2BJ7A

Nikr in closed conformation and nickel bound to high-affinity sites
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
MELIRFSISIPSKLLEKFDQIIEEIGYENRSEAIRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEIISSLHVHMDEHNCLEVIVVKGEAKKIKMIADKLLSLKGVKHGKLVMTSTGKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pyrococcus Horikoshii Nikr: Nickel Sensing and Implications for the Regulation of DNA Recognition
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transcription
molecule keywords NICKEL RESPONSIVE REGULATOR
total genus 37
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2bj7A01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2bj7A02
1MYKA 1QTGA 2CAJA 4D8JA 1ARRA 1MNTA 2KELA 2BNZA 4ME7E 3FT7A 2BSQE 1Q5YA 2F1FA 2JXGA 2JXHA 1BDVA 2K9IA 2CADA 1Q5VA 3H87C 2HZVA 1PARA 1ARQA 2BJ9A 2CA9A 1X93A 2K1OA 2BJ1A 2HZAA 3FMTA 3VW4A 2K29A 2RBFA 2H1OE 3BKTA 2CPGA 3BKUA 2BJ8A 2WVBA 2WVCA 3PHTA 1NLAA 1B28A 2PC6A 3VEAA 2BNWA 1BDTA 2NZCA 1EA4A 2AY0A 2K6LA 2WVFA 3LGHA 3OD2A 1B01A 2FGCA 1BAZA 3GXQA 2Y3YA 1MYLA 3BKFA 2CAXA 1IRQA 2JXIA 2WVDA 3VEBA 2BA3A 2BJ7A 4HV0A 3QOQA 2GPEA 2WVEA 1P94A 1U9PA 2K5JA 3QSIA 2BJ3A 4FXEA
chains in the Genus database with same CATH superfamily
3QGIA 4NXMF 4K5SA 5HVGA 1WACA 2HG4A 4DDFA 5BXIA 3UNYA 2IM1A 1HNZF 3LW5C 4DOZA 2ZDPA 3FZ2A 1FDDA 4RR5A 4TQRA 3OSPA 3AB4B 3GB0A 3SCIE 4PYAA 1UVKA 4L74A 2KG1A 3C19A 2XLIA 3CD0A 5F0UA 2XMVA 2E44A 4L6V3 2I5JA 2DT9A 4B08A 3F73A 5KG6A 1N88A 3HP6A 1HARA 4A8MP 3SSQA 2W4PA 2KRRA 5C2GA 4NXMJ 2LXIA 3HD1A 3A3OB 3N5BA 3NOGA 2UVWA 3OJUA 4CH0S 2RKIA 5D0HA 1HMVA 2QC3A 2WW4A 2O01C 5IQQA 4DR3F 4DFJA 2YTCA 1XNRJ 2YNGA 1W2BR 5KFBA 1R27B 4O3OA 1AZSB 1JLGB 1YGYA 2H3EB 4LBHA 4OYAA 2R8IA 2HAFA 2QA4S 2EK1A 3SCJE 4ETZA 2CQIA 5I42B 1UEKA 2QYGA 3DRPB 3ILOA 2QYCA 4ZP7A 1PJ6A 3M2RB 2HQDA 5HANA 4USUA 2OPSA 3NY0A 3PACA 5F8GA 2F9DA 1G6BA 2MHNA 2P6SA 3SSRA 1Q7YT 4OFZA 5CYMB 5EUHA 3G8TA 3IRWP 3KK3B 5KFKA 3MMBB 2OFHX 2DK2A 4H4KC 1TKTA 2RS8A 1VQ8S 1Q8IA 1TK0A 3Q23A 4CIOA 2UP1A 1HWLA 3TAMA 1S57A 2HNZA 3MECA 2AYGA 1OY8A 1T05A 3V4MA 2RKIB 2C42A 1G4CA 2DGVA 4PABA 5CYJA 1QVGR 2ZOFA 1VIOA 1X4BA 2VFTA 3ZZYA 1Z1ZA 1R6VA 4YP3A 2XULA 1RBLA 3K8WA 5D3GB 4B3RJ 2DNYA 3SFUA 5IT0A 3JSRA 1ZZNA 1H3DA 5THWA 1LK7A 4C8OA 2VU5A 3UVJB 4KB7A 2WK4A 4DQQA 1RT2A 2YWKA 2J9DA 5LJ5Y 1HWIA 2IDLA 3KG0A 3MR7A 3B8HA 2MQPA 4ZDNA 5KFZA 3PRBA 4A4JA 1W26A 2HFUA 2GNKA 1RBAA 2AGPA 5F9LA 3CDUA 2GMHA 2XY6A 2CVEA 3DOMB 1WKJA 3HSDA 3MOJB 1FRMA 2OPPB 4NCGB 2AMCB 2HHSA 5DGAA 1R0BG 4UW2A 1RAOA 2OJ3A 4IYQA 5H9EJ 4OLPA 4OYIA 3CIMA 1T03A 1SJRA 4LFAF 1SH3A 1Y4ZB 3BDPA 4YOEA 1WDDA 4UZCA 1VC0A 1VYAA 2QRRA 1MU2B 1LWFA 4DZ6A 2EKYA 2XC9A 4M63A 1S7HA 2MQ8A 2XZWA 3NOCA 2ASDA 3M6UA 2IA6A 4DX6A 2XGPA 2M0GB 1LWFB 3J7ZT 4P52A 1YG0A 2EW9A 4ZVHA 3T6JA 2GX8A 5EWEA 5KFVA 4DCPB 2JXHA 4E2FB 3MUVP 2KG0A 1WC4A 1RT1A 5C5JA 1DHMA 1VISA 2BE2B 4C8MA 4CO5A 2LCWA 5CCLA 5K14B 4LBIA 5T7LA 3GU0A 3SIPB 2VBZA 4P2SA 2CNOB 2Y0BB 4USWA 1ZOTA 4WP3A 3VR1A 3ZNUA 1CJUB 3DLBA 2W2QP 4UOHA 1HNIB 4F04B 4ED0A 3I32A 2Q1LA 2BX6A 2HBRB 3D6TB 1VJQA 4K50A 1S0MA 2A2CA 3C16A 3OUYB 4HDHA 1YTYA 2EFNA 1UZDA 2XM3A 4DL4A 2GC8A 3KJVA 3R7BB 3T19A 1RTHA 3IFEA 2JVOA 1ZTTA 4N47A 4RNNA 1TL1A 3MCOA 1LKZA 1WJ9A 2BRKA 1Q79A 4KRWA 2RRBA 4YB5A 2LYVA 4A46A 2ADBA 2XS2A 2EVZA 5DQIA 5J2NA 4DS4A 2A3JA 2VD3A 2OPRB 1HPZB 3CMQA 4B3RF 1AW0A 2P6TA 1RT4A 3K5PA 1CJTA 2RH3A 1J2VA 3NCQA 4MH8A 5HO4A 5E33A 2H1OE 1K1SA 1UL3A 2VPWB 5D0RA 4B9NA 1NLKL 3ENAA 4F3OA 2I1RA 4CWBA 5A2QU 1MROA 4QOTA 2B56A 4DL0C 4WFNQ 2Y1IA 1RISA 3GE9A 4LRCA 3EXYA 5DG9A 4NCAA 4WZMA 3HCXA 4C8NA 4E8UA 1TVRB 3M9NB 4J9RA 2W4CA 3PR5B 5EX3A 2NQPA 5LT5A 4OX6A 2ZKUA 4LIRA 1JXLA 4CO0A 1FRKA 1T94A 4JV1A 3KJQB 3FBFA 4BLGA 1X9WA 3AD9C 2KI2A 5DDOC 3M9OB 1Y11A 1SH2A 3A4TA 2I6WA 2DGUA 4URQU 2B3TB 1APSA 3PYGA 1F9HA 2GQCA 1NB2A 3TUIC 1RT7B 4NLGA 1GNKA 1U2CA 1L3SA 2Z56B 4PG5A 3LJPA 1SIWA 4DR3J 3U1LA 5CHCB 1M5KC 4P6QA 2Q2KA 1FRIA 2BW2A 3C15B 4FXVA 4G1IA 3I9ZA 2KFYA 2DNGA 4DG1A 1EB0A 2M52A 5HAOA 8ATCB 2ZM6J 2VG6A 2MKKA 4TNOA 1TKXB 2NYIA 2VFSA 1NEEA 1JLBB 3FBBA 3GR1A 4DV3J 4QYZK 2IC3B 2UUAJ 3SCLE 2RVJA 2MKYA 3AD7C 4AAIA 1DARA 3IN5A 1QTMA 2ZHBA 3HDSA 2N4CA 3OVBA 2BMBA 1U9PA 1RTDA 2ZH2A 2L9NA 3BPSP 4DUYF 2RILA 1IBMF 4GC6A 3U1NA 3VAJA 1R8CA 3IGVA 3LAKA 4DPWA 1PYOB 2ZH6A 2HWIA 2GGPA 1FRXA 2GMJA 2IVMA 3FT7A 4DQSA 4M5LA 4ZLPA 2J0SD 1FD8A 1TV6B 2GAGC 3A8KA 3CTRA 4TXSA 3TP2A 1HHQA 4RUCA 3DKDA 3FQLA 3AT1B 3HI9A 1ZYQA 4EEYA 2H48B 1QUPA 1VRTA 1WEXA 2VB6A 1BQXA 1E6YA 3M2UB 4RWWA 4NRUA 2BJ8A 2HRTA 4R5PB 4GVLA 4JI2J 4DR7F 2QMWA 4EO8A 1J5OB 3M2UA 2Y0SD 3QO9B 3LGMA 5LMUJ 1DTQA 4LIWA 2UUTA 2JL9A 3D5MA 2RMLA 4IFVB 2VQFF 2B0GA 5D4OA 2VOPA 5K8PA 4PKDB 2EK6A 5HQ8A 3VAMA 1U2FA 2WRMA 4U6PA 2F7VA 3QGPA 1S9GB 1PC5A 4Y00A 2HNYA 2HLUA 1L3TA 2H54B 3EZUA 1AFJA 2QZ8A 5IZHA 4ME7E 3RW7A 2VICA 2WBRA 4ECWA 3V6KA 3OW2R 4MJWA 4DU7A 2DH7A 3M8WA 3D28A 2LA6A 4BC9A 4NA3A 1FXDA 1HIYA 1KLMA 5HQMA 3KJNB 4CLZA 4AQYJ 4IFYB 1XEZA 3EGWB 2O66A 2OD4A 3LP1B 1TL7B 1NK5A 2NUHA 3UN3A 2YKNB 4U9RA 3W2VA 2RE1A 3IBFB 2AYBA 1EA4A 2GZOA 3LGHA 4B3SF 1RXOB 1URNA 1TL7A 4DR4J 4RBTA 4O3SA 4ES3A 5T14A 2HQ3A 1B70B 1H2VZ 1TR0A 1GMWA 3MEKA 2NSBA 3IR7B 3IAM9 3QGHA 3NKYA 3H25A 4OJGA 3V6JA 3TNVA 4KV8B 4AXJA 4EU0A 2HNDB 2KH9A 3MAHA 3ZZOA 1BUXA 2UVRA 1IM4A 2V94A 1UJ6A 2ZUAA 2O1PA 4J90A 3TVZA 3H2LA 3MTJA 2QSFA 1YBUA 3AOBA 4G6VB 1WUUA 1FJCA 3ISNC 1URRA 2ACMA 4ZIVA 3FNNA 4ECTA 3UI3A 3CCTA 3OT9A 1O0PA 3P3DA 4EUVA 2V2KA 4KGMA 4RBUA 1HBUA 3UCGA 2VA3A 3VQSA 2ADLA 2VV5A 4O4GA 4QR0A 1RA6A 5A8WA 4JI5J 1N33F 2ZH7A 2IYIA 3HHDA 2EC0A 2CJ9A 1T9YA 4MT1A 2LFVA 2NXNA 3K2YA 4DI6A 5KT3A 1N4LA 5C24A 2PA3A 3QPIA 3FEZA 2DNLA 2PSZA 2V67A 3EICA 3T1YJ 3IAS9 3NLCA 4N8OA 4BC7A 1NZ8A 4IFVA 5KFFA 3PW4A 1YJ7A 4OHYA 4R0EA 2JWNA 1QTGA 1Q53A 2Q6CA 2DXEA 3A8EA 5IS2A 2QA1A 1RT1B 3IMQJ 2DRAA 1FA0A 2R7RA 3IR6B 1WKKA 1YBTA 5AE3A 4KPCA 5A8KA 1EQMA 4N41A 1F6TA 5HSPA 4L73A 2CNLB 2FHJA 3BV8A 2ROPA 2LMIA 4H4MA 4OZ1A 3FSYA 3M1VB 3T5LA 4FS2A 1X4DA 2UUAF 4OX7A 4I6AA 2DRDA 5KG2A 3MEEB 3LANA 4WP8A 1S10A 2DCUB 1UWBB 3RB0A 1K0VA 1PYSB 2N7YA 2WOMA 4WTYA 5HMWA 3VEBA 2XY5A 5RUBA 2HMIB 4DL5A 4ES2A 1H74A 2Z0GA 2V50A 1HI1A 1NMEB 2CJAA 2XBPA 4M5NA 4ZPAA 3TW0A 4ED1A 1HR0F 2MKHA 1JLFB 1FFSB 3TQ1A 1NNDA 4LF5F 3QJPA 3S7RA 2DTJA 3PJWA 3OVAA 1CC8A 4JV2A 2JFKA 4CNYA 3UWTA 3BN4A 1RT6B 3EGZA 5KFMA 2CPJA 1SXLA 5KFIA 1S79A 3D68A 1W25A 3R5CA 5KAKA 1CQMA 3GCXP 4P9SA 5HMYA 3CC2S 3U27A 4USMA 4HDGA 2VBYA 1JJ2R 1EQ0A 3BYPA 2OMOA 2M5YA 1HNXJ 2W7OA 3T9NA 3DLHA 5KFQA 4LF5J 2AN7A 1JKHB 1MWQA 2L08A 4MK8A 1K0TA 1OY6A 4IO1A 1FFGB 1I5OB 3QAEA 3C2PA 1CSJA 4FBUA 1HD1A 1RZMA 3MMBA 5HJYA 3A3PB 5FJ4A 5M2RA 1YHQS 3FDSA 2KT3A 4CI0B 3KLVA 1FERA 3W7BA 3CJ0A 3MMAA 4RW6B 3TA0A 4CO1A 4X4OA 3MR5A 1G3OA 3MURP 1VQ9S 2QIFA 4L3KA 4DR6J 3G8QA 1HL6A 3GR0A 1N5SA 1S12A 2BYCA 2FHOB 5SZTA 3J7AN 2A2BA 2W2NP 1H7XA 3M6XA 1NJWA 3K58A 2GA7A 2EPIA 3MUMP 1HLWA 4MFBB 2APOA 1TL1B 3KK2A 2PT0A 2LQ8A 1FTRA 3TX8A 4U7CA 2WVCA 1RYSA 1N5YB 4X4VA 4TU8A 3DRRB 1VCTA 3BO3A 3CD7A 1WSRA 2QL5B 4DWIA 3M6VA 2FLOA 3T5JA 4ZJOA 3C6UB 4H4OB 4BHQA 1HW8A 1RHQB 4DR1J 3IO1A 2WOMB 4A8XA 3CDWA 3EWGA 4NCGA 3V6DA 1KVIA 4NYPA 4O3PA 4P71A 4BS2A 3DOKA 3NCRA 1SKUB 2Y8YA 3HKWA 1CULA 2WONB 1LW0B 2BSQE 1NDKA 1Q5YA 1VRUB 1IM6A 1I1GA 1YQHA 2CPEA 2K2PA 2YPZA 3GFXA 2Z57B 1RTDB 3PEJA 4ZP8A 5LOQA 1ZPVA 2GVDA 1FX2A 4FVMA 2NLWA 1S6PA 4DPTA 3GIRA 4BCAA 2K29A 1TUGB 3E01A 3DRXA 2AT1B 1OS5A 3BKUA 3PYEA 2F3JA 4LSNB 4Y3CA 1F2GA 1Z2LA 2EG2A 3CCMS 4MIAA 3PKMA 1NDLA 3UD3P 2HHXA 2ZITA 3MPDA 4OHXA 4LREA 2Y3YA 5F3TA 2O67A 3G71S 4LMZA 3LA0A 2CAXA 1WHVA 4NLRA 4UOGA 3HK2A 4L75A 3OFHA 1WG1A 4X4SA 2KYXA 1XMOF 4MFBA 1H72C 1NDCA 3JQKA 2NS1B 2RU3A 2L41A 2H9ZA 2XCAA 2EG1A 2DPJA 2D74B 3GTYX 1HWKA 1HFEL 3G86A 5KFNA 4DXLA 1Q16A 3D0GE 1HQ2A 2ZJQQ 3MR3A 2GQ2A 4QQBA 3ZTSA 3E51A 2DD8S 3M32B 4C8LA 3QZ8A 4K4ZA 1SL2A 2BKOA 4NASA 3OL8A 3EE3A 2AKWB 1NHUA 3OTOF 3KK1B 1KC8T 1QLNA 3QJJA 2AWZA 1S1UA 1S1TA 2UXBF 2YQ0A 3OHBA 3IC1A 1WOOA 4X4TA 4PXEA 2EXUA 2H5IB 1H38A 2DHGA 3J7YI 3OR1A 5A8WB 2OSQA 2IYGA 5KOWA 2R8KA 4RX6A 3DRRA 2UXDJ 4KV8A 3KOAA 4FP9A 3SI8A 3KG4A 2IDEA 4UUXA 2V0NA 2OTJS 3EPGA 3CEDA 4KKOB 4J9NA 4MKYA 2ADCA 1U6BA 3VCDA 3FFIA 3J80Y 4AT1B 1EKSA 1RLCL 2AIRB 4DL3A 3B4DA 1RACB 4ED5A 2JHEA 2ZWPA 1WC0A 3RRHA 1KOHA 4HTIA 2FLLA 3P49B 1VQNS 2HVDA 3PEHA 3LWMA 4IH5A 4NI2B 2I0XA 1RT2B 2DO0A 4O23A 2PC6A 2E5LJ 2BNWA 2Q3PA 1R8BA 3LP1A 3VQTA 2ZWOA 1T9UA 5GMDA 1Q4RA 1Y5NB 4Y2MA 3CSKA 4DPUA 4ZCMA 4KO0B 4F4WA 1C0UB 4LF9F 3QJLA 2WB1D 1KBRA 5G4DA 3LPYA 2IY5B 2KHDA 3IRXA 3J81j 1YJNS 3VTIA 5B0GA 2VOOA 3M8PB 1WOSA 2MQQA 1ZZFA 3R6LB 5JUMA 4LQ3A 2ZM6F 1S9GA 4A8WA 3A1YG 2KOEA 2HNYB 3THPA 3H87C 1DTTB 1TQLA 1YJ9S 1NM2A 5K8NA 2FQQB 5H1SV 2YKMB 2HZAA 1L3KA 3GFYA 4ED6A 2ZNYA 2HQCA 1T9VA 3PNIA 4YMEA 2DYAA 3LUYA 5DS7A 4L76A 3LALA 3OR2B 1R0AB 3M2RA 1IBLF 2MB0B 2I2YA 1YRXA 2RAQA 5ETSA 1NSQA 3BM7A 3FKBA 3ITHA 1HBMA 1HQUB 4CO2A 4J9MA 1FXRA 1S4EA 3E2EA 1MYLA 3M8SA 1L3UA 2FHJD 4OLOA 3P5BP 4KH0B 1FWKA 2CQ4A 2HGNA 1HBUB 1DQ8A 3CJQA 4UF4A 3KHHA 4DL7A 1FWPA 1CS4B 4M5DB 2V2VA 5BR8F 3G96A 4YDXA 2AZ1A 4K4XA 1S59A 4Q45A 1N33J 1U47A 1VRQC 3T3FA 4B9SA 3L7UA 4ZOSA 3DFEA 4HEA9 2W8LA 3UO0A 1NAQA 5IQ6A 1RA7A 2OEMA 2G0JA 3FZBA 1MN7A 4ZN3A 2B4VA 3NGUA 4XDDA 2DXFA 4NLXA 4UTGA 3LP2B 4DUZF 5AXMA 1RAGB 3H5YA 3LH2S 1ZS6A 5KG3A 3CCQS 3K8VA 4F4ZA 1F5BA 3BBBA 4U8YA 3W1YC 2IRXA 3VVTA 4CYUA 5KFYA 4V19X 2ZKTA 4DV2F 2MSSA 2Q79A 3ZZUA 3TZXA 1Y3JA 3I96A 2XI2A 3BEGB 2R7QA 3I87A 2DHHA 2NXUA 3WDOA 2A1BA 2XG8A 5DO2A 3C6UA 4C3KA 4Q43A 4KPYA 3CULA 5CZXA 5GAGI 2JX2A 3FCHA 1U24A 3QRQA 4RW8B 2M88A 1GK8A 3EPIA 2KFZA 4IDKB 1S1VB 2LECA 1BWEA 4DL6A 1PJ7A 4NZ6A 3PXGa 1CJKB 1T0TV 3VWSA 4RW8A 1FTCA 3MM9A 3CMES 4LF6J 3MAAA 3OL7A 1QAJA 4OYPA 3IR7A 4ZVGA 5LXYA 5ETOA 2VG6B 1NB7A 2HW3A 3R2DJ 3D6HB 2EFOA 2GCFA 1GMWD 2RBFA 1JMTA 4DCOB 2YNFB 3GIMA 2W9BB 1QE1A 1WHXA 2P9CA 4X66F 2HFZA 1RSCA 1D9DA 4YUDA 3PJ9A 4CYUB 1FE4A 3O5TB 2RQ4A 2RHSB 1LW2A 1U0SA 3C6TA 1TL4A 1I3OB 5F41A 3TZWA 1IKVB 3TUJC 3HO1A 5E3AA 2WVDA 4ZS6A 1UA0A 3AQPA 2CDRB 2VQFJ 2BXJA 3FBCA 3TZZA 2CPXA 2XHCA 2ZD1B 1MNTA 2MZ1A 2F63A 3D1OA 3MPWA 2RT3A 3WX8A 5CABA 2QGFB 2V8DA 4M5DA 3GYXB 3QLHB 4JI4J 4ZVSB 3CPWR 2D3O1 2IM0A 5AJ3J 3DHXA 1XERA 1ACMB 3DRYA 1V3SA 1REVB 4ZHRB 1DTQB 2YH0A 5H9FK 4CTAA 2E1AA 2VPZB 1RWXB 3OFGA 1N54B 4X4NA 3GJSB 3I56S 1S1TB 1B0VA 4C97A 2FDNA 2K1RA 2R2RA 