2BJ7A

Nikr in closed conformation and nickel bound to high-affinity sites
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
MELIRFSISIPSKLLEKFDQIIEEIGYENRSEAIRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEIISSLHVHMDEHNCLEVIVVKGEAKKIKMIADKLLSLKGVKHGKLVMTSTGKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NICKEL RESPONSIVE REGULATOR
publication title Structure of Pyrococcus Horikoshii Nikr: Nickel Sensing and Implications for the Regulation of DNA Recognition
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transcription
total genus 37
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2bj7A01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2bj7A02
4HV0A 2HZAA 1U9PA 3VEBA 3GXQA 2K5JA 2WVBA 2FGCA 2BSQE 1BDVA 2GPEA 3BKFA 1ARQA 1X93A 3OD2A 2CAXA 2K6LA 2BJ9A 1EA4A 2WVFA 2JXIA 2JXGA 1QTGA 2WVDA 1NLAA 2KELA 3VEAA 3H87C 1IRQA 2HZVA 1BAZA 1B28A 3QSIA 3LGHA 2BJ7A 3VW4A 2BJ1A 2BNWA 2BJ8A 2CAJA 1BDTA 2JXHA 1B01A 2BNZA 1Q5VA 2CPGA 1PARA 2CADA 2BJ3A 4D8JA 2WVEA 1ARRA 2Y3YA 1MYKA 1P94A 1MNTA 2F1FA 3FMTA 2K1OA 1Q5YA 2PC6A 2WVCA 2CA9A 4FXEA 2NZCA 2K9IA 2BA3A 2RBFA 2AY0A 1MYLA 3FT7A 2K29A 3QOQA 4ME7E 3BKUA 3BKTA 3PHTA 2H1OE
chains in the Genus database with same CATH superfamily
4DPUA 2OEKA 3WX4A 2B4VA 2AJ4A 3QFWA 2KHCA 5D0EA 3AHPA 2V0NA 3BGRA 1KFDA 5KOWA 3M05A 1X4GA 1A7GE 2W9BB 4RNHA 1VQ9S 4ENOA 2X3GA 2Q79A 1YZ7A 1HD1A 3NS5A 3Q0AA 3TQ1A 2MJUA 1FFSB 4WF9Q 3LWLA 2KO1A 5HMZA 4B17A 4LFAF 1X5PA 3CD0A 2ZOFA 2A6OA 2ZVIA 2ZNZA 4KHMA 2YKOA 3KWMA 3QAUA 2BV3A 4W90B 4Y34A 3IP0A 4DU7A 1IKYA 1RWVB 5IM0A 2VQEF 1DQ9A 1LW0A 5T41A 4ZIWA 2LXFA 1ZZFA 1HLWA 4B9MA 4P71A 5DRKA 4M5NA 4PQAA 2UVVA 3ZZTA 1ZA2B 2Y1JA 4USVA 2CQDA 1NK0A 1KD1T 1WG1A 5DLGA 4QPTA 5DDQC 4Y28C 4DOZA 3PHEA 1X4BA 3Q2TC 1M0SA 1TKZA 3TOQA 4HL9A 4KYZA 3GTYX 1YGYA 5E0OA 3N4WA 1V3ZA 2KFYA 2G2YA 4PWDA 4WZQA 3KK1A 3N6LA 2QV6A 2XZWA 2BUNA 1BAZA 3FQLA 1EARA 3KLEA 4FXWA 3MD3A 1KTQA 4YMEA 2HFVA 2CDQA 2I6WA 1H74A 2UU9J 1OPIA 4JV2A 2AJ2A 4DR3J 2W4PA 2K3KA 1OWXA 2LVWA 4ZVSB 4ECYA 5HJYA 2BX6A 3AD7C 3OV7A 3OTOJ 2AJQA 2ERRA 1T03B 2P6SA 1H2UX 3THTA 2YKAA 5HO4A 2E1CA 2FPHX 1W26A 2CQGA 3BBCA 2M0GB 2FZKB 3FFIA 2N7YA 4ETXA 2FJXA 1KONA 2BE2B 1RACB 1HR0F 1REVA 2GV1A 2RU3A 1WKLA 4A8FA 3L7OA 5F3TA 4P74A 3FC9A 4ID5A 2V2VA 1RBOB 4OYAA 4EO8A 3E01B 1N34J 4IDKA 1TFWA 4DG1B 2VFRA 2K6LA 1D9FA 4JYAJ 4Y6IA 5KFIA 1PAEX 2KYZA 2E7VA 4PKDB 5CH7B 3V5RA 2B51A 4OLOA 2QL5B 5B0GA 3GPAA 3PG9A 3W8PA 2E9TA 1VQ4S 4C11A 1S1VB 4ZJLA 3PM9A 4DQPA 1YWXA 5BXIA 1L3TA 1Y5IB 1SL2A 1KQKA 3GV5B 2CQ1A 1HNWJ 2X3DA 4DPTA 2PSZA 4GVBB 2XNRA 4LR7A 4USKA 4ZVRB 1XR6A 2CPXA 1IVZA 3FBEA 5E2QA 1HARA 3M8YA 3N79A 2FHOB 5KFZA 2VODA 1YG0A 1H38A 2MZTA 5L9NA 2KN4A 3FBBA 2CQPA 3R7NB 4X84A 2EI5A 1VOMA 3QWUA 4EWTA 3NS6A 5IWAJ 1G1XA 1RCXB 3NEKA 2VG6B 1K0TA 3RAQA 3T1YF 1X4DA 4QW9A 3UD3P 2P8IA 4I6AA 4CZCA 1RTHB 4LF2A 1GX6A 3I0SB 1VQ7S 1OY6A 1EP4A 3D54A 1U7LA 3QO9B 3R1HA 4DU8A 2ALYB 3FQKA 4Q7AA 3TX8A 2BJ3A 3HVTA 1TKXA 3G6ES 1TV6A 4QBUA 1X5TA 1FCAA 4HT7A 3MOJB 1ZBTA 5JVHQ 1JK9B 3HHKA 2BOPA 3BM7A 4U8VA 2KJWA 4DV6F 3DM2B 1DTTA 1YKWA 1O6XA 3FSIA 3K5NA 4KHPJ 2AGOA 4N8OA 5C2CA 2W2PP 2W4CA 2XSJB 1FNXH 4EYHB 3RAMA 2Z2YB 3OQ2A 3HI9A 4B9NA 4QWAA 3L9ZA 1HMVA 1QSLA 3GXQA 4N8NA 5KG5A 2BSQE 5KFPA 4UUXA 1GQEA 2XYPB 4OQJA 3DRSA 4YR0A 1U4BA 4WXWA 5I4MA 4WKYA 4WYLA 4CLPA 1WI6A 4WP3A 4ELVA 4NLPA 4FS2A 1AB8A 4DZDA 4DR2F 2DHSA 5K14A 3DRYA 2QLJB 1NB2A 1WF0A 2W2NP 2CQHA 2YNFA 3R97A 1YJVA 3SSQA 4L3KA 3B4DA 1PARA 2QFIA 3CMAS 2XI2A 2WVEA 3BS9A 5H9EJ 4FNHA 2MZQA 1BLUA 1F9FA 3SZ2A 3SCKE 4DL4A 2W1BA 4YP3A 2E29A 2Z4PA 1REGX 2EC2A 5B0AA 4LF7F 2JEJA 5HLFA 2LXUA 4JI0J 2K1OA 3UR0A 4TVAB 2OELA 3QYYA 1WEYA 2V9KA 1TL4A 1XMQF 4B3RJ 4X4TA 1I5OB 4CYUB 3EM1A 2F4FA 2YNHB 4JUZA 2ZE2B 3BV8A 2AQ4A 3M8PB 2R8IA 4DV7J 1U1RA 3I5CA 4USUA 3JSYA 1G2EA 4WFXA 1NEEA 4PG8A 2HKEA 2BM1A 1KOOA 3HFKA 2XBPA 4WPAA 3NGUA 2E44A 1CS4A 4LF4F 1ITPA 5J2NA 2JNJA 2C22A 2BJ1A 3Q86A 4NI2A 3CSKA 2FJEB 3MMJA 4HACB 2CPHA 1AZSA 2CIMA 2AJ1A 1RWPB 3M6VA 1FKPA 2UUAJ 4NASA 3TUZC 3OR2B 3IM8A 2DNPA 3DXBA 3ET6B 1KLMA 1RA6A 5J1EB 6FD1A 2VH7A 2IA6A 2QE5A 4WKRA 4FPIA 2GHVC 3MM9A 4WWSA 3UR3C 3L7UA 3PZPA 3HFZB 2YQ0A 1FERA 4PG6A 1YTYA 1BQNB 4J9RA 3K89A 3KDOA 1O8BA 1UJ4A 3FCWA 4FNIA 1S4EA 2E1AA 