKA 3GJTB 4DR4F 3S01A 2ADCA 4R25A 1AZSA 2IRXA 3EGVA 2W01A 3I0SA 4LBIA 3KJFB 4I64A 2PE8A 5KG7A 2HBRB 1M5HA 2A3JA 2W4DA 4H4MB 1QE1A 4LSLA 1Q8LA 2ZKUA 2OUGA 4KGMA 4YN3B 4X4RA 2Q3PA 2VFVA 4X4TA 2Y8YA 2O1PA 1IKWB 1S1XA 1H3DA 2HHHJ 4CO1A 5FDLB 3ILOA 4HDHA 4MIWA 3WBZA 4JV5J 5G4DA 5GAHI 1D8YA 1RT1A 3TA0A 2Z56B 2WONA 3J7AN 1DTQA 2MLZA 3MUTP 3CWJA 5DDPC 5L1LA 3C19A 3PYFA 2CNKB 1WC1A 3HHLA 3RBEA 2ATLA 3VF0B 4OYWA 1YG0A 1DTTB 2XCPA 4RW9A 2R7VA 1FO1A 4ZVFA 2XY5A 2MQMA 3CDWA 1RT1B 4ZJOA 3NBPB 1SBRA 4RNFA 3GIKA 1KKHA 1KN6A 4ANDA 3WZ0A 4QBUA 3VAIA 2BMBA 3RAMA 1WKLA 4NMXA 2ASYA 1FD2A 1PYOB 2CJ9A 3FBCA 3A3NB 4DV5J 4H54A 4P52A 5L1JA 4DR5F 4LIRA 2W9AA 2VD3A 4DBQA 3TI0A 4G65A 4GO5X 1KONA 1M5OC 5HANA 5HMZA 4DQIA 2VFSA 3GFHA 1PILA 3IS9A 3MM6B 3H5UA 3NG8A 1HYSB 1VQYA 3DGPA 3LP0B 2MKHA 2RDIA 4RU9A 1FI4A 1DQ9A 1TL3A 4P10A 1S72S 1SKUB 2V5HG 2JH3A 4DS4A 2ZH1A 4F4KA 1JNRB 2HAIA 4URSA 2E5LF 4NLDA 1N56A 3UNGC 1JX4A 1J5EJ 4TVAB 1JNZB 2CAXA 2LFVA 2W25A 2C3OA 4Q8FA 1UP1A 2LU1A 1JLBA 5EUHA 3EGWB 3DDNA 3K89A 1LWCB 4DR3F 1RYRA 2HHVA 4JV0A 1UWBA 2HPUA 1ICEB 3NNHA 3NGDA 1MNEA 3RG6A 2V68A 5IZHA 1UA1A 2UVRA 2E1AA 3HT0A 4HR2A 5BYQA 2U1AA 3GJQB 3M2UB 5D4LA 3KJVA 1XR5A 3EX7B 1FWLA 2A6MA 2DITA 3CO0P 5L39A 4B9NA 1FJ7A 2OEJA 3H0PA 1HWLA 2AEFA 1UW4A 2AMCB 2Z30B 3EM1A 3CF5Q 1R0AB 4QWBA 2YKNA 2J9DE 2RRNA 4OHXA 1T11A 3RAXA 4N76A 4FYWB 3CIMA 4R5PA 2ILYA 3QLHA 4BC9A 4DSLA 2IMWP 4X84A 4OX9F 2MLXA 1MWYA 5B0GA 4MFBB 1BC6A 4USIA 2CPJA 1UVIA 1CC7A 3UFCX 1Q5YA 1XMQF 3IN5A 4EBDA 2ZZNA 2WVFA 3K2YA 4O23A 2BDPA 1ZH5A 4Y2IA 3SCJE 1SIZA 2JXGA 2Y3YA 2UU9J 1CEZA 3DI6A 1T8EA 2IVFB 1H2VZ 3LPEA 1U1KA 4ZJQA 1N5VA 3CDEA 4OLOA 4WYWA 4OHZA 3VGSA 2RNEA 5F8HA 4WFBQ 2OD4A 2ZJQQ 2AEMA 4LF4J 4DR6F 2V67A 3BGLA 3VAFA 1RKIA 1HBOA 3QAEA 2DNZA 5HBMB 2DR8A 1APSA 1NNDA 4K0KJ 1ZYQA 2NXCA 4DR2J 1F3VA 2I38A 1B99A 4C8YA 4JYAF 1DJ0A 3FQLA 4DUTA 3KMSA 1MMLA 1L3TA 1NK5A 3HZEA 2AV5A 1RI7A 3FEZA 3IAS9 4RLEA 3M6WA 1Y3JA 2MJUA 3ZNUA 1X8DA 2CDRB 4AL7A 4LF6F 2GFFA 5CABA 3W2VA 3O5TB 1CVJA 2F40A 1IKWA 3HD2A 4R0EA 3RRKA 4HKQA 2P9EA 3UN5A 4QPXA 1HIYA 4KJIA 1ZA2B 1JLQB 1HBNA 2HNDA 3AT1B 1S6PB 3POTA 4G1QA 5AXLA 4C8NA 3TZXA 4ECXA 1QAYA 1WI8A 2EI5A 2JFDA 2YQ0A 3HVTB 4ZCIA 3SFGA 2LP4A 3MMJA 4QWEA 2FVCA 1RHQB 4I56A 4USVA 3GV7B 1JKHA 4JI8F 4IFVB 4F0MA 3Q22A 4UF4A 2K7KA 1NJYA 4C3MA 2F8EX 3FC9A 3KHLA 1DHMA 1WC0A 5DRKA 1RJJA 2C2ZB 1IQZA 5F0UA 4EYIB 2Z8QA 2CPHA 3TQ1A 4DSIA 1QTMA 1PJ7A 1NBEB 4C6AA 3A12A 3J7YU 4N7TA 2MB0B 3GYGA 5F0WA 4K0KF 3SFUA 4OI4A 1A0OB 4KH1B 5L9NA 2V8PA 3PFEA 1VQ9S 1RAEB 2HKEA 2QL9B 2Z2YB 2CQDA 3K7RA 4QJVA 2BNWA 2AU0A 4HTJA 4MKBA 4JI7F 2DGOA 1I6JA 2EK1A 3PYGA 5GMDA 4U7UK 3H87C 3T1YJ 4HH0A 3R8YA 3HMJG 1QSLA 9ATCB 5HAOA 3R9LA 5KFGA 3MAQA 1DQ8A 1TKDA 4QR1A 3LGMA 2Q66A 1PKUA 2LVWA 1JLEB 4EZ9A 3BDPA 5F8MA 1XMQJ 4TQRA 3DLLQ 3AB4B 4RNHA 2MGZB 3KK1A 1W2BR 4MK7A 5KFSA 4AT1B 4IRCA 1HNXJ 1FE4A 3T9NA 1SIWA 1VR6A 1EAYC 3PRBA 3CJKB 4PPDA 2JX2A 3NWRA 4OX9J 3A8JA 3HD1A 4IFVA 2BM1A 4DV1F 2BJ8A 3MEDB 2AYEA 5A2QU 1TKXB 2LU2A 4XDDA 3M8SA 4X62F 3K0JA 1VIOA 1Y9OA 2VBWA 4NZ7A 2I6WA 4Q43A 4LFAF 2E7XA 2BNZA 4DCOB 2K3IA 1F5AA 3LP1B 1WTBA 1EX8A 2QC3A 4DUYJ 2DHXA 3CJRA 3DRRA 3DHWC 1NJZA 2IHR1 1I94F 1IBCB 4L3NA 5E0OA 1YBTA 1FD8A 2ZNZA 2QSWA 1AYEA 4TLRA 2RD5C 3OJUA 1YHQS 1Y3KA 4F36A 2JBVA 1U09A 2GVZA 3NCRA 1IJEB 1SUQA 4FDFA 2MXYA 3BF4A 6FD1A 1Y11A 3DRPB 3M8WA 1U1LA 2X51A 2IC3A 4B9UA 4KYZA 2ZH7A 2HFSA 1P9QC 3PO5A 4J9NA 4H4OA 2NS1B 3LUYA 3LOUA 4ZPDA 4OYIA 4K8RA 4X4QA 1R0CB 3N79A 2UXDJ 5DZ6A 4NI2B 5J1EA 1FF2A 2RKIB 2W2QP 3HXMA 1QLNA 2CQHA 2B9YA 2YBVA 2J8AA 5GVQA 3D2WA 1FDDA 2WSCC 3UNYA 4PG6A 2AZ3A 2L08A 4DL3A 1UPMB 3NEKA 3QRQA 3MUMP 2YKAA 2XMMA 4DLGA 1NJIT 1R8AA 2A0FB 1RA6A 2LA6A 2AZ1A 4F26A 5K8PA 4PUOB 1IBLF 3EWGA 3JSMB 1OHNA 5HJXA 1OO0B 1Q8IA 2J7KA 5LL6d 1RDRA 4ANCA 1TKZA 4EO6A 3PIPQ 5HLFA 4WFXA 2R8JA 1RTHA 2H1OE 3AOCA 2UXCF 2LEPA 3P96A 4Q0BB 3JB9k 1NRKA 1HNZJ 3D5MA 1F9FA 2DT9A 4OQJA 1U8WA 2H9ZA 3D7SB 2FB0A 1FWPA 3NCQA 4JP8A 4RJVA 4QWDA 3R5DA 1FVQA 3TJAA 2CWXA 1W26A 4KGXB 3M2UA 4M5IA 3GIRA 1H0HB 3H2VE 1YJNS 4A8KA 3W2WB 2DKOB 4DG1A 2F3JA 5C25A 3DLKB 4CH7A 3SXLA 3PRVA 2HVDA 3U1MA 2AGPA 1P1TA 4RW8A 1EARA 4C7QA 3FK4A 4PWUA 2CFXA 3TJ9A 4CNZA 2E7WA 3ZFVA 2WSEC 3LAMA 3OTCA 3IR6B 2GJIA 2ZVIA 3W9IA 1MNTA 1TVRB 1XN9A 2D9OA 2DBBA 1D0EA 2ROGA 3EJMA 4JI4F 2GMJA 2IMOA 4DUYF 1RHJB 3AJ1A 1RWXB 4IO1A 1X4HA 3UI3A 4ZPVR 2RF2B 3GR1A 5HROA 1U24A 2XSFA 1FWKA 1L3KA 3ELHA 4CYUA 3JQMA 3SSSA 3FBFA 3PX4A 1KD1T 4U9RA 1RAJA 1S76D 2UUAF 4FF1A 4QR0A 3BPDA 2YNFB 3UW1A 1R6YA 2Q2KA 1Q0NA 2HVIA 3KMQA 3NNAA 3RBZA 1NSKL 2DEIA 1OMSA 3Q8RB 4WP9A 3T1AA 2GHVC 1HHQA 3IR5B 2DR7A 4FPIA 2CADA 1E6VA 1XEZA 1BWVA 3D54A 2HSEB 2SXLA 3IG1B 2DHAA 1RISA 2VPXB 3DM2A 4P7TA 2OPRA 4RW6B 5CHCB 5J2PA 1S7HA 2RQKA 1WACA 4AXIA 3OL8A 1E6YB 2V4JB 4UQTA 2CIMA 2MLYA 3NNEA 2W8LA 1R7IA 4IDKB 4O3NA 4R0JA 1XNQF 2AP6A 4HHUA 4HV0A 2CZ9A 1N32F 2YX1A 3E51A 2C28A 2NCKL 2MKKA 1HD1A 2FVPA 2IY5B 3NMRA 1R6VA 1URRA 3N28A 3OL9A 3RAQA 1Q78A 2ZITA 1WD6A 4RBUA 2G1HA 3D28A 3DLKA 3HVAA 1AZSB 3I0SB 5L46A 4N5SA 4IH7A 3IM9A 2NZCA 2BRLA 2Y1LB 2VV5A 2CPFA 1IRQA 1OY6A 3W66A 2RU9A 3J81Y 1VHFA 4JI6J 5K5MA 2C2OB 4I2PA 4LF5F 4MAKA 1G7CB 4WE1A 1F6TA 1FK9B 1BQMB 1U1RA 1NKEA 2BANA 1WSRA 2B4UA 2Z57B 3N01A 3B4DA 3MEGA 4M8LA 4ZHRA 3MR6A 1BQXA 2VOPA 2F4VF 1B28A 2QX0A 3HHNB 4FXDA 3QGHA 4NYPA 3CB4A 2BSQE 1WC4A 2KVQE 2YKNB 3CDAA 5U47A 4C8OA 1C0UB 2VC0A 3MMAA 4KFBA 1N88A 3H42A 1LQ9A 4QIGA 4CLFA 4PG8A 4TU7A 1WF0A 1TTHB 3E8OA 2CPGA 2RT3A 4MMOA 1U0SA 4Q2LA 4ZP7A 2HMIA 3Q89A 4DMZA 1KTVA 1GAOA 3UDVA 2GHPA 2R8KA 2IDLA 4DDFA 3R97A 4FXEA 3P5TL 1RT7A 2BKNA 3THTA 4CLTA 2XGQA 1FRJA 3MEEB 3QFWA 2HZCA 2B0GA 3TAPA 1IKYB 2J6TA 1B7FA 4ZVTB 3LGHA 4NZ6A 2XULA 3PDNA 2ROEA 3SQOP 4DV2J 4K4XA 3LA0A 2UV8A 3T9ZA 2VJUA 3G4SS 3DYAA 3I9ZA 1UTAA 4L6V3 3UN3A 4EUVA 1XNRJ 2YY3A 2RF2A 2BW7A 3PM9A 1SL2A 3MM7A 3TJ8A 3CCSS 1VQ4S 5D8HB 4LUBA 3TW0A 2JL9A 4DV3F 1LWFB 4ZIWA 1T9YA 2YX4A 1SH3A 5AXMA 4UOHA 1RT6A 3C15A 2AT1B 3CCVS 3HVWA 4KSEB 2HFUA 3SSRA 4K4SA 1S1WA 3WX4A 3NS6A 2V69A 1HQEA 3DRSA 2VZ9A 1VFJA 3A1YG 1FX2A 2BKPA 2UV8G 2DXDA 2F8MA 3LGNA 3HZGA 4UZCA 4OYPA 3MURP 3TANA 1TL4A 2VJVA 3BREA 1UZHA 2GIQA 3BH6B 5DETA 1TUVA 3CW2C 1VMBA 3PHEA 3PW0A 5SUHA 3OLBA 1Y5LB 5L1KA 1Q82T 4YB6A 1OPZA 3MR7A 1GTEA 3D1HA 5DGAA 1T95A 1R0BG 5E41A 2WZ1A 3MI7X 6FDRA 3HHLB 2JLFA 3VZIA 1CJUA 2KVIA 1S97A 2V94A 1TL1B 1PIEA 2GAHC 1DURA 3RB3A 3PY8A 4X65J 1R8HA 5E7OB 3DXBA 3QPIA 3K17A 2QYCA 2NUHA 5DJBA 4ZVPB 1CULB 1WOPA 3AJDA 3RUBL 2DNYA 1S1XB 3RRGA 4F3OA 4HLBA 4PUOA 2XNQA 3GG0A 4L72B 2AX0A 2XNRA 3N0VA 2BJ7A 2I0XA 4CH0S 4D3GA 2MQNA 3GIIA 3BO3A 4KFBB 3I6PA 3QNWB 2DPJA 2K5JA 2P9CA 2VQFF 2HBZB 4WIQA 3HP6A 2BA9A 4DV6J 1S9FA 3PNIA 3KUEA 3SEOA 2HWTA 3B78A 4LBPA 2OPPB 1TFWA 1FJGJ 4ZP9A 3V81A 5AE3A 2HEKA 3ET6A 1SJFA 3K57A 2KT3A 5D77A 3PR4A 1TK8A 1NMEB 2K6LA 3W60A 3MECA 3FBBA 3IO1A 1VQMS 3KHGA 1Q5VA 3KLFB 4B9MA 2XHCA 5HVHA 4DPYA 1ROFA 4NLSA 1SH2A 2IFXA 4LSNA 4EWTA 4F04B 4EZ6A 1MN9A 2ALYB 3T5KA 2FZKB 4YY3F 3R1HA 3BQ2A 1KQSR 2W9BA 5H1SV 2XZTB 2VODA 2R4FA 2KOEA 3AFGA 4K4UA 2EEYA 2C2NA 4U67Q 3LP1A 1RHMB 2MKYA 5GMKa 3O8WA 2ZM6J 1FJEB 3TZZA 1T94A 2CPDA 4M5JA 3F0NA 4UUWA 2J9EA 1KHWA 4LSNB 3L9ZA 4ENOA 4DR4J 5K8MA 2W2NP 2NR0A 3BSCA 2WRMA 1WHWA 5B0CA 3FMWA 4NEYA 2E5LJ 5JVHQ 2GPEA 2G2OA 4JI1J 3AJ2A 4OYOA 5I3PA 3VV2B 1SIWB 1MN7A 1ULRA 3MEGB 3CJKA 2YWFA 4DUZF 2ATCB 1RCXB 2OD6A 4EK2A 2LMIA 4RUCA 1CG2A 3FZBA 2KM8B 2MDAA 3V81B 1UVMA 3BB5A 4HHJA 3SQGB 2XS2A 2WBMA 4OHYA 3BSOA 2YNGA 3EZUA 2EG2A 2UUAJ 3AD8C 1LFWA 3QWUA 3E01A 4MYUA 4Q5VA 3FDSA 3DU6A 5A6WA 2JEJA 2F4FA 4X4OA 3V4IA 2H5IB 4FS2A 5AE2A 3GYNA 2D41A 1RT6B 2MZSA 4I68A 5F41A 1JLAB 1DQAA 3M8QA 4IYQA 4MKAA 4WXWA 4ZCKA 5J2NB 2CWKA 4K4WA 2OIHA 4F67A 2PMWA 1FXDA 1K44A 2IRYA 2EG1A 5AJ3J 2DNPA 3CCZA 1P1LA 1RTJB 4QIVA 4IO9Q 1MMDA 3GTYX 1K73T 2CDQA 1YZ6A 2JC1A 3BN4A 1VK3A 1WWHA 2DD8S 1C1CA 4JOUA 5M2UA 2RMLA 2MY7A 4LT6A 3ETOA 1RTHB 3F41A 5LOQA 3FGVA 1RWOB 3M9NB 1HNXF 1NEEA 3LO3A 4YB7A 4YDXA 5E3CA 3TP2A 4DHVA 5JJBA 2B8PA 2JLGA 3PACA 1E6VB 2Y1RI 2ZBQA 3OR1B 2KU7A 2M9KA 5F8NA 2IA0A 3EPIA 1XNRF 1YBUA 2V2QA 4NCGA 3HULA 3HSZA 4KR0B 4QW9A 4UOFA 3PW4A 4PQAA 3L3CA 4O3RA 1IN0A 4ZLLA 1HI0P 4NLTA 2YH1A 2ZJPQ 1ZTTA 2OKQA 3I96A 3NWGA 3V4MA 3W1YC 2LCWA 3TZWA 3Q0AA 4KPCA 1D9FA 2UXBF 1EQ0A 2YWWA 3RJMB 3OVBA 2VA2A 1FDAA 2WW4A 3D6FB 2YWGA 3N6MA 4BWJA 2M4MA 2EPIA 2D1CA 2A2DA 1U0HA 2K06A 3IRXB 5T14A 2GCFA 3M05A 2X7IA 2MHEA 1WHXA 3NL0A 3ZO7A 3CJQA 5D4PA 2FYXA 2HVEA 4CDIA 2R8GA 2OEMA 2VPZB 3QSIA 1TAUA 1B0VA 1AROP 1MLAA 3ZZOA 4DR1J 4CRJA 5L38A 1WOSA 3IR7A 4KO0A 2UUBJ 4LBHA 3MEEA 1VJWA 2DO4A 1URNA 2N7YA 5CA5A 4EBCA 3DCAA 3DRRB 2R7SA 4C8LA 4MIAA 2IA6A 2YNGB 1FFGB 1S99A 4HTIA 3H20A 