1R43A 3NGKA 4HACA 3RW6A 4YHHJ 1X9SA 1S1WB 2MZJA 1SVDA 1VFJA 2E5HA 1GMVA 4RW9A 1U02A 2MZQA 4ZVEA 2EC2A 4LF7J 3GYNA 3D1HA 1VJWA 4ATNA 2FHKA 4ED2A 2ZOMA 4W4MA 2IRYA 2J9CA 2AJ0A 4WKYA 2AYEA 5F8NA 3M2VA 3QIDA 3OL9A 3AD8C 4EK2A 4JI7F 2CZVC 5DQGA 2YX4A 1TK8A 3CCES 1QVFR 4TU9A 3F0NA 3US5A 3EVMA 3G6XA 3CDEA 2V4JA 1C4CA 5EGYA 4PXDA 3IM9A 1RAHB 4Y2IA 1HNVA 4ZPTR 4ES1A 1FKOA 3BGLA 5E0OA 4CRJA 3TYTA 1MLAA 4DV0F 4IOCQ 1U8WA 2BM0A 2IA0A 2Q6BA 3ZTQA 1IWGA 1M5OC 2FLNA 2KVQE 5CCMA 3KJFB 1JJ4A 1TL3A 2EBEA 4JOUA 2VBWA 4KY3A 2XS7A 4OQJA 3MR2A 1B3TA 3ZXWA 5CD4H 2CPYA 2NZ4A 3D3CJ 2B7CB 3QIPB 2R8JA 1CC7A 3QSIA 5IWAF 4HLBA 4WU3A 1DBDA 2B5JA 3Q24A 3CDBA 4LSLB 4ELVA 2ZZNA 1B4SA 3N0VA 5IT9U 2N3OA 4WK3A 3L4BC 3PYFA 3PVXA 2GV1A 3TJ9A 2POKA 4S0MA 2J6SA 4DSEA 1RABB 1NHKL 1VHFA 2DEJA 2E66A 4I0WA 4X62F 4ED3A 4U7UD 2HBQB 4G3IA 3MF5A 2V68A 3HF5A 2YX7A 5ITHA 3KHLA 4JI0J 4M1KA 4OYBA 4F4YA 4TQSA 1KD1T 3DLGA 1NHVA 3W5XA 3V81B 1HYSA 5FIIA 3Q86A 2AD9A 3QAUA 2CQBA 2DNNA 2AEMA 2PD1A 5KFCA 3NAIA 2LVWA 3K57A 1ZM4A 3ULHA 1VBYA 2BOPA 4OYOA 3G6ES 2OPQA 2CPZA 4OYZA 4TN2A 2QA4G 4IQXA 1HPZA 4TVAB 3GG0A 4ECXA 5A76A 2WVBA 4F8RA 4NLSA 1U1PA 1JB0C 1LWCB 2D9PA 4CNZA 1HNWF 2WHOA 2QLFB 4UQTA 5K9FA 1U1MA 3CMAS 3DCAA 3MEDA 5IT9Y 1RKJA 1RWNB 5HROB 1I6JA 4OV1A 3BSOA 1KWMA 3TAMB 2RIJA 1IJEB 3TR5A 1V6HA 2B5JB 5LL6d 3CJTA 4B3TF 1GFWB 1VRUA 1YITS 1SI9A 3W64A 3RU0A 1M90T 3NMRA 4WFYA 4GKKF 3TAPA 3UNGC 1IXKA 3BR8A 4P7VA 2LQBA 3TVKA 1ZH5A 3RAMA 4DR2J 2HFOA 3BJYA 3O3LA 3K89A 3EJMA 2FVSA 1NK7A 3T1HF 2VFUA 3PW5A 3QIPA 1C0TB 3ZTPA 1NKEA 2CJKA 1UVLA 2CJQA 5D4NA 3SYZA 2XLKA 2GO9A 3KUHA 4QWCA 4QIFA 3G6VA 1FEEA 4DX5A 2FC8A 4OZ0A 5F9NA 1WHWA 3HHKA 4RNMA 4ZVQB 3KDOA 4O44A 3QWPA 1ZPWX 2J6UA 1XN9A 5BR8J 1VLOA 2AF6A 5K8MA 4X4PA 5IT4A 3SZ2A 1YI2S 1NKBA 4RKUC 3LF0A 2MYFA 1LWCA 2XMTA 3POTA 2M7SA 2AEFA 3CJKA 1X4AA 2CXEA 3IGNA 4W98A 1V9OA 4QYZJ 1LWEB 2MEWA 2KJVA 2DNOA 2X51A 1HQEA 2W7AA 2J76E 1M5SA 2V8HA 2BM1A 4I2QB 3OHAA 1T9TA 3DOMA 4WK1A 1IR2A 1GX5A 5U47A 4BWJA 1MNEA 3FRZA 3N4WA 1FD2A 1Y10A 3J7YU 3PKYA 4LF6F 2CKWA 5K8OA 2HKEA 2DCLA 3D4JA 3Q2SC 3H7HB 4MKBA 5EWFA 5GAEU 2Y8WA 3R5GA 5KG5A 2V34A 3W9HA 4TY8A 4FN5A 2XO6A 4NLWA 4DEZA 3ISND 2AJQA 4RUAA 1EKRA 3CW2C 4MTPA 4ZPCA 1JWWA 2CADA 3S01A 3FK4A 2CA9A 2GQQA 2KT5A 4L3NA 2HHQA 1U2RA 4A8KA 1YKWA 4HR2A 4K0KF 5E7OB 2J5AA 1Q7LB 4NLDA 2DR8A 4DJBA 3JQJA 4Y2KA 4Q2MA 4ZA1A 4FXWA 3A13A 1NLAA 4B9TA 4U67Q 1RTHB 3W9IA 1GEHA 4MYUA 1U6FA 2VDIA 1VQMS 2RQCA 4WPAA 2MKIA 4PXBA 2VH7A 1BAZA 2XMUA 2ZH3A 4HL9A 4NLTA 5B0DA 5D8HB 3HHLB 3GJQB 3UFCX 2XNRA 4DMZA 3PX0A 2I9SA 4KHPF 2PFDA 4PYDA 1EP4A 5CYMA 4DFKA 1Q86T 3BQ1A 4HT7A 3F41A 3O8WA 3W3SA 2RRNA 2VG5B 3SBMA 4ZKAA 1SC1B 2W2PP 5IM0B 1NK9A 2FJXA 1U0HB 1XMBA 4CLUA 2W2MP 3NGRA 4OHWA 2K1OA 3PJXA 3B78A 3SQGB 1X4CA 1NH8A 2M9KA 4LF9J 3WBZA 1GMUA 1OY9A 3DOLA 3SQOP 1VMBA 1RTZA 3GYGA 3UN5A 4FF3A 4OL8A 2QJ3A 3MDFA 2CQHA 3KLGA 4XK8C 2VQEF 3POTB 2OUGA 4FYVB 2AJ2A 2MQLA 4RW9B 3G82A 5IOLA 2MY7A 4EBDA 2C2MB 1LFWA 2ROGA 1AYEA 2C22A 2FJEB 2COLA 2J9DE 3C14A 3WC0A 3LO3A 4LSNA 5I3UB 4X64F 3R5DA 4DZDA 4X84A 3JSYA 5B0FA 3HSGA 4GRSA 2EFVA 3W5YA 3M2VB 2R7VA 4Y0FA 3PO5A 1R89A 4ICLA 2VIHA 1YDLA 1UWAA 2W1BA 5ETQA 1OJ4A 2DO4A 5A0YA 4WXOA 2OEJA 3DI6A 1W2IA 2MZRA 3AOAA 4PR6A 3Q22A 3RBXA 2V4JB 2XMJA 5F8HA 2B9EA 4IRCA 3U7JA 4K2XA 3DI6B 1CPZA 5C24B 4R8UA 4PG8A 5IV4A 3CO9A 3OBIA 5AE2A 4WCEQ 3G4SS 2ATLA 1ZBTA 4XPCA 5IXUA 2DNHA 2MLYA 5FD1A 4ZVFA 2DY1A 1PIEA 2WZ1A 4HKQA 4WE1A 5ETRA 4E0DA 2VKZG 5AXLA 4P72A 2ZHAA 2R7XA 1BD6A 4G1QA 4KH1B 3FUYA 4JI0F 3H4BA 1FK9A 4TLRA 5KG7A 1IBKF 2V69A 3D9BA 1J5EJ 5J2MB 3UDCA 2AX1A 4YR0A 2BW7A 2HBYB 2D9OA 2A2DA 3QMQA 4C7QA 2QO3A 1HI8A 1X5PA 3LQVA 5A0YB 3Q8VA 3FJ2A 5A8RB 3P5TL 4LF2A 4CLTA 1X5OA 4QZVB 2R2UA 5LXRA 3GIJA 1A9NB 1XK8A 1RAIB 4ZLJA 3KWMA 2R7WA 4WFZA 4DR5F 1Q81T 4KYZA 3V6DB 1B64A 1N36J 4B3OB 2KL8A 1SH0A 4P74A 1RJJA 3M8YA 1KFDA 1S1XA 1GT8A 1YX2A 1TV6A 3H59A 2GO8A 2Y1LB 5K5MA 4H4KA 4KJIA 4K5RA 1DJ0A 2FZKB 3HT3A 2CPHA 1P6TA 5LMNJ 1R3NA 4ZCLA 1V3RA 2ZVSA 5JJBA 2BA3A 2BE7D 4U7UK 1E6VA 5DLGA 5IV3A 2MTLA 4B3MF 4ANDA 1RK8A 1FDBA 3VV2B 1ULRA 3KHRA 1ZTWA 3K0JA 1MN9A 3AA9A 3DN9A 4CM0A 2BABA 1E6VB 2DR6A 4ZPBA 4A8YA 1WKLA 1AT1B 2ZC3A 1OWXA 2LU1A 4KFBB 3AXKA 3VAKA 3C46A 2I8EA 5B09A 4Q7AA 2NCKL 3PCOB 4OI1A 4IUFA 1BWVA 2DITA 1EARA 2F9JA 2M4MA 2L3MA 3R5JB 4LF8J 1RU1A 3JXOA 1S1XB 1QTNB 5GADU 4JI3F 1NPRA 4PQAA 2ZOGA 3IS9B 4L72B 1H7WA 2JEIA 1U09A 3EUNA 2E1MC 3BGRB 3CCSS 2CYYA 4LSZB 1HD0A 4ZP9A 3WIUA 1VQ4S 2GIFA 1HQEB 4F0HA 5DZ6A 5DG7A 2IHR1 3IP0A 4DSJA 4N76A 1U1RA 1RHUB 4PUOB 3D0HE 2QV6A 4FXEA 3IG1B 4LBPA 4JI4F 1X0FA 2HK2A 4USKA 3VVUA 2JEGA 2C3PA 2BQRA 3EYZA 1WTFA 4TY8B 2PN6A 2CFXA 2JOQA 3MCNA 2LXUA 1BQMA 5E3PA 1IKWA 4Z7CA 2FGOA 4C0OC 3CC7S 5D6GA 3G9CA 1YRTA 1IKYA 1WOPA 2PO4A 2YKAA 3OFFA 2KZZA 2MZSA 4ANCA 1WI8A 2HK3A 2PA8D 4I68A 3ZTRA 2Y1JA 1A6LA 3RG6A 5KT5A 2QX0A 3GJRB 3OR2A 1Q78A 2YWFA 3FVYA 3HVWA 2J8SA 3MEEA 2EI5A 4FPRA 4AYBD 3M32A 2BJEA 1PC4A 4IG3A 2DNMA 3ZZPA 3QT5A 1FKPB 1RT5A 1T9XA 3PR4A 3MFIA 1EHWA 4ECQA 3L7PA 3BPDA 2MLZA 2FUG9 3N01A 4IQMA 4TY9A 5C25A 5BYQA 1KSPA 5KT7A 3PV8A 1WF1A 2C2EA 2F5GA 4JYAF 1IR1A 4FNHA 1TU0B 3M7VA 2MXYA 4FF1A 3RRGA 4ILLA 1FXLA 3DLEB 1YIJS 3O6QA 2LKZA 2QLJB 3MTKA 4P2FA 1C0TA 1WC1A 3HHEA 2XMAA 1MROB 5KOXA 1VQOS 3M8RA 5D77A 2AYMA 4RL1A 4A47A 1BDVA 1N5YA 2YNHA 4UY85 3KDNA 1K44A 4JV5J 4CO4A 4B9VA 4KTQA 1IKVA 3IWLA 3CJ8A 3TANA 4DV2J 1RWPB 5IC6B 1B28A 4CQ1A 2YY3A 3ZZTA 1CJVA 1F5CA 3ILJA 3W8GA 3K5NA 1BQMB 3T5KA 4B9LA 1WELA 1GXTA 3DNCA 3AJ2A 2ZH5A 1CULB 4ERDA 2VHGA 2DH9A 3K5MA 1RAFB 1TKZB 2YQ3A 5KFLA 5KTQA 4NE9C 3BQ2A 2WVEA 5L9NA 4I2QA 2OPRA 1TELA 1Y5IB 3NS7B 4IFYA 1RT4B 3OUYA 4XTTA 3MEGB 3EGVA 3UN2A 1FJGJ 1O51A 2E5GA 2JJ4D 4ZP6A 4IH6A 1Q8BA 3J81U 2OTLS 2M70A 4XIUA 2AU0A 3CJ5A 2OD6A 4J9PA 1JLAA 3GCWP 3NXZA 2DGQA 2Z58B 5FDLB 1WSVA 3VAGA 2WBMA 2HGLA 1TVRA 3MCMA 3ICLA 1V5VA 1F0XA 1RADB 1RHMB 4JV0A 4FKYA 5H9FJ 1FX4A 5LSLA 2R7UA 1OQ3A 4NLVA 2DXDA 2YNIA 1QJHA 3GONA 5FLXU 1NJIT 2RSQA 3CB4A 6AT1B 1FT8A 1P9YA 3EDRB 4B9MA 4NMLA 2KXHA 3ZZ0A 1WF2A 1ZAVA 3ZNJ1 3NNCA 4P7TA 1F3FA 4ALZA 1X4GA 2F8EX 3DRPA 3I0RA 3OTBA 4BWMA 4CLYA 3QT8A 4EBEA 5ETTA 2EEYA 3UD4P 1SUQA 3CWJA 1ICEB 3N28A 2XYGB 4J9QA 4U95A 3CD5A 1TKZA 3KK3A 2HHVA 3RBZA 2RHQB 2ASJA 1AUDA 2MJUA 3MPYA 4Y2CA 1JLQB 2ZBQA 2ZH9A 4C6AA 4ELTA 2CQGA 3CDAA 3H0PA 3MMCB 4ID5A 4X4RA 5A2QY 1D09B 4F02A 1RB0A 4FKXA 4FYWB 4JI6F 2E5LF 3W61A 3Q8YA 2PMZD 3MMCA 2ZVIA 5LM7E 1NJYA 2JH3A 1HKAA 1NH7A 1FHTA 3LGNA 3HX9A 3Q8UA 1NSKL 4LRBA 4DBQA 1X7VA 2MHEA 5L39A 1T11A 4X65J 3AH6A 1RAEB 2IFXA 5C2CA 2JNJA 3TOQA 5GAHU 4ER8A 4HTJA 3F44A 4ZVRB 3GFHA 5SUHA 1S6QB 3EZOA 4CH7A 5F8IA 5B7WA 2G4BA 2HRYA 1RE1B 4WTOB 4UQGA 1RCOB 1SCJB 2B8PA 3O2IA 3OLBA 1T02A 4QCLA 1RAAB 5EHHA 3OXFA 2Z2LA 4FBTA 2HAIA 5LSOA 3GV8B 8AT1B 2C2OB 1JLEA 2KM8B 3D1QA 4R8UB 3G8SA 5IC4B 1LV5A 3MMJA 5L1LA 4WFBQ 1RKIA 4UZBA 1X5SA 3MM8A 4WXWA 3HXMA 1B01A 2IMOA 2NSCA 1ZAXA 3HJVA 4NYOA 3MWBA 2UXBJ 4CTAB 2BQUA 2ZBPA 4RNOA 3DLGB 2W9BA 2KKHA 3M8ZA 3UR0A 3HD2A 1NRKA 3DGPB 1OYDA 2ZH8A 3UCUP 3J7A1 2DNQA 2W25A 4KFBA 2JRSA 3H98A 3NNHA 4HACB 1YWXA 5FLXY 2N4DA 2P9GA 3CJ4A 3IWNC 1SV5B 2HIYA 4NLPA 2PIIA 5E5NA 4PRFA 1AZSA 1JLGA 3ETOA 4RW7B 4DF8A 2P2CB 3N6LA 1Q5VA 4P2XA 2YBVA 2OSRA 4QIWD 2ZH4A 4OJ3A 4OX8A 4X2BA 5ETPA 1ZAWA 3UDLA 2O3DA 2A10A 3BGRA 3T6BA 4PAAA 3W62A 4DV3F 3MECB 1QM9A 3MM7A 3KTQA 3THVA 3C16B 1NKCA 2AJ1A 1AFIA 1TKTB 2HS0A 3I4PA 5DZ7A 4PWDB 1H0HB 2YVSA 1I94F 2YKNA 4RW4B 2VG7B 4ZK7M 2PDAA 5D0EA 2IAJA 1WG4A 2BR0A 1HNVB 4NWBA 4DV4F 2K3KA 3GPAA 5KFXA 4ECRA 2KB2A 4Z7YA 4RW4A 4WYLA 3DYAB 4D8JA 3R1LA 4EFAC 1QAIA 3TA1A 3DLEA 2XGQA 3AB2B 1WD6A 2RB7A 3DRSB 1IKYB 1TAUA 1S76D 1DRZA 1LFPA 2AGOA 4O3QA 4K4YA 5L9XA 2UV8A 3DC2A 4DR1F 3RB3A 1IUJA 1KQKA 3ILLA 3MM5A 2VBXA 4CM2A 3D2WA 1U1NA 2HURA 1UKUA 2R7TA 3DGVA 4IG3B 4KBIA 3DM2A 5HI7A 3KLFA 1RBOB 4DV1F 4Q8EA 1DAXA 1GQEA 2PEBA 3CNQP 4LR8A 1HBMB 3T1AA 1U1KA 4J5OA 1IR0A 4NX9A 1HNIA 1SC4B 1SC6A 4PG7A 2NPFA 1KHVA 4AD6A 3IR5B 2BEFA 1YZ7A 4ED8A 5DG8A 1VIXA 3BGFA 2R7OA 2E29A 3BBFA 1B0PA 2DHXA 2V6AA 4ZMMA 4DPOA 4YQWA 1S0VA 3H2VE 1TMMA 1K8AT 1FJEB 5GAEI 1UVJA 4DR6F 4QWDA 3PHEA 1RWMB 1B0TA 3MD1A 3IBWA 1N52B 4URGA 4J9KA 4HI2A 1QSYA 5KFJA 2HVHA 5F8JA 2KU7A 2E1PA 3K17A 2HS4A 1RWOB 3RUBL 3VAFA 1X31C 2G1DA 1JJCB 4RBVA 1Y7PA 3KLFB 3BKTA 4QWAA 5C42B 4OZJA 2LQ5A 2ZFHA 2IC3A 1RP5A 2K06A 5ETVA 1HNXF 2UUBJ 4DHVA 1S48A 4KGZB 1JXEA 1D9FA 4JI8J 2SXLA 3TI0A 3HULA 2AV5A 3SCKE 1XWLA 4WU2A 2MZTA 3QSYB 4KR0B 4X64J 1FEHA 3T9ZA 9RUBA 4NRTA 2VG7A 1LW0A 3A12A 1U1QA 1SQGA 2C28A 2DPIA 3SQGA 2O5DA 4RW6A 2DGSA 1EJ7L 2F8MA 3W5ZA 4FYXB 2FJVA 4LJMA 4UT4A 2N82B 4YDDB 4LF1A 4K8RA 3N6NA 4F7VA 5KT6A 1V5IB 4JI1J 4NXNF 2JFDA 2YPYA 3P4UB 1KP6A 3CO0P 4CLSA 3KMSA 5DM6Q 4WBFA 1IKXB 2GVZB 3HFKA 3MR6A 3VW4A 4GVBB 3JB9k 1XIQA 3HFZB 3NNEA 1KKHA 3K5OA 1EETB 4LFAJ 1KVJA 3JSMA 4QWEA 3GIIA 4IR1A 4A48A 3KLHA 2RNEA 4I64A 4GC7A 2JEJA 2QLXA 2IJNA 1SIZA 2J7UA 2L9DA 1T8EA 3PTWA 3PRDA 3NS6A 4Y65A 2J0WA 5CZVA 5J1EB 4F4KA 1F9FA 2OELA 5C42A 2CPIA 4FS1A 3H4DA 2XYPB 4I56A 1K73T 1HW9A 4O0NA 1FFWB 2CQDA 2KXNB 1VQ7S 1FCAA 4DSIA 4FYDA 4OI6A 3HT0A 5KFUA 2DBBA 2C2RA 1D8YA 2PFFB 4JBCA 1KQFB 1PARA 2X1BA 2V8GA 3JYTB 3CCWA 1B7FA 3NG8A 3FMTA 1EZZB 1S4FA 3ELHA 2XWXA 4FDFA 3NL0A 5L8RC 3KYLA 2DY9A 2G9OA 1C1BB 3OR1B 2V9WA 5KFRA 1FJ7A 5CQGA 3N79A 1M5PC 1BMQB 2NZCA 2HHPA 1QD1A 3ENWA 3H20A 1FRHA 2B7BB 3KNGA 4RU9A 3MGJA 3QATA 2HYIB 3JAMY 3CCLS 1NO8A 4CLPA 5MAOA 3C66A 2NXEA 1S9EA 3JS9A 4CO3A 4DV5F 1R31A 5H9EK 1RWVB 4GMKA 1VR6A 1IQZA 2DISA 4G1PA 5B08A 2DR9A 1CVJA 3PFEA 2F4VJ 1U49A 3FBEA 3QRPA 4PQUA 1N32F 5L1KA 2CQ1A 4ZHRA 3GZ7A 2XEXA 4H54A 1R6YA 2QL7B 2W01A 3AQOA 3OXGA 1R7IA 1N6QB 2XHWA 1UTAA 4DR5J 3PZPA 1HWJA 4CLKA 3LWLA 3CCRS 1JIHA 1S0OA 4DR4F 2EFQA 1SUQB 1M5VC 4B3SJ 2RUGA 3ISZA 4O3RA 2ZZMA 3H40A 2WAQD 4USJC 1VQLS 1A0OB 1UW4A 1RTJA 2AEJA 3E8OA 4LVOP 1NSAA 2L48A 5M2UA 4N56A 1IBKJ 5HROA 1FO1A 4J9OA 4V1Ak 4AQYF 2HPUA 2MKCA 4U96A 1GXUA 2DHSA 4EMDA 5DM7Q 3CJSA 1HNZJ 2G0CA 2WONA 3QT6A 3HLUA 1TKXA 2EBGA 3I55S 2W7PA 1CLFA 3UCZP 5KFHA 5KT4A 2V63A 4I6WA 1MMLA 1XNQJ 1Q95G 2FVPA 1DY3A 3M8QB 3GLJA 4I2PB 5L38A 3S1TA 5KT2A 1N5TA 2B6AB 2H65B 3HMJG 3NMAA 4NI2A 4IG0B 3OVSA 5HLFB 5IFMA 2BUNA 1S5ZA 7AT1B 5HVFA 4IR9A 4Q8FA 5LMUF 2VG5A 3FEYB 4OI4A 3KUGA 4RO0A 4IDKA 4M5IA 2M3DA 5HBMA 3TO8A 2MDAA 3BSNA 3MM8B 2ZC4A 4HI1A 4RUBA 4UUWA 4FF2A 2LQ9A 3B4MA 1SJ4P 2JXIA 1MMDA 