4ANEA 4C8KA 1GAOA 1RT1A 2J9CA 5KFTA 2DHAA 5LMNF 1CC7A 2WOMA 2IM2A 4ZPCA 3A4TA 3KG4A 1SKSA 4B3MF 1X4EA 5D6GA 3G8SA 3WBZA 4BLGA 1IKWA 2YWFA 3EXCX 3W9IA 4ZN3A 1MN7A 2UZAA 3CE8A 1TELA 2HYIB 3GJRB 1QE1B 1VQYA 3BQ0A 1DRZA 4LF8J 2DR5A 1HNIA 3MUVP 2CNOB 4WFBQ 3M9MB 4JI2F 3PFEA 3E3XA 2WCXA 1IBMJ 3HXMA 2LYVA 2BRKA 1HIYA 1IR2A 3OL9A 1S1TB 3UVJA 4YB1P 1F5CA 1QJHA 3ZNUA 4LFCJ 1RTJB 1RWKB 2GNKA 1WC5A 3EE3A 3TI0A 4QR2A 3MD1A 3GIKA 3J81j 3RBEA 1HW8A 1RWUA 3SBMA 4LIWA 3M1VA 3LGNA 2ZD1A 4ED6A 2EC0A 2D3UA 3U02A 1T9YA 3BB5A 1FRKA 2XS2A 3J7Z5 2XZTB 1H2TZ 3Q89A 4CH7A 3ITHA 3IFEA 4ZIVA 1AA1B 5BYSA 5KT5A 1XTZA 4GC6A 4MKAA 4YB7A 1XBWA 4WE1B 4NYOA 5GAGI 4WFAQ 5AT1B 3UDCA 3LP2B 2DNQA 2NZ4A 1HNVA 4RWWA 3I0RB 1AUSL 2V2QA 2IRYA 4ZP8A 3JSBA 4B9UA 1RJJA 2XMVA 3GLJA 4F4AA 3EZ5A 2LA4A 2QC3A 4OYMA 3KG0A 2PFDA 4NZ7A 2EFOA 3QATA 2XY5A 2KKHA 2WBRA 2OPSA 1LWXA 1MROB 2IYIA 1RYSA 3TZWA 5ETTA 2BACA 2L9WA 3SYZA 2Z2LA 2V69A 4J37A 2B56A 4ED4A 2QL7B 2GVZB 5AXMA 1FDBA 1HNXF 4C0HA 1EQ0A 2KH9A 4KTQA 3BGRB 1SKWA 3V2UC 3KJQB 4OYOA 2L3MA 1P1LA 2FHMA 2ZH5A 2K5JA 3C8YA 1JIHA 1SXLA 2N4CA 2E9ZA 3HT0A 1CEZA 1TUVA 4NRTA 2CDRB 2DXEA 1FJGJ 1V3RA 3N6MA 1FJEB 4B3TJ 4J90A 2HQDA 2B6AA 4JI7F 1XMOF 1V3SA 2BJ8A 4OL8A 3SDEA 2ASYA 3M9NB 2ZZNA 1YBUA 2DY9A 4NLOA 1B64A 1FRMA 2ILYA 3DNCA 3IRXA 3RR7A 3MDFA 4DN9A 1IKYB 2BJDA 3KKFA 1LW0B 1Q95G 4DCJB 4EU0A 3NGSA 3MCSA 4TY9A 5F3ZA 1UPPA 2HRUA 1OSCA 2ZZTA 3PRBA 3PJ9A 4NLWA 3ZC4A 1KHVA 1C1CA 4QWBA 4TLQA 3OTEA 1GEHA 1RBLA 5LL6d 3EVOA 1TKZB 4A48A 4DUZJ 1R6VA 1NSPA 2IDLA 3R9LA 1UEVA 1UL3A 3R5AA 2MPUA 3VQTA 3UNYA 5H9EK 1LEOA 1FKAF 5LMUJ 1HA1A 1XNQJ 4KE5A 4U7UD 2W9CA 2PIIA 1QAYA 2DITA 4NEYA 2Q6BA 4PWDB 3KK1B 4FVMA 3TA0A 5KFAA 5L38A 2IM1A 2DPJA 3PIPQ 3T5JA 1PIEA 3FSXA 2BM0A 2KVIA 4NLXA 1CJVA 3KLEB 4IKAA 4DX5A 4X4UA 3UPFA 1RAAB 1RAFB 2QRRA 4NOHA 5M2RA 4IRDA 1Q8LA 2CPFA 2JXHA 3W5YA 1HBNA 1YJ9S 2NS1B 3M4XA 3IXQA 4J9PA 2VASA 1YRUA 2CYYA 4ZLNA 1JLAA 4IR9A 4USMA 3JXOA 3IR5B 4PUOA 2KZZA 4LFBF 4EBCA 3HCXA 2V6AA 3IO1A 1HBOA 1NJYA 3FFIB 4F2RA 4XAKA 2I9SA 2M5YA 3BO4A 1F9HA 1REVB 1SB6A 4NEZA 2ACMA 5IT9Y 5B0EA 4ID5B 2R7QA 3HVAA 4CI0B 1K73T 4IDKB 2VICA 1MG7A 3SMZA 1GT8A 1VBXA 2HVEA 2BYCA 2A3JA 5A2QY 4J9MA 3G96A 2HHHF 1XJWB 1UMJA 5ETVA 2H9ZA 1EB0A 2O66A 2YTCA 4C11B 2VHGA 1NK8A 3HVRA 2PT0A 2YKPA 2G0JA 3D1QA 2XYGB 4ITSA 5HATA 3UD4P 5LXYA 4DI6A 1R8PA 1B99A 2JL9A 3N6NA 4MK8A 3QGHA 2DR7A 4RW8A 3R27A 4JI8J 3EMTA 2J76E 3JTNA 4ZJOA 4MT1A 1UVKA 5IT4A 1HW9A 4TYBA 1JLGA 2XCAA 4RLEA 2AEFA 1UW9A 2BQRA 2G13A 2HS3A 3UCUP 3DOKA 3CF5Q 1FXDA 4M1KA 4Y2CA 3BDPA 1VJWA 2R7WA 3QOQA 1JJCB 3VF0B 4GC7A 1VQOS 3BKTA 3DDKA 4ZPVR 2WB1D 5I3PA 3NP5A 3LOUA 2XC9A 1UFKA 5KFSA 1J5OA 3AQPA 2KU7A 5EGYA 2IHR1 2OO4A 3IMQJ 1TR0A 5L9XA 2IRXA 2WSEC 3C3LA 1SH3A 3J80Y 1EP4B 2XI3A 1VK3A 2ZHBA 1P9QC 3Q2SC 3LALA 3F56A 4ZP6A 4XTTA 5GAEI 1ZAXA 1TK8A 2W24A 4EZ6A 1AFIA 1FRHA 4I7FA 3R5GA 3HVTB 1TQLA 1TKXB 1TV6B 2GIRA 1VBYA 4RW7A 3IWXA 3T1HJ 2DGVA 2N7CA 2B4PA 1UKUA 3HULA 4J91A 3EPGA 1BXNA 4OYBA 2NXNA 2ZH2A 3S1TA 9RUBA 4YQWA 1DTTB 4F36A 3MMAA 3CTRA 3ILJA 4J9SA 3ZTSA 1L3UA 1ACMB 2DT9A 2OPPA 1AT1B 3U7JA 2K9IA 1N0VC 4BS2A 1WC6A 1HMVB 1M1KT 5E3RA 2VOOA 4DQQA 5KT2A 4LQ9A 1M5HA 4ILLA 5T7LA 5KT4A 3OVAA 1FVSA 4IH5A 1VQ8S 3AQOA 3DRSB 2COLA 2MLXA 3DGPA 1YIJS 1TL7A 3TNVA 1ZAVA 4DR6J 4RW6A 3EJMA 4GKKF 2RJZA 2ILZA 4TKTA 3WHIA 4LRDA 5K14B 2R7OA 4OHWA 2YNFB 4WJBA 3U1LA 2HWIA 2MQLA 3Q24A 1NJZA 3GCXP 1AW0A 4YR2A 2QYCA 4ELUA 4QU6A 5HJXA 3VR1A 4KKOA 3TUPA 2JC1A 5K8MA 1S6QA 3RG6A 3FEZA 2GS8A 1NZAA 1EIYB 1R31A 2EVZA 2MLZA 2LU1A 5SZTA 2OP5A 2C2EA 5HLFB 3CXCR 2BE7D 2X7IA 4V1Ak 3ENAA 5CZVA 4XO0A 4NRUA 4QR1A 3CCSS 1VC0A 3MCOA 4X4PA 2MKSA 4Z37A 3PYEA 4K7QA 1L3SA 2VB6A 4LFAJ 3OJUA 1TL1A 2UVUA 3PX6A 2HQCA 4ZMMA 2V67A 3WZ0A 2C2MB 1RSCA 4TLRA 4QWDA 2JLGA 5J2NB 4MJKA 4JI4F 5EWEA 2VQEJ 2GQQA 5CXTA 4NI2B 4I1TA 5LJ3Y 1RAOA 1IRQA 3DLLQ 1AZSB 3EXYA 1NPRA 2F5GA 1G7CB 1FKPB 4XDDA 2EFQA 4NLQA 2YH0A 1RDRA 1LWFA 1NLKL 5B0FA 3PDNA 4C6AA 1KLMB 1V6HA 3GFHA 1ZH5A 3NAHA 4GRSA 1YBTA 2BOAA 1MLAA 3IRWP 2OKQA 3MM9B 4A47A 2M8HA 4FP9A 3A8KA 3SV4A 3I4PA 1IM6A 3AOCA 3GV7B 3CDEA 4C8OA 1QSSA 2PC6A 3D6TB 4RU9A 2HHUA 2OTLS 2FDNA 1RT1B 1DY3A 3PJXA 2DNKA 3KUHA 2Q66A 2WOMB 2F4VF 4X62F 2CWKA 3C14A 1GH8A 3BGLA 3N01A 5AXLA 5D8HB 4EBDA 4JP8A 4IOAQ 1IN0A 