4X64J 5DGBA 2ZD1A 4A8QA 1JWWA 1FVSA 2DY9A 4GVBB 1GXLA 3MM7B 2F5GA 3MCOA 3VTIA 5LJ3Y 2Q6BA 1DTTA 3MPDA 4RR5A 1LXJA 1SV5B 4Y65A 4LQ9A 2YH0A 5F8IA 2VHGA 1Z2LA 4EFAC 3DM2B 4ATNA 1TKZB 5HLFB 1ZPWX 1IKVA 3T41A 3SV3A 3QZ8A 3C3LA 1F0XA 1Q8KA 2HRUA 4WE1B 3WIVA 1W25A 2QRRA 4MTPA 1JLGB 1LWEB 3PG9A 2BABA 2FJDB 2HFOA 5KT6A 2UXDF 4AQYF 2PFFB 3PJ9A 4A48A 2G0IA 1L3VA 3RBXA 1JMTA 3CCWA 4HACB 1OJ4A 3VAGA 3CCES 3KLEB 3CTRA 5HVFA 1EHWA 5IQ6A 2XSJB 4ELVA 3KJQB 4U8VA 3HX9A 3K5LA 4J9VA 1X4DA 4J9OA 5HROB 5CYMA 2VUGA 3PEHA 1C1CB 2C3UA 4B3MF 2HHQA 3KOAA 1X5TA 2VBXA 4H4OB 3G6ES 1XR6A 1Y4ZB 4PXEA 4FVCA 2XWYA 3I56S 2BM0A 1R3NA 2DXEA 2A2CA 2IDEA 3PYEA 4ED2A 2Q1LA 3W65A 5C2CA 3ZXWA 3GJSB 3EPGA 4RW7A 2DIVA 4ES2A 1S12A 1EETA 3BPSP 5IV4A 1OS5A 4YB5A 2RDDA 3CD0A 3KLHB 3G9CA 5HQMA 3H59A 5J1NA 4Q2MA 4YQWA 1WELA 2CQBA 3D4JA 4ZN1A 3SV4A 2B4OA 1TELA 1H38A 4YP3A 2J9CA 3CDUA 1NLAA 4FKYA 1N5SA 1K0VA 3OTOF 4EO8A 1E6YA 3AH6A 2VIHA 2DNMA 3ILIA 2PIIA 4QYZK 4Y28C 1FERA 2QYGA 3OJSA 3NAHA 3P3DA 3IA0A 2LQ5A 1XIQA 1YWXA 4CLLA 3JTOA 3THPA 1D1UA 4M5GA 3KK3B 3GB0A 2JDJA 4IH6A 4ZPCA 5H9FJ 1HMVB 3M8PB 2K1RA 1M90T 3C8YA 5IOLA 2DVIA 1S6UA 4RW8B 3PZPA 2FVQA 3QZ7A 3AQOA 3M6VA 4X4PA 2IVYA 4ZVSB 4I6AA 2AW0A 3VR1A 1H98A 3D0GE 3FMBA 3GG1A 4LF9F 3PKMA 2GS8A 2KKEA 1UEUA 1CJKA 3MECB 3D0IE 2MHNA 4K4VA 1VISA 2C22A 1OSDA 2B4PA 2QJ3A 1WHVA 4LMZA 4QCLA 2R7UA 1MYLA 2E7VA 3IM8A 2ALZA 4FNHA 3Q8PB 3BO2A 1LNQA 4U96A 2XO7A 3BO4A 3T5HA 2ZHBA 4PRFA 1JKHB 1FRXA 1RAFB 5BYRA 4B9VA 2BJ9A 1V3RA 1LW0B 1Z4UA 5KFRA 4O4GB 2FVSA 2IM3A 3M4XA 3ISNC 1X9SA 2W9CA 1Q53A 1HHSA 1U6BA 2QFJA 2HK3A 4PAAA 5LMUF 1LWEA 2E5GA 3MEKA 1XNQJ 4AFFA 1VBXA 4K7QA 2XYPB 1S77D 1S4FA 3QLHB 3MXHP 2B5JA 2GMHA 3ETMA 3T19A 3W61A 1R8CA 3H98A 2GAGC 4LFAJ 1EQMA 1JJ2R 1P9YA 2CJYB 2BANB 1FKPB 1J27A 1DY3A 3JSMA 1HBOB 1ZA1B 5HBMA 1U48A 3U27A 3V6DB 4A8FA 3OL6A 3CCJS 1N5TA 3LP0A 5CCMA 1DAXA 2J9DA 3SDEB 1ZM3A 4NRUA 5AXKA 3WIUA 4AD6A 4ZMMA 2F63A 5BXIA 3OSNA 2HZVA 2HK2A 3H8YA 2M0GB 4C3LA 4B3OA 4BLGA 1LW0A 1N5QA 2HIYA 3FCWA 4ECWA 1S1UA 2R9LA 3CD6S 1YJ9S 1HNIA 2KDOA 4NEZA 3FT7A 1IWAA 2K7JA 2P2CB 3FSIA 2DCLA 2ZH4A 1Q81T 4LFCJ 2NXUA 2XS5A 2HS4A 4OYAA 2EFVA 1G3OA 1DZ5A 3IRXA 1S1VB 1C1BB 2PI5A 5J1PA 4F2SA 4TYAA 2K9IA 1S7IA 1RAOA 4ZLJA 3MEDA 3FZ2A 3TNVA 5IC4B 3W5ZA 2ZBRA 4A8SA 3BV8A 2G0CA 1TL5A 3OT9A 4FF4A 4FYXB 3AXMA 2HLTA 2R2RA 4B08A 2LXIA 2DK2A 3CT9A 1P8GA 5IT9Y 2AJQA 3PJWA 1WG1A 2QMUB 3NKYA 4P2FA 1KVJA 2V6AA 2JWNA 1D3WA 2EWHA 1VIXA 2JEIA 1S9EA 3VAKA 1VQ5S 3ONQA 3ZNJ1 5KOXA 1WC3A 1MMNA 3U7JA 4LSLB 2CZVC 1NM2A 2EK6A 2XZWA 4M5LA 5I4MA 1SH0A 2WHOA 4OZNA 2MQOA 1NDLA 2E1MC 3JYTB 5D0GA 3HF5A 2ZDPA 4DF4A 4CO4A 2D3O1 5KFKA 1NK8A 1SJ3P 1SKSA 1TK0A 1JXLA 2K2PA 2BJ1A 4P71A 3W9HA 3W64A 2WB4A 1PGZA 2OAUA 2PGCA 2WONB 3LPYA 1RZMA 4DFKA 2ZBPA 1C0TB 4CLKA 4LF9J 1NB7A 4KHPF 5KFDA 1RTJA 4X4NA 1WOOA 2B43A 3Q8QB 3KXDA 2OPPA 4ED0A 4O44B 5JUMA 2G4BA 1GEHA 2B3TB 2AJ1A 1OY9A 2LDIA 1WF2A 5J2NA 2XI3A 3PYDA 4B3TJ 5A8KA 3QBCA 2FLNA 3K59A 1NK7A 3HVTA 4B3OB 2AJ0A 1NZAA 3U1LA 2C2KB 3KDNA 4ETXA 2XB2D 3QGPA 3VVUA 2R7QA 1WKJA 3IBFB 5MLCV 4MK8A 1U8SA 3BGOP 4J9QA 1V5VA 2AX1A 2MY8A 4FN5A 3QATA 1AB8A 4RUAA 1VQKS 1WEZA 1SVDA 4I7FA 5MAOA 4DV6F 4FVMA 5HMXA 4JI5F 5IS2A 1CJUB 2BKOA 1FE0A 5KFCA 2YX7A 3CMAS 2E29A 2OPRB 2H4YB 1ZETA 1R0AA 1VC6A 3KLEA 3RBDA 5KFXA 2HW3A 3BBFA 3CJ4A 4ILMA 1S0NA 3LW5C 4AL6A 2XMKA 1S6QB 4G1PA 4QWCA 3KK2A 5DG7A 1H74A 1ARQA 2RIJA 4E0DA 4Q45A 2Q43A 5HMYA 2W7AA 2XLKA 3ZTSA 3C6UA 3B8HA 3CIZA 3KTQA 3TUZC 3UQSA 4DV4F 4ZLNA 3E2EA 2J7WA 1QUPA 4LQ3A 2OLWA 4LR8A 4OLPA 3FSXA 3IR7B 2DGXA 1YJWS 1QDUB 3F73A 4HYKA 2AYBA 3FRZA 2RHSB 3G2XA 2GJFA 2KXFA 1NPKA 5BJRA 2CQ0A 5CD4H 1PARA 3IC1A 4ZDNA 2DH7A 3UPFA 5GMEA 5KG2A 1X0FA 4ZPWR 2F7VA 3TUIC 2V8HA 3OXLA 3I5AA 8AT1B 2D74B 1N34J 2IYGA 1TL3B 1VLYA 1GX5A 1VRTA 2W1BA 1YDLA 2Z0GA 1K8AT 3EYZA 2B9EA 3HLUA 3SI8A 3VCDA 1T0TV 2JXHA 2MZRA 2DNKA 2IAJA 2VF3A 1JB0C 3BGUA 3VGVA 3MR3A 2POKA 3ILLA 2DY1A 4ZVEA 2UXBJ 3J80U 3Q2TC 4NYOA 2UZAA 4NLRA 2AKWB 2VBYA 1ELOA 3QYYA 3RYLA 3UN2A 4ZVHA 3UD3P 2WVBA 1HQUA 2A1BA 3R5CA 4O0NA 4CLPA 4ECSA 5HP1A 3ZC4A 1YKWA 1ZAWA 3BEGB 4RPFA 1TFYA 1D09B 4C11B 5F8LA 4DL2A 1HD0A 4X4UA 3R6GB 4LRCA 4OX6A 4W92B 2VG5B 3EVOA 2K29A 3F44A 2LECA 3I32A 3H5XA 2QLFB 4USKA 1XMOJ 2AJ2A 2DH9A 4BCAA 4NLGA 1XC9A 3R5AA 3M6UA 4ECYA 2M88A 1DARA 1RUSA 1UETA 2XHWA 1NJWA 1JLEA 1SXLA 4I2PB 4WTOB 2N7CA 4LVNP 2M8DB 2UUBF 4CO5A 4DV0J 2BJ3A 2DR6A 3G82A 5A76A 1EP4B 3CXCR 5C42A 1N34F 2LYVA 5L8RC 5CAAA 4CNYA 4FS1A 1EETB 2G2YA 3HDSA 1PAEX 1V3SA 3QT7A 2BE7D 1TV6A 4CQ1A 2HGMA 3JAMU 2VG7A 2FJBB 4NLQA 3VZHA 3G8SA 4KB7A 4P9SA 5KFWA 4NLVA 2L41A 3PTWA 3BQ0A 4I69A 1RXOB 4TYBA 1VYAA 1IWGA 3Q24A 2COLA 4OX7A 5IFMA 1NPPA 3Q8SB 3L4BC 2HBYB 1W2IA 3N4WA 4ETZA 2R7RA 3HJFA 5B0EA 2NQPA 1YRTA 2KB2A 3M30A 3FUYA 1A6LA 2E5HA 2FY8A 4GO7X 4N77A 3HJVA 4OZJA 5C7PA 3CC2S 3CCUS 2HS3A 3T3FA 1X4CA 3TAMA 4N56A 3H5SA 2MSSA 4F4WA 4MJKA 3T5JA 1N32J 4N8OA 2VL1A 4WF9Q 3VGTA 2KFNA 2HQ3A 3M8PA 2FPHX 5KT4A 2ASLA 4JB8B 1AT1B 1FEHA 3B4MA 3DFEA 2QFIA 3GE9A 4IR9A 2MZTA 4G3IA 5KFFA 1YJVA 1HPZA 5EWGA 2W7PA 2FLPA 2JVRA 3JTNA 4YY3J 1ZM2A 3MR5A 1KFSA 1BGXT 2HFNA 4OYBA 1FKAF 2XMAA 3GPAA 4AE5A 1FNXH 2EVZA 4E2FB 2FJWA 2UVWA 4ERDA 2QT7A 1BQMA 3AAWB 1S5ZA 4NXNF 2HLUA 1T02A 4OJGA 3QGGA 5KT2A 4UOCA 4CM2A 4A8MP 5CYQB 2J7UA 3EVMA 1A7GE 3H5YA 4OI2A 1RLDA 4ZA1A 1Z1ZA 2ASJA 3BH7B 3OFFA 1V6HA 2B56A 3D67A 2YKMB 4KE5A 5A8RB 1U1PA 3IWLA 1Q4RA 5KG6A 2UUCF 2BA3A 1FRKA 4RX6A 2M3DA 3AA9A 1HLWA 1U0HB 2HS0A 4F3MA 2MZ1A 1RTZA 4JI1F 3M2RB 1G2EA 2M2BA 1OY8A 2VA3A 3RGIA 1TKTB 2QLBB 3SIPB 2V34A 4LRAA 2QE5A 5CYMB 4EGLA 1TL7A 1ZAXA 1ZTWA 3HO1A 3HSJA 2KYXA 2VG6A 4GKJF 4ZVUB 4QW8A 3VW4A 5D78A 5DQGA 1NXIA 2DR5A 2QGFB 1IJFB 4KT0C 3EE3A 2CKWA 4P72A 3EDQB 1EP4A 3R6LB 1KEKA 4DCPB 3PW2A 1U45A 2F8HA 4Z37A 4LVOP 3GFYA 3VEAA 4YMEA 1QUVA 2OHDA 1FRMA 2CNLB 3AHPA 2XWXA 3BKFA 4NXNJ 1NDPA 5K8OA 4ILRA 5A6PA 4DX5A 4NXMJ 3O6QA 5IT0A 1GNKA 3HM9A 2GJ2A 4UY85 2HRYA 1KQKA 3DLGB 3W5YA 5FIIA 4CT8A 1F9EB 1BY9A 4PG7A 4KHRA 2I2YA 4PG4A 3TX0A 4ZITA 5I3UA 4USWA 3TZYA 3K5MA 1C1BA 2WCXA 3DOMB 3ZTRA 2O01C 2D9PA 1T3NA 1EZZB 2KHCA 1TVRA 1UEKA 2F65A 3FFIA 5KT3A 4WK1A 2IJRA 2IYIA 2M52A 3WHIA 3LF0A 4WKYA 2QN6B 1BQNB 4B02A 2CQ1A 3BYPA 4ED1A 2L3MA 4AAIA 1VQ8S 4Y3CA 5H9EJ 2QL5B 3CNQP 1MWZA 5HQ8A 1NU4A 5C42B 1QD1A 3E01B 1Q79A 3MPVA 3KHHA 4Y2CA 2HNYA 3GONA 5B0BA 2OJ3A 1CJTB 1TMMA 3FFIB 4DU7A 5BYSA 5GAHU 4DQSA 1Y7PA 1F1BB 2HQDA 1H2UX 2QLWA 3G8TA 4YR3A 3C2PA 2DISA 3MMAB 1FEEA 2JLEA 5SZTA 4ZCLA 2NUUG 1UPPA 3PX6A 1YJRA 2B7CB 2CPYA 1IUJA 2ZWOA 3AODA 1TL7B 3DLGA 3UWTA 4TU8A 3SYZA 1YITS 4B3RJ 1DTQB 1RWWB 1TKTA 3ZZRA 2K1OA 3SCLE 1M1GA 1FXLA 1RKJA 1JJCB 1S59A 3PEJA 1RT7B 3AD9C 4J7CA 2OI2A 3LP2A 3W63A 4JI8J 1FNMA 5ETMA 1KNZA 1GXUA 3F56A 3SCIE 5HP1B 3BBBA 1T05B 4F4ZA 3V6JA 4U7UD 5LXRA 4RWXA 5A8WB 4FBTA 5KFNA 3TRGA 5IXUA 2FZGB 4F2RA 2KT5A 2QV6A 2EFQA 3BKTA 3ZZTA 5HJYA 2IIHA 2QTWA 2V8GA 4KV8A 4CTAB 4QYRA 1XMOF 2CPEA 1U1MA 1YX2A 4QIWD 1N8RT 4J9RA 2IRUA 4X66F 1VRUA 1RT2A 3PW7A 4PWDB 5B09A 3VQSA 3DXSX 1SJQA 1VGYA 2ZH8A 2C3YA 4I6WA 4RBTA 4QPTA 3TVKA 3TO8A 3JQKA 3P5BP 3ZZYA 3GCXP 5KFMA 2BE9B 4YB1P 1H7WA 4PXCA 2MKCA 2OMOA 2XZDB 3IG1A 5DS7A 3CC7S 4WU2A 3CMQA 2O5DA 3M8YA 3POTB 4G1QB 1UJ6A 4PZVA 4WJBA 1X0PA 1KLNA 4J9LA 1O51A 2QZ8A 4CT9A 3MMCB 1EA4A 2G2ZA 5C24A 2GV1A 3PJXA 5KFEA 4DV7J 1NK4A 1TAQA 3HI9A 2JVOA 4OFZA 1HFEL 2VFTA 3R5GA 2L9DA 5J2MA 3PX0A 1T3OA 4NLWA 3D6TB 1TL1A 5KFYA 4V19X 1Q16B 1VDHA 3IAM9 4ZCMA 4GKKF 1N5YB 1RTIB 1K1QA 4RL1A 4USTA 4EI2A 2XLIA 2YKQA 4DS5A 3H7HB 2C2MB 2QMWA 2C2RA 3PXGa 3HSGA 3MM8A 1AFJA 3A13A 4V1Ak 4KKOB 2CPXA 3VQTA 1PCAA 1RWUA 2ZC3A 4FYVB 5KG0A 3TEGA 1KLMB 3KNGA 4LFBJ 3D3CJ 1N33F 5D4OA 1Q95G 3TAQA 4M95A 2E1PA 1OYEA 3HFVA 2G13A 1ZM9A 2XYHB 1B4SA 3UD5A 4DPOA 1SC3B 3PVXA 2YNFA 2IBKA 5GAEI 1GH8A 3DHXA 1YZ7A 3EDRB 4F4XA 2R8HA 4RW7B 3SSQA 4MYTA 1VBKA 2ZC4A 3BBCA 1RHKB 3CD7A 2DNGA 2XLJA 1F2HA 1LWFA 1WG4A 2J8SA 2W2MP 4JI5J 2FVRA 4YHHF 3V6DA 3DOMA 3K5NA 3L09A 3Q23A 1S1VA 4C48A 4FZVA 1PJ6A 2NPFA 1RT2B 3J7YI 1BAZA 2IPOB 2WBRA 4F7VA 2RVJA 4AQYJ 1UVNA 1FHTA 1KTQA 3G87A 3BSNA 4ZVQB 5RUBA 2RE1A 2UUTA 4C11A 1LK5A 5LSLA 2GO9A 5HN0A 2IM2A 4X4VA 3B6BA 5A8WA 5IC6B 2E66A 4TQSA 1NLKL 1KFDA 2LDYA 2VONA 2E1RA 2F1FA 2NYIA 3MM9B 3KK2B 3N5FA 3R2DJ 2HMIB 2B7BB 3W2VB 3H90A 3OFHA 1HBUB 3BS9A 1YLXA 3GJRB 3MCSA 1ACMB 2GO8A 4YS2A 2KJWA 4G1IA 4NX9A 5ETKA 5A2QY 3PV8A 1WNEA 5J2QB 2RDJA 4DSKA 1CS4B 2PT0A 4LF8F 2VG6B 4WZQA 1FJCA 1BHNA 1YJUA 3GWCA 4M5MA 4ED4A 3J80Y 2Z58B 2XMVA 1MYKA 2VG5A 3JTPA 3PHTA 5T41A 1SJ4P 5F3TA 3ENVA 2RILA 2QIFA 2ZOFA 1QVGR 1FK9A 2NSCA 3D6MB 3GU0A 4Y2AA 4OI3A 2ABYA 3S8SA 5DLGA 3MOJB 3MTJA 4KY3A 4ZOSA 1OQ6A 2IC3B 2HFZA 2HYIB 3H2LA 2FLLA 3KWMA 5HMWA 4W4MA 