2VJVA 3QQCD 1H2TZ 2R8GA 4W90B 1UJ5A 5DQHA 1JLEB 2BJDA 2NREA 4GKJJ 3PG9A 1UZHA 4DV7J 1F3VA 1I51B 2XMMA 3B82A 3C8YA 1UETA 1WHYA 2BANA 1PYTA 3AHPA 1AUSL 1BGXT 1P9QC 1U8SA 3MHYA 1RCXB 3CUNA 1RAJA 4DUYJ 1SL0A 4KQZA 3Q83A 1CBKA 2FJAB 4LSLA 2UVUA 2D3ZA 3BYRA 3MUTP 2XSFA 2CPGA 3CCZA 2GHWA 3HVTA 3IXQA 5A8RA 5B0CA 3W2VB 1OO0B 2XQCA 1FRJA 3BS9A 3DMJA 3FQKA 2H5JB 3L7OA 3ET6A 4PEOA 4D3HA 5I4MA 1VC5A 1MU2A 3ENQA 1KLNA 2LQJA 4YY3J 2GW8A 3D6MB 2KO1A 2OI2A 3M30A 2GS8A 2MLXA 3ETMA 4NA2A 3QOQA 3W9JA 5IWAJ 2KZMA 4ETXA 4OHZA 2JLEA 2ILZA 3ADAC 4QIEA 3EM1A 4F25A 2MGZA 4WZQA 1HMVB 1Y0HA 2HQIA 3IBCB 1KDNA 1N32J 4J7CA 2IMWP 4RNFA 3SMZA 2C2DA 1NU4A 1SPBP 1S6OA 3QWUA 3R8YA 1NCLA 2MGZB 2KDOA 3GV5B 2E9TA 2YWGA 1RHRB 5ETKA 4K4VA 1S1WA 5KFTA 1N8RT 3H2UB 4OZLA 1UVMA 3R9LA 3M8QA 3CIZA 1XR6A 1PGZA 4JI7J 1K47A 5L1JA 3ET6B 3R3TA 4WWSA 4J37A 3R6GB 2DKOB 4A8QA 1N0UA 1WC3A 4MK7A 1EAYC 2QFIA 3NGDA 3GSIA 4WF9Q 8RUCA 5KFDA 3OJSA 1YSJA 3W8PA 4K4SA 1TP7A 2ERRA 1VDHA 3HM9A 2X7IA 3RR8A 2X1GA 2J0XA 2VUGA 1V3ZA 2AX0A 1UJ4A 3W60A 2XI3A 3PYDA 4YHHF 3DXBA 3D7SB 1X8DA 2GJ2A 2W24A 4FZVA 1RI7A 4QR2A 4TYBA 4EWTA 4XPEA 3R1HA 2UXCF 2K8GA 2GVZA 4F4XA 1T3OA 1FKAF 1O6XA 3Q89A 3RJMB 2CPDA 3UPFA 4NMXA 5HATA 4DSLA 2D3OR 2RDIA 2CPFA 3CXCR 4V19J 2HIQA 1PILA 3I4HX 1LOUA 3P8BB 3C14B 1LXJA 2HRUA 2AW0A 2AQ4A 4OI2A 1QY7A 3RRKA 3HHLC 1TL5A 3T1HJ 4ICLB 1U1LA 4O4GB 4GO5X 2FVCA 2QL9B 3QFWA 2CVIA 2QA2A 1D0EA 3NP5A 2WSFC 2ZNZA 3MAAB 2CJBA 1SBRA 2D41A 3QBCA 2RRAA 4LF8F 5J1NA 4Q2LA 4ZCIA 2LEBA 4ZJLA 1X0PA 3RGIA 3DLJA 2DGTA 2FY1A 1WORA 2HFNA 2OP5A 3I5AA 3WX4A 4X66J 1S1UB 2QMXA 3MI7X 3TA2A 4JB8B 4KHMA 5E3CA 3KG1A 4AL7A 1IKXA 3RBEA 2H1YA 1VQ5S 5A8KB 2YQ1A 3HHLA 4OYXA 4K4TA 2FC9A 2QN6B 1FNOA 1TL3B 2HFVA 2Z30B 4ZVTB 3ZTOA 1QE1B 3GILA 1NBEB 1HNWJ 1RT6A 3OD2A 2F8HA 1R8HA 3OTDA 3W63A 2Z2YB 3GJTB 2QG9B 1ITPA 2WTFA 1CJTB 3DU5A 1JK9B 1S9EB 3FC9A 1ZETA 1HHSA 3GWCA 4I7FB 4NLOA 1N36F 5J1EA 1RWWB 1XMQF 2DB1A 3H5XA 5DJBA 4CZCA 3I9V9 5KFEA 1S1VA 4OX9F 5ETLA 3AODA 2G2OA 3MM6A 4WJBA 1YBAA 1FDAA 2ZBCA 2OLWA 1FI4A 1DQAA 1N34J 4QU7A 3QLHA 1N34F 1GAOA 4ED4A 3QFHA 4C9DA 4PZVA 2MY8A 3QO9A 2PI5A 2VFVA 1Q8KA 3VAIA 5DGBA 1TK5A 2LLZA 2HHHJ 3KLIA 3D0IE 6FD1A 3DXSX 4OYWA 5J2PA 3FSXA 1YVFA 5DDPC 3TQEA 3LOUA 5K14A 2A6MA 1OPIA 3AOCA 1D3WA 1E6YB 3GQCA 4DV7F 3RAXA 1IKWB 2KT2A 2C3UA 1KTVA 2WW8A 4LR7A 4F0KA 1H98A 2HSEB 2R3VA 2KKEA 3V5RA 3AY0A 2BJ3A 4DG1B 4Z2XA 4ZN1A 1SJFA 4CDIA 3OTCA 4ELUA 3R5AA 2W9AA 2JC0A 4CT8A 3CJKB 3BREA 1OQ6A 3Q8PB 1XBWA 2AP6A 2RQMA 3Q2TC 4C4WA 2GFFA 3WQPA 1XNRF 3V2UC 1RLDA 4DUTA 4DV4J 1HWUA 4M5GA 3BO2A 2DRBA 4MYTA 3DLLQ 1I94J 3SDEB 2W4DA 2MSTA 2OH2A 2XMWA 3FMBA 4LRVA 3QNWB 4MMOA 4F2RA 5JXSA 1CEZA 3PM9A 3DYAA 4UY8T 3N9UC 3EZ5A 2LXFA 3HHLD 2VJUA 4DFPA 1S0NA 1LQ9A 4KIAA 2HZCA 4YR2A 1NPPA 2FB0A 5BYSA 3I0SA 2X1AA 1VHIA 2XB2D 4Q44A 3UQSA 2LP4A 4RZRA 4PWDA 2EWHA 3M8PA 1PBUA 3MEDB 4A8SA 4ID8A 3GV7B 1SV5A 3WZ0A 4ECSA 3SV4A 2BOAA 2K9IA 4C0HA 4CLLA 4NPOA 5L46A 5J1PA 2BJ1A 1IQTA 2DEIA 1RGVA 1VK8A 5C7PA 1SJQA 4NLUA 3OSNA 2KRBA 1RT3B 1WC5A 4USHA 5HL7Q 3JTPA 3D66A 1Q0NA 4QWBA 5B0BA 3KLEA 4HYKA 1CS4A 2DNPA 2J0QD 2UXCJ 3MOZA 1PSDA 4M94A 2F4VF 4JUZA 1O8BA 3RZAA 3VZHA 3R27A 2CIMA 4OZ2A 4AUKA 2AJ4A 1BQNB 4QPXA 4IG0A 5HLFA 2E5JA 1C1CA 2QEXS 2IAJB 4YB1P 2J8AA 2WCXA 1Y9OA 1NK0A 4KGVB 3VAHA 1TUVA 5D0GA 5J2QA 2ABYA 1S7IA 1RQ0A 4U8VA 4O4RA 3PRVA 3ZO7A 4ANEA 1J27A 4MJKA 2LU2A 4YB7A 3UD5A 3CC4S 2HHTA 1LWEA 4DX8H 4F0MA 1Q16B 1VQYA 4NL5A 1TFWA 4JP8A 1Y3KA 4LRAA 4FNIA 4KC5A 4RPFA 3O44A 5ETMA 4EO6A 1YJTA 4F4AA 1EX8A 1FF2A 3M6WA 4URSA 5KFAA 3CCJS 3H5UA 1TMJA 2YX1A 1Q8LA 2KM8C 3PX6A 3ITHB 1ZA2B 2KJWA 1UFKA 2XYHB 2B6AA 4RW7A 1NK4A 3I0RB 1S6QA 3W65A 5AE1A 1RTIB 4KE5A 1FKPA 1RT5B 1VBKA 3P45B 4I69A 3PW2A 2UUCJ 3WC2A 4Y6IA 1C0UA 3EXCX 5T7LB 2R9LA 1R0AA 2B4PA 3P96A 1UPMB 3KKFA 4M5HA 1S9FA 1JLFA 3MD3A 4RLEA 1FVQA 4C48A 4QJVA 4EZ6A 2J7KA 3NBPB 5CAAA 1TKDA 2FVQA 4YR3A 3RB6A 3TJ8A 5E3QA 4DCJB 1PAEX 4D3GA 1SB6A 1M5HA 2CDQA 4AFFA 1YRUA 3VGUA 4QW8A 2HMIA 4C8ZA 1GTEA 1N5VA 2F1FA 4J9VA 5HMZA 3PHTA 3O1LA 4DU8A 1P27B 1YLXA 2BANB 3HVAA 5DLFA 4WIIA 1FESA 3I5CA 4TKTA 4LFBF 3IG1A 3IRXB 3NGTA 2LA4A 4C2MA 2RD5C 2CG4A 4DR2F 1IVZA 1K9MT 4Y34A 2U1AA 4EBCA 4DV6F 1DQ9A 2DIUA 1LWXA 2FTRA 3TX0A 5J2QB 2HQGA 3RTVA 3CD6S 4Q0BB 4NXNJ 4GKKJ 4I1TA 4USVA 5GAGU 4ZITA 1YJWS 3HVTB 4QBUA 1WNEA 2JBVA 1MMNA 2L9WA 2DR5A 1XJWB 2MJNA 3BSCA 2CWXA 3PW0A 4TYAA 4GKJF 1F5AA 1U7LA 4K2JA 1N5QA 1ROFA 5CYQB 3TEHB 4ZPVR 5HP1A 2GJIA 5EX0A 4KGKA 2C2NA 2E5IA 3J81Y 1FNXH 1MYKA 5MLCV 2NUUG 3OV7A 1B99A 2KELA 3JTOA 1DLOA 1S49A 2GIRA 1IJFB 3ENVA 2FY8A 1IBLJ 1UMJA 4HH1A 1JLAB 1ARQA 3I6PA 5FDLA 2V4QA 4A8FA 2QFJA 1G7CB 4LRFA 1FWLA 3AAWB 3RR7A 3BSAA 3MM9B 4MKVA 4C3LA 2M8HA 1BXNA 2QT7A 1PKUA 1XNQF 2CQ2A 5JVGQ 3SFGA 2E1RA 4WYWA 2V8VA 2HEKA 3VEAA 3KLHB 2U2FA 5KG4A 2OMLA 2AJFE 3MEGA 4YS2A 3BKFA 2B4UA 2RF2A 3HSJA 1KRPA 1IRQA 2E7VA 3M05A 1KNZA 4R0JA 5B0EA 5DDRC 1CJUA 3X1LB 2OPSB 1HBOB 3ZC4A 4EYIB 3R2CJ 2ZHOA 3NGSA 4I6YA 4X62J 3EX7B 1D9AA 1Q1KA 2GMLA 3GFZA 2CAJA 1SC3B 1DLOB 3AA8A 4NZ7A 5T41A 2FD2A 5GAHI 4IRDA 3HKZD 4PPZA 3V6HA 2MQNA 1GX6A 2YKPA 4QIGA 1S6PB 1PBAA 1OIAA 2B4OA 3UW1A 4YB6A 2QSWA 2D7SA 4J9UE 2ASYA 1JLQA 2H5EA 2Z2ZA 4F3MA 5HP1B 4YN3B 3V81A 1HYSB 3PDNA 1W7WA 2XSJB 4ZCKA 3W66A 4ECZA 1R8PA 5J2MA 1XR5A 1PG5B 1UW9A 2CJXB 3G2XA 1CJKA 4DL2A 2F65A 2FZCB 1FKOB 1ZM3A 3FMWA 2UU9J 3HZGA 3MPVA 4Q0BA 1UAWA 3B6BA 4LRDA 4OIXA 2W2OP 3VHQA 4DV0J 4DV5J 3E01B 1HR0J 1WF0A 2H3AA 2OGUA 1JNZB 1HA1A 4NLQA 2JLGA 2HHWA 1P1TA 4FXDA 1OSDA 5CA5A 2VZ9A 3BO4A 4KGXB 1FRLA 2E1CA 2DVIA 1H2UX 2JVRA 5F8MA 4ZPDA 5AT1B 4KT0C 1VQPS 4C8KA 1NXIA 2A18A 2XNQA 4J9LA 2UV8G 1WDTA 1T7PA 3OTEA 1WEYA 3UDEA 3DOKB 3U1MA 4PG6A 2KHCA 2JXGA 5KFWA 2OFGX 4EZ9A 4ZIWA 4PQUB 3BGUA 3ILIA 2D1CA 4NLYA 4OZNA 1UPPA 4BBYA 2YWWA 2MQOA 3OTOJ 4DFMA 1KONA 3BN7A 2GVDB 2QMUB 2BBEA 3M4XA 2BVZA 3R7NB 1R8AA 2P9EA 4J91A 1NDPA 3VF0B 5GMKa 4OI0A 1S77D 4PPDA 2X1FA 2HFSA 3MZIA 2VPXB 2K1RB 4NCBA 2DHAA 4LFCF 3D67A 1WI6A 2VKRA 4LFCJ 1M0SA 3FRYA 3G82B 3PW7A 2RDDA 2CZ4A 4DQPA 4RWXA 4KSEB 4JI3J 1RWUA 1VQ6S 1KS2A 3KHGA 3FEXB 3EVWA 1C1BA 4HV0A 2XSJA 4C11B 3JSMB 3NEKA 1XC9A 3HZEA 2HWHA 3H42A 5F0WA 1KN6A 2C2KB 2KVIA 2K7KA 4LF4J 3IS9A 4I67A 1R0CB 1U1OA 1RHJB 3OL6A 1EIYB 1UEUA 2VDHA 3IM8A 3NO7A 4PCQA 4TLQA 2W8KA 2UVVA 2C2ZB 3EVOA 2ASLA 4B3MJ 3ZZRA 3DHWC 4M5MA 4XAKA 1KVKA 4F67A 4WFAQ 1NPKA 3I5BA 3FFIB 2D3UA 2ZBIA 3FSIA 4ZLNA 9ATCB 3QGGA 2V5HG 1REVA 4JI1F 1XMOJ 2XO7A 2Z4PA 2XMKA 2C3YA 3NRBA 1RT7A 2Q43A 1VLYA 4M5KA 4X65F 1FK9B 1MW7A 1A7GE 2BDPA 5I42A 1M1KT 5F8LA 2I5JB 4PWWA 3L09A 2XCPA 3JAMU 4CCHA 1P1LA 4DSKA 2QE5A 4GVBA 4P73A 2YH1A 3I0SB 1RWKB 5HK4A 4JI8F 1SKRA 3FCWA 1JQGA 4W92B 4HHUA 3K59A 2HNDA 2UUBF 4H4MB 4A8OA 1VI7A 2OIHA 1OMSA 5GVQA 4DN9A 3C3LA 3G6YA 1M1GA 5C25B 3TZYA 3WHIA 2V4RA 1UWBA 3LPEA 1SQFA 1GTHA 2NXJA 3QT7A 2CZ9A 4PUOA 1X60A 2ZE2A 1DZ5A 5D3GA 1YJUA 2H51B 4C3MA 3CGIA 3DDKA 1REGX 4QR1A 1LNQA 2RDJA 3AJDA 4DUZJ 3M1VA 2IM3A 4OI3A 1DFDA 3CVKA 1VQSA 5CH7B 4HVZA 4DLGA 1FDNA 3HJFA 1JLCB 1YJRA 4FPIA 1HQUA 2GHVC 4O44B 4QPTA 4KHRA 3BH7B 1JJHA 1Z2ZA 2W9CA 4DV1J 1S72S 1U4BA 1NJZA 2J7WA 4JI2F 1BHNA 2B8QA 2P5VA 5M2PA 4X4UA 5K20B 5EN1A 4B02A 2I38A 1ELOA 4PWUA 3CJ2A 3K5LA 2VA2A 1UEVA 3KMQA 4PG4A 2PI4A 3SV3A 2B9YA 2NXCA 3IWXA 4ZVOB 1KQSR 2V2ZA 2PMWA 3I31A 4OHVA 2X3DA 3OXLA 4O3NA 1EP4B 4F36A 1AXQA 3V4IA 1QAXA 4DQRA 4DQIA 2R4FA 4NEYA 3DU6A 1BE4A 1DTTA 3T41A 2CG8A 5GADI 4CH1A 3MM5B 4DV6J 5I3UA 3UR3C 5D15A 2IPOB 4P2MA 4N5SA 1G1XA 2DR7A 1IWAA 1F2HA 3JSBA 2BE9B 2BZ2A 4QW9A 3DM2B 2ROEA 3GG1A 3GMGA 1YJVA 4ZVPB 2M8DB 1P94A 3K7RA 3N6MA 2HLTA 4KO0A 4WIQA 1Z4UA 2BKNA 1ZM2A 4HT5A 2YWEA 3LAMA 1VGYA 1F9EB 2GAHC 2DNKA 1TZ0A 4G65A 3QRRA 5BJRA 1KEKA 3PX4A 5KFPA 3PIPQ 4KHPJ 1PJ5A 4FF4A 4HHJA 4ID5B 1GH8A 3UDVA 5JVHQ 3MMAB 3MPUB 3RB4A 1ZA1B 4XDCA 4Y28C 1SJ1A 5KG0A 4UOCA 1X4EA 2HVEA 2PE8A 5AXKA 4TU7A 3BF4A 2CRLA 3PFOA 2IVFB 2IBKA 1B7YB 1BDTA 4FYYB 4DSFA 3PIOQ 1T95A 2JDJA 2OHDA 3KK2B 3FGVA 3T1YF 1RT3A 3JTNA 3VGVA 4C98A 5LSRA 2JSXA 3TUZC 5EWGA 1Q82T 2J6TA 1KLMB 4DLEA 3EDQB 2WSEC 3LTOA 4YEAA 2JC1A 1ARRA 1D8ZA 4J9SA 1VRTB 5CD4A 2HVZA 3KFWX 1KOOA 6FDRA 3TARA 3KJVB 1UVIA 1MWYA 5HVHA 2HNZB 1N48A 2HBZB 3DOLB 1JXVA 2K7JA 3KXDA 2RUSA 2XLJA 2BACA 2CQ3A 4WP9A 3CF5Q 3LP0B 2FLPA 2IBOA 5D4LA 2B51A 4MAKA 4OYMA 1XMQJ 1RYRA 2KYZA 2UXDF 1YZ6A 4AL6A 1CJVB 2WSCC 1HBNA 1OYEA 3VZIA 4E98A 4F26A 1LXNA 2CUYA 4XO0A 3IA0A 1S99A 2K6LA 1WG5A 2E7WA 1YK9A 5KFSA 1NUEA 5HMXA 1AROP 4OZ3A 1QAYA 1VC6A 3VGTA 1RU2A 3OPKA 3L9ZA 3M9MB 1RDRA 5D4PA 3DLKA 1AB8A 3TJAA 3VGSA 4H4OA 2K5JA 1UFLA 5I3PA 4CT9A 4BDPA 5CYQA 2X3GA 3J80U 4JI6J 2VODA 1TTHB 2FJBB 2V9KA 4GO7X 3JQMA 3AJ1A 5AXNA 2XS5A 3DMJB 1KTQA 3UE2A 1UP1A 1L3VA 3PY8A 2PGCA 2CJYB 2FHMA 4OZ5A 2HGMA 4F2SA 3OLAA 1X93A 4OMFG 4O0IA 3M30B 3CJRA 3NBPA 3BH6B 3W2WB 2YKOA 3TWZA 5ADZA 1Y5LB 2D69A 5JMNA 5G0RB 4NZ0A 4P10A 3KLGB 1RHKB 2CWKA 5IM0A 1VBZA 4OV6A 2YNIB 2PEHA 3H90A 5G0RA 2WVFA 4UOFA 4Y2AA 1SJ3P 1IBCB 3DDNA 4MIWA 1KHWA 4R25A 4EYHB 4B3TJ 1S6UA 1PAUB 3C15A 2PMHA 1WWHA 4K59A 3LP0A 2VFRA 1C2PA 1HBNB 2JLFA 2HQFA 2IJRA 2B9WA 2RU9A 4DPYA 2GJFA 4ITSA 2LEPA 4ZVUB 3Q0AA 5LMNF 2BNZA 2VL1A 2NR0A 4AL5A 4DR7J 5A6WA 1L5UA 1QSLA 4F50A 2HVIA 2QTWA 3KLEB 2BV3A 2QLBB 4LF4F 3BDEA 1WEZA 2BJ9A 3DLKB 2EKNA 4NYZA 2FPHX 2YXLA 3D54A 3W2WA 4DF4A 2HWTA 4OJHA 1JX4A 3GSDA 2VF3A 4USIA 3THTA 1X9MA 1FNMA 4ECYA 4M95A 2Y9HA 2AZ3A 2DIVA 5D78A 1BQNA 1U6ZA 2B9XA 1H73A 2N7CA 5KG1A 4ENOA 2KN4A 5HBMB 4JI5F 2HHHF 1NK8A 1FJGF 2YWHA 3D3BJ 1HI0P 3OQ2A 2E9ZA 2KFNA 2ZJRQ 1IBMJ 2FGCA 3KUEA 2XWYA 4OJ1A 1X4HA 3OFEA 3BBCA 2VC1A 1C4AA 2HS3A 2MKJA 2BJ7A 4MIBA 3NCPA 2VONA 2BA9A 1OHNA 2GPEA 1J5EF 3DDIA 3HHNB 2G1HA 1MG7A 3S6EA 4ED7A 4I2PA 4B17A 2OKQA 2DGWA 3BQ0A 1RTJB 3N5FA 5LJ3Y 1AA1B 5B0AA 3GIKA 1UFWA 2VASA 2YNHB 4KKOA 4I4BA 2FVRA 4K4UA 1T9WA 4OX9J 2UZAA 3HSZA 3MM7B 3Q8SB 1MSWD 2XY7A 4ZJQA 4LUBA 4C11A 1TFYA 1UA1A 3HVRA 1T3NA 2M2BA 3TUPA 2GHPA 1T05B 3RAQA 1D1UA 2ATCB 1OPZA 3KNAA 4LR9A 2BKPA 1G2EA 1BLUA 4ILRA 3CCVS 1U45A 3NAHA 1PO6A 5GMEA 2UU9F 3G5OA 2J9EA 3BGOP 2DGOA 2CNNB 2AY0A 1N56A 1QSSA 2AHOB 1UVNA 3GXQA 4JYAJ 2N3LA 2F4FA 2OO4A 1OSCA 2DJWA 2CQCA 2WB4A 4IOBA 5BYRA 3DGPA 2ZH1A 4B3OA 2ZZTA 3SDEA 5KFGA 4LQ9A 2BE2A 4EI2A 2R2SA 4RJVA 4WKRA 2Q66A 1RTIA 4M8LA 3HFVA 4WFXA 1M1HA 4C8YA 2MQMA 2OEKA 1VBXA 4NEZA 4CLFA 3MXHP 1NZAA 3R97A 2DH8A 2VQEJ 2BQ3A 2XZTB 3Q8QB 3CCUS 4DS5A 2ZJPQ 1VK3A 3CT9A 3B54A 