4V19X 1IKWB 2ZBCA 1TUWA 4C97A 2ZJQQ 2XO6A 2DYAA 2XNQA 5U47A 2V50A 1SH0A 5AE1A 3TQEA 1HWJA 1S59A 1WF1A 1HNIB 3A3PB 3HF5A 1VC5A 2ZHOA 5KFWA 5HVHA 1FE0A 3F0NA 1XN9A 5ETLA 3OXLA 3UVJB 1URNA 3OR1A 1PCAA 3CC4S 3MM6A 4B3OA 3KXDA 2KJVA 4UT4A 1BQMA 1V5VA 3M1VB 4YB5A 3AJ2A 1RT4A 1UZHA 2ZD1B 4LRFA 2X1BA 4Q2LA 3LGMA 1JXVA 2H3EB 1VHIA 4FYXB 2DNOA 5E3PA 1U0HA 4LRAA 2OD6A 4O0IA 1VK8A 3ITHB 5KFCA 3MOZA 3KK2A 2ZITA 5A8RA 2AX0A 4ANCA 4OYWA 1PG5B 1T9WA 2EK6A 4RX6A 5I3UA 1LWEB 1HNVB 3I55S 2FVQA 5KAKA 5CYQA 5KG6A 5JMNA 1U48A 4USIA 4LF5J 2JZ5A 2RMLA 1B0TA 1WD6A 1EQMA 3J81U 2D41A 2H65B 4BC9A 2CQCA 2DKOB 3W64A 3VGVA 2OPSB 1NKEA 2F8EX 2OMLA 2EFGA 3CB4A 4MIBA 4RKUC 4GO7X 1HI0P 4HT5A 4HTJA 2ROGA 4DL2A 1GMWA 3MAAA 4NMXA 3T1YJ 4ES1A 1J5EF 2Y1RI 4DMZA 5ETMA 2BEFA 4F8RA 2RD5C 4QOTA 4DS4A 2MQPA 1RT6A 1UEUA 1VJQA 3CMQA 3T6BA 3CC2S 2HZAA 2GHWA 4C2MA 1NPKA 4WU2A 5KFBA 1NDCA 3ILLA 1YK9A 3R5DA 3CJ2A 3QMQA 1EKSA 3PXGa 2B6AB 2FY1A 3LANA 4DV6J 3ZZRA 3VAIA 3SDEB 5BJRA 5E41A 2GJIA 3BN4A 1EHWA 3IRXB 2YKQA 2XQCA 2F8HA 3UN3A 1GTHA 3VVTA 5EHHA 3W5ZA 1X4AA 4EO6A 2APOA 1UETA 2YPYA 3KNGA 1KQSR 1FJCA 1C1CB 1Q82T 1GXTA 4DV1F 2R7SA 1X4HA 1JKHA 1OMSA 1QD1A 5IC4B 4L6V3 3ZZPA 2LEPA 4YDXA 3SSSA 3TAPA 3I9V9 1E6VA 5GMKa 4ECUA 4Q43A 4CO4A 4DR2J 2W9CB 2VFVA 4L3NA 1LFPA 3HHLC 2QIFA 1FT8A 3SSRA 3Q8QB 2AJ0A 1KRPA 4USWA 3UDEA 1WDTA 2EFNA 1FK9A 4KJIA 1NK9A 1D1UA 1S7IA 3FMBA 1CJVB 2KXNB 3KLGA 3D1OA 4AT1B 2VG5A 2RQ4A 4LF7J 3MEDA 5F8IA 1HBNB 4P72A 2FY8A 4E98A 2VJUA 5KFDA 3BF4A 3PYFA 3OL6A 1JLAB 3DLBA 1XMQJ 3FKBA 2R3VA 4PUOB 2KRBA 2IBOA 1LW2A 4B9LA 1FTRA 4PYAA 5DZ6A 2XY6A 3D4JA 2D3ZA 4CNZA 1HBOB 5LJ5Y 5B7WA 4ZPTR 4PG5A 3FRZA 3THPA 4Y2MA 2AW0A 2RKIA 2H1YA 4NLVA 2EG2A 3TUIC 1HWKA 1NKBA 2VG7A 4YDDB 4PPZA 3OFEA 4LF4J 1U49A 2FC8A 1H0HB 2ZDPA 2XGPA 4DL7A 2OI2A 2NCKL 1RUSA 2QLBB 4X4OA 3TJ8A 3OFGA 2J0XA 1KVKA 4LQ3A 2RRNA 4QIGA 1AXQA 3I6PA 4FYVB 4OZ2A 3POTA 3PTWA 4F4WA 4K0KF 1BD6A 2VC0A 2RAQA 4WTYA 4IFYA 4G1QA 1M5VC 3ZZ0A 3PRDA 1YVFA 2I38A 4W4MA 1X8DA 3D28A 2VPWB 3H87C 1I6JA 3J7YU 4CLLA 1I3OB 1FXRA 1VCTA 1ZTTA 2JBVA 1BDTA 1ZTWA 4RW8B 2CPDA 4LRCA 2V8VA 2G2ZA 1SQEA 4CLUA 4ECVA 3MURP 5HN0A 1SQFA 3DRPA 1SCJB 5KG2A 4TNOA 4PAAA 3LPEA 1JLGB 3ETOA 2LFVA 1AFJA 1APSA 5A76A 5LMNJ 3W62A 3SFGA 2ZWOA 3DOKB 2XHCA 1WOSA 4EFAC 1RU1A 4B3MJ 1F60B 4YB6A 5CAAA 3S6EA 3L09A 2AWZA 4NX9A 4ECRA 1GNKA 4JI6J 3GSDA 4NE9C 3W66A 1J5OB 3R2CJ 3GJSB 4ZVUB 3NO7A 4ZPDA 3M32A 5F9NA 4JI2J 3MM7A 3A12A 1YI2S 1RQ0A 2POKA 3I4HX 1FEHA 3RUBL 3IAS9 4I7FB 4R25A 4RW7B 4HHUA 4F4KA 4I0WA 2ZKUA 1D9DA 2Q6CA 2KB2A 3CJ0A 3V6DA 5EWGA 1ZOTA 4P2XA 4RUHA 5HQLA 2CJBA 5F0WA 3LTOA 3VGSA 5C2GA 1BC6A 3R5JB 3MMAB 4DV2F 5B09A 1KP6A 5F8LA 2WK4A 2LQ9A 4FF2A 5GMEA 1SIZA 3BEGB 3DXSX 4A8SA 1WDDA 2DCLA 1RT5A 5LXRA 2Z2ZA 1SC4B 2VIHA 2OPPB 4WP9A 5KG0A 1PYTA 3LF0A 4AXJA 1O5JA 4DSKA 3W60A 2R9LA 3I87A 1X0PA 1S4FA 1VR6A 5T7LB 1MYLA 2DNLA 5J2MA 4M94A 4UOHA 1VMBA 1U9PA 3DGPB 1TL7B 3KTQA 4RW6B 2AYMA 4ED1A 4LUBA 2QT7A 1S0NA 5EX3A 1KC8T 4NA3A 1FD2A 3LW5C 4FPRA 3RRKA 4ECXA 2W9AA 1WKJA 3VAJA 2MZ1A 1RWOB 2RF2A 2M70A 2OIHA 3DI6A 5J2PA 2XS5A 4CWBA 3VCDA 2CPIA 5L1JA 2P9GA 2V4RA 4KKOB 1S6QB 1HNXJ 1Y4ZB 2DK2A 2W01A 1QUPA 3OVSA 3K2YA 4DV5F 3SEOA 3VAFA 1YQHA 4PWWA 4DFJA 3PKMA 2K8GA 3BGFA 3OJSA 5B0DA 3VAHA 1N54B 2R42A 1PO6A 1N5VA 5KFJA 3R3TA 3EGNA 4JI7J 1XMOJ 4F0KA 1Q5YA 1ZM9A 4I2PA 3HHLD 1TL1B 4FF3A 1NJIT 2YX4A 4LFCF 4DPYA 4ED2A 2UUCF 1RKIA 1TMMA 4HDHA 2M52A 1UTAA 3UI3A 3QFHA 1N5QA 2HHWA 4KH1B 2DO4A 2HNZA 2PI5A 2HSEB 2MQQA 2PA8D 4U96A 1GMWD 4KR0B 2ZJPQ 5L1KA 4JV5F 1LWFB 1Q78A 3IR6B 1YHQS 2IAJA 1RP5A 1NO8A 1QAXA 4KSEB 3QJPA 2CZVC 1NB7A 2H4YB 1U2RA 1SC1B 2M2BA 3GYXB 3ZFVA 3C15A 2YQ3A 4U7CA 1X9SA 3DRXA 2KZMA 2B9YA 2BANA 3I82A 4UY8T 2JSXA 3LJPA 2B0GA 3ICLA 1W2BR 2FHJA 4TQSA 5DJBA 1JB0C 3C14B 2B8PA 4LF6F 1MMNA 2KT2A 3IGVA 1KHWA 2D9OA 1KOHA 4O4RA 5KG3A 2IVMA 2DGSA 1S9EA 3Q8VA 3CPWR 5LM7E 2VKRA 4LFBJ 5ETNA 2V94A 4DSJA 4R0EA 4WU3A 1JJ4A 7FD1A 2I8EA 3CJQA 1QTGA 1SC6A 3ILOA 2HPUA 2HQFA 3FZBA 1B3TA 4MK7A 3VW4A 2YWWA 3K59A 3BQ1A 1UEKA 3H7HB 2V5HG 2R7VA 3DOLA 3MPUB 4I4BA 3Q8UA 3OR1B 3CCVS 1BWVA 1U02A 3MM6B 4B3OB 4O3OA 5F8JA 1ZA1B 2CPEA 2HLTA 5MLCV 1F9EB 3NKYA 1BQMB 4R5PA 2E5LF 2GW8A 3HT3A 1RT4B 2HHHJ 2VONA 3B6BA 3HO1A 5C7PA 3K7RA 1L3KA 3A8JA 1U0HB 5I42A 4FKYA 