1NSAA 2QG9B 2YKMA 3KUGA 2CVIA 1NCLA 2OTLS 4B9LA 1HYSA 2OSRA 4X2BA 2VOOA 1S48A 3MM5B 1GMWA 2MZJA 4TLQA 3MFIA 2ZHOA 4IG3B 1SQEA 2GMLA 2RKIA 3BKUA 2EBEA 4NLXA 3ZZZA 4DL5A 1XERA 1NUEA 5CZVA 4DSFA 4PPZA 4K4ZA 1JLFB 5D4NA 3C6TB 4DPUA 2QLXA 3LJPA 2VFUA 3TA1A 1JJHA 5F8JA 4DI6A 2I9SA 3C14B 1S9GB 3GCWP 3R5JB 4AXJA 4U95A 3UVJA 1C0TA 2MPUA 3DMJB 2RS8A 3LALA 3NGUA 4IDKA 4J91A 2HIQA 4RKUC 2R2SA 3I9V9 4DZ6A 2HHPA 3TOQA 2FQQB 4ED8A 1IBLJ 1LW2A 4WK3A 2B5JB 5DG9A 3D68A 4ZVOB 3J81j 4DFJA 3FBEA 2ZH5A 2ZVSA 1XWLA 2BBEA 2AQ4A 1N0UA 1UKUA 3DLJA 4H4KA 5FDLA 1FCAA 3OPKA 2GW8A 4ZKAA 3R27A 1RQ0A 4DR7J 1RT3A 4RBVA 2HBQB 1RWVB 4C8ZA 1BDVA 3KK3A 4UTGA 3TWZA 4DR7F 4C2MA 3SBMA 5KG3A 3CDBA 4CYUB 4U7CA 2G1DA 2BEFA 2BE2B 1MU2A 3AQPA 1YGYA 4USUA 4XTTA 2QA4G 4JI7J 3JSBA 4IRDA 1UWAA 3DDKA 4XPEA 2HHHF 3KK1B 4EEYA 1DLOB 4J90A 4CLUA 2WTFA 3M2RA 4Z2XA 3Q8UA 4L75A 3VAMA 2GQQA 4A46A 3JAMY 1UVLA 1JJ4A 3GSIA 2OFGX 4TY8B 4ZJLA 4OZLA 4DL6A 3VAJA 2ZZMA 1WI6A 1KP6A 2BE2A 1QVFR 2DIUA 2AJ4A 4WP3A 4A47A 4F4AA 4WFAQ 1WTFA 5HO4A 2CA9A 1X93A 4DUZJ 1DRZA 4NLYA 4ILLA 3G82B 3RW7A 5EX3A 4KTQA 2K1RB 4M5DB 2YPYA 2MKIA 2YPZA 5D0HA 3TYTA 2H1YA 1Y0HA 1S0VA 3BN7A 4G6VB 1NDCA 2C1EB 2KRRA 2LQBA 4CO2A 1HKAA 1AUSL 1MWQA 3MPWA 4YDDB 3JQJA 2KH9A 3CVKA 3HHDA 2OP5A 5T7LA 2BOPA 1SC4B 3CC4S 5JVGQ 3OTBA 4RW6A 5J2PB 1VC0A 2FGOA 2YNIA 4HACA 4DQRA 5K14A 1H6KX 4O0IA 2KXNB 3SMZA 4OYMA 1D8ZA 3J81U 1T9UA 4NLOA 4USMA 3BGRA 5DDRC 1M5PC 5EWFA 1HQUB 2VKRA 1HWIA 3NLCA 3MMCA 3O44A 4L76A 5G0RB 2KN4A 2W9BB 4NCBA 1V9OA 4H4MA 4O4GA 3R3TA 3HHEA 1CQMA 3QRPA 2VASA 1FJGF 2CJXB 3W5XA 3QGIA 1OYDA 8RUCA 5L1IA 1X4FA 4WTYA 2MEWA 1RYSA 3GV5B 2UU9F 3CCRS 4JI0J 2KO1A 2QL7B 5HK4A 4AL5A 1SQGA 3FMTA 3VGUA 2GGPB 1WDTA 4PQUB 3MPUB 3NGRA 1I51B 2DNOA 1U47A 3AA8A 1Q1KA 4UT4A 1G1XA 2E44A 2LXUA 1M5KC 4YUDA 1I5OB 2BVZA 4WU3A 2RUGA 3TEHB 2JC0A 4R5PB 3NOGA 1GX6A 2CG4A 4KGKA 3GIJA 2BQ3A 4QIEA 2ZUGA 4PXDA 3M8ZA 4K5RA 4ZK7M 3MPYA 2RQCA 4I1TA 4ID5B 1TV6B 4IG3A 4IG0A 3J7ZT 1KBRA 4N8NA 1AUDA 1LOUA 2A10A 5FD1A 4X65F 1T03A 1Q7YT 3C16A 4E8UA 1RU2A 3SDEA 4CLSA 3G71S 2H4WB 1CQNA 2YWKA 5LMNJ 3I0RA 4DCJB 3CJ0A 1JLGA 1UWBB 2YNHA 4M94A 4OI0A 1IKVB 3K8VA 2JXIA 3GXQA 2WB1D 2MZQA 4PWWA 2FDNA 1FTRA 2O67A
chains in the Genus database with same CATH topology
2PC6A 1ARRA 2WVBA 2BSQE 2HZVA 1Q5VA 2AY0A 3QSIA 4HV0A 2BA3A 1MYKA 2BJ8A 1BDTA 3PHTA 2CPGA 3FT7A 1BAZA 2WVCA 3QOQA 1U9PA 2BJ7A 2K29A 2CAXA 2WVEA 4ME7E 1PARA 2CAJA 2BNZA 1NLAA 2K1OA 2BJ1A 2FGCA 4FXEA 2K5JA 2BNWA 3VEBA 1Q5YA 1P94A 2K9IA 2CA9A 2WVFA 3VW4A 1X93A 2NZCA 3LGHA 3H87C 1IRQA 2JXGA 1MYLA 2CADA 2Y3YA 1B01A 1BDVA 2KELA 3OD2A 2F1FA 1QTGA 3BKUA 2JXHA 2GPEA 2RBFA 2HZAA 1MNTA 4D8JA 1EA4A 2BJ3A 2WVDA 3VEAA 2JXIA 1ARQA 3GXQA 3BKFA 2BJ9A 3FMTA 3BKTA 2K6LA 2H1OE 1B28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PC6 A;  1ARR A;  2WVB A;  2BSQ E;  2HZV A;  1Q5V A;  2AY0 A;  3QSI A;  4HV0 A;  2BA3 A;  1MYK A;  2BJ8 A;  1BDT A;  3PHT A;  2CPG A;  3FT7 A;  1BAZ A;  2WVC A;  3QOQ A;  1U9P A;  2BJ7 A;  2K29 A;  2CAX A;  2WVE A;  4ME7 E;  1PAR A;  2CAJ A;  2BNZ A;  1NLA A;  2K1O A;  2BJ1 A;  2FGC A;  4FXE A;  2K5J A;  2BNW A;  3VEB A;  1Q5Y A;  1P94 A;  2K9I A;  2CA9 A;  2WVF A;  3VW4 A;  1X93 A;  2NZC A;  3LGH A;  3H87 C;  1IRQ A;  2JXG A;  1MYL A;  2CAD A;  2Y3Y A;  1B01 A;  1BDV A;  2KEL A;  3OD2 A;  2F1F A;  1QTG A;  3BKU A;  2JXH A;  2GPE A;  2RBF A;  2HZA A;  1MNT A;  4D8J A;  1EA4 A;  2BJ3 A;  2WVD A;  3VEA A;  2JXI A;  1ARQ A;  3GXQ A;  3BKF A;  2BJ9 A;  3FMT A;  3BKT A;  2K6L A;  2H1O E;  1B28 A; 
#chains in the Genus database with same CATH topology
 1Y00 A;  1Z2Z A;  2I5J B;  2B4V A;  5ETO A;  2J6S A;  3ICL A;  3TVY A;  3CME S;  4DR6 J;  1XBW A;  2UVV A;  2HHS A;  4DL4 A;  1HNW J;  3M32 A;  3DOL B;  2XY7 A;  2CPI A;  2NXE A;  2YNH B;  3OXG A;  5LM7 E;  2PMH A;  1SQF A;  2M70 A;  3MM9 A;  4Q8E A;  1C4C A;  2VIC A;  5FJ4 A;  2MMY A;  4TU9 A;  5IM0 A;  3CCL S;  5B0A A;  4RNO A;  3OR1 A;  1RT4 A;  4I0W A;  3L7P A;  1LWC A;  1P94 A;  2HWI A;  1EKR A;  1H73 A;  2PSZ A;  5LJ5 Y;  1B7Y B;  3QIP A;  4Y2M A;  3H2U B;  3HCX A;  4IFY A;  4RO0 A;  4Z7Y A;  4N41 A;  1MSW D;  2N4C A;  3G6V A;  2KI2 A;  4R8U B;  3EIC A;  1X4G A;  3TUP A;  5AT1 B;  2HQI A;  3DOK A;  3NBP A;  4M5N A;  3Q2S C;  3KFW X;  2GGP A;  2NSB A;  4PQU A;  2NRE A;  5CXT A;  2MYF A;  2LQJ A;  2WOM A;  1ZZF A;  1TU0 B;  2V8D A;  4FXV A;  4JI3 F;  4ZS6 A;  1UEV A;  1RTI A;  1UL3 A;  2ROP A;  3EMT A;  3IWN C;  1B3T A;  5LMN F;  1B64 A;  2CUY A;  3BSA A;  3WDO A;  1CBK A;  3AXK A;  3KG4 A;  2Y1I A;  4DR1 F;  4ITS A;  1KOH A;  3OFG A;  1KQF B;  4ME7 E;  2Q79 A;  2RU3 A;  1RT3 B;  1RSC A;  2LKZ A;  1HMV A;  1JXV A;  1X60 A;  2OO4 A;  3DNC A;  3FEY B;  3UDC A;  2XO6 A;  4DR3 J;  5DLF A;  4NE9 C;  4L3K A;  4D3H A;  3NP5 A;  2J0Q D;  1RAI B;  5H9F K;  3M1V B;  3TAM B;  1LFP A;  4WCE Q;  4ED7 A;  2E5J A;  4UW2 A;  1NDK A;  4JI6 F;  3CE8 A;  2DNH A;  5ETL A;  2FLO A;  2I1R A;  4XPC A;  3HKW A;  3MOZ A;  1RAB B;  4FP9 A;  2RUS A;  3WX8 A;  1N5Y A;  3FCH A;  3IMQ J;  2V9K A;  4GVB A;  1VQO S;  4DV7 F;  2GNK A;  2DHS A;  2PFD A;  5KG5 A;  2CJA A;  2ZBI A;  1T9W A;  1YTY A;  5KFH A;  5D0E A;  2E9R X;  5KFP A;  4W98 A;  3TAR A;  4ES1 A;  1U2C A;  3AB2 B;  3C6T A;  2DCU B;  2GVD B;  5D6G A;  2N82 B;  1PSD A;  3T1H F;  1HNI B;  2XMJ A;  1RAC B;  3S1T A;  1TUW A;  3LAN A;  1EB0 A;  2O66 A;  3TQE A;  4B17 A;  4CI0 B;  4PCQ A;  1SJ1 A;  1TUG B;  5I42 A;  3HK2 A;  3KLF A;  2ZKT A;  3AOB A;  4WBF A;  3UE2 A;  4JBC A;  1GK8 A;  2HHX A;  5C5J A;  2XC9 A;  3HHK A;  3LAK A;  2BJD A;  2GVD A;  1PYT A;  4OI1 A;  1HBM A;  4MKY A;  4OYX A;  2JOQ A;  3GP9 A;  4CH1 A;  3D1O A;  1WEY A;  1REV A;  2RHQ B;  1HW8 A;  2K8G A;  1DLO A;  3E3X A;  4DSJ A;  1TP7 A;  1GQE A;  2FHO B;  1RWK B;  1B0P A;  3QT6 A;  2HQG A;  3QJL A;  2CNN B;  1UJ5 A;  3M2V B;  4I2Q A;  5ETR A;  4CLY A;  2AHO B;  2ZUA A;  3X3U A;  2RQM A;  3K5O A;  2DNQ A;  1PAU B;  5D3G A;  4P6Q A;  2OSQ A;  2V50 A;  4KC5 A;  1F5C A;  1S49 A;  4P74 A;  5AJ3 F;  5JMN A;  1N33 J;  2EC0 A;  3ENW A;  2JEF A;  3I0R B;  2AIR B;  2B9W A;  1T05 A;  3FQK A;  4Y2K A;  3H4D A;  3JSR A;  4NAS A;  3ZZU A;  1HWK A;  1CUL A;  1UMJ A;  3GSD A;  1KOO A;  4F50 A;  3LWL A;  3FRY A;  3QO9 A;  1FXR A;  4K2X A;  3UDL A;  1VQ7 S;  1GMU A;  1KWM A;  1N52 B;  2D7S A;  5DO2 A;  4ELT A;  1WOR A;  4DN9 A;  2LEB A;  3GFZ A;  2BAC A;  1IQT A;  1Y5N B;  1XK8 A;  3DGV A;  4DZD A;  1SV5 A;  2N3O A;  2DR9 A;  4QU7 A;  3RR7 A;  3B82 A;  8ATC B;  3NXZ A;  4L73 A;  3OHB A;  2CQ4 A;  2BUN A;  3FKB A;  5GAD U;  4XAK A;  4HT5 A;  1FRL A;  1R89 A;  3UVJ B;  4A8O A;  4BHQ A;  2IVM A;  3GFX A;  4I4B A;  1PJ5 A;  4USH A;  1LK7 A;  4KRW A;  2XYG B;  5KFI A;  2RRB A;  1REG X;  1NH7 A;  2W4P A;  2LXF A;  3R7S B;  3KHR A;  2EKY A;  3MM6 A;  3DI6 B;  4Y6I A;  2EFN A;  4URG A;  4WFN Q;  3KLG A;  1F2G A;  1HQE B;  3DRS B;  1HL6 A;  1SC1 B;  2OFH X;  2ZEJ A;  1VJQ A;  5B7W A;  7AT1 B;  2H3E B;  2E9Z A;  3MM5 A;  1RT4 B;  2HWH A;  2CQ3 A;  2Z2M A;  3GMG A;  2H5E A;  4WYL A;  4CO3 A;  3CUL A;  4J9M A;  2VDI A;  4LRV A;  4PR6 A;  2AGQ A;  4NRT A;  3IBW A;  2YKP A;  1NAQ A;  3FSY A;  3TR5 A;  2YNI B;  3DRY A;  2BOA A;  3GYX B;  3OD2 A;  5CH7 B;  4GC6 A;  1PO6 A;  2EFO A;  3P45 B;  3HT3 A;  4D8J A;  4Y34 A;  2WVD A;  3RB4 A;  3CPW R;  2FZC B;  4TN2 A;  1N36 F;  3NGS A;  3MGJ A;  1VLO A;  2Z2L A;  3BJY A;  1CS4 A;  1U4B A;  1RTD A;  1ZZN A;  4FBU A;  3CO9 A;  3QJJ A;  3CJS A;  4WP8 A;  5KFJ A;  1REV B;  3O2I A;  1DFD A;  1YBA A;  2LQ8 A;  1FKO A;  4BC7 A;  4PEO A;  1LEO A;  1SB6 A;  4CP5 A;  1ZM4 A;  1EJ7 L;  1I1G A;  5IWA J;  2AJF E;  1JIH A;  2FC8 A;  2JRS A;  2G0J A;  2VQF J;  1HAR A;  2W9C B;  2KYZ A;  2A2B A;  3IXQ A;  3A4T A;  1JXE A;  3TA2 A;  4ANE A;  4OZ5 A;  4GKJ J;  3BYR A;  4NLU A;  3QMQ A;  4F3Q A;  1PBA A;  2MQQ A;  2KHD A;  1OIA A;  5IT9 U;  1K47 A;  2ILZ A;  4LF1 A;  3GIL A;  4OZ3 A;  3Q86 A;  1IBM F;  2HGL A;  4M5H A;  6AT1 B;  4IUF A;  3NAI A;  4P7V A;  1B01 A;  1X5S A;  2CYY A;  3HHL C;  4DJB A;  5B0D A;  4ECV A;  2DNN A;  3G96 A;  3ET6 B;  4B9T A;  4JUZ A;  4LF7 F;  1YRX A;  3NY0 A;  4QR2 A;  5F8G A;  4L74 A;  2B6A B;  5LT5 A;  3OBI A;  2AEJ A;  4DX7 A;  4A4J A;  1IM4 A;  4NYZ A;  2P9G A;  3OSP A;  3UCU P;  4ZN3 A;  2HFV A;  3D6H B;  4Q44 A;  4DL7 A;  1RA7 A;  3QRR A;  4HHH A;  3M7V A;  1HHT P;  2KM8 C;  1TK5 A;  4UY8 T;  5LSO A;  3T6J A;  3BR9 A;  4PXB A;  1U26 A;  2AN7 A;  1JLQ A;  3UR0 A;  1HBN B;  2H48 B;  2HND B;  4ZIV A;  5CYQ A;  2KTQ A;  3C66 A;  1VS3 A;  2DNL A;  3OR2 B;  2V2V A;  1QJH A;  3ZTQ A;  5ADZ A;  5F9N