4B9UA 3L95X 3RBDA 2QLWA 4DN0A 2G2ZA 1EETA 2R42A 2VPYB 4USTA 5ETNA 3U02A 4LF7F 5E3RA 2R8HA 2ALZA 2OAUA 2BRLA 1T03B 2W9CB 3I82A 2VC0A 5CXTA 3J7Z5 3QZ7A 3HPOA 3TAQA 1QUVA 2IRUA 2IVYA 5J2PB 1PCAA 1F60B 4DPXA 3MM6B 2MPUA 4M5JA 3SSSA 4IH7A 2OPPA 2FIUA 2EFGA 2FJDB 3F56A 2Z8QA 2ZBRA 4LVNP 3QYYA 2B43A 2IIHA 4HHHA 1SKSA 2NPIA 1HHTP 4ECVA 4IRKA 5AJ3F 2G2YA 2OPQB 3NNAA 2DNRA 2JZ5A 1VOMA 1N0VC 2GIQA 1JNRB 2Z2MA 1CQNA 4K7QA 3RYLA 3TVYA 3UVJA 2CQ0A 1U48A 1BY9A 2YNFA 1SKWA 1SQEA 4C0BA 5HN0A 2ZDOA 3AFGA 3SEOA 4QU6A 1C1CB 3EMTA 2R2TA 1VQKS 3SXLA 3CE8A 2IM2A 1F1BB 2ILYA 3ZZZA 4Z37A 2F40A 1JLCA 4RUHA 4K0KJ 3PO4A 3T5HA 2RF2B 2C1EB 2DGXA 2K3IA 2ALYB 7FD1A 4N7TA 3FCVA 4I7FA 2MMYA 2UUWA 4CLWA 1JLBA 3A8IA 4X4QA 1TUWA 2RJZA 2NYHA 3NS5A 1UCNA 2ZD1A 5I3QA 2G13A 2ZE2B 3TRGA 1WTBA 1X5TA 3NWRA 3R5BA 4LT6A 2JEFA 1NSPA 3S8SA 2FYXA 3D6FB 3L3CA 3JYTA 1LEOA 4AXIA 3H8YA 1SIWB 4QIVA 5DRKA 3R7SB 4YFUA 4IO9Q 4IOAQ 2A6OA 4LFBJ 1LW2B 3A8JA 3C6TB 4P75A 1U0HA 1U26A 1Y00A 2KXFA 2H4WB 2LEAA 3MCSA 4NA1A 5A6PA 2XZDB 2LDIA 5E41A 3MFHA 2AGQA 2KTQA 1OG7A 1NK6A 1HBOA 2CNKB 1DURA 2RQKA 2C3OA 2CQPA 4AE5A 1N6QA 4QYRA 3AXMA 4DX7A 1NJXA 2YKQA 1CG2A 1MWZA 5J2NB 2FJWA 1JKHA 1WC6A 5HJXA 5DDQC 1KR4A 4JV5F 4RNHA 1XQIA 4FVCA 4YY3F 7FDRA 1ZM9A 4EGLA 1KQGB 2R7SA 3ZFVA 2ZEJA 4MKAA 4CP5A 2XTJP 3ONQA 3WIVA 2UUCF 3BB5A 3H5SA 2ZUGA 2Y1RI 1S97A 4WE1B 1K1QA 2G0IA 5E2QA 1QDUB 4KAIA 3V4IB 2YNGB 4ILMA 4N8NA 3Q8RB 3LP2A 2P8IA 1KFSA 2FZGB 1FVSA 1IN0A 1XR7A 3G87A 3MAQA 2EFPA 1FE0A 4F3QA 3TEGA 4PXCA 1SL1A 2E9RX 1P8GA 4K4WA 3KK1A 2V2QA 1RUSA 1XTZA 2H4YB 5DETA 1BC6A 3A3NB 1VS3A 4HH0A 1J5OA 4IKAA 4ZLLA 2HZVA 3P6YC 1H6KX 5HQLA 2DNZA 2MKSA 2ACYA 4NOHA 4ZPWR 5F3ZA 1LK5A 2A0FB 4R5PA 2RS2A 3E3XA 2HHUA 4RU2A 1TAQA 3KLIB 4N77A 3CJ3A 4G1QB 1O5JA 2E7XA 3BR9A 5KFOA 5L1IA 1U25A 2V8PA 3X3UA 2IJFA 2GGPB 3EGNA 3NWGA 3GP9A 3VALA 1GXLA 2C3MA 2LDYA 1X4FA 2YKMA 4Q5VA 5EDWA 4MK9A 3BZQA 4ECUA 3DRSA
chains in the Genus database with same CATH topology
1MYKA 1QTGA 2CAJA 4D8JA 1ARRA 1MNTA 2KELA 2BNZA 4ME7E 3FT7A 2BSQE 1Q5YA 2F1FA 2JXGA 2JXHA 1BDVA 2K9IA 2CADA 1Q5VA 3H87C 2HZVA 1PARA 1ARQA 2BJ9A 2CA9A 1X93A 2K1OA 2BJ1A 2HZAA 3FMTA 3VW4A 2K29A 2RBFA 2H1OE 3BKTA 2CPGA 3BKUA 2BJ8A 2WVBA 2WVCA 3PHTA 1NLAA 1B28A 2PC6A 3VEAA 2BNWA 1BDTA 2NZCA 1EA4A 2AY0A 2K6LA 2WVFA 3LGHA 3OD2A 1B01A 2FGCA 1BAZA 3GXQA 2Y3YA 1MYLA 3BKFA 2CAXA 1IRQA 2JXIA 2WVDA 3VEBA 2BA3A 2BJ7A 4HV0A 3QOQA 2GPEA 2WVEA 1P94A 1U9PA 2K5JA 3QSIA 2BJ3A 4FXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MYK A;  1QTG A;  2CAJ A;  4D8J A;  1ARR A;  1MNT A;  2KEL A;  2BNZ A;  4ME7 E;  3FT7 A;  2BSQ E;  1Q5Y A;  2F1F A;  2JXG A;  2JXH A;  1BDV A;  2K9I A;  2CAD A;  1Q5V A;  3H87 C;  2HZV A;  1PAR A;  1ARQ A;  2BJ9 A;  2CA9 A;  1X93 A;  2K1O A;  2BJ1 A;  2HZA A;  3FMT A;  3VW4 A;  2K29 A;  2RBF A;  2H1O E;  3BKT A;  2CPG A;  3BKU A;  2BJ8 A;  2WVB A;  2WVC A;  3PHT A;  1NLA A;  1B28 A;  2PC6 A;  3VEA A;  2BNW A;  1BDT A;  2NZC A;  1EA4 A;  2AY0 A;  2K6L A;  2WVF A;  3LGH A;  3OD2 A;  1B01 A;  2FGC A;  1BAZ A;  3GXQ A;  2Y3Y A;  1MYL A;  3BKF A;  2CAX A;  1IRQ A;  2JXI A;  2WVD A;  3VEB A;  2BA3 A;  2BJ7 A;  4HV0 A;  3QOQ A;  2GPE A;  2WVE A;  1P94 A;  1U9P A;  2K5J A;  3QSI A;  2BJ3 A;  4FXE A; 
#chains in the Genus database with same CATH topology
 3QGI A;  4NXM F;  4K5S A;  5HVG A;  1WAC A;  2HG4 A;  4DDF A;  5BXI A;  3UNY A;  2IM1 A;  1HNZ F;  3LW5 C;  4DOZ A;  2ZDP A;  3FZ2 A;  1FDD A;  4RR5 A;  4TQR A;  3OSP A;  3AB4 B;  3GB0 A;  3SCI E;  4PYA A;  1UVK A;  4L74 A;  2KG1 A;  3C19 A;  2XLI A;  3CD0 A;  5F0U A;  2XMV A;  2E44 A;  4L6V 3;  2I5J A;  2DT9 A;  4B08 A;  3F73 A;  5KG6 A;  1N88 A;  3HP6 A;  1HAR A;  4A8M P;  3SSQ A;  2W4P A;  2KRR A;  5C2G A;  4NXM J;  2LXI A;  3HD1 A;  3A3O B;  3N5B A;  3NOG A;  2UVW A;  3OJU A;  4CH0 S;  2RKI A;  5D0H A;  1HMV A;  2QC3 A;  2WW4 A;  2O01 C;  5IQQ A;  4DR3 F;  4DFJ A;  2YTC A;  1XNR J;  2YNG A;  1W2B R;  5KFB A;  1R27 B;  4O3O A;  1AZS B;  1JLG B;  1YGY A;  2H3E B;  4LBH A;  4OYA A;  2R8I A;  2HAF A;  2QA4 S;  2EK1 A;  3SCJ E;  4ETZ A;  2CQI A;  5I42 B;  1UEK A;  2QYG A;  3DRP B;  3ILO A;  2QYC A;  4ZP7 A;  1PJ6 A;  3M2R B;  2HQD A;  5HAN A;  4USU A;  2OPS A;  3NY0 A;  3PAC A;  5F8G A;  2F9D A;  1G6B A;  2MHN A;  2P6S A;  3SSR A;  1Q7Y T;  4OFZ A;  5CYM B;  5EUH A;  3G8T A;  3IRW P;  3KK3 B;  5KFK A;  3MMB B;  2OFH X;  2DK2 A;  4H4K C;  1TKT A;  2RS8 A;  1VQ8 S;  1Q8I A;  1TK0 A;  3Q23 A;  4CIO A;  2UP1 A;  1HWL A;  3TAM A;  1S57 A;  2HNZ A;  3MEC A;  2AYG A;  1OY8 A;  1T05 A;  3V4M A;  2RKI B;  2C42 A;  1G4C A;  2DGV A;  4PAB A;  5CYJ A;  1QVG R;  2ZOF A;  1VIO A;  1X4B A;  2VFT A;  3ZZY A;  1Z1Z A;  1R6V A;  4YP3 A;  2XUL A;  1RBL A;  3K8W A;  5D3G B;  4B3R J;  2DNY A;  3SFU A;  5IT0 A;  3JSR A;  1ZZN A;  1H3D A;  5THW A;  1LK7 A;  4C8O A;  2VU5 A;  3UVJ B;  4KB7 A;  2WK4 A;  4DQQ A;  1RT2 A;  2YWK A;  2J9D A;  5LJ5 Y;  1HWI A;  2IDL A;  3KG0 A;  3MR7 A;  3B8H A;  2MQP A;  4ZDN A;  5KFZ A;  3PRB A;  4A4J A;  1W26 A;  2HFU A;  2GNK A;  1RBA A;  2AGP A;  5F9L A;  3CDU A;  2GMH A;  2XY6 A;  2CVE A;  3DOM B;  1WKJ A;  3HSD A;  3MOJ B;  1FRM A;  2OPP B;  4NCG B;  2AMC B;  2HHS A;  5DGA A;  1R0B G;  4UW2 A;  1RAO A;  2OJ3 A;  4IYQ A;  5H9E J;  4OLP A;  4OYI A;  3CIM A;  1T03 A;  1SJR A;  4LFA F;  1SH3 A;  1Y4Z B;  3BDP A;  4YOE A;  1WDD A;  4UZC A;  1VC0 A;  1VYA A;  2QRR A;  1MU2 B;  1LWF A;  4DZ6 A;  2EKY A;  2XC9 A;  4M63 A;  1S7H A;  2MQ8 A;  2XZW A;  3NOC A;  2ASD A;  3M6U A;  2IA6 A;  4DX6 A;  2XGP A;  2M0G B;  1LWF B;  3J7Z T;  4P52 A;  1YG0 A;  2EW9 A;  4ZVH A;  3T6J A;  2GX8 A;  5EWE A;  5KFV A;  4DCP B;  2JXH A;  4E2F B;  3MUV P;  2KG0 A;  1WC4 A;  1RT1 A;  5C5J A;  1DHM A;  1VIS A;  2BE2 B;  4C8M A;  4CO5 A;  2LCW A;  5CCL A;  5K14 B;  4LBI A;  5T7L A;  3GU0 A;  3SIP B;  2VBZ A;  4P2S A;  2CNO B;  2Y0B B;  4USW A;  1ZOT A;  4WP3 A;  3VR1 A;  3ZNU A;  1CJU B;  3DLB A;  2W2Q P;  4UOH A;  1HNI B;  4F04 B;  4ED0 A;  3I32 A;  2Q1L A;  2BX6 A;  2HBR B;  3D6T B;  1VJQ A;  4K50 A;  1S0M A;  2A2C A;  3C16 A;  3OUY B;  4HDH A;  1YTY A;  2EFN A;  1UZD A;  2XM3 A;  4DL4 A;  2GC8 A;  3KJV A;  3R7B B;  3T19 A;  1RTH A;  3IFE A;  2JVO A;  1ZTT A;  4N47 A;  4RNN A;  1TL1 A;  3MCO A;  1LKZ A;  1WJ9 A;  2BRK A;  1Q79 A;  4KRW A;  2RRB A;  4YB5 A;  2LYV A;  4A46 A;  2ADB A;  2XS2 A;  2EVZ A;  5DQI A;  5J2N A;  4DS4 A;  2A3J A;  2VD3 A;  2OPR B;  1HPZ B;  3CMQ A;  4B3R F;  1AW0 A;  2P6T A;  1RT4 A;  3K5P A;  1CJT A;  2RH3 A;  1J2V A;  3NCQ A;  4MH8 A;  5HO4 A;  5E33 A;  2H1O E;  1K1S A;  1UL3 A;  2VPW B;  5D0R A;  4B9N A;  1NLK L;  3ENA A;  4F3O A;  2I1R A;  4CWB A;  5A2Q U;  1MRO A;  4QOT A;  2B56 A;  4DL0 C;  4WFN Q;  2Y1I A;  1RIS A;  3GE9 A;  4LRC A;  3EXY A;  5DG9 A;  4NCA A;  4WZM A;  3HCX A;  4C8N A;  4E8U A;  1TVR B;  3M9N B;  4J9R A;  2W4C A;  3PR5 B;  5EX3 A;  2NQP A;  5LT5 A;  4OX6 A;  2ZKU A;  4LIR A;  1JXL A;  4CO0 A;  1FRK A;  1T94 A;  4JV1 A;  3KJQ B;  3FBF A;  4BLG A;  1X9W A;  3AD9 C;  2KI2 A;  5DDO C;  3M9O B;  1Y11 A;  1SH2 A;  3A4T A;  2I6W A;  2DGU A;  4URQ U;  2B3T B;  1APS A;  3PYG A;  1F9H A;  2GQC A;  1NB2 A;  3TUI C;  1RT7 B;  4NLG A;  1GNK A;  1U2C A;  1L3S A;  2Z56 B;  4PG5 A;  3LJP A;  1SIW A;  4DR3 J;  3U1L A;  5CHC B;  1M5K C;  4P6Q A;  2Q2K A;  1FRI A;  2BW2 A;  3C15 B;  4FXV A;  4G1I A;  3I9Z A;  2KFY A;  2DNG A;  4DG1 A;  1EB0 A;  2M52 A;  5HAO A;  8ATC B;  2ZM6 J;  2VG6 A;  2MKK A;  4TNO A;  1TKX B;  2NYI A;  2VFS A;  1NEE A;  1JLB B;  3FBB A;  3GR1 A;  4DV3 J;  4QYZ K;  2IC3 B;  2UUA J;  3SCL E;  2RVJ A;  2MKY A;  3AD7 C;  4AAI A;  1DAR A;  3IN5 A;  1QTM A;  2ZHB A;  3HDS A;  2N4C A;  3OVB A;  2BMB A;  1U9P A;  1RTD A;  2ZH2 A;  2L9N A;  3BPS P;  4DUY F;  2RIL A;  1IBM F;  4GC6 A;  3U1N A;  3VAJ A;  1R8C A;  3IGV A;  3LAK A;  4DPW A;  1PYO B;  2ZH6 A;  2HWI A;  2GGP A;  1FRX A;  2GMJ A;  2IVM A;  3FT7 A;  4DQS A;  4M5L A;  4ZLP A;  2J0S D;  1FD8 A;  1TV6 B;  2GAG C;  3A8K A;  3CTR A;  4TXS A;  3TP2 A;  1HHQ A;  4RUC A;  3DKD A;  3FQL A;  3AT1 B;  3HI9 A;  1ZYQ A;  4EEY A;  2H48 B;  1QUP A;  1VRT A;  1WEX A;  2VB6 A;  1BQX A;  1E6Y A;  3M2U B;  4RWW A;  4NRU A;  2BJ8 A;  2HRT A;  4R5P B;  4GVL A;  4JI2 J;  4DR7 F;  2QMW A;  4EO8 A;  1J5O B;  3M2U A;  2Y0S D;  3QO9 B;  3LGM A;  5LMU J;  1DTQ A;  4LIW A;  2UUT A;  2JL9 A;  3D5M A;  2RML A;  4IFV B;  2VQF F;  2B0G A;  5D4O A;  2VOP A;  5K8P A;  4PKD B;  2EK6 A;  5HQ8 A;  3VAM A;  1U2F A;  2WRM A;  4U6P A;  2F7V A;  3QGP A;  1S9G B;  1PC5 A;  4Y00 A;  2HNY A;  2HLU A;  1L3T A;  2H54 B;  3EZU A;  1AFJ A;  2QZ8 A;  5IZH A;  4ME7 E;  3RW7 A;  2VIC A;  2WBR A;  4ECW A;  3V6K A;  3OW2 R;  4MJW A;  4DU7 A;  2DH7 A;  3M8W A;  3D28 A;  2LA6 A;  4BC9 A;  4NA3 A;  1FXD A;  1HIY A;  1KLM A;  5HQM A;  3KJN B;  4CLZ A;  4AQY J;  4IFY B;  1XEZ A;  3EGW B;  2O66 A;  2OD4 A;  3LP1 B;  1TL7 B;  1NK5 A;  2NUH A;  3UN3 A;  2YKN B;  4U9R A;  3W2V A;  2RE1 A;  3IBF B;  2AYB A;  1EA4 A;  2GZO A;  3LGH A;  4B3S F;  1RXO B;  1URN A;  1TL7 A;  4DR4 J;  4RBT A;  4O3S A;  4ES3 A;  5T14 A;  2HQ3 A;  1B70 B;  1H2V Z;  1TR0 A;  1GMW A;  3MEK A;  2NSB A;  3IR7 B;  3IAM 9;  3QGH A;  3NKY A;  3H25 A;  4OJG A;  3V6J A;  3TNV A;  4KV8 B;  4AXJ A;  4EU0 A;  2HND B;  2KH9 A;  3MAH A;  3ZZO A;  1BUX A;  2UVR A;  1IM4 A;  2V94 A;  1UJ6 A;  2ZUA A;  2O1P A;  4J90 A;  3TVZ A;  3H2L A;  3MTJ A;  2QSF A;  1YBU A;  3AOB A;  4G6V B;  1WUU A;  1FJC A;  3ISN C;  1URR A;  2ACM A;  4ZIV A;  3FNN A;  4ECT A;  3UI3 A;  3CCT A;  3OT9 A;  1O0P A;  3P3D A;  4EUV A;  2V2K A;  4KGM A;  4RBU A;  1HBU A;  3UCG A;  2VA3 A;  3VQS A;  2ADL A;  2VV5 A;  4O4G A;  4QR0 A;  1RA6 A;  5A8W A;  4JI5 J;  1N33 F;  2ZH7 A;  2IYI A;  3HHD A;  2EC0 A;  2CJ9 A;  1T9Y A;  4MT1 A;  2LFV A;  2NXN A;  3K2Y A;  4DI6 A;  5KT3 A;  1N4L A;  5C24 A;  2PA3 A;  3QPI A;  3FEZ A;  2DNL A;  2PSZ A;  2V67 A;  3EIC A;  3T1Y J;  3IAS 9;  3NLC A;  4N8O A;  4BC7 A;  1NZ8 A;  4IFV A;  5KFF A;  3PW4 A;  1YJ7 A;  4OHY A;  4R0E A;  2JWN A;  1QTG A;  1Q53 A;  2Q6C A;  2DXE A;  3A8E A;  5IS2 A;  2QA1 A;  1RT1 B;  3IMQ J;  2DRA A;  1FA0 A;  2R7R A;  3IR6 B;  1WKK A;  1YBT A;  5AE3 A;  4KPC A;  5A8K A;  1EQM A;  4N41 A;  1F6T A;  5HSP A;  4L73 A;  2CNL B;  2FHJ A;  3BV8 A;  