2R2RA 3UN5A 1S77D 3KK2B 4OI4A 3QJLA 5A8RB 2IVYA 5EN1A 1C4AA 4HH0A 4KV8A 2JJ4D 1IUJA 3O6QA 5I3UB 2CPZA 1VQMS 3R5CA 5CYQB 3A3OB 4ZVPB 1U25A 2ZC4A 1Y11A 1ULRA 1SJQA 2XLJA 2F65A 3GJTB 5LMUF 1XNQF 2HFSA 2KELA 1SVDA 1RHMB 3NGRA 3BGOP 2Y9HA 4ECWA 2FZCB 5DQHA 2OGUA 4DX8H 4ED3A 4KIAA 1CJUA 4ANDA 5GADU 3DU6A 4YN3B 3NCQA 2HAIA 3OL7A 3MAAB 1ARRA 4B3SF 1DLOA 2X1FA 3L4BC 4DFPA 2DIVA 5AXNA 1RT6B 4JI5J 2OPQA 3QSYB 4OI0A 1MWZA 4HYKA 4MYTA 3HDSA 2FVSA 2KL8A 5CCLA 4ZN1A 4FXVA 3MR2A 3KHLA 4IQXA 2MZRA 3LA0A 4NA2A 5AE2A 2CNNB 3EGVA 1TKTA 4J9NA 3AFGA 3IWNC 1XNRF 2C2KB 3U1MA 5KT3A 1S10A 4OYXA 2DEIA 2ZH6A 4J9VA 5KFVA 1LV5A 2A10A 1FEEA 1N0UA 3TVKA 3M8QA 1JKHB 3ENWA 3M6UA 2NR0A 5DQGA 4GKKJ 1E6VB 3CD5A 5C42A 4K5RA 1S6UA 2CQ0A 3NOGA 3FT7A 3MUTP 3DLGA 2AEJA 1FK9B 4Q5VA 4A8WA 1Z4UA 3RBZA 4OZLA 1SIWA 3PW2A 2LQJA 1ZYQA 1RADB 4ZHRA 3LWMA 4X65F 3KLGB 4B9TA 1H98A 1RKJA 3C46A 2VG5B 1F2HA 1RHQB 3MEDB 2IDEA 2MKCA 3FEXB 3ISNC 2CJ9A 3PW5A 4KH0B 2VZ9A 4F02A 5K9FA 3CJ5A 1SL1A 1BGXT 3QJJA 1LW2B 3PKYA 2ZM6J 4KT0C 5HL7Q 5T14A 2I1RA 3W9HA 4JI3F 5HSPA 1U24A 4MMOA 1WTBA 2CPGA 4ER8A 2RKIB 2BABA 3NGKA 5IZHA 2EFPA 1GMVA 3G5OA 4RPFA 2VG7B 4DCOB 1D8ZA 4OV1A 1KDNA 4HTIA 2QMWA 3T1HF 2IM0A 1XIQA 2LECA 3GCWP 2OAUA 4WCEQ 3P3DA 2ZHAA 1R8CA 4Q44A 2N4DA 2X1GA 4I64A 2GMJA 1WC4A 3DGVA 2VKZG 2JWNA 3CCMS 3POTB 2LXIA 1IR0A 1TU0B 1KVJA 3TJ9A 4IFYB 1KS2A 4N5SA 4G1QB 3NNCA 2AX1A 2N82B 3RRGA 1VLYA 1Q81T 3HK2A 3KUEA 4TU9A 1X93A 5D78A 5IOLA 1GK8A 4K4XA 1OSDA 4L72B 4AL5A 4ZVFA 3QRQA 3LUYA 2Y8YA 2ATCB 2U1AA 2WRMA 3DRPB 1M5SA 2OD4A 4UQGA 4R8UA 4PRFA 3CJRA 2AKWB 1U8WA 1WSRA 2FZGB 1X4CA 2RQCA 2E7WA 2C3OA 2F4VJ 3I5BA 4YEAA 4C4WA 2FQQB 2DH8A 2UUBF 2ZZMA 1KNZA 1RZMA 4NCAA 2ASDA 2EFVA 2HBRB 4HKQA 2HNYA 2MJNA 2HRYA 1OQ3A 1P94A 4CLKA 3NNAA 1MW7A 3TR5A 3W2WA 1N48A 2XULA 4TQRA 3CO0P 3RBDA 4HHJA 4KFBA 3JS9A 3S01A 3M32B 2RIJA 2V4JA 3MM7B 3GB0A 2GQCA 4O3RA 1VI7A 5LOQA 2L48A 4ED5A 1RABB 3IGNA 4RNFA 2HVHA 4K4TA 2IVFB 4ZLLA 4HDGA 3O2IA 4CO2A 1VLOA 3KLHA 3W2VA 2HIQA 2VQFF 4HVZA 4TY8A 1RE1B 3MEGA 3WX8A 5FDLA 2PD1A 2FHJD 4NPOA 3RBXA 2HGNA 3V6DB 2J6TA 2VFSA 3NCRA 1YJNS 1RYRA 1RT3A 4NXNF 1UA0A 2XO7A 3GIIA 2LCWA 1RHKB 4JBCA 4A8YA 2MQOA 3PJWA 1LFWA 2RS2A 2J8AA 2BRLA 1OO0B 2HS0A 4PXDA 1RT5B 2I2YA 2HGLA 3A3NB 2MKKA 2HBZB 4ED7A 2YNIA 3EDQB 3GMGA 4C8MA 3BQ2A 1NDPA 2EWHA 1WUUA 2SXLA 1W7WA 3RZAA 1I94F 3TYTA 1GX5A 1ZS6A 2PMWA 5J2MB 5HI7A 4PABA 2G9OA 4FBUA 5HMWA 4E8UA 2CPJA 3MR6A 3H2LA 2QSFA 4AXIA 4RR5A 2DNMA 3BH6B 2AGQA 4LRVA 4UF4A 2BQUA 2H48B 1S97A 2RF2B 1OY8A 5A0YA 4U9RA 2QG9B 3DI6B 5J2PB 1RBAA 1S1WA 4JV1A 1R6YA 3L3CA 4KRWA 3OSPA 1J5EJ 3WQPA 2XMWA 4PXEA 2HZVA 5KFQA 3K5MA 1TKDA 3CVKA 4C3KA 3CEDA 2FJWA 2KM8C 1VQNS 2C2ZB 1DHMA 3D3BJ 2IFXA 3O5TB 1AUDA 1IKVA 1UFLA 3JQJA 3H4BA 3ZTRA 4ZOSA 2HURA 4MFBA 1U09A 2I0XA 1UVIA 3MAQA 2NUUG 2OJ3A 2OTJS 1FVQA 2ZC3A 1Z2ZA 3W3SA 4OI1A 2QA4G 1FWLA 4FF1A 3HSDA 3CDBA 4I2PB 1WJ9A 3H5XA 3OL8A 2F1FA 4N47A 5C25A 4NYZA 2GA7A 3HHNB 3MCNA 2BE9B 1PC4A 3DN9A 3G6XA 3VGTA 2WONA 5GAHU 4B9VA 1CBKA 1HD0A 3RB6A 1CULA 2D3O1 2RHSB 2HNZB 2FGOA 2XMMA 3ZNJ1 3OD2A 3ISND 3HHEA 1H3DA 4QQBA 3EZUA 4DV1J 4K4SA 1WACA 3GG1A 4DSEA 2IAJB 2AMCB 2VPXB 4UZBA 3PW7A 2BNWA 2R2SA 2IJRA 3HMJG 2DBBA 4Y3CA 2XHWA 3P4UB 3P45B 2JH3A 5CYMA 2VA2A 1NRKA 3C15B 2W8KA 4LF5F 1S99A 4CIOA 4IO9Q 2BANB 1Z2LA 3Q83A 3UWTA 2JEFA 4YS2A 3DHWC 1P9YA 4DQSA 3SV3A 3D6HB 1AYEA 5KFFA 4AAIA 4RJVA 2VU5A 4KAIA 2CG8A 1N36F 2P5VA 1IBLF 4NYPA 1ZPWX 3MM5A 3EVWA 1R8AA 3CJTA 2D9PA 1LKZA 2FIUA 2YY3A 4PEOA 4OIXA 2ZDOA 3UD5A 1S9EB 2NXEA 1VBZA 2WSCC 2RHQB 5CHCB 2A2DA 1S0MA 1F2GA 4GMKA 1ARQA 4FDFA 3HP6A 4M5KA 3PX4A 2JXIA 2JXGA 2CJAA 1K44A 3DOLB 3FDSA 4XPCA 3PVXA 4DSFA 1U1QA 5HP1B 4IFVA 2BA9A 4F04B 3QGGA 2DHHA 4CT8A 3G71S 3TARA 2AHOB 4I67A 3H40A 1E6YA 4R5PB 2XWXA 4S0MA 1P27B 4HEA9 4LSNA 4K0KJ 1L3VA 4EK2A 2OSQA 3T6JA 1FWKA 5I42B 2UV8G 3GSIA 3K58A 2GAGC 5ETQA 3QIPA 4KV8B 4OV6A 4M5GA 3Q8RB 1JLEA 3R6LB 4F3QA 5JJBA 2M8DB 1JJ2R 3P49B 3ULHA 4DEZA 1S1XA 5D4OA 2FLLA 3GE9A 2G1HA 3V4IA 3QLHA 2E9RX 3JTOA 3T1AA 4LSZB 2GX8A 4U67Q 3R5BA 1B4SA 4BWMA 1KVIA 4DR4F 1WTFA 4BHQA 1CJUB 4NXMF 2XMJA 1S49A 4G3IA 3TZYA 2E5GA 3V4MA 2RVJA 4OYPA 1JLBA 4M5LA 1DLOB 3GIRA 1HHSA 3W7BA 2JLFA 1RLCL 2OPQB 4BBYA 2W2QP 2JVRA 2VFTA 3M8RA 4RU2A 4USHA 3NL0A 1U6FA 3UCGA 3T5KA 3ZZUA 