A;  3PKY A;  2BX6 A;  3MFH A;  3G6Y A;  4QZV B;  2DRA A;  1S6Q A;  1TMJ A;  2EBG A;  3VEB A;  2YVS A;  1D9D A;  2XG8 A;  4KHM A;  5E3P A;  3U1N A;  1CJV B;  1IR2 A;  2CQ2 A;  4X4S A;  1TKX A;  3MAH A;  3P8B B;  3EXC X;  3C46 A;  5LSR A;  3IGV A;  2KT2 A;  3OFE A;  3OUY B;  3CSK A;  2PEB A;  2BV3 A;  3JS9 A;  1U25 A;  3RB0 A;  2FUG 9;  1IR0 A;  1CJV A;  1Y5I B;  2OPQ A;  4O3O A;  3G6X A;  3GR0 A;  2DXF A;  1U1O A;  2E1C A;  2YQ3 A;  4B3S F;  5M2P A;  5KTQ A;  3CJ2 A;  4NXM F;  2J0X A;  2MTL A;  4DLE A;  1UJ4 A;  2GIF A;  2ZDO A;  2C2D A;  2X1F A;  4HL9 A;  2L9N A;  3CED A;  4LFB F;  2YXL A;  1VOM A;  4ZPT R;  4UZB A;  1HI8 A;  4ECT A;  1R43 A;  3KLG B;  2J5A A;  4PYD A;  3NGK A;  3LWM A;  2DTJ A;  3M9O B;  1U1Q A;  1U49 A;  4DX6 A;  1RU1 A;  2FJE B;  4J37 A;  1WSV A;  3KG0 A;  4WZM A;  4XK8 C;  2W2O P;  4IKA A;  4FXW A;  3MMB B;  2UP1 A;  2OEL A;  1GMV A;  2V2K A;  3JXO A;  5BR8 J;  2KZM A;  2RAQ A;  1FKP A;  1MRO B;  1JLC B;  5KFO A;  1LKZ A;  2RBF A;  1U2R A;  2EW9 A;  3DYA B;  4RWW A;  3HSD A;  2V4J A;  5E3A A;  3ISZ A;  2F4V J;  4YOE A;  2GQC A;  4KV8 B;  1FX4 A;  1KVI A;  3WC2 A;  4J9U E;  1IKY A;  1M1K T;  4CZC A;  1RWM B;  5HSP A;  3M1V A;  1UVK A;  4LF5 J;  3CJT A;  3W2W A;  5C25 B;  2XQC A;  3THV A;  3DRX A;  4FYY B;  4JI3 J;  2VBZ A;  2HHW A;  4P2M A;  2I8E A;  4P2S A;  2WVC A;  1FRH A;  5HAT A;  5DM7 Q;  3QOQ A;  1FKO B;  2DRD A;  3O3L A;  4DR2 F;  4RNM A;  1VBY A;  4JYA J;  2CAJ A;  2QLJ B;  4ICL B;  5KAK A;  3FJ2 A;  2DNR A;  4PYA A;  1VQ6 S;  3C15 B;  2B8Q A;  2KZZ A;  5KFV A;  1RE1 B;  2RRA A;  2EFG A;  3M2V A;  1NH8 A;  3PCO B;  3CD5 A;  4I2Q B;  1NSQ A;  5KFZ A;  1RK8 A;  4F4Y A;  2KEL A;  2C3M A;  3UCG A;  1EIY B;  1VI7 A;  2CZ4 A;  4LF2 A;  3MF5 A;  4IH5 A;  1PC5 A;  4A8W A;  2B9X A;  2FC9 A;  3OL7 A;  5EN1 A;  4BS2 A;  2X1G A;  1UZD A;  3DRP A;  4JV2 A;  5A8R A;  1JLF A;  3W3S A;  1SJR A;  4DEZ A;  4DSE A;  1Q86 T;  5THW A;  4OZ0 A;  1UA0 A;  5C2G A;  1P27 B;  3DU5 A;  3I4P A;  3MR2 A;  3P49 B;  4FF3 A;  4NA2 A;  1KVK A;  4KGV B;  4C8K A;  4OIX A;  1DBD A;  4NI2 A;  4MJW A;  2ZE2 B;  2JZ5 A;  1FNO A;  3M8R A;  3DN9 A;  3SQG A;  4TXS A;  1T9T A;  2AF6 A;  2Z2Z A;  4YR0 A;  2D3O R;  2CVE A;  2HRT A;  4B3T F;  4BWM A;  4PG5 A;  4RU2 A;  3OW2 R;  3LH2 S;  2N4D A;  2C2E A;  2QEX S;  4JI4 J;  3ENQ A;  4DX8 H;  3MM8 B;  5FLX U;  2R8I A;  2FJA B;  4UOG A;  4CLZ A;  2Y9H A;  3QJP A;  2HZA A;  2VQE J;  4QWA A;  4S0M A;  4ZPB A;  4ZPA A;  1ZAV A;  1S79 A;  2OML A;  2DHG A;  5DQH A;  1QAI A;  3R7N B;  1JK9 B;  2JFK A;  4P2X A;  3N6L A;  3MCN A;  1X4B A;  2XMW A;  5KFU A;  2RQ4 A;  4RZR A;  1HR0 J;  1M1H A;  2LQ9 A;  3BGF A;  2LA4 A;  5IWA F;  3OHA A;  4MH8 A;  2Y0B B;  1J5E F;  2LLZ A;  5B08 A;  1VHI A;  2FJX A;  1KSP A;  5GAE U;  2IM0 A;  1O0P A;  2V0N A;  2UUC J;  2XBP A;  1QY7 A;  2ZH3 A;  4QIF A;  3H25 A;  2J0W A;  1X31 C;  1KQG B;  2NXJ A;  3R7B B;  2EC2 A;  4P73 A;  3K8W A;  5T7L B;  1H2T Z;  1QAJ A;  2F9J A;  1QSS A;  1TZ0 A;  3NS5 A;  2CPZ A;  1YVF A;  5KG4 A;  3GQC A;  2VPW B;  4C9D A;  1WC6 A;  5E3R A;  2UUW A;  2MKS A;  5ETV A;  2KKH A;  4C98 A;  4JV1 A;  1PYS B;  3IP0 A;  1CSJ A;  3MMB A;  5KG1 A;  4IQM A;  3ULH A;  3KJN B;  1HNW F;  2DGU A;  2ACY A;  1CJK B;  4DR5 J;  4N47 A;  1U1N A;  2UXC J;  4LF8 J;  2P6S A;  4OJH A;  5ETQ A;  1ARR A;  1UFL A;  2QO3 A;  3N9U C;  3EGN A;  3X1L B;  2GHW A;  2XGP A;  3MHY A;  2HQC A;  2VB6 A;  1V5I B;  5IM0 B;  4DF8 A;  2D3Z A;  4QU6 A;  1SI9 A;  1UW9 A;  4CO0 A;  1RAH B;  1NHK L;  3HFZ B;  3DLE B;  2ASD A;  2VPY B;  5K14 B;  2GZO A;  3EGZ A;  5A0Y B;  4ED6 A;  1L3S A;  1UVJ A;  4P75 A;  2I5J A;  1OPI A;  5DQI A;  2APO A;  2XY6 A;  1IVZ A;  3U02 A;  2HHU A;  2FTR A;  2X1B A;  1HPZ B;  5HVG A;  4KH0 B;  4YEA A;  5A0Y A;  1YJT A;  4OHV A;  3DLB A;  1AFI A;  2PI4 A;  1I94 J;  2X3G A;  3CCQ S;  1FT8 A;  3BR8 A;  1U02 A;  2R3V A;  4A8Y A;  2P5V A;  1HWJ A;  1HI1 A;  2XI2 A;  3OR2 A;  4A8X A;  4E98 A;  1NB2 A;  2XMU A;  3I5B A;  2NZ4 A;  1N4L A;  2HVZ A;  3WC0 A;  3OV7 A;  2VQE F;  2BQU A;  3NOC A;  4XDC A;  2AD9 A;  3QT8 A;  5CCL A;  1BQN A;  1NHU A;  3A8I A;  3WQP A;  4O3P A;  2F9D A;  1C4A A;  4K5S A;  3I55 S;  5CYJ A;  1S0O A;  2V63 A;  4DV1 J;  3QQC D;  1B70 B;  3W9J A;  1YJ7 A;  3OQ2 A;  1WUU A;  1J2V A;  5D0R A;  3ENA A;  7FDR A;  2VC1 A;  2XS7 A;  2BYC A;  3ITH A;  4X62 J;  4DV0 F;  3DDI A;  3DOK B;  3DOL A;  1OG7 A;  1MW7 A;  4RW4 A;  3N6N A;  2Q6C A;  2W4C A;  2DGS A;  5DDQ C;  1K0T A;  1RLC L;  1RHR B;  2YTC A;  4RNN A;  1NPR A;  1RHU B;  3QAU A;  5KFB A;  4Q0B A;  4DV3 J;  4C4W A;  3G86 A;  3NMA A;  2PDA A;  2ZWP A;  1RTD B;  1N6Q A;  4ECU A;  1S6P A;  2R7W A;  1F9H A;  3RZA A;  3AD7 C;  4KPY A;  4HI2 A;  4EU0 A;  2QA2 A;  4O4R A;  3RU0 A;  3VWS A;  2MKJ A;  2PO4 A;  2XEX A;  2Z4P A;  3K5P A;  4NOH A;  3ILJ A;  4OZ2 A;  4JI0 F;  2E5I A;  1F5B A;  2W2P P;  4MFB A;  4OX8 A;  2EFP A;  1NJX A;  1N6Q B;  3N5B A;  4HI1 A;  3M32 B;  4UUX A;  2WW8 A;  2ZBC A;  3PO4 A;  3EUN A;  4ID5 A;  1IKX A;  1X9W A;  4KIA A;  5I3Q A;  1R8B A;  4GC7 A;  1RGV A;  4B3S J;  3L7O A;  2FIU A;  1Y10 A;  4ZP6 A;  4HT7 A;  2R2U A;  1UAW A;  2GX8 A;  2CXE A;  3TVZ A;  5HL7 Q;  3G5O A;  2PN6 A;  4EYH B;  3IWX A;  3ITH B;  1RAG B;  1U2F A;  1FFS B;  2CRL A;  2U2F A;  5K8N A;  5ITH A;  2ZD1 B;  1KHV A;  4U6P A;  5EDW A;  3OTO J;  4ER8 A;  1YK9 A;  4LRF A;  2MQ8 A;  2H54 B;  2GVZ B;  1TQL A;  2PC6 A;  2HAF A;  3UCZ P;  2E9T A;  4NPO A;  2PD1 A;  4LF6 J;  2G9O A;  1RBO B;  3V4I B;  2ACM A;  3FVY A;  1GMW D;  1JLB B;  4IG0 B;  5IQQ A;  2QA4 S;  1FRI A;  5A8K B;  4ED3 A;  3W8P A;  2HQF A;  2Y8W A;  5G0R A;  3V2U C;  4C0O C;  3R2C J;  2OPS A;  4DPW A;  2CQI A;  2OEK A;  4FNI A;  5BR8 F;  3IRW P;  1KLM A;  3BGR B;  2WK4 A;  1JQG A;  3QSY B;  3NNC A;  2PA3 A;  2DGQ A;  3TX8 A;  3OXF A;  2ZJR Q;  1YSJ A;  2JNJ A;  2BZ2 A;  1BXN A;  2KL8 A;  4M1K A;  4NML A;  1WEX A;  2OH2 A;  3MCM A;  4DFM A;  2P8I A;  4HVZ A;  3KLI A;  1MU2 B;  4ID8 A;  4NLP A;  4URQ U;  2H65 B;  5ETP A;  4U8Y A;  4GMK A;  3PW5 A;  1KRP A;  2R7T A;  2JHE A;  3TUJ C;  4DXL A;  5KT7 A;  4QQB A;  3SZ2 A;  5H9E K;  2ERR A;  1NKB A;  1IBM J;  5KOW A;  4TY9 A;  4FPR A;  2JSX A;  1WC5 A;  4UQG A;  2ZH6 A;  3NS7 B;  1T9V A;  1RBL A;  1S9E B;  4NCG B;  1L3U A;  1BLU A;  2VFR A;  3DLH A;  2HHT A;  1HA1 A;  2KJV A;  3I82 A;  3OTE A;  2ZHA A;  1M0S A;  1MG7 A;  3PIO Q;  4DQQ A;  3KLH A;  3A8K A;  2EKN A;  1XJW B;  4C0H A;  4DU8 A;  4WFY A;  1SL0 A;  2DGV A;  2CNO B;  1GTH A;  4DN0 A;  1F3F A;  1Q8B A;  2MJN A;  2H5J B;  4WFZ A;  5FLX Y;  4IR1 A;  1O5J A;  4MK9 A;  3VAH A;  4AUK A;  2L48 A;  2XMT A;  5L9X A;  1Q16 A;  2D69 A;  3UD4 P;  1ZPV A;  4I7F B;  4DPX A;  2BXJ A;  1RCO B;  2NLW A;  3ZZP A;  3BDE A;  3PRD A;  2YWE A;  1K9M T;  4KHP J;  2W24 A;  1ZS6 A;  1OSC A;  2CG8 A;  4DV4 J;  3W62 A;  1S1U B;  2DJW A;  1N48 A;  4XIU A;  2FY1 A;  2Y0S D;  3IS9 B;  4K59 A;  2LEA A;  4OHW A;  4F0H A;  2KFZ A;  2FHJ A;  4W90 B;  4C97 A;  2CJB A;  4DG1 B;  1WF1 A;  2AWZ A;  3HFK A;  3EVW A;  2V8V A;  3NGT A;  2WAQ D;  9RUB A;  4LF7 J;  5E3Q A;  3NO7 A;  2NPI A;  3CGI A;  4LRD A;  4NL5 A;  3CJ5 A;  4DPT A;  2KFY A;  4B3M J;  1U6Z A;  2R2T A;  3QFH A;  2DGT A;  5KFQ A;  2DO0 A;  2DHH A;  4ZVG A;  1O8B A;  4IOB A;  3UDE A;  3PR5 B;  1GFW B;  3OUY A;  3MUV P;  2X3D A;  3M9M B;  1X5O A;  4QOT A;  5EHH A;  1IKX B;  3HHL D;  3G8Q A;  3DKD A;  3V5R A;  3P6Y C;  2YWH A;  3D66 A;  1K1S A;  4I6Y A;  3SCK E;  2MQP A;  3KYL A;  1AW0 A;  3H4B A;  4HDG A;  3KJV B;  2PA8 D;  1HNZ F;  1SPB P;  4OL8 A;  4HEA 9;  1B0T A;  1CJT A;  3A8E A;  5LXY A;  1NKC A;  4WXO A;  3EZ5 A;  1NK6 A;  4LFC F;  2BRK A;  1N36 J;  2K3K A;  4B9S A;  1S1W B;  4IOA Q;  4NZ0 A;  1HNV A;  2ZOM A;  2IBO A;  3A3O B;  2O3D A;  3J7A 1;  2QSF A;  4C0B A;  3MD1 A;  4LR7 A;  5J1E B;  5CZX A;  5CD4 A;  3GIM A;  1RT5 A;  2DRB A;  3RR8 A;  4DV5 F;  3CJ3 A;  1EKS A;  5EX0 A;  1SL1 A;  2NYH A;  3VHQ A;  2YQ1 A;  2B6A A;  5GAD I;  4DL0 C;  3OVS A;  4DWI A;  4LRB A;  1RP5 A;  4V19 J;  2DPI A;  1VK8 A;  2GIR A;  3O1L A;  1IXK A;  1S9G A;  3IBC B;  2WSF C;  4PKD B;  7FD1 A;  4JV5 F;  1BD6 A;  3S6E A;  4EMD A;  4R8U A;  4ELU A;  2KXH A;  1M5S A;  1RAD B;  1RT5 B;  1SUQ B;  2XTJ P;  3DGP B;  1X9M A;  3S7R A;  2OTJ S;  2M5Y A;  3GV8 B;  2NXN A;  4YFU A;  2HG4 A;  1H72 C;  3I5C A;  1GXT A;  2ZFH A;  1X7V A;  4OI6 A;  3AOA A;  3BQ1 A;  4YHH J;  4FF2 A;  1YIJ S;  2V4Q A;  5KFL A;  4WWS A;  2HGN A;  2H51 B;  2ADB A;  4DOZ A;  3US5 A;  2ZNY A;  2A18 A;  2FHM A;  1AXQ A;  3VVT A;  3KNA