2ROP A;  2LMI A;  4H4M A;  4OZ1 A;  3FSY A;  3M1V B;  3T5L A;  4FS2 A;  1X4D A;  2UUA F;  4OX7 A;  4I6A A;  2DRD A;  5KG2 A;  3MEE B;  3LAN A;  4WP8 A;  1S10 A;  2DCU B;  1UWB B;  3RB0 A;  1K0V A;  1PYS B;  2N7Y A;  2WOM A;  4WTY A;  5HMW A;  3VEB A;  2XY5 A;  5RUB A;  2HMI B;  4DL5 A;  4ES2 A;  1H74 A;  2Z0G A;  2V50 A;  1HI1 A;  1NME B;  2CJA A;  2XBP A;  4M5N A;  4ZPA A;  3TW0 A;  4ED1 A;  1HR0 F;  2MKH A;  1JLF B;  1FFS B;  3TQ1 A;  1NND A;  4LF5 F;  3QJP A;  3S7R A;  2DTJ A;  3PJW A;  3OVA A;  1CC8 A;  4JV2 A;  2JFK A;  4CNY A;  3UWT A;  3BN4 A;  1RT6 B;  3EGZ A;  5KFM A;  2CPJ A;  1SXL A;  5KFI A;  1S79 A;  3D68 A;  1W25 A;  3R5C A;  5KAK A;  1CQM A;  3GCX P;  4P9S A;  5HMY A;  3CC2 S;  3U27 A;  4USM A;  4HDG A;  2VBY A;  1JJ2 R;  1EQ0 A;  3BYP A;  2OMO A;  2M5Y A;  1HNX J;  2W7O A;  3T9N A;  3DLH A;  5KFQ A;  4LF5 J;  2AN7 A;  1JKH B;  1MWQ A;  2L08 A;  4MK8 A;  1K0T A;  1OY6 A;  4IO1 A;  1FFG B;  1I5O B;  3QAE A;  3C2P A;  1CSJ A;  4FBU A;  1HD1 A;  1RZM A;  3MMB A;  5HJY A;  3A3P B;  5FJ4 A;  5M2R A;  1YHQ S;  3FDS A;  2KT3 A;  4CI0 B;  3KLV A;  1FER A;  3W7B A;  3CJ0 A;  3MMA A;  4RW6 B;  3TA0 A;  4CO1 A;  4X4O A;  3MR5 A;  1G3O A;  3MUR P;  1VQ9 S;  2QIF A;  4L3K A;  4DR6 J;  3G8Q A;  1HL6 A;  3GR0 A;  1N5S A;  1S12 A;  2BYC A;  2FHO B;  5SZT A;  3J7A N;  2A2B A;  2W2N P;  1H7X A;  3M6X A;  1NJW A;  3K58 A;  2GA7 A;  2EPI A;  3MUM P;  1HLW A;  4MFB B;  2APO A;  1TL1 B;  3KK2 A;  2PT0 A;  2LQ8 A;  1FTR A;  3TX8 A;  4U7C A;  2WVC A;  1RYS A;  1N5Y B;  4X4V A;  4TU8 A;  3DRR B;  1VCT A;  3BO3 A;  3CD7 A;  1WSR A;  2QL5 B;  4DWI A;  3M6V A;  2FLO A;  3T5J A;  4ZJO A;  3C6U B;  4H4O B;  4BHQ A;  1HW8 A;  1RHQ B;  4DR1 J;  3IO1 A;  2WOM B;  4A8X A;  3CDW A;  3EWG A;  4NCG A;  3V6D A;  1KVI A;  4NYP A;  4O3P A;  4P71 A;  4BS2 A;  3DOK A;  3NCR A;  1SKU B;  2Y8Y A;  3HKW A;  1CUL A;  2WON B;  1LW0 B;  2BSQ E;  1NDK A;  1Q5Y A;  1VRU B;  1IM6 A;  1I1G A;  1YQH A;  2CPE A;  2K2P A;  2YPZ A;  3GFX A;  2Z57 B;  1RTD B;  3PEJ A;  4ZP8 A;  5LOQ A;  1ZPV A;  2GVD A;  1FX2 A;  4FVM A;  2NLW A;  1S6P A;  4DPT A;  3GIR A;  4BCA A;  2K29 A;  1TUG B;  3E01 A;  3DRX A;  2AT1 B;  1OS5 A;  3BKU A;  3PYE A;  2F3J A;  4LSN B;  4Y3C A;  1F2G A;  1Z2L A;  2EG2 A;  3CCM S;  4MIA A;  3PKM A;  1NDL A;  3UD3 P;  2HHX A;  2ZIT A;  3MPD A;  4OHX A;  4LRE A;  2Y3Y A;  5F3T A;  2O67 A;  3G71 S;  4LMZ A;  3LA0 A;  2CAX A;  1WHV A;  4NLR A;  4UOG A;  3HK2 A;  4L75 A;  3OFH A;  1WG1 A;  4X4S A;  2KYX A;  1XMO F;  4MFB A;  1H72 C;  1NDC A;  3JQK A;  2NS1 B;  2RU3 A;  2L41 A;  2H9Z A;  2XCA A;  2EG1 A;  2DPJ A;  2D74 B;  3GTY X;  1HWK A;  1HFE L;  3G86 A;  5KFN A;  4DXL A;  1Q16 A;  3D0G E;  1HQ2 A;  2ZJQ Q;  3MR3 A;  2GQ2 A;  4QQB A;  3ZTS A;  3E51 A;  2DD8 S;  3M32 B;  4C8L A;  3QZ8 A;  4K4Z A;  1SL2 A;  2BKO A;  4NAS A;  3OL8 A;  3EE3 A;  2AKW B;  1NHU A;  3OTO F;  3KK1 B;  1KC8 T;  1QLN A;  3QJJ A;  2AWZ A;  1S1U A;  1S1T A;  2UXB F;  2YQ0 A;  3OHB A;  3IC1 A;  1WOO A;  4X4T A;  4PXE A;  2EXU A;  2H5I B;  1H38 A;  2DHG A;  3J7Y I;  3OR1 A;  5A8W B;  2OSQ A;  2IYG A;  5KOW A;  2R8K A;  4RX6 A;  3DRR A;  2UXD J;  4KV8 A;  3KOA A;  4FP9 A;  3SI8 A;  3KG4 A;  2IDE A;  4UUX A;  2V0N A;  2OTJ S;  3EPG A;  3CED A;  4KKO B;  4J9N A;  4MKY A;  2ADC A;  1U6B A;  3VCD A;  3FFI A;  3J80 Y;  4AT1 B;  1EKS A;  1RLC L;  2AIR B;  4DL3 A;  3B4D A;  1RAC B;  4ED5 A;  2JHE A;  2ZWP A;  1WC0 A;  3RRH A;  1KOH A;  4HTI A;  2FLL A;  3P49 B;  1VQN S;  2HVD A;  3PEH A;  3LWM A;  4IH5 A;  4NI2 B;  2I0X A;  1RT2 B;  2DO0 A;  4O23 A;  2PC6 A;  2E5L J;  2BNW A;  2Q3P A;  1R8B A;  3LP1 A;  3VQT A;  2ZWO A;  1T9U A;  5GMD A;  1Q4R A;  1Y5N B;  4Y2M A;  3CSK A;  4DPU A;  4ZCM A;  4KO0 B;  4F4W A;  1C0U B;  4LF9 F;  3QJL A;  2WB1 D;  1KBR A;  5G4D A;  3LPY A;  2IY5 B;  2KHD A;  3IRX A;  3J81 j;  1YJN S;  3VTI A;  5B0G A;  2VOO A;  3M8P B;  1WOS A;  2MQQ A;  1ZZF A;  3R6L B;  5JUM A;  4LQ3 A;  2ZM6 F;  1S9G A;  4A8W A;  3A1Y G;  2KOE A;  2HNY B;  3THP A;  3H87 C;  1DTT B;  1TQL A;  1YJ9 S;  1NM2 A;  5K8N A;  2FQQ B;  5H1S V;  2YKM B;  2HZA A;  1L3K A;  3GFY A;  4ED6 A;  2ZNY A;  2HQC A;  1T9V A;  3PNI A;  4YME A;  2DYA A;  3LUY A;  5DS7 A;  4L76 A;  3LAL A;  3OR2 B;  1R0A B;  3M2R A;  1IBL F;  2MB0 B;  2I2Y A;  1YRX A;  2RAQ A;  5ETS A;  1NSQ A;  3BM7 A;  3FKB A;  3ITH A;  1HBM A;  1HQU B;  4CO2 A;  4J9M A;  1FXR A;  1S4E A;  3E2E A;  1MYL A;  3M8S A;  1L3U A;  2FHJ D;  4OLO A;  3P5B P;  4KH0 B;  1FWK A;  2CQ4 A;  2HGN A;  1HBU B;  1DQ8 A;  3CJQ A;  4UF4 A;  3KHH A;  4DL7 A;  1FWP A;  1CS4 B;  4M5D B;  2V2V A;  5BR8 F;  3G96 A;  4YDX A;  2AZ1 A;  4K4X A;  1S59 A;  4Q45 A;  1N33 J;  1U47 A;  1VRQ C;  3T3F A;  4B9S A;  3L7U A;  4ZOS A;  3DFE A;  4HEA 9;  2W8L A;  3UO0 A;  1NAQ A;  5IQ6 A;  1RA7 A;  2OEM A;  2G0J A;  3FZB A;  1MN7 A;  4ZN3 A;  2B4V A;  3NGU A;  4XDD A;  2DXF A;  4NLX A;  4UTG A;  3LP2 B;  4DUZ F;  5AXM A;  1RAG B;  3H5Y A;  3LH2 S;  1ZS6 A;  5KG3 A;  3CCQ S;  3K8V A;  4F4Z A;  1F5B A;  3BBB A;  4U8Y A;  3W1Y C;  2IRX A;  3VVT A;  4CYU A;  5KFY A;  4V19 X;  2ZKT A;  4DV2 F;  2MSS A;  2Q79 A;  3ZZU A;  3TZX A;  1Y3J A;  3I96 A;  2XI2 A;  3BEG B;  2R7Q A;  3I87 A;  2DHH A;  2NXU A;  3WDO A;  2A1B A;  2XG8 A;  5DO2 A;  3C6U A;  4C3K A;  4Q43 A;  4KPY A;  3CUL A;  5CZX A;  5GAG I;  2JX2 A;  3FCH A;  1U24 A;  3QRQ A;  4RW8 B;  2M88 A;  1GK8 A;  3EPI A;  2KFZ A;  4IDK B;  1S1V B;  2LEC A;  1BWE A;  4DL6 A;  1PJ7 A;  4NZ6 A;  3PXG a;  1CJK B;  1T0T V;  3VWS A;  4RW8 A;  1FTC A;  3MM9 A;  3CME S;  4LF6 J;  3MAA A;  3OL7 A;  1QAJ A;  4OYP A;  3IR7 A;  4ZVG A;  5LXY A;  5ETO A;  2VG6 B;  1NB7 A;  2HW3 A;  3R2D J;  3D6H B;  2EFO A;  2GCF A;  1GMW D;  2RBF A;  1JMT A;  4DCO B;  2YNF B;  3GIM A;  2W9B B;  1QE1 A;  1WHX A;  2P9C A;  4X66 F;  2HFZ A;  1RSC A;  1D9D A;  4YUD A;  3PJ9 A;  4CYU B;  1FE4 A;  3O5T B;  2RQ4 A;  2RHS B;  1LW2 A;  1U0S A;  3C6T A;  1TL4 A;  1I3O B;  5F41 A;  3TZW A;  1IKV B;  3TUJ C;  3HO1 A;  5E3A A;  2WVD A;  4ZS6 A;  1UA0 A;  3AQP A;  2CDR B;  2VQF J;  2BXJ A;  3FBC A;  3TZZ A;  2CPX A;  2XHC A;  2ZD1 B;  1MNT A;  2MZ1 A;  2F63 A;  3D1O A;  3MPW A;  2RT3 A;  3WX8 A;  5CAB A;  2QGF B;  2V8D A;  4M5D A;  3GYX B;  3QLH B;  4JI4 J;  4ZVS B;  3CPW R;  2D3O 1;  2IM0 A;  5AJ3 J;  3DHX A;  1XER A;  1ACM B;  3DRY A;  1V3S A;  1REV B;  4ZHR B;  1DTQ B;  2YH0 A;  5H9F K;  4CTA A;  2E1A A;  2VPZ B;  1RWX B;  3OFG A;  1N54 B;  4X4N A;  3GJS B;  3I56 S;  1S1T B;  1B0V A;  4C97 A;  2FDN A;  2K1R A;  2R2R A;  1R43 A;  3NGK A;  4HAC A;  3RW6 A;  4YHH J;  1X9S A;  1S1W B;  2MZJ A;  1SVD A;  1VFJ A;  2E5H A;  1GMV A;  4RW9 A;  1U02 A;  2MZQ A;  4ZVE A;  2EC2 A;  4LF7 J;  3GYN A;  3D1H A;  1VJW A;  4ATN A;  2FHK A;  4ED2 A;  2ZOM A;  4W4M A;  2IRY A;  2J9C A;  2AJ0 A;  4WKY A;  2AYE A;  5F8N A;  3M2V A;  3QID A;  3OL9 A;  3AD8 C;  4EK2 A;  4JI7 F;  2CZV C;  5DQG A;  2YX4 A;  1TK8 A;  3CCE S;  1QVF R;  4TU9 A;  3F0N A;  3US5 A;  3EVM A;  3G6X A;  3CDE A;  2V4J A;  1C4C A;  5EGY A;  4PXD A;  3IM9 A;  1RAH B;  4Y2I A;  1HNV A;  4ZPT R;  4ES1 A;  1FKO A;  3BGL A;  5E0O A;  4CRJ A;  3TYT A;  1MLA A;  4DV0 F;  4IOC Q;  1U8W A;  2BM0 A;  2IA0 A;  2Q6B A;  3ZTQ A;  1IWG A;  1M5O C;  2FLN A;  2KVQ E;  5CCM A;  3KJF B;  1JJ4 A;  1TL3 A;  2EBE A;  4JOU A;  2VBW A;  4KY3 A;  2XS7 A;  4OQJ A;  3MR2 A;  1B3T A;  3ZXW A;  5CD4 H;  2CPY A;  2NZ4 A;  3D3C J;  2B7C B;  3QIP B;  2R8J A;  1CC7 A;  3QSI A;  5IWA F;  4HLB A;  4WU3 A;  1DBD A;  2B5J A;  3Q24 A;  3CDB A;  4LSL B;  4ELV A;  2ZZN A;  1B4S A;  3N0V A;  5IT9 U;  2N3O A;  4WK3 A;  3L4B C;  3PYF A;  3PVX A;  2GV1 A;  3TJ9 A;  2POK A;  4S0M A;  2J6S A;  4DSE A;  1RAB B;  1NHK L;  1VHF A;  2DEJ A;  2E66 A;  4I0W A;  4X62 F;  4ED3 A;  4U7U D;  2HBQ B;  4G3I A;  3MF5 A;  2V68 A;  3HF5 A;  2YX7 A;  5ITH A;  3KHL A;  4JI0 J;  4M1K A;  4OYB A;  4F4Y A;  4TQS A;  1KD1 T;  3DLG A;  1NHV A;  3W5X A;  3V81 B;  1HYS A;  5FII A;  3Q86 A;  2AD9 A;  3QAU A;  2CQB A;  2DNN A;  2AEM A;  2PD1 A;  5KFC A;  3NAI A;  2LVW A;  3K57 A;  1ZM4 A;  3ULH A;  1VBY A;  2BOP A;  4OYO A;  3G6E S;  2OPQ A;  2CPZ A;  4OYZ A;  4TN2 A;  2QA4 G;  4IQX A;  1HPZ A;  4TVA B;  3GG0 A;  4ECX A;  5A76 A;  2WVB A;  4F8R A;  4NLS A;  1U1P A;  1JB0 C;  1LWC B;  2D9P A;  4CNZ A;  1HNW F;  2WHO A;  2QLF B;  4UQT A;  5K9F A;  1U1M A;  3CMA S;  3DCA A;  3MED A;  5IT9 Y;  1RKJ A;  1RWN B;  5HRO B;  1I6J A;  4OV1 A;  3BSO A;  1KWM A;  3TAM B;  2RIJ A;  1IJE B;  3TR5 A;  1V6H A;  2B5J B;  5LL6 d;  3CJT A;  4B3T F;  1GFW B;  1VRU A;  1YIT S;  1SI9 A;  3W64 A;  3RU0 A;  1M90 T;  3NMR A;  4WFY A;  4GKK F;  3TAP A;  3UNG C;  1IXK A;  3BR8 A;  4P7V A;  2LQB A;  3TVK A;  1ZH5 A;  3RAM A;  4DR2 J;  2HFO A;  3BJY A;  3O3L A;  3K89 A;  3EJM A;  2FVS A;  1NK7 A;  3T1H F;  2VFU A;  3PW5 A;  3QIP A;  1C0T B;  3ZTP A;  1NKE A;  2CJK A;  1UVL A;  2CJQ A;  5D4N A;  3SYZ A;  2XLK A;  2GO9 A;  3KUH A;  4QWC A;  4QIF A;  3G6V A;  1FEE A;  4DX5 A;  2FC8 A;  4OZ0 A;  5F9N A;  1WHW A;  3HHK A;  4RNM A;  4ZVQ B;  3KDO A;  4O44 A;  3QWP A;  1ZPW X;  2J6U A;  1XN9 A;  5BR8 J;  1VLO A;  2AF6 A;  5K8M A;  4X4P A;  5IT4 A;  3SZ2 A;  1YI2 S;  1NKB A;  4RKU C;  3LF0 A;  2MYF A;  1LWC A;  2XMT A;  3POT A;  2M7S A;  2AEF A;  3CJK A;  1X4A A;  2CXE A;  3IGN A;  4W98 A;  1V9O A;  4QYZ J;  1LWE B;  2MEW A;  2KJV A;  2DNO A;  2X51 A;  1HQE A;  2W7A A;  2J76 E;  1M5S A;  2V8H A;  2BM1 A;  4I2Q B;  3OHA A;  1T9T A;  3DOM A;  4WK1 A;  1IR2 A;  1GX5 A;  5U47 A;  4BWJ A;  1MNE A;  3FRZ A;  3N4W A;  1FD2 A;  1Y10 A;  3J7Y U;  3PKY A;  4LF6 F;  2CKW A;  5K8O A;  2HKE A;  2DCL A;  3D4J A;  3Q2S C;  3H7H B;  4MKB A;  5EWF A;  5GAE U;  2Y8W A;  3R5G A;  5KG5 A;  2V34 A;  3W9H A;  4TY8 A;  4FN5 A;  2XO6 A;  4NLW A;  4DEZ A;  3ISN D;  2AJQ A;  4RUA A;  1EKR A;  3CW2 C;  4MTP A;  4ZPC A;  1JWW A;  2CAD A;  3S01 A;  3FK4 A;  2CA9 A;  2GQQ A;  2KT5 A;  4L3N A;  2HHQ A;  1U2R A;  4A8K A;  1YKW A;  4HR2 A;  4K0K F;  5E7O B;  2J5A A;  1Q7L B;  4NLD A;  2DR8 A;  4DJB A;  3JQJ A;  4Y2K A;  4Q2M A;  4ZA1 A;  4FXW A;  3A13 A;  1NLA A;  4B9T A;  4U67 Q;  1RTH B;  3W9I A;  1GEH A;  4MYU A;  1U6F A;  2VDI A;  1VQM S;  2RQC A;  4WPA A;  2MKI A;  4PXB A;  2VH7 A;  