5F0UA 4IOBA 2V8DA 1GTEA 1T0TV 5KFNA 4C8YA 1XR5A 3T9ZA 1TKTB 5L8RC 3Q8PB 2P9CA 4UOFA 4OZ1A 1FTCA 3NBPA 4DV2J 3I56S 3M30A 4Y2KA 5AE3A 3N0VA 2O67A 4BDPA 1PJ5A 4PQUA 1S9FA 2XG8A 1VYAA 1RTZA 2KG0A 2R2TA 4PCQA 2M3DA 4F26A 2YWHA 5CQGA 2KVQE 5KFXA 4ZCKA 4A8QA 4TN2A 2NPIA 3M8QB 4RNNA 2GHPA 1H72C 1WEZA 3F44A 2QGFB 1R27B 5KT6A 1WC3A 1DBDA 5C42B 2UV8A 3GWCA 3CDUA 1MNTA 2VA3A 4WFYA 3LP0A 1C4CA 4GVLA 4ID8A 1ZETA 3R7BB 1ZPVA 3DC2A 1PGZA 3NAIA 3HX9A 4EEYA 3DLGB 2NYHA 3K5PA 4HI1A 1Q79A 2IYGA 1SIWB 4ZHRB 4DPWA 2YQ1A 1R3NA 2QL9B 1CQMA 1NJWA 2ADCA 4OJGA 5BYQA 4DV5J 5HROA 4YY3F 4ZS6A 2XY7A 2JEIA 4JI6F 5FLXY 4DZ6A 2M4MA 4P73A 2DTJA 3H20A 2R8KA 4KGVB 1Y5NB 3LPYA 3PX0A 2PA3A 4O4GA 3E51A 1WHYA 1RXOB 3C6TA 1GXLA 2EXUA 4Y00A 3VHQA 1WC1A 4W92B 2UUCJ 4A8XA 4WFZA 4KHRA 2GFFA 4IG0A 1DQ8A 1M5KC 2E1MC 2DRDA 1B7YB 5B0CA 5KFMA 4A8OA 4KC5A 1FKOA 5HQMA 1JMTA 1NNDA 3BJYA 4G6VB 4DL5A 4JV5J 4IRKA 1T9XA 1T05A 2BA3A 2AY0A 2H5EA 1BE4A 3OT9A 4ZKAA 3NWGA 3VEBA 2UXBF 1S79A 2LLZA 1FX2A 2VL1A 3L7PA 1YDLA 3G8TA 1G4CA 3GR0A 1R7IA 4OJ1A 2AU0A 3ZZYA 4UOGA 3T5HA 2JX2A 3TVZA 4R8UB 2XTJP 3S7RA 5F41A 4MIWA 5J2QA 1PKUA 3HKWA 1BUXA 3BZQA 2MHNA 1B0PA 4CNYA 2OH2A 1JX4A 2PGCA 1UA1A 4P7TA 2EPIA 4LF6J 1O0PA 1WC0A 2HNYB 3MXHP 4CRJA 1X9WA 2L9DA 4EBEA 1VHFA 3GIJA 4DBQA 4IOCQ 1TK5A 2KM8B 1RT7A 3W2WB 1V9OA 3H25A 2CRLA 1MYKA 1MN9A 1KKHA 1S76D 2AF6A 1MNEA 4A8KA 4OI6A 1O51A 2HVIA 1SV5A 2DR9A 4DPXA 4Z2XA 2W7AA 4KFBB 5KG1A 2AYGA 2RT3A 3MMCA 2V4JB 2B4OA 2MY7A 4X4SA 1HWUA 4AL6A 3RR8A 1S5ZA 1U1OA 2KKEA 2Y0SD 4NLTA 1XEZA 1QDUB 4N76A 3KLHB 3W2VB 3BSOA 2F9JA 4TY8B 2E5LJ 4AFFA 4FYWB 2KOEA 2WW4A 3MEGB 5FDLB 1S0VA 4K4VA 3IAM9 4J9QA 2DR8A 4IO1A 2ZUAA 1RT3B 2QLXA 5IM0B 3NY0A 3JSRA 1HBUA 2KDOA 3DKDA 3BO2A 5DM7Q 3SI8A 5D3GA 3AY0A 3AH6A 2FLNA 2MMYA 4J9OA 1B01A 1QM9A 1QVFR 1VQ6S 2DY1A 4B02A 2H3AA 2YNIB 5KFEA 5FIIA 4QYZJ 1CJTA 3K5OA 1YBAA 3ZTPA 1XERA 3VGUA 4CO1A 1XWLA 1HWIA 1DARA 2A2BA 3W9JA 3JQMA 5DG9A 1IR1A 3HD1A 1BWEA 2W4DA 3NGDA 1IQZA 3BPDA 3TANA 2F3JA 1QSYA 5LSRA 3QQCD 2QO3A 1F6TA 4DX7A 2QN6B 2M9KA 3CW2C 5A0YB 3W8GA 4CLWA 1MWYA 3MTKA 2NXJA 4URSA 2AP6A 1S1WB 5BR8F 1Q8IA 2GO8A 1VIOA 4B3SJ 4A46A 4OX6A 2P6TA 4OHXA 4CH1A 1RB0A 1IKVB 3ZZOA 5JUMA 1SBRA 3QT5A 3M2VA 4BWJA 1MSWD 2B8QA 2ZOGA 3MGJA 4UQTA 4MFBB 3FEYB 4M5JA 3VZHA 2JOQA 2PMHA 3OSNA 4AL7A 3AD8C 3CD7A 1F3FA 4CLZA 1WHWA 4LREA 1HQUA 3UNGC 4DL0C 2KTQA 3Q23A 2HVZA 1TL3A 2NPFA 1U2FA 2AT1B 5C25B 3HD2A 4WIQA 5F9LA 1XNRJ 1S1UA 2WONB 4KPYA 4IG3A 4BC7A 4AQYF 2RBFA 2JVOA 1CULB 3QGIA 1DURA 1JWWA 4ZP9A 3QWPA 4QIWD 2CFXA 2Y1LB 4Y65A 5KFGA 2DGTA 4LR8A 1FDDA 4HV0A 4UUWA 2XMKA 1EJ7L 1TAUA 1W25A 3D7SB 3EUNA 2F40A 1U1KA 2FTRA 1Y00A 2HGMA 3THVA 1IJFB 4ICLA 5GMDA 2L08A 5IQ6A 2HHPA 5CYMB 1VC6A 3BH7B 3CGIA 4K5SA 2D1CA 4OZ5A 1HQ2A 1KEKA 5D0RA 1WNEA 1C1BA 1UAWA 5D4PA 4ZCMA 1Q5VA 3D6FB 3GJQB 1IBKF 3CCRS 1TZ0A 4DX6A 2DNRA 4LR9A 3J7A1 2Y1IA 4X65J 3CCQS 2B43A 5D15A 3I9ZA 1YJTA 3VV2B 3HZGA 2DH9A 3MM5B 1H7XA 2RB7A 3MMBA 2EW9A 3IS9A 3OXGA 2HS4A 2K06A 2NZCA 2K7KA 4XDCA 4WIIA 3OHAA 1SJRA 4HLBA 4X64F 4ZVEA 4GO5X 2G4BA 4JI3J 1X31C 4EUVA 1WWHA 4JI5F 4NLUA 5IFMA 2R2UA 1XMBA 1GXUA 3HZEA 4MTPA 1YZ6A 1X7VA 4V19J 3ETMA 3JAMU 4IFVB 3ZZZA 5I3QA 2JFDA 4RO0A 3MPYA 2IBKA 4GKJF 4UOCA 1NCLA 2H5JB 1Y5LB 1E6YB 2DGOA 4H4OA 4DL3A 2J9DE 4P52A 2V2KA 4DL6A 3O1LA 4LSNB 1U26A 4URGA 5KOXA 2CWXA 1R43A 1TK0A 4OMFG 2B3TB 1MWQA 4ED8A 1FRJA 1LQ9A 2ATLA 4ETZA 3TX0A 2F9DA 3W5XA 4CLTA 3TJAA 2V34A 1UJ6A 3QIPB 4WZMA 3HFVA 2MEWA 1Q8BA 3PFOA 2OEJA 1JLEB 2GVDA 5E33A 2CNKB 1Q16A 1IWAA 2QFJA 3ZXWA 3M6WA 5HVFA 2XB2D 1SJFA 5C24A 3OPKA 4U95A 1S1XB 3TRGA 1QLNA 4RUCA 2R8JA 3NXZA 2UUBJ 3SQOP 3V4IB 2J6SA 3QLHB 5DM6Q 1T3OA 3T3FA 4WTOB 2CAXA 3GONA 3KHGA 1EKRA 2OLWA 1FRIA 3T19A 2FJDB 4DR1J 5KT7A 1VIXA 3NGTA 2PFFB 2FLOA 4QR0A 1ZAWA 3FBFA 2B5JA 3MR5A 4C8ZA 2R8GA 3OFFA 1T9VA 1JLBB 2LEAA 4RBTA 1RAHB 2AIRB 5D77A 1IBCB 2ADLA 1HNZF 3RW6A 4URQU 4NLYA 2ZM6F 3AJ1A 3T5LA 4DSIA 3KMSA 1OYEA 2EEYA 4CDIA 5DS7A 2DB1A 2FJBB 2DHGA 3RAXA 2B9XA 2J9DA 4B9SA 2BKOA 3PCOB 3MHYA 4HH1A 2VQFJ 2HWHA 4O3SA 4N77A 4N41A 1M1HA 1KLNA 3PV8A 1CS4B 1U47A 4NXNJ 2V68A 4QYZK 3NBPB 3B8HA 3PHTA 2G0CA 3M30B 2JLEA 4JV0A 4P2MA 3BBFA 5A6WA 4ZPBA 4L74A 3EYZA 2FVCA 4PQUB 4DLGA 1N5TA 1EETA 3NOCA 4KY3A 1KWMA 1A9NB 2MDAA 8AT1B 4LF9F 2C2DA 2VF3A 