A;  1HWU A;  4ECR A;  4O3S A;  1OQ3 A;  1BDT A;  1KR4 A;  5LMU J;  1KC8 T;  1AA1 B;  2FD2 A;  2GQ2 A;  3CCT A;  4M63 A;  5KFT A;  3T1H J;  2CQG A;  3FNN A;  1VQS A;  5I3U B;  4WKR A;  1C0U A;  2PEH A;  4OJ3 A;  1FFW B;  2BJE A;  1J5O A;  4OJ1 A;  1VQP S;  2VDH A;  4BDP A;  2BQR A;  1N54 B;  3C14 A;  3MAA B;  3KG1 A;  2UVU A;  3L7U A;  3R1L A;  1SC6 A;  2D3U A;  2FHJ D;  4RUH A;  5J2Q A;  1VQL S;  1MRO A;  2VH7 A;  3DLE A;  1I3O B;  2X1A A;  1L5U A;  4F25 A;  4XO0 A;  1SKR A;  1XMB A;  3BM7 A;  2DYA A;  1R8P A;  3L95 X;  4OV1 A;  5ETT A;  5C24 B;  5I42 B;  5GAG I;  1NK0 A;  1T7P A;  1FDB A;  1YRU A;  2HNY B;  2ZH2 A;  1FTC A;  2CQP A;  3D0H E;  1GT8 A;  2W8K A;  3Q8Y A;  2ZM6 F;  1R31 A;  1CC8 A;  2R7X A;  3MWB A;  4ZLP A;  5K20 B;  1RB0 A;  4LIW A;  2MQL A;  2AGO A;  1UCN A;  2ADL A;  1VCT A;  1VRT B;  1FA0 A;  3IGN A;  4TY8 A;  3JSY A;  4HH1 A;  4O44 A;  3T1Y F;  2V9W A;  5DDO C;  4TKT A;  1LV5 A;  2JJ4 D;  3HKZ D;  4OMF G;  4O3Q A;  2WVE A;  4JI2 F;  3UR3 C;  1WG5 A;  5DZ7 A;  4KKO A;  2H3A A;  2XCA A;  3QID A;  4Z7C A;  1LXN A;  1S4E A;  2FGC A;  1IBK F;  2P6T A;  3DC2 A;  3R5B A;  4BBY A;  1RBA A;  2M8H A;  1JLA A;  1RAA B;  3M8Q B;  2GC8 A;  5M2R A;  4CTA A;  2XSJ A;  2BW2 A;  5ETN A;  4FYD A;  1ZOT A;  2ZOG A;  2XM3 A;  4IOC Q;  3JYT A;  1VQN S;  1UFK A;  1S1T A;  2HNZ B;  3ADA C;  2CJQ A;  4K50 A;  3EZO A;  5E33 A;  4C8M A;  2L9W A;  2N3L A;  2FHK A;  4MKV A;  2DB1 A;  3CUN A;  1QSY A;  5DG8 A;  3HVR A;  3HPO A;  4F02 A;  1XR7 A;  3LP2 B;  2DH8 A;  3MD3 A;  2C42 A;  4MIB A;  4KBI A;  2AYG A;  2V4R A;  4PAB A;  1S6O A;  4ECQ A;  2OPQ B;  4F8R A;  3AY0 A;  1Q7L B;  4OYZ A;  1PG5 B;  1WDD A;  2WOM B;  3I87 A;  4LR9 A;  3KLI B;  5IV3 A;  2VKZ G;  4CIO A;  5E5N A;  4ZVR B;  3H40 A;  1ITP A;  2ZZT A;  2KG1 A;  3DMJ A;  2KG0 A;  1TR0 A;  5ETS A;  2FJV A;  5EGY A;  1UFW A;  2YKO A;  4B3R F;  3KKF A;  1VRU B;  5J2M B;  1OWX A;  2GA7 A;  3CJ8 A;  4IFY B;  4I67 A;  2DEJ A;  2EXU A;  2RS2 A;  1QE1 B;  3ZZ0 A;  2HUR A;  1X4E A;  3KLV A;  1IM6 A;  1U6F A;  1S10 A;  1CPZ A;  2RSQ A;  3FCV A;  4Q7A A;  3W8G A;  4NWB A;  4LF4 F;  5JXS A;  3QT5 A;  2BR0 A;  2AY0 A;  2KRB A;  1P6T A;  1LWX A;  4K2J A;  3NRB A;  3RW6 A;  1U7L A;  2V2Z A;  2VU5 A;  4ZP8 A;  3OVA A;  3PFO A;  5AXN A;  2C3P A;  1KDN A;  2AYM A;  5AE1 A;  4ED5 A;  3T6B A;  4J5O A;  2VG7 B;  4AYB D;  1J5O B;  3KDO A;  1QM9 A;  1CLF A;  4KQZ A;  4ICL A;  3MZI A;  1BUX A;  1HBU A;  2IJF A;  4DV2 F;  1H7X A;  1R27 B;  3Q83 A;  1XTZ A;  4YR2 A;  2ZH9 A;  5F3Z A;  3D1Q A;  3EXY A;  4RUB A;  4WPA A;  2DGW A;  1G4C A;  1HW9 A;  1V3Z A;  4OV6 A;  1WHY A;  2MST A;  3C16 B;  3ISN D;  2R7O A;  4QYZ J;  4CLW A;  3A3P B;  1FDN A;  1NSP A;  1S1T B;  2HNZ A;  3W7B A;  1SCJ B;  2IAJ B;  1WKK A;  1BWE A;  1C2P A;  3MAA A;  2Y1J A;  4C3K A;  1LW2 B;  3RRH A;  4KAI A;  1S57 A;  1X5P A;  4USJ C;  4RW4 B;  4GKK J;  3B54 A;  3LQV A;  4LRE A;  3UO0 A;  3D3B J;  1S0M A;  1WJ9 A;  3VAL A;  3RB6 A;  4J9S A;  1T9X A;  2RJZ A;  2ZE2 A;  2OPS B;  3ZTP A;  2J0S D;  4WII A;  1HR0 F;  3QIP B;  1A9N B;  3V6K A;  1VRQ C;  1HNV B;  3KUH A;  2RH3 A;  1QTG A;  2IJN A;  3BZQ A;  3NCP A;  3QO9 B;  4GRS A;  1N0V C;  4KO0 B;  5KFA A;  4J9K A;  1IR1 A;  3FEX B;  1QTN B;  1PC4 A;  3C6U B;  2W7O A;  4Y00 A;  3LTO A;  1FES A;  3Q8V A;  4OZ1 A;  1BMQ B;  1M5V C;  1PBU A;  5F9L A;  2OGU A;  1NK9 A;  3IFE A;  4CWB A;  3D9B A;  4LJM A;  4J9P A;  1NO8 A;  2CJK A;  4LSZ B;  4M5K A;  4RW9 B;  4X66 J;  3CCM S;  3I31 A;  1BE4 A;  5DM6 Q;  1QAX A;  4NCA A;  4NA1 A;  1SKW A;  2HVH A;  4EBE A;  2JEG A;  1U9P A;  4TNO A;  4CM0 A;  3J7Z 5;  3MDF A;  5HI7 A;  2PMZ D;  4ZHR B;  5KT5 A;  3RTV A;  1NZ8 A;  3OLA A;  2QMX A;  4X64 F;  1RWP B;  2MGZ A;  1IBK J;  3ZTO A;  5E2Q A;  2R42 A;  3GZ7 A;  4FKX A;  4DQP A;  4JI2 J;  3K58 A;  1KS2 A;  5K9F A;  4ALZ A;  4M5D A;  1X4A A;  4K4T A;  4K4Y A;  3M6X A;  1YQH A;  1YI2 S;  5CQG A;  5IT4 A;  4F0K A;  4Y0F A;  4ECZ A;  3V6H A;  1T03 B;  1VC5 A;  4H4K C;  2J76 E;  2A6O A;  5D3G B;  4KGZ B;  4MT1 A;  5D15 A;  3GLJ A;  5EWE A;  3M30 B;  3QWP A;  5B0F A;  4IRK A;  1NHV A;  1W7W A;  4PWD A;  2RB7 A;  1G6B A;  3OTD A;  3P4U B;  4NA3 A;  4CCH A;  1JLC A;  5HQL A;  4GVL A;  2B51 A;  1HQ2 A;  1VBZ A;  4DFP A;  2M7S A;  5GAG U;  1F60 B;  2QA1 A;  1HBM B;  1XQI A;  1D9A A;  1ZBT A;  2IM1 A;  3I4H X;  3T5L A;  1RWN B;  1O6X A;  2CQC A;  4IQX A;  4ES3 A;  2J6U A;  3MTK A;  3GJT B;  4DR4 F;  3S01 A;  2ADC A;  4R25 A;  1AZS A;  2IRX A;  3EGV A;  2W01 A;  3I0S A;  4LBI A;  3KJF B;  4I64 A;  2PE8 A;  5KG7 A;  2HBR B;  1M5H A;  2A3J A;  2W4D A;  4H4M B;  1QE1 A;  4LSL A;  1Q8L A;  2ZKU A;  2OUG A;  4KGM A;  4YN3 B;  4X4R A;  2Q3P A;  2VFV A;  4X4T A;  2Y8Y A;  2O1P A;  1IKW B;  1S1X A;  1H3D A;  2HHH J;  4CO1 A;  5FDL B;  3ILO A;  4HDH A;  4MIW A;  3WBZ A;  4JV5 J;  5G4D A;  5GAH I;  1D8Y A;  1RT1 A;  3TA0 A;  2Z56 B;  2WON A;  3J7A N;  1DTQ A;  2MLZ A;  3MUT P;  3CWJ A;  5DDP C;  5L1L A;  3C19 A;  3PYF A;  2CNK B;  1WC1 A;  3HHL A;  3RBE A;  2ATL A;  3VF0 B;  4OYW A;  1YG0 A;  1DTT B;  2XCP A;  4RW9 A;  2R7V A;  1FO1 A;  4ZVF A;  2XY5 A;  2MQM A;  3CDW A;  1RT1 B;  4ZJO A;  3NBP B;  1SBR A;  4RNF A;  3GIK A;  1KKH A;  1KN6 A;  4AND A;  3WZ0 A;  4QBU A;  3VAI A;  2BMB A;  3RAM A;  1WKL A;  4NMX A;  2ASY A;  1FD2 A;  1PYO B;  2CJ9 A;  3FBC A;  3A3N B;  4DV5 J;  4H54 A;  4P52 A;  5L1J A;  4DR5 F;  4LIR A;  2W9A A;  2VD3 A;  4DBQ A;  3TI0 A;  4G65 A;  4GO5 X;  1KON A;  1M5O C;  5HAN A;  5HMZ A;  4DQI A;  2VFS A;  3GFH A;  1PIL A;  3IS9 A;  3MM6 B;  3H5U A;  3NG8 A;  1HYS B;  1VQY A;  3DGP A;  3LP0 B;  2MKH A;  2RDI A;  4RU9 A;  1FI4 A;  1DQ9 A;  1TL3 A;  4P10 A;  1S72 S;  1SKU B;  2V5H G;  2JH3 A;  4DS4 A;  2ZH1 A;  4F4K A;  1JNR B;  2HAI A;  4URS A;  2E5L F;  4NLD A;  1N56 A;  3UNG C;  1JX4 A;  1J5E J;  4TVA B;  1JNZ B;  2CAX A;  2LFV A;  2W25 A;  2C3O A;  4Q8F A;  1UP1 A;  2LU1 A;  1JLB A;  5EUH A;  3EGW B;  3DDN A;  3K89 A;  1LWC B;  4DR3 F;  1RYR A;  2HHV A;  4JV0 A;  1UWB A;  2HPU A;  1ICE B;  3NNH A;  3NGD A;  1MNE A;  3RG6 A;  2V68 A;  5IZH A;  1UA1 A;  2UVR A;  2E1A A;  3HT0 A;  4HR2 A;  5BYQ A;  2U1A A;  3GJQ B;  3M2U B;  5D4L A;  3KJV A;  1XR5 A;  3EX7 B;  1FWL A;  2A6M A;  2DIT A;  3CO0 P;  5L39 A;  4B9N A;  1FJ7 A;  2OEJ A;  3H0P A;  1HWL A;  2AEF A;  1UW4 A;  2AMC B;  2Z30 B;  3EM1 A;  3CF5 Q;  1R0A B;  4QWB A;  2YKN A;  2J9D E;  2RRN A;  4OHX A;  1T11 A;  3RAX A;  4N76 A;  4FYW B;  3CIM A;  4R5P A;  2ILY A;  3QLH A;  4BC9 A;  4DSL A;  2IMW P;  4X84 A;  4OX9 F;  2MLX A;  1MWY A;  5B0G A;  4MFB B;  1BC6 A;  4USI A;  2CPJ A;  1UVI A;  1CC7 A;  3UFC X;  1Q5Y A;  1XMQ F;  3IN5 A;  4EBD A;  2ZZN A;  2WVF A;  3K2Y A;  4O23 A;  2BDP A;  1ZH5 A;  4Y2I A;  3SCJ E;  1SIZ A;  2JXG A;  2Y3Y A;  2UU9 J;  1CEZ A;  3DI6 A;  1T8E A;  2IVF B;  1H2V Z;  3LPE A;  1U1K A;  4ZJQ A;  1N5V A;  3CDE A;  4OLO A;  4WYW A;  4OHZ A;  3VGS A;  2RNE A;  5F8H A;  4WFB Q;  2OD4 A;  2ZJQ Q;  2AEM A;  4LF4 J;  4DR6 F;  2V67 A;  3BGL A;  3VAF A;  1RKI A;  1HBO A;  3QAE A;  2DNZ A;  5HBM B;  2DR8 A;  1APS A;  1NND A;  4K0K J;  1ZYQ A;  2NXC A;  4DR2 J;  1F3V A;  2I38 A;  1B99 A;  4C8Y A;  4JYA F;  1DJ0 A;  3FQL A;  4DUT A;  3KMS A;  1MML A;  1L3T A;  1NK5 A;  3HZE A;  2AV5 A;  1RI7 A;  3FEZ A;  3IAS 9;  4RLE A;  3M6W A;  1Y3J A;  2MJU A;  3ZNU A;  1X8D A;  2CDR B;  4AL7 A;  4LF6 F;  2GFF A;  5CAB A;  3W2V A;  3O5T B;  1CVJ A;  2F40 A;  1IKW A;  3HD2 A;  4R0E A;  3RRK A;  4HKQ A;  2P9E A;  3UN5 A;  4QPX A;  1HIY A;  4KJI A;  1ZA2 B;  1JLQ B;  1HBN A;  2HND A;  3AT1 B;  1S6P B;  3POT A;  4G1Q A;  5AXL A;  4C8N A;  3TZX A;  4ECX A;  1QAY A;  1WI8 A;  2EI5 A;  2JFD A;  2YQ0 A;  3HVT B;  4ZCI A;  3SFG A;  2LP4 A;  3MMJ A;  4QWE A;  2FVC A;  1RHQ B;  4I56 A;  4USV A;  3GV7 B;  1JKH A;  4JI8 F;  4IFV B;  4F0M A;  3Q22 A;  4UF4 A;  2K7K A;  1NJY A;  4C3M A;  2F8E X;  3FC9 A;  3KHL A;  1DHM A;  1WC0 A;  5DRK A;  1RJJ A;  2C2Z B;  1IQZ A;  5F0U A;  4EYI B;  2Z8Q A;  2CPH A;  3TQ1 A;  4DSI A;  1QTM A;  1PJ7 A;  1NBE B;  4C6A A;  3A12 A;  3J7Y U;  4N7T A;  2MB0 B;  3GYG A;  5F0W A;  4K0K F;  3SFU A;  4OI4 A;  1A0O B;  4KH1 B;  5L9N A;  2V8P A;  3PFE A;  1VQ9 S;  1RAE B;  2HKE A;  2QL9 B;  2Z2Y B;  2CQD A;  3K7R A;  4QJV A;  2BNW A;  2AU0 A;  4HTJ A;  4MKB A;  4JI7 F;  2DGO A;  1I6J A;  2EK1 A;  3PYG A;  5GMD A;  4U7U K;  3H87 C;  3T1Y J;  4HH0 A;  3R8Y A;  3HMJ G;  1QSL A;  9ATC B;  5HAO A;  3R9L A;  5KFG A;  3MAQ A;  1DQ8 A;  1TKD A;  4QR1 A;  3LGM A;  2Q66 A;  1PKU A;  2LVW A;  1JLE B;  4EZ9 A;  3BDP