1BAZ A;  2XMU A;  2ZH3 A;  4HL9 A;  4NLT A;  5B0D A;  5D8H B;  3HHL B;  3GJQ B;  3UFC X;  2XNR A;  4DMZ A;  3PX0 A;  2I9S A;  4KHP F;  2PFD A;  4PYD A;  1EP4 A;  5CYM A;  4DFK A;  1Q86 T;  3BQ1 A;  4HT7 A;  3F41 A;  3O8W A;  3W3S A;  2RRN A;  2VG5 B;  3SBM A;  4ZKA A;  1SC1 B;  2W2P P;  5IM0 B;  1NK9 A;  2FJX A;  1U0H B;  1XMB A;  4CLU A;  2W2M P;  3NGR A;  4OHW A;  2K1O A;  3PJX A;  3B78 A;  3SQG B;  1X4C A;  1NH8 A;  2M9K A;  4LF9 J;  3WBZ A;  1GMU A;  1OY9 A;  3DOL A;  3SQO P;  1VMB A;  1RTZ A;  3GYG A;  3UN5 A;  4FF3 A;  4OL8 A;  2QJ3 A;  3MDF A;  2CQH A;  3KLG A;  4XK8 C;  2VQE F;  3POT B;  2OUG A;  4FYV B;  2AJ2 A;  2MQL A;  4RW9 B;  3G82 A;  5IOL A;  2MY7 A;  4EBD A;  2C2M B;  1LFW A;  2ROG A;  1AYE A;  2C22 A;  2FJE B;  2COL A;  2J9D E;  3C14 A;  3WC0 A;  3LO3 A;  4LSN A;  5I3U B;  4X64 F;  3R5D A;  4DZD A;  4X84 A;  3JSY A;  5B0F A;  3HSG A;  4GRS A;  2EFV A;  3W5Y A;  3M2V B;  2R7V A;  4Y0F A;  3PO5 A;  1R89 A;  4ICL A;  2VIH A;  1YDL A;  1UWA A;  2W1B A;  5ETQ A;  1OJ4 A;  2DO4 A;  5A0Y A;  4WXO A;  2OEJ A;  3DI6 A;  1W2I A;  2MZR A;  3AOA A;  4PR6 A;  3Q22 A;  3RBX A;  2V4J B;  2XMJ A;  5F8H A;  2B9E A;  4IRC A;  3U7J A;  4K2X A;  3DI6 B;  1CPZ A;  5C24 B;  4R8U A;  4PG8 A;  5IV4 A;  3CO9 A;  3OBI A;  5AE2 A;  4WCE Q;  3G4S S;  2ATL A;  1ZBT A;  4XPC A;  5IXU A;  2DNH A;  2MLY A;  5FD1 A;  4ZVF A;  2DY1 A;  1PIE A;  2WZ1 A;  4HKQ A;  4WE1 A;  5ETR A;  4E0D A;  2VKZ G;  5AXL A;  4P72 A;  2ZHA A;  2R7X A;  1BD6 A;  4G1Q A;  4KH1 B;  3FUY A;  4JI0 F;  3H4B A;  1FK9 A;  4TLR A;  5KG7 A;  1IBK F;  2V69 A;  3D9B A;  1J5E J;  5J2M B;  3UDC A;  2AX1 A;  4YR0 A;  2BW7 A;  2HBY B;  2D9O A;  2A2D A;  3QMQ A;  4C7Q A;  2QO3 A;  1HI8 A;  1X5P A;  3LQV A;  5A0Y B;  3Q8V A;  3FJ2 A;  5A8R B;  3P5T L;  4LF2 A;  4CLT A;  1X5O A;  4QZV B;  2R2U A;  5LXR A;  3GIJ A;  1A9N B;  1XK8 A;  1RAI B;  4ZLJ A;  3KWM A;  2R7W A;  4WFZ A;  4DR5 F;  1Q81 T;  4KYZ A;  3V6D B;  1B64 A;  1N36 J;  4B3O B;  2KL8 A;  1SH0 A;  4P74 A;  1RJJ A;  3M8Y A;  1KFD A;  1S1X A;  1GT8 A;  1YX2 A;  1TV6 A;  3H59 A;  2GO8 A;  2Y1L B;  5K5M A;  4H4K A;  4KJI A;  4K5R A;  1DJ0 A;  2FZK B;  3HT3 A;  2CPH A;  1P6T A;  5LMN J;  1R3N A;  4ZCL A;  1V3R A;  2ZVS A;  5JJB A;  2BA3 A;  2BE7 D;  4U7U K;  1E6V A;  5DLG A;  5IV3 A;  2MTL A;  4B3M F;  4AND A;  1RK8 A;  1FDB A;  3VV2 B;  1ULR A;  3KHR A;  1ZTW A;  3K0J A;  1MN9 A;  3AA9 A;  3DN9 A;  4CM0 A;  2BAB A;  1E6V B;  2DR6 A;  4ZPB A;  4A8Y A;  1WKL A;  1AT1 B;  2ZC3 A;  1OWX A;  2LU1 A;  4KFB B;  3AXK A;  3VAK A;  3C46 A;  2I8E A;  5B09 A;  4Q7A A;  2NCK L;  3PCO B;  4OI1 A;  4IUF A;  1BWV A;  2DIT A;  1EAR A;  2F9J A;  2M4M A;  2L3M A;  3R5J B;  4LF8 J;  1RU1 A;  3JXO A;  1S1X B;  1QTN B;  5GAD U;  4JI3 F;  1NPR A;  4PQA A;  2ZOG A;  3IS9 B;  4L72 B;  1H7W A;  2JEI A;  1U09 A;  3EUN A;  2E1M C;  3BGR B;  3CCS S;  2CYY A;  4LSZ B;  1HD0 A;  4ZP9 A;  3WIU A;  1VQ4 S;  2GIF A;  1HQE B;  4F0H A;  5DZ6 A;  5DG7 A;  2IHR 1;  3IP0 A;  4DSJ A;  4N76 A;  1U1R A;  1RHU B;  4PUO B;  3D0H E;  2QV6 A;  4FXE A;  3IG1 B;  4LBP A;  4JI4 F;  1X0F A;  2HK2 A;  4USK A;  3VVU A;  2JEG A;  2C3P A;  2BQR A;  3EYZ A;  1WTF A;  4TY8 B;  2PN6 A;  2CFX A;  2JOQ A;  3MCN A;  2LXU A;  1BQM A;  5E3P A;  1IKW A;  4Z7C A;  2FGO A;  4C0O C;  3CC7 S;  5D6G A;  3G9C A;  1YRT A;  1IKY A;  1WOP A;  2PO4 A;  2YKA A;  3OFF A;  2KZZ A;  2MZS A;  4ANC A;  1WI8 A;  2HK3 A;  2PA8 D;  4I68 A;  3ZTR A;  2Y1J A;  1A6L A;  3RG6 A;  5KT5 A;  2QX0 A;  3GJR B;  3OR2 A;  1Q78 A;  2YWF A;  3FVY A;  3HVW A;  2J8S A;  3MEE A;  2EI5 A;  4FPR A;  4AYB D;  3M32 A;  2BJE A;  1PC4 A;  4IG3 A;  2DNM A;  3ZZP A;  3QT5 A;  1FKP B;  1RT5 A;  1T9X A;  3PR4 A;  3MFI A;  1EHW A;  4ECQ A;  3L7P A;  3BPD A;  2MLZ A;  2FUG 9;  3N01 A;  4IQM A;  4TY9 A;  5C25 A;  5BYQ A;  1KSP A;  5KT7 A;  3PV8 A;  1WF1 A;  2C2E A;  2F5G A;  4JYA F;  1IR1 A;  4FNH A;  1TU0 B;  3M7V A;  2MXY A;  4FF1 A;  3RRG A;  4ILL A;  1FXL A;  3DLE B;  1YIJ S;  3O6Q A;  2LKZ A;  2QLJ B;  3MTK A;  4P2F A;  1C0T A;  1WC1 A;  3HHE A;  2XMA A;  1MRO B;  5KOX A;  1VQO S;  3M8R A;  5D77 A;  2AYM A;  4RL1 A;  4A47 A;  1BDV A;  1N5Y A;  2YNH A;  4UY8 5;  3KDN A;  1K44 A;  4JV5 J;  4CO4 A;  4B9V A;  4KTQ A;  1IKV A;  3IWL A;  3CJ8 A;  3TAN A;  4DV2 J;  1RWP B;  5IC6 B;  1B28 A;  4CQ1 A;  2YY3 A;  3ZZT A;  1CJV A;  1F5C A;  3ILJ A;  3W8G A;  3K5N A;  1BQM B;  3T5K A;  4B9L A;  1WEL A;  1GXT A;  3DNC A;  3AJ2 A;  2ZH5 A;  1CUL B;  4ERD A;  2VHG A;  2DH9 A;  3K5M A;  1RAF B;  1TKZ B;  2YQ3 A;  5KFL A;  5KTQ A;  4NE9 C;  3BQ2 A;  2WVE A;  5L9N A;  4I2Q A;  2OPR A;  1TEL A;  1Y5I B;  3NS7 B;  4IFY A;  1RT4 B;  3OUY A;  4XTT A;  3MEG B;  3EGV A;  3UN2 A;  1FJG J;  1O51 A;  2E5G A;  2JJ4 D;  4ZP6 A;  4IH6 A;  1Q8B A;  3J81 U;  2OTL S;  2M70 A;  4XIU A;  2AU0 A;  3CJ5 A;  2OD6 A;  4J9P A;  1JLA A;  3GCW P;  3NXZ A;  2DGQ A;  2Z58 B;  5FDL B;  1WSV A;  3VAG A;  2WBM A;  2HGL A;  1TVR A;  3MCM A;  3ICL A;  1V5V A;  1F0X A;  1RAD B;  1RHM B;  4JV0 A;  4FKY A;  5H9F J;  1FX4 A;  5LSL A;  2R7U A;  1OQ3 A;  4NLV A;  2DXD A;  2YNI A;  1QJH A;  3GON A;  5FLX U;  1NJI T;  2RSQ A;  3CB4 A;  6AT1 B;  1FT8 A;  1P9Y A;  3EDR B;  4B9M A;  4NML A;  2KXH A;  3ZZ0 A;  1WF2 A;  1ZAV A;  3ZNJ 1;  3NNC A;  4P7T A;  1F3F A;  4ALZ A;  1X4G A;  2F8E X;  3DRP A;  3I0R A;  3OTB A;  4BWM A;  4CLY A;  3QT8 A;  4EBE A;  5ETT A;  2EEY A;  3UD4 P;  1SUQ A;  3CWJ A;  1ICE B;  3N28 A;  2XYG B;  4J9Q A;  4U95 A;  3CD5 A;  1TKZ A;  3KK3 A;  2HHV A;  3RBZ A;  2RHQ B;  2ASJ A;  1AUD A;  2MJU A;  3MPY A;  4Y2C A;  1JLQ B;  2ZBQ A;  2ZH9 A;  4C6A A;  4ELT A;  2CQG A;  3CDA A;  3H0P A;  3MMC B;  4ID5 A;  4X4R A;  5A2Q Y;  1D09 B;  4F02 A;  1RB0 A;  4FKX A;  4FYW B;  4JI6 F;  2E5L F;  3W61 A;  3Q8Y A;  2PMZ D;  3MMC A;  2ZVI A;  5LM7 E;  1NJY A;  2JH3 A;  1HKA A;  1NH7 A;  1FHT A;  3LGN A;  3HX9 A;  3Q8U A;  1NSK L;  4LRB A;  4DBQ A;  1X7V A;  2MHE A;  5L39 A;  1T11 A;  4X65 J;  3AH6 A;  1RAE B;  2IFX A;  5C2C A;  2JNJ A;  3TOQ A;  5GAH U;  4ER8 A;  4HTJ A;  3F44 A;  4ZVR B;  3GFH A;  5SUH A;  1S6Q B;  3EZO A;  4CH7 A;  5F8I A;  5B7W A;  2G4B A;  2HRY A;  1RE1 B;  4WTO B;  4UQG A;  1RCO B;  1SCJ B;  2B8P A;  3O2I A;  3OLB A;  1T02 A;  4QCL A;  1RAA B;  5EHH A;  3OXF A;  2Z2L A;  4FBT A;  2HAI A;  5LSO A;  3GV8 B;  8AT1 B;  2C2O B;  1JLE A;  2KM8 B;  3D1Q A;  4R8U B;  3G8S A;  5IC4 B;  1LV5 A;  3MMJ A;  5L1L A;  4WFB Q;  1RKI A;  4UZB A;  1X5S A;  3MM8 A;  4WXW A;  3HXM A;  1B01 A;  2IMO A;  2NSC A;  1ZAX A;  3HJV A;  4NYO A;  3MWB A;  2UXB J;  4CTA B;  2BQU A;  2ZBP A;  4RNO A;  3DLG B;  2W9B A;  2KKH A;  3M8Z A;  3UR0 A;  3HD2 A;  1NRK A;  3DGP B;  1OYD A;  2ZH8 A;  3UCU P;  3J7A 1;  2DNQ A;  2W25 A;  4KFB A;  2JRS A;  3H98 A;  3NNH A;  4HAC B;  1YWX A;  5FLX Y;  2N4D A;  2P9G A;  3CJ4 A;  3IWN C;  1SV5 B;  2HIY A;  4NLP A;  2PII A;  5E5N A;  4PRF A;  1AZS A;  1JLG A;  3ETO A;  4RW7 B;  4DF8 A;  2P2C B;  3N6L A;  1Q5V A;  4P2X A;  2YBV A;  2OSR A;  4QIW D;  2ZH4 A;  4OJ3 A;  4OX8 A;  4X2B A;  5ETP A;  1ZAW A;  3UDL A;  2O3D A;  2A10 A;  3BGR A;  3T6B A;  4PAA A;  3W62 A;  4DV3 F;  3MEC B;  1QM9 A;  3MM7 A;  3KTQ A;  3THV A;  3C16 B;  1NKC A;  2AJ1 A;  1AFI A;  1TKT B;  2HS0 A;  3I4P A;  5DZ7 A;  4PWD B;  1H0H B;  2YVS A;  1I94 F;  2YKN A;  4RW4 B;  2VG7 B;  4ZK7 M;  2PDA A;  5D0E A;  2IAJ A;  1WG4 A;  2BR0 A;  1HNV B;  4NWB A;  4DV4 F;  2K3K A;  3GPA A;  5KFX A;  4ECR A;  2KB2 A;  4Z7Y A;  4RW4 A;  4WYL A;  3DYA B;  4D8J A;  3R1L A;  4EFA C;  1QAI A;  3TA1 A;  3DLE A;  2XGQ A;  3AB2 B;  1WD6 A;  2RB7 A;  3DRS B;  1IKY B;  1TAU A;  1S76 D;  1DRZ A;  1LFP A;  2AGO A;  4O3Q A;  4K4Y A;  5L9X A;  2UV8 A;  3DC2 A;  4DR1 F;  3RB3 A;  1IUJ A;  1KQK A;  3ILL A;  3MM5 A;  2VBX A;  4CM2 A;  3D2W A;  1U1N A;  2HUR A;  1UKU A;  2R7T A;  3DGV A;  4IG3 B;  4KBI A;  3DM2 A;  5HI7 A;  3KLF A;  1RBO B;  4DV1 F;  4Q8E A;  1DAX A;  1GQE A;  2PEB A;  3CNQ P;  4LR8 A;  1HBM B;  3T1A A;  1U1K A;  4J5O A;  1IR0 A;  4NX9 A;  1HNI A;  1SC4 B;  1SC6 A;  4PG7 A;  2NPF A;  1KHV A;  4AD6 A;  3IR5 B;  2BEF A;  1YZ7 A;  4ED8 A;  5DG8 A;  1VIX A;  3BGF A;  2R7O A;  2E29 A;  3BBF A;  1B0P A;  2DHX A;  2V6A A;  4ZMM A;  4DPO A;  4YQW A;  1S0V A;  3H2V E;  1TMM A;  1K8A T;  1FJE B;  5GAE I;  1UVJ A;  4DR6 F;  4QWD A;  3PHE A;  1RWM B;  1B0T A;  3MD1 A;  3IBW A;  1N52 B;  4URG A;  4J9K A;  4HI2 A;  1QSY A;  5KFJ A;  2HVH A;  5F8J A;  2KU7 A;  2E1P A;  3K17 A;  2HS4 A;  1RWO B;  3RUB L;  3VAF A;  1X31 C;  2G1D A;  1JJC B;  4RBV A;  1Y7P A;  3KLF B;  3BKT A;  4QWA A;  5C42 B;  4OZJ A;  2LQ5 A;  2ZFH A;  2IC3 A;  1RP5 A;  2K06 A;  5ETV A;  1HNX F;  2UUB J;  4DHV A;  1S48 A;  4KGZ B;  1JXE A;  1D9F A;  4JI8 J;  2SXL A;  3TI0 A;  3HUL A;  2AV5 A;  3SCK E;  1XWL A;  4WU2 A;  2MZT A;  3QSY B;  4KR0 B;  4X64 J;  1FEH A;  3T9Z A;  9RUB A;  4NRT A;  2VG7 A;  1LW0 A;  3A12 A;  1U1Q A;  1SQG A;  2C28 A;  2DPI A;  3SQG A;  2O5D A;  4RW6 A;  2DGS A;  1EJ7 L;  2F8M A;  3W5Z A;  4FYX B;  2FJV A;  4LJM A;  4UT4 A;  2N82 B;  4YDD B;  4LF1 A;  4K8R A;  3N6N A;  4F7V A;  5KT6 A;  1V5I B;  4JI1 J;  4NXN F;  2JFD A;  2YPY A;  3P4U B;  1KP6 A;  3CO0 P;  4CLS A;  3KMS A;  5DM6 Q;  4WBF A;  1IKX B;  2GVZ B;  3HFK A;  3MR6 A;  3VW4 A;  4GVB B;  3JB9 k;  1XIQ A;  3HFZ B;  3NNE A;  1KKH A;  3K5O A;  1EET B;  4LFA J;  1KVJ A;  3JSM A;  4QWE A;  3GII A;  4IR1 A;  4A48 A;  3KLH A;  2RNE A;  4I64 A;  4GC7 A;  2JEJ A;  2QLX A;  2IJN A;  1SIZ A;  2J7U A;  2L9D A;  1T8E A;  3PTW A;  3PRD A;  3NS6 A;  4Y65 A;  2J0W A;  5CZV A;  5J1E B;  4F4K A;  1F9F A;  2OEL A;  5C42 A;  2CPI A;  4FS1 A;  3H4D A;  2XYP B;  4I56 A;  1K73 T;  1HW9 A;  4O0N A;  1FFW B;  2CQD A;  2KXN B;  1VQ7 S;  1FCA A;  4DSI A;  4FYD A;  4OI6 A;  3HT0 A;  5KFU A;  2DBB A;  2C2R A;  1D8Y A;  2PFF B;  4JBC A;  1KQF B;  1PAR A;  2X1B A;  2V8G A;  3JYT B;  3CCW A;  1B7F A;  3NG8 A;  3FMT A;  1EZZ B;  1S4F A;  3ELH A;  2XWX A;  4FDF A;  3NL0 A;  5L8R C;  3KYL A;  2DY9 A;  2G9O A;  1C1B B;  3OR1 B;  2V9W A;  5KFR A;  1FJ7 A;  5CQG A;  3N79 A;  1M5P C;  1BMQ B;  2NZC A;  2HHP A;  1QD1 A;  3ENW A;  3H20 A;  1FRH A;  2B7B B;  3KNG A;  4RU9 A;  3MGJ A;  3QAT A;  2HYI B;  3JAM Y;  3CCL S;  1NO8 A;  