1BMQB 2VD3A 1Q7LB 2XSFA 3LP1A 1I94J 2HQIA 4MH8A 3V6JA 1VFJA 4JOUA 1JLQA 3VQSA 2WTFA 3FUYA 4ED0A 2OMOA 2ZH7A 4CQ1A 3GV8B 1NU4A 2WHOA 3IBFB 1SJ3P 2NQPA 1FDAA 4H4KA 3BSAA 3RW7A 4N56A 2UXCF 3LP0B 2GAHC 3CCLS 1B70B 3H2VE 4U6PA 2W8LA 4DUTA 4AE5A 3R1LA 2RNEA 3TZZA 2QMUB 3C16A 3EDRB 1TL5A 1OJ4A 1N33F 1VRQC 3VAKA 5HROB 3SCLE 4ALZA 3W1YC 3UE2A 4C3LA 1Q4RA 2RQMA 4U8YA 1K8AT 3KK3A 3CNQP 2J7WA 5JVGQ 5HANA 4DV4F 3J7YI 1Z1ZA 3TO8A 4C8NA 1SJ4P 1WI8A 1NKCA 4O4GB 4FKXA 4W98A 3C6TB 1SC3B 3H5SA 4CO0A 3UN2A 3TAMA 1N5SA 4IG0B 3R8YA 2YPZA 1D8YA 1N32F 2GQ2A 3QZ8A 5DZ7A 1RAIB 2EK1A 1VGYA 2ASJA 1FKOB 3DHXA 5IT0A 4ZP7A 3PW4A 2N3LA 1OS5A 2CJQA 3GG0A 2H4WB 3HPOA 4DFKA 1WKKA 3U27A 1T05B 6FDRA 2K3IA 4XK8C 3RRHA 3UCZP 2MQ8A 2DCUB 5D4NA 1K47A 3CC7S 1NK7A 1LXJA 4QZVB 3LO3A 4L76A 4WP8A 5IV3A 5F8NA 4KB7A 5ETRA 1MMDA 4O44A 3OXFA 1GFWB 5KFUA 4F7VA 2CJXB 4DLEA 4ES3A 3HHLA 2MXYA 3Q8SB 3TZXA 2E1PA 4C48A 4H4KC 4F0HA 1L5UA 5J2QB 3CD6S 2H54B 1EA4A 4OZ0A 4C3MA 3D0HE 1X4FA 4M95A 5H9FJ 5F8GA 1N36J 2QX0A 3QBCA 4CM2A 5C5JA 1HI1A 5DDPC 1PJ7A 1IBLJ 3OLAA 4TXSA 1S0OA 2ZEJA 3N5FA 2J0QD 2C2OB 4DV3J 2RDJA 1D09B 2YWEA 1RT7B 1DAXA 7AT1B 2DRBA 2ADBA 1S6OA 3ADAC 2DO0A 3D1HA 2YH1A 1BHNA 2JFKA 1SV5B 5IC6B 3MMCB 2Z8QA 2HFOA 2YVSA 2HNDA 4OFZA 1F5BA 3I32A 2A2CA 4DR5F 4P6QA 1QUVA 4J9LA 4X4RA 2HBQB 5FD1A 1Y3JA 1T9UA 1NK6A 3VAGA 3CO9A 1PYSB 3FZ2A 1PBAA 3K8VA 2B7CB 2VBYA 4OZ3A 2RUGA 2CXEA 2BJ7A 2ZFHA 4RBUA 4NL5A 1VDHA 3CT9A 4QYRA 1NJXA 2QMXA 4AUKA 1EZZB 1UVLA 1HBUB 5HAOA 2HK3A 3MR3A 4FXDA 3US5A 5D3GB 1C2PA 1F0XA 4MIAA 3ISZA 2KRRA 1RAEB 4QIEA 3X3UA 1CJTB 3GU0A 4NMLA 2Z0GA 2V4QA 3RB0A 4M5HA 3UDVA 2RILA 4KO0A 4C7QA 1HBMA 3QRRA 1M1GA 3G4SS 3ELHA 2UXDJ 3KFWX 1FNOA 1P6TA 2DGXA 3MI7X 3Q22A 3P5BP 2KG1A 1X0FA 2W2MP 3NS7B 2J0SD 3SQGA 1RAJA 3MECA 4CM0A 2OPRA 2D3OR 1N56A 5EX0A 3WC2A 4DR4J 1RHJB 4LBPA 1C0UA 4QIVA 5GVQA 2F63A 4NXMJ 2MB0B 2O1PA 2X51A 4TU7A 1R0AA 1UVNA 2YX7A 2JDJA 4X66F 4CLSA 2ZUGA 1RTIA 2HFZA 1YRTA 3KMQA 2CKWA 3CJKA 3M2VB 4RNOA 4M5MA 3P6YC 2CQIA 1IXKA 3IBWA 3HSJA 4PYDA 3K8WA 4ZLPA 4CH0S 1U1NA 3BBBA 1HQUB 2UVRA 4YHHF 2DD8S 3P8BB 3MEKA 1LWEA 1TL3B 5CCMA 3JB9k 2RRAA 2IJFA 3BYPA 4R0JA 4U7UK 3TA1A 5ETKA 3C19A 1R89A 4OX9F 1S1UB 2QYGA 3KJNB 4IG3B 3N28A 4O3PA 4DFMA 3MF5A 3N5BA 3BGUA 2YNGA 3D3CJ 2M7SA 1GMUA 3P5TL 3AXMA 4CCHA 1HQEA 1QVGR 4DQIA 2IM3A 4P10A 3VWSA 3FNNA 1U6ZA 5DG8A 4WXOA 1UPMB 1JXLA 2ACYA 1T8EA 7FDRA 3QPIA 3FVYA 1UCNA 2DIUA 1S48A 4FVCA 1FFWB 4K2XA 2XMAA 4ICLB 2R7TA 4NZ0A 2G2OA 4A4JA 3MWBA 1URRA 2WAQD 4X2BA 1U8SA 1YSJA 1C1BB 3AXKA 3LAMA 3W63A 4KQZA 4KGKA 1OYDA 4O23A 2VV5A 3QT8A 4DQRA 3OBIA 3S8SA 3Q8YA 2ZH8A 4K2JA 2LQBA 1RWMB 3KJFB 1TVRA 3L95X 3DLJA 4IRCA 4YY3J 3MMBB 3IS9B 2VPYB 3QRPA 3K17A 1UVJA 2IIHA 2UVWA 1S6PA 3C6UA 4CO3A 1M5OC 4ZVGA 3IG1A 3EGZA 1OPZA 1WF2A 5CD4A 1KN6A 2CUYA 4C9DA 3UO0A 2ZH3A 2IMWP 4EMDA 1LNQA 5HK4A 4MKYA 2PO4A 4NWBA 4LMZA 5B0BA 5CABA 2FJAB 2XZDB 1SUQA 3BKFA 4H4MA 4Y2IA 3AT1B 5IXUA 2KYXA 2QZ8A 1M90T 4I6WA 3WC0A 1FJ7A 1X9MA 2YKNA 2C28A 3C2PA 4H4OB 2CPYA 4J9KA 5ADZA 3TAQA 1FNMA 2F8MA 5GADI 2HHSA 1WHXA 1YLXA 2O01C 1DFDA 4QPXA 5KFYA 2VUGA 2HHTA 3D67A 3BN7A 2UUWA 3D2WA 2UXBJ 3AD9C 4MKVA 2HFUA 1NK4A 4CLYA 2NREA 1T3NA 3TP2A 4JI1F 3QT6A 4IH7A 2BMBA 2O3DA 5H9FK 4YR3A 4K4WA 2E66A 2AYBA 2GVDB 1Q16B 3JSMA 3AB2B 1UJ5A 4ZPWR 4UTGA 4L73A 5E3AA 2BDPA 3DLKA 3M8WA 3OHBA 5C24B 1NSAA 1NAQA 3CJ3A 1JLCA 3BSCA 3EICA 5AJ3F 5KFLA 3T41A 2CZ4A 4FYYB 1VQLS 3DYAA 3GFXA 3MR7A 4EYIB 3KLIA 1N88A 4DR7F 3IWLA 3ENQA 2HFNA 4FN5A 3KHHA 2R8HA 4OYZA 1FX4A 2E5HA 2C3MA 2B5JB 1CQNA 4F4YA 2ALZA 3GIMA 1T9TA 1NHUA 2HQ3A 2KXFA 5D0GA 4ZITA 2CZ9A 2OEMA 3NLCA 1OHNA 3CIMA 1RWWB 2LEBA 1LK7A 4ZK7M 5A6PA 2BNZA 4OLPA 2DXFA 1VQPS 2VJVA 5E3CA 4WBFA 2DJWA 2LP4A 4Z7CA 4PR6A 3TW0A 1CLFA 3HSGA 3O3LA 2RDDA 1PC5A 2IC3A 1JXEA 3I31A 3PIOQ 2MY8A 2CA9A 5KFKA 4IR1A 1UW4A 5EDWA 3HSZA 1KTVA 1EETB 2Z57B 3MPWA 3PACA 5DO2A 4WK3A 2BQ3A 2KFNA 4J9UE 1JLFA 3O44A 2VBZA 2YKMA 4DUYF 2PN6A 3LP1B 4RW4A 1RGVA 2KHDA 1JLQB 1FF2A 1QAJA 1NHKL 4CTAA 2G1DA 1CJKA 2RH3A 1SH2A 1U6BA 3D66A 2DPIA 2MKHA 5GAGU 5D0HA 3DCAA 3OTBA 4LRBA 4X4VA 3PYDA 3IN5A 3OVBA 2DXDA 3ENVA 3G8QA 1RHRB 2CVIA 3IR7A 5BR8J 1ZM3A 2DNZA 4OJ3A 3C16B 1NM2A 3WIUA 4ECSA 4C0OC 1NMEB 5HMXA 1HPZA 2ZNYA 2YBVA 3MM8A 4DCPB 2FJVA 1Q86T 2C3YA 4O3NA 2E1RA 4F67A 