A;  5F8M A;  1XMQ J;  4TQR A;  3DLL Q;  3AB4 B;  4RNH A;  2MGZ B;  3KK1 A;  1W2B R;  4MK7 A;  5KFS A;  4AT1 B;  4IRC A;  1HNX J;  1FE4 A;  3T9N A;  1SIW A;  1VR6 A;  1EAY C;  3PRB A;  3CJK B;  4PPD A;  2JX2 A;  3NWR A;  4OX9 J;  3A8J A;  3HD1 A;  4IFV A;  2BM1 A;  4DV1 F;  2BJ8 A;  3MED B;  2AYE A;  5A2Q U;  1TKX B;  2LU2 A;  4XDD A;  3M8S A;  4X62 F;  3K0J A;  1VIO A;  1Y9O A;  2VBW A;  4NZ7 A;  2I6W A;  4Q43 A;  4LFA F;  2E7X A;  2BNZ A;  4DCO B;  2K3I A;  1F5A A;  3LP1 B;  1WTB A;  1EX8 A;  2QC3 A;  4DUY J;  2DHX A;  3CJR A;  3DRR A;  3DHW C;  1NJZ A;  2IHR 1;  1I94 F;  1IBC B;  4L3N A;  5E0O A;  1YBT A;  1FD8 A;  2ZNZ A;  2QSW A;  1AYE A;  4TLR A;  2RD5 C;  3OJU A;  1YHQ S;  1Y3K A;  4F36 A;  2JBV A;  1U09 A;  2GVZ A;  3NCR A;  1IJE B;  1SUQ A;  4FDF A;  2MXY A;  3BF4 A;  6FD1 A;  1Y11 A;  3DRP B;  3M8W A;  1U1L A;  2X51 A;  2IC3 A;  4B9U A;  4KYZ A;  2ZH7 A;  2HFS A;  1P9Q C;  3PO5 A;  4J9N A;  4H4O A;  2NS1 B;  3LUY A;  3LOU A;  4ZPD A;  4OYI A;  4K8R A;  4X4Q A;  1R0C B;  3N79 A;  2UXD J;  5DZ6 A;  4NI2 B;  5J1E A;  1FF2 A;  2RKI B;  2W2Q P;  3HXM A;  1QLN A;  2CQH A;  2B9Y A;  2YBV A;  2J8A A;  5GVQ A;  3D2W A;  1FDD A;  2WSC C;  3UNY A;  4PG6 A;  2AZ3 A;  2L08 A;  4DL3 A;  1UPM B;  3NEK A;  3QRQ A;  3MUM P;  2YKA A;  2XMM A;  4DLG A;  1NJI T;  1R8A A;  2A0F B;  1RA6 A;  2LA6 A;  2AZ1 A;  4F26 A;  5K8P A;  4PUO B;  1IBL F;  3EWG A;  3JSM B;  1OHN A;  5HJX A;  1OO0 B;  1Q8I A;  2J7K A;  5LL6 d;  1RDR A;  4ANC A;  1TKZ A;  4EO6 A;  3PIP Q;  5HLF A;  4WFX A;  2R8J A;  1RTH A;  2H1O E;  3AOC A;  2UXC F;  2LEP A;  3P96 A;  4Q0B B;  3JB9 k;  1NRK A;  1HNZ J;  3D5M A;  1F9F A;  2DT9 A;  4OQJ A;  1U8W A;  2H9Z A;  3D7S B;  2FB0 A;  1FWP A;  3NCQ A;  4JP8 A;  4RJV A;  4QWD A;  3R5D A;  1FVQ A;  3TJA A;  2CWX A;  1W26 A;  4KGX B;  3M2U A;  4M5I A;  3GIR A;  1H0H B;  3H2V E;  1YJN S;  4A8K A;  3W2W B;  2DKO B;  4DG1 A;  2F3J A;  5C25 A;  3DLK B;  4CH7 A;  3SXL A;  3PRV A;  2HVD A;  3U1M A;  2AGP A;  1P1T A;  4RW8 A;  1EAR A;  4C7Q A;  3FK4 A;  4PWU A;  2CFX A;  3TJ9 A;  4CNZ A;  2E7W A;  3ZFV A;  2WSE C;  3LAM A;  3OTC A;  3IR6 B;  2GJI A;  2ZVI A;  3W9I A;  1MNT A;  1TVR B;  1XN9 A;  2D9O A;  2DBB A;  1D0E A;  2ROG A;  3EJM A;  4JI4 F;  2GMJ A;  2IMO A;  4DUY F;  1RHJ B;  3AJ1 A;  1RWX B;  4IO1 A;  1X4H A;  3UI3 A;  4ZPV R;  2RF2 B;  3GR1 A;  5HRO A;  1U24 A;  2XSF A;  1FWK A;  1L3K A;  3ELH A;  4CYU A;  3JQM A;  3SSS A;  3FBF A;  3PX4 A;  1KD1 T;  4U9R A;  1RAJ A;  1S76 D;  2UUA F;  4FF1 A;  4QR0 A;  3BPD A;  2YNF B;  3UW1 A;  1R6Y A;  2Q2K A;  1Q0N A;  2HVI A;  3KMQ A;  3NNA A;  3RBZ A;  1NSK L;  2DEI A;  1OMS A;  3Q8R B;  4WP9 A;  3T1A A;  2GHV C;  1HHQ A;  3IR5 B;  2DR7 A;  4FPI A;  2CAD A;  1E6V A;  1XEZ A;  1BWV A;  3D54 A;  2HSE B;  2SXL A;  3IG1 B;  2DHA A;  1RIS A;  2VPX B;  3DM2 A;  4P7T A;  2OPR A;  4RW6 B;  5CHC B;  5J2P A;  1S7H A;  2RQK A;  1WAC A;  4AXI A;  3OL8 A;  1E6Y B;  2V4J B;  4UQT A;  2CIM A;  2MLY A;  3NNE A;  2W8L A;  1R7I A;  4IDK B;  4O3N A;  4R0J A;  1XNQ F;  2AP6 A;  4HHU A;  4HV0 A;  2CZ9 A;  1N32 F;  2YX1 A;  3E51 A;  2C28 A;  2NCK L;  2MKK A;  1HD1 A;  2FVP A;  2IY5 B;  3NMR A;  1R6V A;  1URR A;  3N28 A;  3OL9 A;  3RAQ A;  1Q78 A;  2ZIT A;  1WD6 A;  4RBU A;  2G1H A;  3D28 A;  3DLK A;  3HVA A;  1AZS B;  3I0S B;  5L46 A;  4N5S A;  4IH7 A;  3IM9 A;  2NZC A;  2BRL A;  2Y1L B;  2VV5 A;  2CPF A;  1IRQ A;  1OY6 A;  3W66 A;  2RU9 A;  3J81 Y;  1VHF A;  4JI6 J;  5K5M A;  2C2O B;  4I2P A;  4LF5 F;  4MAK A;  1G7C B;  4WE1 A;  1F6T A;  1FK9 B;  1BQM B;  1U1R A;  1NKE A;  2BAN A;  1WSR A;  2B4U A;  2Z57 B;  3N01 A;  3B4D A;  3MEG A;  4M8L A;  4ZHR A;  3MR6 A;  1BQX A;  2VOP A;  2F4V F;  1B28 A;  2QX0 A;  3HHN B;  4FXD A;  3QGH A;  4NYP A;  3CB4 A;  2BSQ E;  1WC4 A;  2KVQ E;  2YKN B;  3CDA A;  5U47 A;  4C8O A;  1C0U B;  2VC0 A;  3MMA A;  4KFB A;  1N88 A;  3H42 A;  1LQ9 A;  4QIG A;  4CLF A;  4PG8 A;  4TU7 A;  1WF0 A;  1TTH B;  3E8O A;  2CPG A;  2RT3 A;  4MMO A;  1U0S A;  4Q2L A;  4ZP7 A;  2HMI A;  3Q89 A;  4DMZ A;  1KTV A;  1GAO A;  3UDV A;  2GHP A;  2R8K A;  2IDL A;  4DDF A;  3R97 A;  4FXE A;  3P5T L;  1RT7 A;  2BKN A;  3THT A;  4CLT A;  2XGQ A;  1FRJ A;  3MEE B;  3QFW A;  2HZC A;  2B0G A;  3TAP A;  1IKY B;  2J6T A;  1B7F A;  4ZVT B;  3LGH A;  4NZ6 A;  2XUL A;  3PDN A;  2ROE A;  3SQO P;  4DV2 J;  4K4X A;  3LA0 A;  2UV8 A;  3T9Z A;  2VJU A;  3G4S S;  3DYA A;  3I9Z A;  1UTA A;  4L6V 3;  3UN3 A;  4EUV A;  1XNR J;  2YY3 A;  2RF2 A;  2BW7 A;  3PM9 A;  1SL2 A;  3MM7 A;  3TJ8 A;  3CCS S;  1VQ4 S;  5D8H B;  4LUB A;  3TW0 A;  2JL9 A;  4DV3 F;  1LWF B;  4ZIW A;  1T9Y A;  2YX4 A;  1SH3 A;  5AXM A;  4UOH A;  1RT6 A;  3C15 A;  2AT1 B;  3CCV S;  3HVW A;  4KSE B;  2HFU A;  3SSR A;  4K4S A;  1S1W A;  3WX4 A;  3NS6 A;  2V69 A;  1HQE A;  3DRS A;  2VZ9 A;  1VFJ A;  3A1Y G;  1FX2 A;  2BKP A;  2UV8 G;  2DXD A;  2F8M A;  3LGN A;  3HZG A;  4UZC A;  4OYP A;  3MUR P;  3TAN A;  1TL4 A;  2VJV A;  3BRE A;  1UZH A;  2GIQ A;  3BH6 B;  5DET A;  1TUV A;  3CW2 C;  1VMB A;  3PHE A;  3PW0 A;  5SUH A;  3OLB A;  1Y5L B;  5L1K A;  1Q82 T;  4YB6 A;  1OPZ A;  3MR7 A;  1GTE A;  3D1H A;  5DGA A;  1T95 A;  1R0B G;  5E41 A;  2WZ1 A;  3MI7 X;  6FDR A;  3HHL B;  2JLF A;  3VZI A;  1CJU A;  2KVI A;  1S97 A;  2V94 A;  1TL1 B;  1PIE A;  2GAH C;  1DUR A;  3RB3 A;  3PY8 A;  4X65 J;  1R8H A;  5E7O B;  3DXB A;  3QPI A;  3K17 A;  2QYC A;  2NUH A;  5DJB A;  4ZVP B;  1CUL B;  1WOP A;  3AJD A;  3RUB L;  2DNY A;  1S1X B;  3RRG A;  4F3O A;  4HLB A;  4PUO A;  2XNQ A;  3GG0 A;  4L72 B;  2AX0 A;  2XNR A;  3N0V A;  2BJ7 A;  2I0X A;  4CH0 S;  4D3G A;  2MQN A;  3GII A;  3BO3 A;  4KFB B;  3I6P A;  3QNW B;  2DPJ A;  2K5J A;  2P9C A;  2VQF F;  2HBZ B;  4WIQ A;  3HP6 A;  2BA9 A;  4DV6 J;  1S9F A;  3PNI A;  3KUE A;  3SEO A;  2HWT A;  3B78 A;  4LBP A;  2OPP B;  1TFW A;  1FJG J;  4ZP9 A;  3V81 A;  5AE3 A;  2HEK A;  3ET6 A;  1SJF A;  3K57 A;  2KT3 A;  5D77 A;  3PR4 A;  1TK8 A;  1NME B;  2K6L A;  3W60 A;  3MEC A;  3FBB A;  3IO1 A;  1VQM S;  3KHG A;  1Q5V A;  3KLF B;  4B9M A;  2XHC A;  5HVH A;  4DPY A;  1ROF A;  4NLS A;  1SH2 A;  2IFX A;  4LSN A;  4EWT A;  4F04 B;  4EZ6 A;  1MN9 A;  2ALY B;  3T5K A;  2FZK B;  4YY3 F;  3R1H A;  3BQ2 A;  1KQS R;  2W9B A;  5H1S V;  2XZT B;  2VOD A;  2R4F A;  2KOE A;  3AFG A;  4K4U A;  2EEY A;  2C2N A;  4U67 Q;  3LP1 A;  1RHM B;  2MKY A;  5GMK a;  3O8W A;  2ZM6 J;  1FJE B;  3TZZ A;  1T94 A;  2CPD A;  4M5J A;  3F0N A;  4UUW A;  2J9E A;  1KHW A;  4LSN B;  3L9Z A;  4ENO A;  4DR4 J;  5K8M A;  2W2N P;  2NR0 A;  3BSC A;  2WRM A;  1WHW A;  5B0C A;  3FMW A;  4NEY A;  2E5L J;  5JVH Q;  2GPE A;  2G2O A;  4JI1 J;  3AJ2 A;  4OYO A;  5I3P A;  3VV2 B;  1SIW B;  1MN7 A;  1ULR A;  3MEG B;  3CJK A;  2YWF A;  4DUZ F;  2ATC B;  1RCX B;  2OD6 A;  4EK2 A;  2LMI A;  4RUC A;  1CG2 A;  3FZB A;  2KM8 B;  2MDA A;  3V81 B;  1UVM A;  3BB5 A;  4HHJ A;  3SQG B;  2XS2 A;  2WBM A;  4OHY A;  3BSO A;  2YNG A;  3EZU A;  2EG2 A;  2UUA J;  3AD8 C;  1LFW A;  3QWU A;  3E01 A;  4MYU A;  4Q5V A;  3FDS A;  3DU6 A;  5A6W A;  2JEJ A;  2F4F A;  4X4O A;  3V4I A;  2H5I B;  4FS2 A;  5AE2 A;  3GYN A;  2D41 A;  1RT6 B;  2MZS A;  4I68 A;  5F41 A;  1JLA B;  1DQA A;  3M8Q A;  4IYQ A;  4MKA A;  4WXW A;  4ZCK A;  5J2N B;  2CWK A;  4K4W A;  2OIH A;  4F67 A;  2PMW A;  1FXD A;  1K44 A;  2IRY A;  2EG1 A;  5AJ3 J;  2DNP A;  3CCZ A;  1P1L A;  1RTJ B;  4QIV A;  4IO9 Q;  1MMD A;  3GTY X;  1K73 T;  2CDQ A;  1YZ6 A;  2JC1 A;  3BN4 A;  1VK3 A;  1WWH A;  2DD8 S;  1C1C A;  4JOU A;  5M2U A;  2RML A;  2MY7 A;  4LT6 A;  3ETO A;  1RTH B;  3F41 A;  5LOQ A;  3FGV A;  1RWO B;  3M9N B;  1HNX F;  1NEE A;  3LO3 A;  4YB7 A;  4YDX A;  5E3C A;  3TP2 A;  4DHV A;  5JJB A;  2B8P A;  2JLG A;  3PAC A;  1E6V B;  2Y1R I;  2ZBQ A;  3OR1 B;  2KU7 A;  2M9K A;  5F8N A;  2IA0 A;  3EPI A;  1XNR F;  1YBU A;  2V2Q A;  4NCG A;  3HUL A;  3HSZ A;  4KR0 B;  4QW9 A;  4UOF A;  3PW4 A;  4PQA A;  3L3C A;  4O3R A;  1IN0 A;  4ZLL A;  1HI0 P;  4NLT A;  2YH1 A;  2ZJP Q;  1ZTT A;  2OKQ A;  3I96 A;  3NWG A;  3V4M A;  3W1Y C;  2LCW A;  3TZW A;  3Q0A A;  4KPC A;  1D9F A;  2UXB F;  1EQ0 A;  2YWW A;  3RJM B;  3OVB A;  2VA2 A;  1FDA A;  2WW4 A;  3D6F B;  2YWG A;  3N6M A;  4BWJ A;  2M4M A;  2EPI A;  2D1C A;  2A2D A;  1U0H A;  2K06 A;  3IRX B;  5T14 A;  2GCF A;  3M05 A;  2X7I A;  2MHE A;  1WHX A;  3NL0 A;  3ZO7 A;  3CJQ A;  5D4P A;  2FYX A;  2HVE A;  4CDI A;  2R8G A;  2OEM A;  2VPZ B;  3QSI A;  1TAU A;  1B0V A;  1ARO P;  1MLA A;  3ZZO A;  4DR1 J;  4CRJ A;  5L38 A;  1WOS A;  3IR7 A;  4KO0 A;  2UUB J;  4LBH A;  3MEE A;  1VJW