4CLP A;  5MAO A;  3C66 A;  2NXE A;  1S9E A;  3JS9 A;  4CO3 A;  4DV5 F;  1R31 A;  5H9E K;  1RWV B;  4GMK A;  1VR6 A;  1IQZ A;  2DIS A;  4G1P A;  5B08 A;  2DR9 A;  1CVJ A;  3PFE A;  2F4V J;  1U49 A;  3FBE A;  3QRP A;  4PQU A;  1N32 F;  5L1K A;  2CQ1 A;  4ZHR A;  3GZ7 A;  2XEX A;  4H54 A;  1R6Y A;  2QL7 B;  2W01 A;  3AQO A;  3OXG A;  1R7I A;  1N6Q B;  2XHW A;  1UTA A;  4DR5 J;  3PZP A;  1HWJ A;  4CLK A;  3LWL A;  3CCR S;  1JIH A;  1S0O A;  4DR4 F;  2EFQ A;  1SUQ B;  1M5V C;  4B3S J;  2RUG A;  3ISZ A;  4O3R A;  2ZZM A;  3H40 A;  2WAQ D;  4USJ C;  1VQL S;  1A0O B;  1UW4 A;  1RTJ A;  2AEJ A;  3E8O A;  4LVO P;  1NSA A;  2L48 A;  5M2U A;  4N56 A;  1IBK J;  5HRO A;  1FO1 A;  4J9O A;  4V1A k;  4AQY F;  2HPU A;  2MKC A;  4U96 A;  1GXU A;  2DHS A;  4EMD A;  5DM7 Q;  3CJS A;  1HNZ J;  2G0C A;  2WON A;  3QT6 A;  3HLU A;  1TKX A;  2EBG A;  3I55 S;  2W7P A;  1CLF A;  3UCZ P;  5KFH A;  5KT4 A;  2V63 A;  4I6W A;  1MML A;  1XNQ J;  1Q95 G;  2FVP A;  1DY3 A;  3M8Q B;  3GLJ A;  4I2P B;  5L38 A;  3S1T A;  5KT2 A;  1N5T A;  2B6A B;  2H65 B;  3HMJ G;  3NMA A;  4NI2 A;  4IG0 B;  3OVS A;  5HLF B;  5IFM A;  2BUN A;  1S5Z A;  7AT1 B;  5HVF A;  4IR9 A;  4Q8F A;  5LMU F;  2VG5 A;  3FEY B;  4OI4 A;  3KUG A;  4RO0 A;  4IDK A;  4M5I A;  2M3D A;  5HBM A;  3TO8 A;  2MDA A;  3BSN A;  3MM8 B;  2ZC4 A;  4HI1 A;  4RUB A;  4UUW A;  4FF2 A;  2LQ9 A;  3B4M A;  1SJ4 P;  2JXI A;  1MMD A;  2VJV A;  3QQC D;  1H2T Z;  2R8G A;  4W90 B;  1UJ5 A;  5DQH A;  1JLE B;  2BJD A;  2NRE A;  4GKJ J;  3PG9 A;  1UZH A;  4DV7 J;  1F3V A;  1I51 B;  2XMM A;  3B82 A;  3C8Y A;  1UET A;  1WHY A;  2BAN A;  1PYT A;  3AHP A;  1AUS L;  1BGX T;  1P9Q C;  1U8S A;  3MHY A;  1RCX B;  3CUN A;  1RAJ A;  4DUY J;  1SL0 A;  4KQZ A;  3Q83 A;  1CBK A;  2FJA B;  4LSL A;  2UVU A;  2D3Z A;  3BYR A;  3MUT P;  2XSF A;  2CPG A;  3CCZ A;  2GHW A;  3HVT A;  3IXQ A;  5A8R A;  5B0C A;  3W2V B;  1OO0 B;  2XQC A;  1FRJ A;  3BS9 A;  3DMJ A;  3FQK A;  2H5J B;  3L7O A;  3ET6 A;  4PEO A;  4D3H A;  5I4M A;  1VC5 A;  1MU2 A;  3ENQ A;  1KLN A;  2LQJ A;  4YY3 J;  2GW8 A;  3D6M B;  2KO1 A;  2OI2 A;  3M30 A;  2GS8 A;  2MLX A;  3ETM A;  4NA2 A;  3QOQ A;  3W9J A;  5IWA J;  2KZM A;  4ETX A;  4OHZ A;  2JLE A;  2ILZ A;  3ADA C;  4QIE A;  3EM1 A;  4F25 A;  2MGZ A;  4WZQ A;  1HMV B;  1Y0H A;  2HQI A;  3IBC B;  1KDN A;  1N32 J;  4J7C A;  2IMW P;  4RNF A;  3SMZ A;  2C2D A;  1NU4 A;  1SPB P;  1S6O A;  3QWU A;  3R8Y A;  1NCL A;  2MGZ B;  2KDO A;  3GV5 B;  2E9T A;  2YWG A;  1RHR B;  5ETK A;  4K4V A;  1S1W A;  5KFT A;  1N8R T;  3H2U B;  4OZL A;  1UVM A;  3R9L A;  3M8Q A;  3CIZ A;  1XR6 A;  1PGZ A;  4JI7 J;  1K47 A;  5L1J A;  3ET6 B;  3R3T A;  4WWS A;  4J37 A;  3R6G B;  2DKO B;  4A8Q A;  1N0U A;  1WC3 A;  4MK7 A;  1EAY C;  2QFI A;  3NGD A;  3GSI A;  4WF9 Q;  8RUC A;  5KFD A;  3OJS A;  1YSJ A;  3W8P A;  4K4S A;  1TP7 A;  2ERR A;  1VDH A;  3HM9 A;  2X7I A;  3RR8 A;  2X1G A;  2J0X A;  2VUG A;  1V3Z A;  2AX0 A;  1UJ4 A;  3W60 A;  2XI3 A;  3PYD A;  4YHH F;  3DXB A;  3D7S B;  1X8D A;  2GJ2 A;  2W24 A;  4FZV A;  1RI7 A;  4QR2 A;  4TYB A;  4EWT A;  4XPE A;  3R1H A;  2UXC F;  2K8G A;  2GVZ A;  4F4X A;  1T3O A;  1FKA F;  1O6X A;  3Q89 A;  3RJM B;  2CPD A;  3UPF A;  4NMX A;  5HAT A;  4DSL A;  2D3O R;  2RDI A;  2CPF A;  3CXC R;  4V19 J;  2HIQ A;  1PIL A;  3I4H X;  1LOU A;  3P8B B;  3C14 B;  1LXJ A;  2HRU A;  2AW0 A;  2AQ4 A;  4OI2 A;  1QY7 A;  3RRK A;  3HHL C;  1TL5 A;  3T1H J;  4ICL B;  1U1L A;  4O4G B;  4GO5 X;  2FVC A;  2QL9 B;  3QFW A;  2CVI A;  2QA2 A;  1D0E A;  3NP5 A;  2WSF C;  2ZNZ A;  3MAA B;  2CJB A;  1SBR A;  2D41 A;  3QBC A;  2RRA A;  4LF8 F;  5J1N A;  4Q2L A;  4ZCI A;  2LEB A;  4ZJL A;  1X0P A;  3RGI A;  3DLJ A;  2DGT A;  2FY1 A;  1WOR A;  2HFN A;  2OP5 A;  3I5A A;  3WX4 A;  4X66 J;  1S1U B;  2QMX A;  3MI7 X;  3TA2 A;  4JB8 B;  4KHM A;  5E3C A;  3KG1 A;  4AL7 A;  1IKX A;  3RBE A;  2H1Y A;  1VQ5 S;  5A8K B;  2YQ1 A;  3HHL A;  4OYX A;  4K4T A;  2FC9 A;  2QN6 B;  1FNO A;  1TL3 B;  2HFV A;  2Z30 B;  4ZVT B;  3ZTO A;  1QE1 B;  3GIL A;  1NBE B;  1HNW J;  1RT6 A;  3OD2 A;  2F8H A;  1R8H A;  3OTD A;  3W63 A;  2Z2Y B;  3GJT B;  2QG9 B;  1ITP A;  2WTF A;  1CJT B;  3DU5 A;  1JK9 B;  1S9E B;  3FC9 A;  1ZET A;  1HHS A;  3GWC A;  4I7F B;  4NLO A;  1N36 F;  5J1E A;  1RWW B;  1XMQ F;  2DB1 A;  3H5X A;  5DJB A;  4CZC A;  3I9V 9;  5KFE A;  1S1V A;  4OX9 F;  5ETL A;  3AOD A;  2G2O A;  3MM6 A;  4WJB A;  1YBA A;  1FDA A;  2ZBC A;  2OLW A;  1FI4 A;  1DQA A;  1N34 J;  4QU7 A;  3QLH A;  1N34 F;  1GAO A;  4ED4 A;  3QFH A;  4C9D A;  4PZV A;  2MY8 A;  3QO9 A;  2PI5 A;  2VFV A;  1Q8K A;  3VAI A;  5DGB A;  1TK5 A;  2LLZ A;  2HHH J;  3KLI A;  3D0I E;  6FD1 A;  3DXS X;  4OYW A;  5J2P A;  3FSX A;  1YVF A;  5DDP C;  3TQE A;  3LOU A;  5K14 A;  2A6M A;  1OPI A;  3AOC A;  1D3W A;  1E6Y B;  3GQC A;  4DV7 F;  3RAX A;  1IKW B;  2KT2 A;  2C3U A;  1KTV A;  2WW8 A;  4LR7 A;  4F0K A;  1H98 A;  2HSE B;  2R3V A;  2KKE A;  3V5R A;  3AY0 A;  2BJ3 A;  4DG1 B;  4Z2X A;  4ZN1 A;  1SJF A;  4CDI A;  3OTC A;  4ELU A;  3R5A A;  2W9A A;  2JC0 A;  4CT8 A;  3CJK B;  3BRE A;  1OQ6 A;  3Q8P B;  1XBW A;  2AP6 A;  2RQM A;  3Q2T C;  4C4W A;  2GFF A;  3WQP A;  1XNR F;  3V2U C;  1RLD A;  4DUT A;  4DV4 J;  1HWU A;  4M5G A;  3BO2 A;  2DRB A;  4MYT A;  3DLL Q;  1I94 J;  3SDE B;  2W4D A;  2MST A;  2OH2 A;  2XMW A;  3FMB A;  4LRV A;  3QNW B;  4MMO A;  4F2R A;  5JXS A;  1CEZ A;  3PM9 A;  3DYA A;  4UY8 T;  3N9U C;  3EZ5 A;  2LXF A;  3HHL D;  2VJU A;  4DFP A;  1S0N A;  1LQ9 A;  4KIA A;  2HZC A;  4YR2 A;  1NPP A;  2FB0 A;  5BYS A;  3I0S A;  2X1A A;  1VHI A;  2XB2 D;  4Q44 A;  3UQS A;  2LP4 A;  4RZR A;  4PWD A;  2EWH A;  3M8P A;  1PBU A;  3MED B;  4A8S A;  4ID8 A;  3GV7 B;  1SV5 A;  3WZ0 A;  4ECS A;  3SV4 A;  2BOA A;  2K9I A;  4C0H A;  4CLL A;  4NPO A;  5L46 A;  5J1P A;  2BJ1 A;  1IQT A;  2DEI A;  1RGV A;  1VK8 A;  5C7P A;  1SJQ A;  4NLU A;  3OSN A;  2KRB A;  1RT3 B;  1WC5 A;  4USH A;  5HL7 Q;  3JTP A;  3D66 A;  1Q0N A;  4QWB A;  5B0B A;  3KLE A;  4HYK A;  1CS4 A;  2DNP A;  2J0Q D;  2UXC J;  3MOZ A;  1PSD A;  4M94 A;  2F4V F;  4JUZ A;  1O8B A;  3RZA A;  3VZH A;  3R27 A;  2CIM A;  4OZ2 A;  4AUK A;  2AJ4 A;  1BQN B;  4QPX A;  4IG0 A;  5HLF A;  2E5J A;  1C1C A;  2QEX S;  2IAJ B;  4YB1 P;  2J8A A;  2WCX A;  1Y9O A;  1NK0 A;  4KGV B;  3VAH A;  1TUV A;  5D0G A;  5J2Q A;  2ABY A;  1S7I A;  1RQ0 A;  4U8V A;  4O4R A;  3PRV A;  3ZO7 A;  4ANE A;  1J27 A;  4MJK A;  2LU2 A;  4YB7 A;  3UD5 A;  3CC4 S;  2HHT A;  1LWE A;  4DX8 H;  4F0M A;  1Q16 B;  1VQY A;  4NL5 A;  1TFW A;  4JP8 A;  1Y3K A;  4LRA A;  4FNI A;  4KC5 A;  4RPF A;  3O44 A;  5ETM A;  4EO6 A;  1YJT A;  4F4A A;  1EX8 A;  1FF2 A;  3M6W A;  4URS A;  5KFA A;  3CCJ S;  3H5U A;  1TMJ A;  2YX1 A;  1Q8L A;  2KM8 C;  3PX6 A;  3ITH B;  1ZA2 B;  2KJW A;  1UFK A;  2XYH B;  2B6A A;  4RW7 A;  1NK4 A;  3I0R B;  1S6Q A;  3W65 A;  5AE1 A;  1RTI B;  4KE5 A;  1FKP A;  1RT5 B;  1VBK A;  3P45 B;  4I69 A;  3PW2 A;  2UUC J;  3WC2 A;  4Y6I A;  1C0U A;  3EXC X;  5T7L B;  2R9L A;  1R0A A;  2B4P A;  3P96 A;  1UPM B;  3KKF A;  4M5H A;  1S9F A;  1JLF A;  3MD3 A;  4RLE A;  1FVQ A;  4C48 A;  4QJV A;  4EZ6 A;  2J7K A;  3NBP B;  5CAA A;  1TKD A;  2FVQ A;  4YR3 A;  3RB6 A;  3TJ8 A;  5E3Q A;  4DCJ B;  1PAE X;  4D3G A;  1SB6 A;  1M5H A;  2CDQ A;  4AFF A;  1YRU A;  3VGU A;  4QW8 A;  2HMI A;  4C8Z A;  1GTE A;  1N5V A;  2F1F A;  4J9V A;  5HMZ A;  3PHT A;  3O1L A;  4DU8 A;  1P27 B;  1YLX A;  2BAN B;  3HVA A;  5DLF A;  4WII A;  1FES A;  3I5C A;  4TKT A;  4LFB F;  3IG1 A;  3IRX B;  3NGT A;  2LA4 A;  4C2M A;  2RD5 C;  2CG4 A;  4DR2 F;  1IVZ A;  1K9M T;  4Y34 A;  2U1A A;  4EBC A;  4DV6 F;  1DQ9 A;  2DIU A;  1LWX A;  2FTR A;  3TX0 A;  5J2Q B;  2HQG A;  3RTV A;  3CD6 S;  4Q0B B;  4NXN J;  4GKK J;  4I1T A;  4USV A;  5GAG U;  4ZIT A;  1YJW S;  3HVT B;  4QBU A;  1WNE A;  2JBV A;  1MMN A;  2L9W A;  2DR5 A;  1XJW B;  2MJN A;  3BSC A;  2CWX A;  3PW0 A;  4TYA A;  4GKJ F;  1F5A A;  1U7L A;  4K2J A;  1N5Q A;  1ROF A;  5CYQ B;  3TEH B;  4ZPV R;  5HP1 A;  2GJI A;  5EX0 A;  4KGK A;  2C2N A;  2E5I A;  3J81 Y;  1FNX H;  1MYK A;  5MLC V;  2NUU G;  3OV7 A;  1B99 A;  2KEL A;  3JTO A;  1DLO A;  1S49 A;  2GIR A;  1IJF B;  3ENV A;  2FY8 A;  1IBL J;  1UMJ A;  4HH1 A;  1JLA B;  1ARQ A;  3I6P A;  5FDL A;  2V4Q A;  4A8F A;  2QFJ A;  1G7C B;  4LRF A;  1FWL A;  3AAW B;  3RR7 A;  3BSA A;  3MM9 B;  4MKV A;  4C3L A;  2M8H A;  1BXN A;  2QT7 A;  1PKU A;  1XNQ F;  2CQ2 A;  5JVG Q;  3SFG A;  2E1R A;  4WYW A;  2V8V A;  2HEK A;  3VEA A;  3KLH B;  2U2F A;  5KG4 A;  2OML A;  2AJF E;  3MEG A;  4YS2 A;  3BKF A;  2B4U A;  2RF2 A;  3HSJ A;  1KRP A;  1IRQ A;  2E7V A;  3M05 A;  1KNZ A;  4R0J A;  5B0E A;  5DDR C;  1CJU A;  3X1L B;  2OPS B;  1HBO B;  3ZC4 A;  4EYI B;  3R2C J;  2ZHO A;  3NGS A;  4I6Y A;  4X62 J;  3EX7 B;  1D9A A;  1Q1K A;  2GML A;  3GFZ A;  2CAJ A;  1SC3 B;  1DLO B;  3AA8 A;  4NZ7 A;  5T41 A;  2FD2 A;  5GAH I;  4IRD A;  3HKZ D;  4PPZ A;  3V6H A;  2MQN A;  1GX6 A;  2YKP A;  4QIG A;  1S6P B;  1PBA A;  1OIA A;  2B4O A;  3UW1 A;  4YB6 A;  2QSW A;  2D7S A;  4J9U E;  2ASY A;  1JLQ A;  2H5E A;  2Z2Z A;  4F3M A;  5HP1 B;  4YN3 B;  3V81 A;  1HYS B;  3PDN A;  1W7W A;  2XSJ B;  4ZCK A;  3W66 A;  4ECZ A;  1R8P A;  5J2M A;  1XR5 A;  1PG5 B;  1UW9 A;  2CJX B;  3G2X A;  1CJK A;  4DL2 A;  2F65 A;  2FZC B;  1FKO B;  1ZM3 A;  3FMW A;  2UU9 J;  3HZG A;  3MPV A;  4Q0B A;  1UAW A;  3B6B A;  4LRD A;  4OIX A;  2W2O P;  3VHQ A;  4DV0 J;  4DV5 J;  3E01 B;  1HR0 J;  1WF0 A;  2H3A A;  2OGU A;  1JNZ B;  1HA1 A;  4NLQ A;  2JLG A;  2HHW A;  1P1T A;  4FXD A;  1OSD A;  5CA5 A;  2VZ9 A;  3BO4 A;  4KGX B;  1FRL A;  2E1C A;  2DVI A;  1H2U X;  2JVR A;  5F8M A;  4ZPD A;  5AT1 B;  4KT0 C;  1VQP S;  4C8K A;  1NXI A;  2A18 A;  2XNQ A;  4J9L A;  2UV8 G;  1WDT A;  1T7P A;  3OTE A;  1WEY A;  3UDE A;  3DOK B;  3U1M A;  4PG6 A;  2KHC A;  2JXG A;  5KFW A;  2OFG X;  4EZ9 A;  4ZIW A;  4PQU B;  3BGU A;  3ILI A;  2D1C A;  4NLY A;  4OZN A;  1UPP A;  4BBY A;  2YWW A;  2MQO A;  3OTO J;  4DFM A;  1KON A;  3BN7 A;  2GVD B;  2QMU B;  2BBE A;  3M4X A;  2BVZ A;  3R7N B;  1R8A A;  2P9E A;  4J91 A;  1NDP A;  3VF0 B;  5GMK a;  4OI0 A;  1S77 D;  4PPD A;  2X1F A;  2HFS A;  3MZI A;  2VPX B;  2K1R B;  4NCB A;  2DHA A;  