5FJ4A 4ME7E 3EVMA 2MZJA 4NA1A 2BJEA 2LKZA 2WSFC 4ZVOB 3KK3B 3VZIA 3HJVA 1RT2A 4H54A 1WHVA 2D74B 4G1IA 4RNMA 1WG5A 2W25A 3D68A 2R4FA 2BBEA 2GC8A 4G65A 3PW0A 3OUYA 4K8RA 3TAMB 1FRLA 4DV0J 4LF1A 4AQYJ 2MZSA 2U2FA 2YXLA 4DF4A 1WEXA 4DPOA 4FF4A 1DTQA 1LWCA 4DF8A 3M8SA 1IKXA 1VRTA 1ZM4A 2N3OA 3UQSA 2HEKA 2XWYA 1RAGB 4Q45A 3NCPA 2FLPA 3MAHA 4KGXB 2FB0A 2AD9A 4NZ6A 2EKNA 1VRUA 3I96A 4O44B 4QU7A 3RJMB 4P75A 3FSYA 3HHLB 2PE8A 3QAEA 4PZVA 1IBKJ 3ZO7A 3CCTA 2HRTA 4ELTA 2KI2A 1B0VA 2OUGA 2V63A 3JAMY 1NZ8A 3CIZA 4NCGA 2IMOA 3CCWA 3G87A 2J6UA 3ZTOA 3UW1A 2DNYA 2JRSA 3CJ8A 4CP5A 1DQAA 4JB8B 3DDIA 3H0PA 5M2PA 5IS2A 4PWUA 2CAJA 1ZM2A 3NG8A 2GJFA 3G86A 4X64J 1N8RT 5AXKA 2ZH9A 3MTJA 1XR7A 2A18A 1K0VA 5E3QA 1DJ0A 3PRVA 1TP7A 2AYEA 3KUGA 3CWJA 1Q0NA 1UWBA 5DDRC 2HNDB 4NLGA 4MJWA 2NSBA 1G3OA 3I5AA 3R7SB 4ZCIA 1R0CB 1X60A 1OIAA 4TYAA 4GKJJ 1T95A 2K1RA 5F8MA 3D0GE 3FGVA 2GIQA 2MGZA 2CNLB 3KLFA 3TEGA 4RZRA 2KT5A 4LSLA 2ZJRQ 2GMLA 3CULA 1NDLA 3MEEA 3AJDA 2WVBA 5L39A 4O3QA 2XMTA 2LDIA 3DRRA 3SIPB 2A1BA 1QY7A 4F25A 4QWCA 4ZCLA 3FRYA 2VDHA 1WG4A 4WYWA 1SQGA 4DXLA 2M88A 3DDNA 3JYTA 1HWLA 1PAUB 1KSPA 4KO0B 3M9OB 4PG7A 1JNRB 1HBMB 3FCVA 3DOMA 3LQVA 4ECTA 4LT6A 4P2FA 4QIFA 2MSTA 4ZVQB 3MPDA 5CYJA 1NH8A 3G2XA 5ETOA 1TTHB 3TEHB 5L1LA 4FBTA 4UZCA 1CG2A 3MUMP 1HR0J 3SQGB 2XLIA 3MECB 3V81A 2OPRB 1LOUA 5GAHI 1OY9A 1C0UB 1KBRA 3NWRA 4YOEA 2WB4A 1K1SA 2LDYA 1Y0HA 1R0AB 1Y10A 1SI9A 2B9EA 3DU5A 2CQ3A 2QA2A 2IY5B 1RTIB 4DN0A 2GO9A 4Z7YA 3VVUA 1HNZJ 2KFZA 3CJKB 3TA2A 2DGUA 1UZDA 4MK9A 1JNZB 3IBCB 3PEHA 4EZ9A 1F3VA 1WORA 2XYHB 5CZXA 1NLAA 4NLDA 1UVMA 3HM9A 2ROEA 2Z2MA 4ECZA 1U0SA 3D0IE 3DFEA 5LSLA 2UUTA 4WFNQ 2O5DA 4L75A 5GAEU 3GFYA 2PDAA 5EWFA 4Q8EA 2B9WA 2DR6A 1IJEB 3OFHA 5L1IA 3D5MA 3FMWA 2YNGB 4IYQA 3PEJA 4LF9J 4E0DA 2BZ2A 3M2UA 5JXSA 1A0OB 4OI2A 1HQEB 3PYGA 4OHYA 2ZH1A 3CJSA 1WSVA 4P7VA 3AAWB 2Q3PA 2EBEA 4F4XA 4M8LA 3SCIE 2AV5A 3AOBA 1NDKA 4I2QA 1AROP 2B4UA 1NHVA 4RL1A 2UU9F 4DR3F 2NLWA 4K50A 2VBXA 2UXCJ 4P2SA 3EZOA 3OTOF 3NMAA 3TWZA 2HVDA 2RE1A 2QSWA 2A6MA 3DLEA 1HL6A 2RU9A 3MCMA 2OFHX 2HW3A 3H90A 2ZWPA 3T9NA 3DMJA 2JEGA 4K4YA 1NXIA 4F3OA 3NNEA 1I51B 1N33J 3MPVA 4DR1F 4F3MA 1TVRB 4ZLJA 4ZVTB 1N34F 2W7PA 1VQ5S 2WBMA 4JYAF 3H5UA 3C66A 3HVWA 3RB4A 4DV4J 1S6PB 3C6UB 2J9EA 5HBMA 3IG1B 2R7UA 1QTMA 4N7TA 4FS1A 3H98A 5CA5A 4OHVA 3H4DA 4PPDA 2MQMA 2V8HA 3M7VA 5K8OA 3D9BA 3M2RA 4ERDA 3HJFA 1C0TA 2GZOA 1SUQB 3K57A 1N5YA 4H4MB 3J81Y 1QTNB 1FXLA 1HNWF 4C98A 1FI4A 1N32J 4M5DA 4QWEA 4ZJQA 2YKNB 4OYIA 4XIUA 2Y0BB 2ASLA 1SPBP 1ICEB 2Y8WA 1UP1A 4KGZB 1H7WA 1T11A 4D3GA 1D9AA 2GMHA 2YX1A 2IRUA 3V6HA 4HR2A 2IJNA 1RLDA 5G0RA 2PEHA 3H8YA 1W2IA 3FBCA 2AGPA 4Q2MA 1DZ5A 3CDWA 4OHZA 2YWGA 5IWAF 3G82A 2CVEA 4ZA1A 3CJ4A 2MQNA 3JSMB 3CCJS 3UFCX 1S57A 5KFOA 1NK5A 4IQMA 1S72S 3U1NA 2OHDA 3DLKB 3VTIA 2CQ2A 2MKIA 4Q0BA 4Q8FA 1JLCB 2DISA 3RTVA 4NLSA 2DRAA 2CJYB 2PI4A 2FC9A 3DYAB 2P2CB 1YITS 3KLIB 2DVIA 1N6QA 1H2VZ 3BDEA 2GPEA 4IH6A 3NRBA 1VQSA 4FZVA 5CD4H 1FESA 2I5JA 2V8GA 2WVFA 1IQTA 3J7AN 3BSNA 2WVDA 1MMLA 4KHPF 2V9WA 2R7RA 4DR5J 3BPSP 5K8PA 1YJRA 2EG1A 1PILA 2QTWA 3A8EA 5B08A 2J7UA 3DLHA 2FUG9 4BCAA 4LVNP 2HBYB 1R8BA 2AEMA 1ELOA 1S9GA 3GZ7A 1Q53A 3B82A 1U2CA 3GR1A 1T7PA 4CO5A 3KJVA 2IC3B 2VOPA 3AB4B 2HMIA 1HFEL 4EGLA 2QA1A 2GGPA 2J7KA 1KR4A 1NSQA 1HKAA 3H5YA 5A8KA 3OLBA 2JHEA 1HYSA 2MYFA 4RW9A 4ECQA 5DETA 3G9CA 1R0BG 2WVCA 1MU2A 1OQ6A 4DSLA 5E7OB 4HHHA 5RUBA 2PMZD 1JLFB 3BKUA 1FO1A 3BO3A 2YKMB 4FYDA 3EGWB 5A8WA 3E8OA 1RTDA 1P1TA 4I69A 4RW4B 5KTQA 2LQ5A 3JTPA 4CTAB 2FD2A 5K8NA 4DDFA 1CJKB 4P9SA 1WOOA 4JI0F 2W9BA 4Y2AA 1YX2A 3W61A 3QSIA 1NSKL 1RHUB 1HHTP 3IC1A 3H42A 4B3RF 3FK4A 1HI8A 2QLFB 3KLVA 1JJHA 1CPZA 4RUBA 1LK5A 2RS8A 4ILRA 3KDNA 5KFRA 2Z56B 4DS5A 3FCHA 4D8JA 3IR7B 3R2DJ 2Z58B 2E5IA 4DV7F 2MLYA 2QJ3A 2ROPA 4X66J 1EX8A 4DV3F 1HPZB 5DGAA 3MM8B 2HZCA 1NPPA 1G6BA 2CQ4A 1YJWS 2CG4A 2XMUA 3GFZA 4O0NA 1RISA 5KG4A 4YFUA 3R6GB 1U1PA 1FE4A 2FVRA 4LVOP 4QCLA 3FMTA 2RUSA 2HQGA 1RT2B 1PBUA 1XC9A 3KNAA 1I1GA 2UUAF 2Q1LA 1Q7YT 4YHHJ 1NBEB 4LBHA 1RK8A 3PR4A 1TUGB 2K2PA 2WW8A 1YRXA 3AA9A 4OX9J 3OUYB 3KG1A 2Z30B 2D7SA 4I56A 4CLFA 3VEAA 1DTQB 4B08A 1LWCB 1B28A 1U1MA 1H6KX 1Y3KA 3TVYA 1IKXB 1VRTB 5K5MA 1FDNA 1D3WA 1QAIA 4UY85 2VFUA 3IA0A 3PNIA 2B7BB 1ROFA 3WIVA 3RYLA 