A;  2DO4 A;  1URN A;  2N7Y A;  5CA5 A;  4EBC A;  3DCA A;  3DRR B;  2R7S A;  4C8L A;  4MIA A;  2IA6 A;  2YNG B;  1FFG B;  1S99 A;  4HTI A;  3H20 A;  4X64 J;  5DGB A;  2ZD1 A;  4A8Q A;  1JWW A;  1FVS A;  2DY9 A;  4GVB B;  1GXL A;  3MM7 B;  2F5G A;  3MCO A;  3VTI A;  5LJ3 Y;  2Q6B A;  1DTT A;  3MPD A;  4RR5 A;  1LXJ A;  1SV5 B;  4Y65 A;  4LQ9 A;  2YH0 A;  5F8I A;  2VHG A;  1Z2L A;  4EFA C;  3DM2 B;  4ATN A;  1TKZ B;  5HLF B;  1ZPW X;  1IKV A;  3T41 A;  3SV3 A;  3QZ8 A;  3C3L A;  1F0X A;  1Q8K A;  2HRU A;  4WE1 B;  3WIV A;  1W25 A;  2QRR A;  4MTP A;  1JLG B;  1LWE B;  3PG9 A;  2BAB A;  2FJD B;  2HFO A;  5KT6 A;  2UXD F;  4AQY F;  2PFF B;  3PJ9 A;  4A48 A;  2G0I A;  1L3V A;  3RBX A;  1JMT A;  3CCW A;  4HAC B;  1OJ4 A;  3VAG A;  3CCE S;  3KLE B;  3CTR A;  5HVF A;  1EHW A;  5IQ6 A;  2XSJ B;  4ELV A;  3KJQ B;  4U8V A;  3HX9 A;  3K5L A;  4J9V A;  1X4D A;  4J9O A;  5HRO B;  5CYM A;  2VUG A;  3PEH A;  1C1C B;  2C3U A;  4B3M F;  2HHQ A;  3KOA A;  1X5T A;  2VBX A;  4H4O B;  3G6E S;  1XR6 A;  1Y4Z B;  4PXE A;  4FVC A;  2XWY A;  3I56 S;  2BM0 A;  1R3N A;  2DXE A;  2A2C A;  2IDE A;  3PYE A;  4ED2 A;  2Q1L A;  3W65 A;  5C2C A;  3ZXW A;  3GJS B;  3EPG A;  4RW7 A;  2DIV A;  4ES2 A;  1S12 A;  1EET A;  3BPS P;  5IV4 A;  1OS5 A;  4YB5 A;  2RDD A;  3CD0 A;  3KLH B;  3G9C A;  5HQM A;  3H59 A;  5J1N A;  4Q2M A;  4YQW A;  1WEL A;  2CQB A;  3D4J A;  4ZN1 A;  3SV4 A;  2B4O A;  1TEL A;  1H38 A;  4YP3 A;  2J9C A;  3CDU A;  1NLA A;  4FKY A;  1N5S A;  1K0V A;  3OTO F;  4EO8 A;  1E6Y A;  3AH6 A;  2VIH A;  2DNM A;  3ILI A;  2PII A;  4QYZ K;  4Y28 C;  1FER A;  2QYG A;  3OJS A;  3NAH A;  3P3D A;  3IA0 A;  2LQ5 A;  1XIQ A;  1YWX A;  4CLL A;  3JTO A;  3THP A;  1D1U A;  4M5G A;  3KK3 B;  3GB0 A;  2JDJ A;  4IH6 A;  4ZPC A;  5H9F J;  1HMV B;  3M8P B;  2K1R A;  1M90 T;  3C8Y A;  5IOL A;  2DVI A;  1S6U A;  4RW8 B;  3PZP A;  2FVQ A;  3QZ7 A;  3AQO A;  3M6V A;  4X4P A;  2IVY A;  4ZVS B;  4I6A A;  2AW0 A;  3VR1 A;  1H98 A;  3D0G E;  3FMB A;  3GG1 A;  4LF9 F;  3PKM A;  2GS8 A;  2KKE A;  1UEU A;  1CJK A;  3MEC B;  3D0I E;  2MHN A;  4K4V A;  1VIS A;  2C22 A;  1OSD A;  2B4P A;  2QJ3 A;  1WHV A;  4LMZ A;  4QCL A;  2R7U A;  1MYL A;  2E7V A;  3IM8 A;  2ALZ A;  4FNH A;  3Q8P B;  3BO2 A;  1LNQ A;  4U96 A;  2XO7 A;  3BO4 A;  3T5H A;  2ZHB A;  4PRF A;  1JKH B;  1FRX A;  1RAF B;  5BYR A;  4B9V A;  2BJ9 A;  1V3R A;  1LW0 B;  1Z4U A;  5KFR A;  4O4G B;  2FVS A;  2IM3 A;  3M4X A;  3ISN C;  1X9S A;  2W9C A;  1Q53 A;  1HHS A;  1U6B A;  2QFJ A;  2HK3 A;  4PAA A;  5LMU F;  1LWE A;  2E5G A;  3MEK A;  1XNQ J;  4AFF A;  1VBX A;  4K7Q A;  2XYP B;  1S77 D;  1S4F A;  3QLH B;  3MXH P;  2B5J A;  2GMH A;  3ETM A;  3T19 A;  3W61 A;  1R8C A;  3H98 A;  2GAG C;  4LFA J;  1EQM A;  1JJ2 R;  1P9Y A;  2CJY B;  2BAN B;  1FKP B;  1J27 A;  1DY3 A;  3JSM A;  1HBO B;  1ZA1 B;  5HBM A;  1U48 A;  3U27 A;  3V6D B;  4A8F A;  3OL6 A;  3CCJ S;  1N5T A;  3LP0 A;  5CCM A;  1DAX A;  2J9D A;  3SDE B;  1ZM3 A;  4NRU A;  5AXK A;  3WIU A;  4AD6 A;  4ZMM A;  2F63 A;  5BXI A;  3OSN A;  2HZV A;  2HK2 A;  3H8Y A;  2M0G B;  4C3L A;  4B3O A;  4BLG A;  1LW0 A;  1N5Q A;  2HIY A;  3FCW A;  4ECW A;  1S1U A;  2R9L A;  3CD6 S;  1YJ9 S;  1HNI A;  2KDO A;  4NEZ A;  3FT7 A;  1IWA A;  2K7J A;  2P2C B;  3FSI A;  2DCL A;  2ZH4 A;  1Q81 T;  4LFC J;  2NXU A;  2XS5 A;  2HS4 A;  4OYA A;  2EFV A;  1G3O A;  1DZ5 A;  3IRX A;  1S1V B;  1C1B B;  2PI5 A;  5J1P A;  4F2S A;  4TYA A;  2K9I A;  1S7I A;  1RAO A;  4ZLJ A;  3MED A;  3FZ2 A;  3TNV A;  5IC4 B;  3W5Z A;  2ZBR A;  4A8S A;  3BV8 A;  2G0C A;  1TL5 A;  3OT9 A;  4FF4 A;  4FYX B;  3AXM A;  2HLT A;  2R2R A;  4B08 A;  2LXI A;  2DK2 A;  3CT9 A;  1P8G A;  5IT9 Y;  2AJQ A;  3PJW A;  1WG1 A;  2QMU B;  3NKY A;  4P2F A;  1KVJ A;  2V6A A;  2JWN A;  1D3W A;  2EWH A;  1VIX A;  2JEI A;  1S9E A;  3VAK A;  1VQ5 S;  3ONQ A;  3ZNJ 1;  5KOX A;  1WC3 A;  1MMN A;  3U7J A;  4LSL B;  2CZV C;  1NM2 A;  2EK6 A;  2XZW A;  4M5L A;  5I4M A;  1SH0 A;  2WHO A;  4OZN A;  2MQO A;  1NDL A;  2E1M C;  3JYT B;  5D0G A;  3HF5 A;  2ZDP A;  4DF4 A;  4CO4 A;  2D3O 1;  5KFK A;  1NK8 A;  1SJ3 P;  1SKS A;  1TK0 A;  1JXL A;  2K2P A;  2BJ1 A;  4P71 A;  3W9H A;  3W64 A;  2WB4 A;  1PGZ A;  2OAU A;  2PGC A;  2WON B;  3LPY A;  1RZM A;  4DFK A;  2ZBP A;  1C0T B;  4CLK A;  4LF9 J;  1NB7 A;  4KHP F;  5KFD A;  1RTJ A;  4X4N A;  1WOO A;  2B43 A;  3Q8Q B;  3KXD A;  2OPP A;  4ED0 A;  4O44 B;  5JUM A;  2G4B A;  1GEH A;  2B3T B;  2AJ1 A;  1OY9 A;  2LDI A;  1WF2 A;  5J2N A;  2XI3 A;  3PYD A;  4B3T J;  5A8K A;  3QBC A;  2FLN A;  3K59 A;  1NK7 A;  3HVT A;  4B3O B;  2AJ0 A;  1NZA A;  3U1L A;  2C2K B;  3KDN A;  4ETX A;  2XB2 D;  3QGP A;  3VVU A;  2R7Q A;  1WKJ A;  3IBF B;  5MLC V;  4MK8 A;  1U8S A;  3BGO P;  4J9Q A;  1V5V A;  2AX1 A;  2MY8 A;  4FN5 A;  3QAT A;  1AB8 A;  4RUA A;  1VQK S;  1WEZ A;  1SVD A;  4I7F A;  5MAO A;  4DV6 F;  4FVM A;  5HMX A;  4JI5 F;  5IS2 A;  1CJU B;  2BKO A;  1FE0 A;  5KFC A;  2YX7 A;  3CMA S;  2E29 A;  2OPR B;  2H4Y B;  1ZET A;  1R0A A;  1VC6 A;  3KLE A;  3RBD A;  5KFX A;  2HW3 A;  3BBF A;  3CJ4 A;  4ILM A;  1S0N A;  3LW5 C;  4AL6 A;  2XMK A;  1S6Q B;  4G1P A;  4QWC A;  3KK2 A;  5DG7 A;  1H74 A;  1ARQ A;  2RIJ A;  4E0D A;  4Q45 A;  2Q43 A;  5HMY A;  2W7A A;  2XLK A;  3ZTS A;  3C6U A;  3B8H A;  3CIZ A;  3KTQ A;  3TUZ C;  3UQS A;  4DV4 F;  4ZLN A;  3E2E A;  2J7W A;  1QUP A;  4LQ3 A;  2OLW A;  4LR8 A;  4OLP A;  3FSX A;  3IR7 B;  2DGX A;  1YJW S;  1QDU B;  3F73 A;  4HYK A;  2AYB A;  3FRZ A;  2RHS B;  3G2X A;  2GJF A;  2KXF A;  1NPK A;  5BJR A;  2CQ0 A;  5CD4 H;  1PAR A;  3IC1 A;  4ZDN A;  2DH7 A;  3UPF A;  5GME A;  5KG2 A;  1X0F A;  4ZPW R;  2F7V A;  3TUI C;  2V8H A;  3OXL A;  3I5A A;  8AT1 B;  2D74 B;  1N34 J;  2IYG A;  1TL3 B;  1VLY A;  1GX5 A;  1VRT A;  2W1B A;  1YDL A;  2Z0G A;  1K8A T;  3EYZ A;  2B9E A;  3HLU A;  3SI8 A;  3VCD A;  1T0T V;  2JXH A;  2MZR A;  2DNK A;  2IAJ A;  2VF3 A;  1JB0 C;  3BGU A;  3VGV A;  3MR3 A;  2POK A;  3ILL A;  2DY1 A;  4ZVE A;  2UXB J;  3J80 U;  3Q2T C;  4NYO A;  2UZA A;  4NLR A;  2AKW B;  2VBY A;  1ELO A;  3QYY A;  3RYL A;  3UN2 A;  4ZVH A;  3UD3 P;  2WVB A;  1HQU A;  2A1B A;  3R5C A;  4O0N A;  4CLP A;  4ECS A;  5HP1 A;  3ZC4 A;  1YKW A;  1ZAW A;  3BEG B;  4RPF A;  1TFY A;  1D09 B;  4C11 B;  5F8L A;  4DL2 A;  1HD0 A;  4X4U A;  3R6G B;  4LRC A;  4OX6 A;  4W92 B;  2VG5 B;  3EVO A;  2K29 A;  3F44 A;  2LEC A;  3I32 A;  3H5X A;  2QLF B;  4USK A;  1XMO J;  2AJ2 A;  2DH9 A;  4BCA A;  4NLG A;  1XC9 A;  3R5A A;  3M6U A;  4ECY A;  2M88 A;  1DAR A;  1RUS A;  1UET A;  2XHW A;  1NJW A;  1JLE A;  1SXL A;  4I2P B;  4WTO B;  2N7C A;  4LVN P;  2M8D B;  2UUB F;  4CO5 A;  4DV0 J;  2BJ3 A;  2DR6 A;  3G82 A;  5A76 A;  1EP4 B;  3CXC R;  5C42 A;  1N34 F;  2LYV A;  5L8R C;  5CAA A;  4CNY A;  4FS1 A;  1EET B;  2G2Y A;  3HDS A;  1PAE X;  1V3S A;  3QT7 A;  2BE7 D;  1TV6 A;  4CQ1 A;  2HGM A;  3JAM U;  2VG7 A;  2FJB B;  4NLQ A;  3VZH A;  3G8S A;  4KB7 A;  4P9S A;  5KFW A;  4NLV A;  2L41 A;  3PTW A;  3BQ0 A;  4I69 A;  1RXO B;  4TYB A;  1VYA A;  1IWG A;  3Q24 A;  2COL A;  4OX7 A;  5IFM A;  1NPP A;  3Q8S B;  3L4B C;  2HBY B;  1W2I A;  3N4W A;  4ETZ A;  2R7R A;  3HJF A;  5B0E A;  2NQP A;  1YRT A;  2KB2 A;  3M30 A;  3FUY A;  1A6L A;  2E5H A;  2FY8 A;  4GO7 X;  4N77 A;  3HJV A;  4OZJ A;  5C7P A;  3CC2 S;  3CCU S;  2HS3 A;  3T3F A;  1X4C A;  3TAM A;  4N56 A;  3H5S A;  2MSS A;  4F4W A;  4MJK A;  3T5J A;  1N32 J;  4N8O A;  2VL1 A;  4WF9 Q;  3VGT A;  2KFN A;  2HQ3 A;  3M8P A;  2FPH X;  5KT4 A;  2ASL A;  4JB8 B;  1AT1 B;  1FEH A;  3B4M A;  3DFE A;  2QFI A;  3GE9 A;  4IR9 A;  2MZT A;  4G3I A;  5KFF A;  1YJV A;  1HPZ A;  5EWG A;  2W7P A;  2FLP A;  2JVR A;  3JTN A;  4YY3 J;  1ZM2 A;  3MR5 A;  1KFS A;  1BGX T;  2HFN A;  4OYB A;  1FKA F;  2XMA A;  3GPA A;  4AE5 A;  1FNX H;  2EVZ A;  4E2F B;  2FJW A;  2UVW A;  4ERD A;  2QT7 A;  1BQM A;  3AAW B;  1S5Z A;  4NXN F;  2HLU A;  1T02 A;  4OJG A;  3QGG A;  5KT2 A;  4UOC A;  4CM2 A;  4A8M P;  5CYQ B;  2J7U A;  3EVM A;  1A7G E;  3H5Y A;  4OI2 A;  1RLD A;  4ZA1 A;  1Z1Z A;  2ASJ A;  3BH7 B;  3OFF A;  1V6H A;  2B56 A;  3D67 A;  2YKM B;  4KE5 A;  5A8R B;  1U1P A;  3IWL A;  1Q4R A;  5KG6 A;  2UUC F;  2BA3 A;  1FRK A;  4RX6 A;  2M3D A;  3AA9 A;  1HLW A;  1U0H B;  2HS0 A;  4F3M A;  2MZ1 A;  1RTZ A;  4JI1 F;  3M2R B;  1G2E A;  2M2B A;  1OY8 A;  2VA3 A;  3RGI A;  1TKT B;  2QLB B;  3SIP B;  2V34 A;  4LRA A;  2QE5 A;  5CYM B;  4EGL A;  1TL7 A;  1ZAX A;  1ZTW A;  3HO1 A;  3HSJ A;  2KYX A;  2VG6 A;  4GKJ F;  4ZVU B;  4QW8 A;  3VW4 A;  5D78 A;  5DQG A;  1NXI A;  2DR5 A;  2QGF