4LFC F;  3D67 A;  1WI6 A;  2VKR A;  4LFC J;  1M0S A;  3FRY A;  3G82 B;  3PW7 A;  2RDD A;  2CZ4 A;  4DQP A;  4RWX A;  4KSE B;  4JI3 J;  1RWU A;  1VQ6 S;  1KS2 A;  3KHG A;  3FEX B;  3EVW A;  1C1B A;  4HV0 A;  2XSJ A;  4C11 B;  3JSM B;  3NEK A;  1XC9 A;  3HZE A;  2HWH A;  3H42 A;  5F0W A;  1KN6 A;  2C2K B;  2KVI A;  2K7K A;  4LF4 J;  3IS9 A;  4I67 A;  1R0C B;  1U1O A;  1RHJ B;  3OL6 A;  1EIY B;  1UEU A;  2VDH A;  3IM8 A;  3NO7 A;  4PCQ A;  4TLQ A;  2W8K A;  2UVV A;  2C2Z B;  3EVO A;  2ASL A;  4B3M J;  3ZZR A;  3DHW C;  4M5M A;  4XAK A;  1KVK A;  4F67 A;  4WFA Q;  1NPK A;  3I5B A;  3FFI B;  2D3U A;  2ZBI A;  3FSI A;  4ZLN A;  9ATC B;  3QGG A;  2V5H G;  1REV A;  4JI1 F;  1XMO J;  2XO7 A;  2Z4P A;  2XMK A;  2C3Y A;  3NRB A;  1RT7 A;  2Q43 A;  1VLY A;  4M5K A;  4X65 F;  1FK9 B;  1MW7 A;  1A7G E;  2BDP A;  5I42 A;  1M1K T;  5F8L A;  2I5J B;  4PWW A;  3L09 A;  2XCP A;  3JAM U;  4CCH A;  1P1L A;  4DSK A;  2QE5 A;  4GVB A;  4P73 A;  2YH1 A;  3I0S B;  1RWK B;  5HK4 A;  4JI8 F;  1SKR A;  3FCW A;  1JQG A;  4W92 B;  4HHU A;  3K59 A;  2HND A;  2UUB F;  4H4M B;  4A8O A;  1VI7 A;  2OIH A;  1OMS A;  5GVQ A;  4DN9 A;  3C3L A;  3G6Y A;  1M1G A;  5C25 B;  3TZY A;  3WHI A;  2V4R A;  1UWB A;  3LPE A;  1SQF A;  1GTH A;  2NXJ A;  3QT7 A;  2CZ9 A;  4PUO A;  1X60 A;  2ZE2 A;  1DZ5 A;  5D3G A;  1YJU A;  2H51 B;  4C3M A;  3CGI A;  3DDK A;  1REG X;  4QR1 A;  1LNQ A;  2RDJ A;  3AJD A;  4DUZ J;  3M1V A;  2IM3 A;  4OI3 A;  1DFD A;  3CVK A;  1VQS A;  5CH7 B;  4HVZ A;  4DLG A;  1FDN A;  3HJF A;  1JLC B;  1YJR A;  4FPI A;  1HQU A;  2GHV C;  4O44 B;  4QPT A;  4KHR A;  3BH7 B;  1JJH A;  1Z2Z A;  2W9C A;  4DV1 J;  1S72 S;  1U4B A;  1NJZ A;  2J7W A;  4JI2 F;  1BHN A;  2B8Q A;  2P5V A;  5M2P A;  4X4U A;  5K20 B;  5EN1 A;  4B02 A;  2I38 A;  1ELO A;  4PWU A;  3CJ2 A;  3K5L A;  2VA2 A;  1UEV A;  3KMQ A;  4PG4 A;  2PI4 A;  3SV3 A;  2B9Y A;  2NXC A;  3IWX A;  4ZVO B;  1KQS R;  2V2Z A;  2PMW A;  3I31 A;  4OHV A;  2X3D A;  3OXL A;  4O3N A;  1EP4 B;  4F36 A;  1AXQ A;  3V4I A;  1QAX A;  4DQR A;  4DQI A;  2R4F A;  4NEY A;  3DU6 A;  1BE4 A;  1DTT A;  3T41 A;  2CG8 A;  5GAD I;  4CH1 A;  3MM5 B;  4DV6 J;  5I3U A;  3UR3 C;  5D15 A;  2IPO B;  4P2M A;  4N5S A;  1G1X A;  2DR7 A;  1IWA A;  1F2H A;  3JSB A;  2BE9 B;  2BZ2 A;  4QW9 A;  3DM2 B;  2ROE A;  3GG1 A;  3GMG A;  1YJV A;  4ZVP B;  2M8D B;  1P94 A;  3K7R A;  3N6M A;  2HLT A;  4KO0 A;  4WIQ A;  1Z4U A;  2BKN A;  1ZM2 A;  4HT5 A;  2YWE A;  3LAM A;  1VGY A;  1F9E B;  2GAH C;  2DNK A;  1TZ0 A;  4G65 A;  3QRR A;  5BJR A;  1KEK A;  3PX4 A;  5KFP A;  3PIP Q;  4KHP J;  1PJ5 A;  4FF4 A;  4HHJ A;  4ID5 B;  1GH8 A;  3UDV A;  5JVH Q;  3MMA B;  3MPU B;  3RB4 A;  1ZA1 B;  4XDC A;  4Y28 C;  1SJ1 A;  5KG0 A;  4UOC A;  1X4E A;  2HVE A;  2PE8 A;  5AXK A;  4TU7 A;  3BF4 A;  2CRL A;  3PFO A;  2IVF B;  2IBK A;  1B7Y B;  1BDT A;  4FYY B;  4DSF A;  3PIO Q;  1T95 A;  2JDJ A;  2OHD A;  3KK2 B;  3FGV A;  3T1Y F;  1RT3 A;  3JTN A;  3VGV A;  4C98 A;  5LSR A;  2JSX A;  3TUZ C;  5EWG A;  1Q82 T;  2J6T A;  1KLM B;  4DLE A;  3EDQ B;  2WSE C;  3LTO A;  4YEA A;  2JC1 A;  1ARR A;  1D8Z A;  4J9S A;  1VRT B;  5CD4 A;  2HVZ A;  3KFW X;  1KOO A;  6FDR A;  3TAR A;  3KJV B;  1UVI A;  1MWY A;  5HVH A;  2HNZ B;  1N48 A;  2HBZ B;  3DOL B;  1JXV A;  2K7J A;  3KXD A;  2RUS A;  2XLJ A;  2BAC A;  2CQ3 A;  4WP9 A;  3CF5 Q;  3LP0 B;  2FLP A;  2IBO A;  5D4L A;  2B51 A;  4MAK A;  4OYM A;  1XMQ J;  1RYR A;  2KYZ A;  2UXD F;  1YZ6 A;  4AL6 A;  1CJV B;  2WSC C;  1HBN A;  1OYE A;  3VZI A;  4E98 A;  4F26 A;  1LXN A;  2CUY A;  4XO0 A;  3IA0 A;  1S99 A;  2K6L A;  1WG5 A;  2E7W A;  1YK9 A;  5KFS A;  1NUE A;  5HMX A;  1ARO P;  4OZ3 A;  1QAY A;  1VC6 A;  3VGT A;  1RU2 A;  3OPK A;  3L9Z A;  3M9M B;  1RDR A;  5D4P A;  3DLK A;  1AB8 A;  3TJA A;  3VGS A;  4H4O A;  2K5J A;  1UFL A;  5I3P A;  4CT9 A;  4BDP A;  5CYQ A;  2X3G A;  3J80 U;  4JI6 J;  2VOD A;  1TTH B;  2FJB B;  2V9K A;  4GO7 X;  3JQM A;  3AJ1 A;  5AXN A;  2XS5 A;  3DMJ B;  1KTQ A;  3UE2 A;  1UP1 A;  1L3V A;  3PY8 A;  2PGC A;  2CJY B;  2FHM A;  4OZ5 A;  2HGM A;  4F2S A;  3OLA A;  1X93 A;  4OMF G;  4O0I A;  3M30 B;  3CJR A;  3NBP A;  3BH6 B;  3W2W B;  2YKO A;  3TWZ A;  5ADZ A;  1Y5L B;  2D69 A;  5JMN A;  5G0R B;  4NZ0 A;  4P10 A;  3KLG B;  1RHK B;  2CWK A;  5IM0 A;  1VBZ A;  4OV6 A;  2YNI B;  2PEH A;  3H90 A;  5G0R A;  2WVF A;  4UOF A;  4Y2A A;  1SJ3 P;  1IBC B;  3DDN A;  4MIW A;  1KHW A;  4R25 A;  4EYH B;  4B3T J;  1S6U A;  1PAU B;  3C15 A;  2PMH A;  1WWH A;  4K59 A;  3LP0 A;  2VFR A;  1C2P A;  1HBN B;  2JLF A;  2HQF A;  2IJR A;  2B9W A;  2RU9 A;  4DPY A;  2GJF A;  4ITS A;  2LEP A;  4ZVU B;  3Q0A A;  5LMN F;  2BNZ A;  2VL1 A;  2NR0 A;  4AL5 A;  4DR7 J;  5A6W A;  1L5U A;  1QSL A;  4F50 A;  2HVI A;  2QTW A;  3KLE B;  2BV3 A;  2QLB B;  4LF4 F;  3BDE A;  1WEZ A;  2BJ9 A;  3DLK B;  2EKN A;  4NYZ A;  2FPH X;  2YXL A;  3D54 A;  3W2W A;  4DF4 A;  2HWT A;  4OJH A;  1JX4 A;  3GSD A;  2VF3 A;  4USI A;  3THT A;  1X9M A;  1FNM A;  4ECY A;  4M95 A;  2Y9H A;  2AZ3 A;  2DIV A;  5D78 A;  1BQN A;  1U6Z A;  2B9X A;  1H73 A;  2N7C A;  5KG1 A;  4ENO A;  2KN4 A;  5HBM B;  4JI5 F;  2HHH F;  1NK8 A;  1FJG F;  2YWH A;  3D3B J;  1HI0 P;  3OQ2 A;  2E9Z A;  2KFN A;  2ZJR Q;  1IBM J;  2FGC A;  3KUE A;  2XWY A;  4OJ1 A;  1X4H A;  3OFE A;  3BBC A;  2VC1 A;  1C4A A;  2HS3 A;  2MKJ A;  2BJ7 A;  4MIB A;  3NCP A;  2VON A;  2BA9 A;  1OHN A;  2GPE A;  1J5E F;  3DDI A;  3HHN B;  2G1H A;  1MG7 A;  3S6E A;  4ED7 A;  4I2P A;  4B17 A;  2OKQ A;  2DGW A;  3BQ0 A;  1RTJ B;  3N5F A;  5LJ3 Y;  1AA1 B;  5B0A A;  3GIK A;  1UFW A;  2VAS A;  2YNH B;  4KKO A;  4I4B A;  2FVR A;  4K4U A;  1T9W A;  4OX9 J;  2UZA A;  3HSZ A;  3MM7 B;  3Q8S B;  1MSW D;  2XY7 A;  4ZJQ A;  4LUB A;  4C11 A;  1TFY A;  1UA1 A;  3HVR A;  1T3N A;  2M2B A;  3TUP A;  2GHP A;  1T05 B;  3RAQ A;  1D1U A;  2ATC B;  1OPZ A;  3KNA A;  4LR9 A;  2BKP A;  1G2E A;  1BLU A;  4ILR A;  3CCV S;  1U45 A;  3NAH A;  1PO6 A;  5GME A;  2UU9 F;  3G5O A;  2J9E A;  3BGO P;  2DGO A;  2CNN B;  2AY0 A;  1N56 A;  1QSS A;  2AHO B;  1UVN A;  3GXQ A;  4JYA J;  2N3L A;  2F4F A;  2OO4 A;  1OSC A;  2DJW A;  2CQC A;  2WB4 A;  4IOB A;  5BYR A;  3DGP A;  2ZH1 A;  4B3O A;  2ZZT A;  3SDE A;  5KFG A;  4LQ9 A;  2BE2 A;  4EI2 A;  2R2S A;  4RJV A;  4WKR A;  2Q66 A;  1RTI A;  4M8L A;  3HFV A;  4WFX A;  1M1H A;  4C8Y A;  2MQM A;  2OEK A;  1VBX A;  4NEZ A;  4CLF A;  3MXH P;  1NZA A;  3R97 A;  2DH8 A;  2VQE J;  2BQ3 A;  2XZT B;  3Q8Q B;  3CCU S;  4DS5 A;  2ZJP Q;  1VK3 A;  3CT9 A;  3B54 A;  4B9U A;  3L95 X;  3RBD A;  2QLW A;  4DN0 A;  2G2Z A;  1EET A;  2R42 A;  2VPY B;  4UST A;  5ETN A;  3U02 A;  4LF7 F;  5E3R A;  2R8H A;  2ALZ A;  2OAU A;  2BRL A;  1T03 B;  2W9C B;  3I82 A;  2VC0 A;  5CXT A;  3J7Z 5;  3QZ7 A;  3HPO A;  3TAQ A;  1QUV A;  2IRU A;  2IVY A;  5J2P B;  1PCA A;  1F60 B;  4DPX A;  3MM6 B;  2MPU A;  4M5J A;  3SSS A;  4IH7 A;  2OPP A;  2FIU A;  2EFG A;  2FJD B;  3F56 A;  2Z8Q A;  2ZBR A;  4LVN P;  3QYY A;  2B43 A;  2IIH A;  4HHH A;  1SKS A;  2NPI A;  1HHT P;  4ECV A;  4IRK A;  5AJ3 F;  2G2Y A;  2OPQ B;  3NNA A;  2DNR A;  2JZ5 A;  1VOM A;  1N0V C;  2GIQ A;  1JNR B;  2Z2M A;  1CQN A;  4K7Q A;  3RYL A;  3TVY A;  3UVJ A;  2CQ0 A;  1U48 A;  1BY9 A;  2YNF A;  1SKW A;  1SQE A;  4C0B A;  5HN0 A;  2ZDO A;  3AFG A;  3SEO A;  4QU6 A;  1C1C B;  3EMT A;  2R2T A;  1VQK S;  3SXL A;  3CE8 A;  2IM2 A;  1F1B B;  2ILY A;  3ZZZ A;  4Z37 A;  2F40 A;  1JLC A;  4RUH A;  4K0K J;  3PO4 A;  3T5H A;  2RF2 B;  2C1E B;  2DGX A;  2K3I A;  2ALY B;  7FD1 A;  4N7T A;  3FCV A;  4I7F A;  2MMY A;  2UUW A;  4CLW A;  1JLB A;  3A8I A;  4X4Q A;  1TUW A;  2RJZ A;  2NYH A;  3NS5 A;  1UCN A;  2ZD1 A;  5I3Q A;  2G13 A;  2ZE2 B;  3TRG A;  1WTB A;  1X5T A;  3NWR A;  3R5B A;  4LT6 A;  2JEF A;  1NSP A;  3S8S A;  2FYX A;  3D6F B;  3L3C A;  3JYT A;  1LEO A;  4AXI A;  3H8Y A;  1SIW B;  4QIV A;  5DRK A;  3R7S B;  4YFU A;  4IO9 Q;  4IOA Q;  2A6O A;  4LFB J;  1LW2 B;  3A8J A;  3C6T B;  4P75 A;  1U0H A;  1U26 A;  1Y00 A;  2KXF A;  2H4W B;  2LEA A;  3MCS A;  4NA1 A;  5A6P A;  2XZD B;  2LDI A;  5E41 A;  3MFH A;  2AGQ A;  2KTQ A;  1OG7 A;  1NK6 A;  1HBO A;  2CNK B;  1DUR A;  2RQK A;  2C3O A;  2CQP A;  4AE5 A;  1N6Q A;  4QYR A;  3AXM A;  4DX7 A;  1NJX A;  2YKQ A;  1CG2 A;  1MWZ A;  5J2N B;  2FJW A;  1JKH A;  1WC6 A;  5HJX A;  5DDQ C;  1KR4 A;  4JV5 F;  4RNH A;  1XQI A;  4FVC A;  4YY3 F;  7FDR A;  1ZM9 A;  4EGL A;  1KQG B;  2R7S A;  3ZFV A;  2ZEJ A;  4MKA A;  4CP5 A;  2XTJ P;  3ONQ A;  3WIV A;  2UUC F;  3BB5 A;  3H5S A;  2ZUG A;  2Y1R I;  1S97 A;  4WE1 B;  1K1Q A;  2G0I A;  5E2Q A;  1QDU B;  4KAI A;  3V4I B;  2YNG B;  4ILM A;  4N8N A;  3Q8R B;  3LP2 A;  2P8I A;  1KFS A;  2FZG B;  1FVS A;  1IN0 A;  1XR7 A;  3G87 A;  3MAQ A;  2EFP A;  1FE0 A;  4F3Q A;  3TEG A;  4PXC A;  1SL1 A;  2E9R X;  1P8G A;  4K4W A;  3KK1 A;  2V2Q A;  1RUS A;  1XTZ A;  2H4Y B;  5DET A;  1BC6 A;  3A3N B;  1VS3 A;  4HH0 A;  1J5O A;  4IKA A;  4ZLL A;  2HZV A;  3P6Y C;  1H6K X;  5HQL A;  2DNZ A;  2MKS A;  2ACY A;  4NOH A;  4ZPW R;  5F3Z A;  1LK5 A;  2A0F B;  4R5P A;  2RS2 A;  3E3X A;  2HHU A;  4RU2 A;  1TAQ A;  3KLI B;  4N77 A;  3CJ3 A;  4G1Q B;  1O5J A;  2E7X A;  3BR9 A;  5KFO A;  5L1I A;  1U25 A;  2V8P A;  3X3U A;  2IJF A;  2GGP B;  3EGN A;  3NWG A;  3GP9 A;  3VAL A;  1GXL A;  2C3M A;  2LDY A;  1X4F A;  2YKM A;  4Q5V A;  5EDW A;  4MK9 A;  3BZQ A;  4ECU A;  3DRS A; 
#chains in the Genus database with same CATH homology
 1MYK A;  1QTG A;  2CAJ A;  4D8J A;  1ARR A;  1MNT A;  2KEL A;  2BNZ A;  4ME7 E;  3FT7 A;  2BSQ E;  1Q5Y A;  2F1F A;  2JXG A;  2JXH A;  1BDV A;  2K9I A;  2CAD A;  1Q5V A;  3H87 C;  2HZV A;  1PAR A;  1ARQ A;  2BJ9 A;  2CA9 A;  1X93 A;  2K1O A;  2BJ1 A;  2HZA A;  3FMT A;  3VW4 A;  2K29 A;  2RBF A;  2H1O E;  3BKT A;  2CPG A;  3BKU A;  2BJ8 A;  2WVB A;  2WVC A;  3PHT A;  1NLA A;  1B28 A;  2PC6 A;  3VEA A;  2BNW A;  1BDT A;  2NZC A;  1EA4 A;  2AY0 A;  2K6L A;  2WVF A;  3LGH A;  3OD2 A;  1B01 A;  2FGC A;  1BAZ A;  3GXQ A;  2Y3Y A;  1MYL A;  3BKF A;  2CAX A;  1IRQ A;  2JXI A;  2WVD A;  3VEB A;  2BA3 A;  2BJ7 A;  4HV0 A;  3QOQ A;  2GPE A;  2WVE A;  1P94 A;  1U9P A;  2K5J A;  3QSI A;  2BJ3 A;  4FXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...