B;  1IJF B;  4KT0 C;  3EE3 A;  2CKW A;  4P72 A;  3EDQ B;  1EP4 A;  3R6L B;  1KEK A;  4DCP B;  3PW2 A;  1U45 A;  2F8H A;  4Z37 A;  4LVO P;  3GFY A;  3VEA A;  4YME A;  1QUV A;  2OHD A;  1FRM A;  2CNL B;  3AHP A;  2XWX A;  3BKF A;  4NXN J;  1NDP A;  5K8O A;  4ILR A;  5A6P A;  4DX5 A;  4NXM J;  3O6Q A;  5IT0 A;  1GNK A;  3HM9 A;  2GJ2 A;  4UY8 5;  2HRY A;  1KQK A;  3DLG B;  3W5Y A;  5FII A;  4CT8 A;  1F9E B;  1BY9 A;  4PG7 A;  4KHR A;  2I2Y A;  4PG4 A;  3TX0 A;  4ZIT A;  5I3U A;  4USW A;  3TZY A;  3K5M A;  1C1B A;  2WCX A;  3DOM B;  3ZTR A;  2O01 C;  2D9P A;  1T3N A;  1EZZ B;  2KHC A;  1TVR A;  1UEK A;  2F65 A;  3FFI A;  5KT3 A;  4WK1 A;  2IJR A;  2IYI A;  2M52 A;  3WHI A;  3LF0 A;  4WKY A;  2QN6 B;  1BQN B;  4B02 A;  2CQ1 A;  3BYP A;  4ED1 A;  2L3M A;  4AAI A;  1VQ8 S;  4Y3C A;  5H9E J;  2QL5 B;  3CNQ P;  1MWZ A;  5HQ8 A;  1NU4 A;  5C42 B;  1QD1 A;  3E01 B;  1Q79 A;  3MPV A;  3KHH A;  4Y2C A;  2HNY A;  3GON A;  5B0B A;  2OJ3 A;  1CJT B;  1TMM A;  3FFI B;  4DU7 A;  5BYS A;  5GAH U;  4DQS A;  1Y7P A;  1F1B B;  2HQD A;  1H2U X;  2QLW A;  3G8T A;  4YR3 A;  3C2P A;  2DIS A;  3MMA B;  1FEE A;  2JLE A;  5SZT A;  4ZCL A;  2NUU G;  1UPP A;  3PX6 A;  1YJR A;  2B7C B;  2CPY A;  1IUJ A;  2ZWO A;  3AOD A;  1TL7 B;  3DLG A;  3UWT A;  4TU8 A;  3SYZ A;  1YIT S;  4B3R J;  1DTQ B;  1RWW B;  1TKT A;  3ZZR A;  2K1O A;  3SCL E;  1M1G A;  1FXL A;  1RKJ A;  1JJC B;  1S59 A;  3PEJ A;  1RT7 B;  3AD9 C;  4J7C A;  2OI2 A;  3LP2 A;  3W63 A;  4JI8 J;  1FNM A;  5ETM A;  1KNZ A;  1GXU A;  3F56 A;  3SCI E;  5HP1 B;  3BBB A;  1T05 B;  4F4Z A;  3V6J A;  4U7U D;  5LXR A;  4RWX A;  5A8W B;  4FBT A;  5KFN A;  3TRG A;  5IXU A;  2FZG B;  4F2R A;  2KT5 A;  2QV6 A;  2EFQ A;  3BKT A;  3ZZT A;  5HJY A;  2IIH A;  2QTW A;  2V8G A;  4KV8 A;  4CTA B;  4QYR A;  1XMO F;  2CPE A;  1U1M A;  1YX2 A;  4QIW D;  1N8R T;  4J9R A;  2IRU A;  4X66 F;  1VRU A;  1RT2 A;  3PW7 A;  4PWD B;  5B09 A;  3VQS A;  3DXS X;  1SJQ A;  1VGY A;  2ZH8 A;  2C3Y A;  4I6W A;  4RBT A;  4QPT A;  3TVK A;  3TO8 A;  3JQK A;  3P5B P;  3ZZY A;  3GCX P;  5KFM A;  2BE9 B;  4YB1 P;  1H7W A;  4PXC A;  2MKC A;  2OMO A;  2XZD B;  3IG1 A;  5DS7 A;  3CC7 S;  4WU2 A;  3CMQ A;  2O5D A;  3M8Y A;  3POT B;  4G1Q B;  1UJ6 A;  4PZV A;  4WJB A;  1X0P A;  1KLN A;  4J9L A;  1O51 A;  2QZ8 A;  4CT9 A;  3MMC B;  1EA4 A;  2G2Z A;  5C24 A;  2GV1 A;  3PJX A;  5KFE A;  4DV7 J;  1NK4 A;  1TAQ A;  3HI9 A;  2JVO A;  4OFZ A;  1HFE L;  2VFT A;  3R5G A;  2L9D A;  5J2M A;  3PX0 A;  1T3O A;  4NLW A;  3D6T B;  1TL1 A;  5KFY A;  4V19 X;  1Q16 B;  1VDH A;  3IAM 9;  4ZCM A;  4GKK F;  1N5Y B;  1RTI B;  1K1Q A;  4RL1 A;  4UST A;  4EI2 A;  2XLI A;  2YKQ A;  4DS5 A;  3H7H B;  2C2M B;  2QMW A;  2C2R A;  3PXG a;  3HSG A;  3MM8 A;  1AFJ A;  3A13 A;  4V1A k;  4KKO B;  2CPX A;  3VQT A;  1PCA A;  1RWU A;  2ZC3 A;  4FYV B;  5KG0 A;  3TEG A;  1KLM B;  3KNG A;  4LFB J;  3D3C J;  1N33 F;  5D4O A;  1Q95 G;  3TAQ A;  4M95 A;  2E1P A;  1OYE A;  3HFV A;  2G13 A;  1ZM9 A;  2XYH B;  1B4S A;  3UD5 A;  4DPO A;  1SC3 B;  3PVX A;  2YNF A;  2IBK A;  5GAE I;  1GH8 A;  3DHX A;  1YZ7 A;  3EDR B;  4F4X A;  2R8H A;  4RW7 B;  3SSQ A;  4MYT A;  1VBK A;  2ZC4 A;  3BBC A;  1RHK B;  3CD7 A;  2DNG A;  2XLJ A;  1F2H A;  1LWF A;  1WG4 A;  2J8S A;  2W2M P;  4JI5 J;  2FVR A;  4YHH F;  3V6D A;  3DOM A;  3K5N A;  3L09 A;  3Q23 A;  1S1V A;  4C48 A;  4FZV A;  1PJ6 A;  2NPF A;  1RT2 B;  3J7Y I;  1BAZ A;  2IPO B;  2WBR A;  4F7V A;  2RVJ A;  4AQY J;  1UVN A;  1FHT A;  1KTQ A;  3G87 A;  3BSN A;  4ZVQ B;  5RUB A;  2RE1 A;  2UUT A;  4C11 A;  1LK5 A;  5LSL A;  2GO9 A;  5HN0 A;  2IM2 A;  4X4V A;  3B6B A;  5A8W A;  5IC6 B;  2E66 A;  4TQS A;  1NLK L;  1KFD A;  2LDY A;  2VON A;  2E1R A;  2F1F A;  2NYI A;  3MM9 B;  3KK2 B;  3N5F A;  3R2D J;  2HMI B;  2B7B B;  3W2V B;  3H90 A;  3OFH A;  1HBU B;  3BS9 A;  1YLX A;  3GJR B;  3MCS A;  1ACM B;  2GO8 A;  4YS2 A;  2KJW A;  4G1I A;  4NX9 A;  5ETK A;  5A2Q Y;  3PV8 A;  1WNE A;  5J2Q B;  2RDJ A;  4DSK A;  1CS4 B;  2PT0 A;  4LF8 F;  2VG6 B;  4WZQ A;  1FJC A;  1BHN A;  1YJU A;  3GWC A;  4M5M A;  4ED4 A;  3J80 Y;  2Z58 B;  2XMV A;  1MYK A;  2VG5 A;  3JTP A;  3PHT A;  5T41 A;  1SJ4 P;  5F3T A;  3ENV A;  2RIL A;  2QIF A;  2ZOF A;  1QVG R;  1FK9 A;  2NSC A;  3D6M B;  3GU0 A;  4Y2A A;  4OI3 A;  2ABY A;  3S8S A;  5DLG A;  3MOJ B;  3MTJ A;  4KY3 A;  4ZOS A;  1OQ6 A;  2IC3 B;  2HFZ A;  2HYI B;  3H2L A;  2FLL A;  3KWM A;  5HMW A;  4W4M A;  1NSA A;  2QG9 B;  2YKM A;  3KUG A;  2CVI A;  1NCL A;  2OTL S;  4B9L A;  1HYS A;  2OSR A;  4X2B A;  2VOO A;  1S48 A;  3MM5 B;  1GMW A;  2MZJ A;  4TLQ A;  3MFI A;  2ZHO A;  4IG3 B;  1SQE A;  2GML A;  2RKI A;  3BKU A;  2EBE A;  4NLX A;  3ZZZ A;  4DL5 A;  1XER A;  1NUE A;  5CZV A;  4DSF A;  4PPZ A;  4K4Z A;  1JLF B;  5D4N A;  3C6T B;  4DPU A;  2QLX A;  3LJP A;  2VFU A;  3TA1 A;  1JJH A;  5F8J A;  4DI6 A;  2I9S A;  3C14 B;  1S9G B;  3GCW P;  3R5J B;  4AXJ A;  4U95 A;  3UVJ A;  1C0T A;  2MPU A;  3DMJ B;  2RS8 A;  3LAL A;  3NGU A;  4IDK A;  4J91 A;  2HIQ A;  4RKU C;  2R2S A;  3I9V 9;  4DZ6 A;  2HHP A;  3TOQ A;  2FQQ B;  4ED8 A;  1IBL J;  1LW2 A;  4WK3 A;  2B5J B;  5DG9 A;  3D68 A;  4ZVO B;  3J81 j;  4DFJ A;  3FBE A;  2ZH5 A;  2ZVS A;  1XWL A;  2BBE A;  2AQ4 A;  1N0U A;  1UKU A;  3DLJ A;  4H4K A;  5FDL A;  1FCA A;  3OPK A;  2GW8 A;  4ZKA A;  3R27 A;  1RQ0 A;  4DR7 J;  1RT3 A;  4RBV A;  2HBQ B;  1RWV B;  4C8Z A;  1BDV A;  3KK3 A;  4UTG A;  3TWZ A;  4DR7 F;  4C2M A;  3SBM A;  5KG3 A;  3CDB A;  4CYU B;  4U7C A;  2G1D A;  2BEF A;  2BE2 B;  1MU2 A;  3AQP A;  1YGY A;  4USU A;  4XTT A;  2QA4 G;  4JI7 J;  3JSB A;  4IRD A;  1UWA A;  3DDK A;  4XPE A;  2HHH F;  3KK1 B;  4EEY A;  1DLO B;  4J90 A;  4CLU A;  2WTF A;  3M2R A;  4Z2X A;  3Q8U A;  4L75 A;  3VAM A;  2GQQ A;  4A46 A;  3JAM Y;  1UVL A;  1JJ4 A;  3GSI A;  2OFG X;  4TY8 B;  4ZJL A;  4OZL A;  4DL6 A;  3VAJ A;  2ZZM A;  1WI6 A;  1KP6 A;  2BE2 A;  1QVF R;  2DIU A;  2AJ4 A;  4WP3 A;  4A47 A;  4F4A A;  4WFA Q;  1WTF A;  5HO4 A;  2CA9 A;  1X93 A;  4DUZ J;  1DRZ A;  4NLY A;  4ILL A;  3G82 B;  3RW7 A;  5EX3 A;  4KTQ A;  2K1R B;  4M5D B;  2YPY A;  2MKI A;  2YPZ A;  5D0H A;  3TYT A;  2H1Y A;  1Y0H A;  1S0V A;  3BN7 A;  4G6V B;  1NDC A;  2C1E B;  2KRR A;  2LQB A;  4CO2 A;  1HKA A;  1AUS L;  1MWQ A;  3MPW A;  4YDD B;  3JQJ A;  2KH9 A;  3CVK A;  3HHD A;  2OP5 A;  5T7L A;  2BOP A;  1SC4 B;  3CC4 S;  5JVG Q;  3OTB A;  4RW6 A;  5J2P B;  1VC0 A;  2FGO A;  2YNI A;  4HAC A;  4DQR A;  5K14 A;  1H6K X;  4O0I A;  2KXN B;  3SMZ A;  4OYM A;  1D8Z A;  3J81 U;  1T9U A;  4NLO A;  4USM A;  3BGR A;  5DDR C;  1M5P C;  5EWF A;  1HQU B;  2VKR A;  1HWI A;  3NLC A;  3MMC A;  3O44 A;  4L76 A;  5G0R B;  2KN4 A;  2W9B B;  4NCB A;  1V9O A;  4H4M A;  4O4G A;  3R3T A;  3HHE A;  1CQM A;  3QRP A;  2VAS A;  1FJG F;  2CJX B;  3W5X A;  3QGI A;  1OYD A;  8RUC A;  5L1I A;  1X4F A;  4WTY A;  2MEW A;  1RYS A;  3GV5 B;  2UU9 F;  3CCR S;  4JI0 J;  2KO1 A;  2QL7 B;  5HK4 A;  4AL5 A;  1SQG A;  3FMT A;  3VGU A;  2GGP B;  1WDT A;  4PQU B;  3MPU B;  3NGR A;  1I51 B;  2DNO A;  1U47 A;  3AA8 A;  1Q1K A;  4UT4 A;  1G1X A;  2E44 A;  2LXU A;  1M5K C;  4YUD A;  1I5O B;  2BVZ A;  4WU3 A;  2RUG A;  3TEH B;  2JC0 A;  4R5P B;  3NOG A;  1GX6 A;  2CG4 A;  4KGK A;  3GIJ A;  2BQ3 A;  4QIE A;  2ZUG A;  4PXD A;  3M8Z A;  4K5R A;  4ZK7 M;  3MPY A;  2RQC A;  4I1T A;  4ID5 B;  1TV6 B;  4IG3 A;  4IG0 A;  3J7Z T;  1KBR A;  4N8N A;  1AUD A;  1LOU A;  2A10 A;  5FD1 A;  4X65 F;  1T03 A;  1Q7Y T;  3C16 A;  4E8U A;  1RU2 A;  3SDE A;  4CLS A;  3G71 S;  2H4W B;  1CQN A;  2YWK A;  5LMN J;  3I0R A;  4DCJ B;  3CJ0 A;  1JLG A;  1UWB B;  2YNH A;  4M94 A;  4OI0 A;  1IKV B;  3K8V A;  2JXI A;  3GXQ A;  2WB1 D;  2MZQ A;  4PWW A;  2FDN A;  1FTR A;  2O67 A; 
#chains in the Genus database with same CATH homology
 2PC6 A;  1ARR A;  2WVB A;  2BSQ E;  2HZV A;  1Q5V A;  2AY0 A;  3QSI A;  4HV0 A;  2BA3 A;  1MYK A;  2BJ8 A;  1BDT A;  3PHT A;  2CPG A;  3FT7 A;  1BAZ A;  2WVC A;  3QOQ A;  1U9P A;  2BJ7 A;  2K29 A;  2CAX A;  2WVE A;  4ME7 E;  1PAR A;  2CAJ A;  2BNZ A;  1NLA A;  2K1O A;  2BJ1 A;  2FGC A;  4FXE A;  2K5J A;  2BNW A;  3VEB A;  1Q5Y A;  1P94 A;  2K9I A;  2CA9 A;  2WVF A;  3VW4 A;  1X93 A;  2NZC A;  3LGH A;  3H87 C;  1IRQ A;  2JXG A;  1MYL A;  2CAD A;  2Y3Y A;  1B01 A;  1BDV A;  2KEL A;  3OD2 A;  2F1F A;  1QTG A;  3BKU A;  2JXH A;  2GPE A;  2RBF A;  2HZA A;  1MNT A;  4D8J A;  1EA4 A;  2BJ3 A;  2WVD A;  3VEA A;  2JXI A;  1ARQ A;  3GXQ A;  3BKF A;  2BJ9 A;  3FMT A;  3BKT A;  2K6L A;  2H1O E;  1B28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...