2BKNA 5ETSA 4USJC 2H51B 4QJVA 2DHXA 1VRUB 3QIDA 1FHTA 1T03A 2UXDF 4J7CA 2XLKA 5THWA 1Q1KA 1J2VA 2L9NA 2H5IB 1RA7A 3WDOA 4ES2A 2QA4S 3CMES 4LF8F 3H59A 4DWIA 2BE2A 2RSQA 4NCGB 9ATCB 4LIRA 1K1QA 1IBMF 1FWPA 1KQFB 3GP9A 2D69A 2HHVA 3GYNA 2LQ8A 2KT3A 4F2SA 5ETPA 3E01A 4DG1A 4OZJA 1P8GA 2ZH4A 3QGPA 4KGMA 2IPOB 3KHRA 1F5AA 4XPEA 2K7JA 3AOAA 3K5LA 3RB3A 1CSJA 1RCOB 4A8MP 4UW2A 2A0FB 1S1VA 1SKRA 1H73A 4LJMA 1UWBB 5H1SV 5FLXU 2XEXA 1R8HA 4OX7A 3HLUA 3B54A 2X1AA 2HLUA 2K1RB 2J5AA 2GCFA 1Y9OA 4GVBA 2MGZB 2MSSA 4USTA 3KOAA 3KLFB 1SJ1A 4ZVHA 4LSLB 4MYUA 2BR0A 3MEEB 1BQXA 5DDOC 1VBKA 4C8LA 2ZBRA 3DRRB 2CJKA 5HQ8A 2E7XA 4EI2A 4G1PA 3HHDA 1T94A 5IV4A 5DQIA 4X4QA 2HHXA 2QEXS 4JI1J 3JYTB 8RUCA 3M8ZA 3PO5A 3OTCA 2VBWA 2VG6A 2ZKTA 3E2EA 3LGHA 3DOMB 3OTDA 2OSRA 2HK2A 4CT9A 4HI2A 2BXJA 4I6YA 1RTHA 1S7HA 3I0SA 5K20B 1FA0A 3QNWB 4D3HA 3B78A 1KQGB 5F8HA 1F1BB 2LMIA 3QO9A 3GILA 2J8SA 5AJ3J 2RDIA 3FJ2A 2HIYA 2MKYA 3V81B 4Y0FA 1FJGF 4RBVA 2IA0A 4DR7J 1U45A 4RUAA 4B3TF 5HP1A 2GIFA 1T02A 5J1PA 2ABYA 1PYOB 5J1NA 4ATNA 3F73A 3DM2A 3BREA 4FXEA 1WELA 2VDIA 2C42A 2NXCA 1K9MT 2HHQA 3H2UB 2BVZA 3B4MA 2XSJA 2Q2KA 1BDVA 2AZ1A 1PSDA 2KXHA 3NMRA 3ILIA 4PXCA 1KFSA 2CQBA 2G0IA 4DJBA 1NH7A 1ZZNA 1FRXA 3O8WA 3A1YG 4F0MA 4DUZF 1SL0A 3A8IA 4LBIA 1NUEA 2RRBA 2XM3A 3M2UB 5SUHA 2ZBQA 2DNGA 2MTLA 1SKUB 2DH7A 2J0WA 4DUYJ 1Q8KA 2VC1A 4I2QB 3KYLA 5D4LA 4X4NA 3BR9A 3QT7A 3F41A 5G4DA 2WZ1A 5KFHA 2FHKA 3PY8A 4ZDNA 5MAOA 2LU2A 1N4LA 4F4ZA 3DLEB 2DGQA 2C3PA 4OX8A 4K4ZA 4CYUA 2DGWA 2Q43A 3RGIA 4WK1A 3DMJB 2YNHA 2BJ9A 2ZE2A 3G6VA 3M8PA 3LAKA 1TFYA 1FD8A 2C1EB 3MFHA 1IWGA 5HVGA 3EWGA 1D0EA 3M6XA 3PR5B 3A13A 1XK8A 3OW2R 5LSOA 2JC0A 4QW8A 2CADA 4HACA 2UP1A 4K59A 5HBMB 1HHQA 1Y7PA 4NCBA 2DEJA 4TU8A 5HMYA 3OR2A 2C3UA 5LT5A 3GQCA 1RU2A 3ET6A 3M2RB 4I68A 5J1EA 4OJHA 1CC8A 3ONQA 1C0TB 4KPCA 4OZNA 2NSCA 4KBIA 3EX7B 1N5YB 1YJ7A 2HWTA 5IT9U 2K29A 3NNHA 1OG7A 4M5DB 1CVJA 3J7ZT 4JI8F 1BQNA 2NYIA 2EBGA 2DNHA 2HG4A 1VS3A 1PJ6A 2FVPA 5DG7A 1N52B 2BW7A 3JQKA 2AN7A 2PEBA 5A2QU 5DLFA 1J27A 1WOPA 2C2NA 5G0RB 2XCPA 1LXNA 4K4UA 1XQIA 2BW2A 5E5NA 2LA6A 8ATCB 3X1LB 3QZ7A 1UWAA 3G82B 1RI7A 2EKYA 1X5OA 2RQKA 1IM4A 5ITHA 1QE1A 1TMJA 2V2ZA 4MAKA 1BY9A 2Y3YA 4Q0BB 2NUHA 3D6MB 3ZTQA 5M2UA 4F50A 1YJUA 3SXLA 4PXBA 1RWNB 4M5IA 1JQGA 3V6KA 2MKJA 1EAYC 3CCUS 1S1TA 1VISA 2F7VA 2XS7A 1RTJA 2HAFA 5EUHA 2OFGX 4AYBD 3VALA 1N6QB 2GJ2A 3P96A 4JI4J 4J5OA 6AT1B 2H1OE 3VAMA 4DHVA 4AD6A 3CDAA 1V5IB 2C2RA 3UDLA 2I5JB 3N9UC 2VPZB 2FGCA 2XGQA 2P9EA 3BYRA 2AJFE 4E2FB 3MZIA 3RU0A 2W7OA 3BR8A 5L46A 4C0BA 2R7XA 1U1LA 1X5SA 1FFGB 1M5PC 4RWXA 3PO4A 3LH2S 2QLWA 3J80U 3SFUA 1UFWA 2AZ3A 3AODA 3CUNA 4WE1A 3IM9A 4MKBA 3CCES 1TAQA 4ZPAA 2V8PA 3LP2A 1S9GB 2DNNA 3I0RA 2W2OP 2ZBPA 3AA8A 3K0JA 2NXUA 4PG4A 3W65A 3KJVB 3SCJE 4DV0F 2HMIB 3TUJC 2BKPA 2GGPB 4IUFA 3MFIA 1VQKS 4DR6F 2ZVSA 2E5JA 4M63A 5A8KB 2YWKA 1HYSB 3EPIA 4RW9B 5IQQA 1MROA 1B7FA 1MU2B 4X62J 3GYGA 5DGBA 2L41A 2MHEA 4OI3A 1S12A 1A6LA 2ZOMA 3G6YA 1RWXB 5KG7A 3CCZA 5A8WB 1RTDB 3HKZD 4ILMA 4NLRA 4YUDA 2FYXA 2ZBIA 5BYRA 2GVZA
chains in the Genus database with same CATH topology
4HV0A 2HZAA 1U9PA 3VEBA 3GXQA 2K5JA 2WVBA 2FGCA 2BSQE 1BDVA 2GPEA 3BKFA 1ARQA 1X93A 3OD2A 2CAXA 2K6LA 2BJ9A 1EA4A 2WVFA 2JXIA 2JXGA 1QTGA 2WVDA 1NLAA 2KELA 3VEAA 3H87C 1IRQA 2HZVA 1BAZA 1B28A 3QSIA 3LGHA 2BJ7A 3VW4A 2BJ1A 2BNWA 2BJ8A 2CAJA 1BDTA 2JXHA 1B01A 2BNZA 1Q5VA 2CPGA 1PARA 2CADA 2BJ3A 4D8JA 2WVEA 1ARRA 2Y3YA 1MYKA 1P94A 1MNTA 2F1FA 3FMTA 2K1OA 1Q5YA 2PC6A 2WVCA 2CA9A 4FXEA 2NZCA 2K9IA 2BA3A 2RBFA 2AY0A 1MYLA 3FT7A 2K29A 3QOQA 4ME7E 3BKUA 3BKTA 3PHTA 2H1OE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HV0 A;  2HZA A;  1U9P A;  3VEB A;  3GXQ A;  2K5J A;  2WVB A;  2FGC A;  2BSQ E;  1BDV A;  2GPE A;  3BKF A;  1ARQ A;  1X93 A;  3OD2 A;  2CAX A;  2K6L A;  2BJ9 A;  1EA4 A;  2WVF A;  2JXI A;  2JXG A;  1QTG A;  2WVD A;  1NLA A;  2KEL A;  3VEA A;  3H87 C;  1IRQ A;  2HZV A;  1BAZ A;  1B28 A;  3QSI A;  3LGH A;  2BJ7 A;  3VW4 A;  2BJ1 A;  2BNW A;  2BJ8 A;  2CAJ A;  1BDT A;  2JXH A;  1B01 A;  2BNZ A;  1Q5V A;  2CPG A;  1PAR A;  2CAD A;  2BJ3 A;  4D8J A;  2WVE A;  1ARR A;  2Y3Y A;  1MYK A;  1P94 A;  1MNT A;  2F1F A;  3FMT A;  2K1O A;  1Q5Y A;  2PC6 A;  2WVC A;  2CA9 A;  4FXE A;  2NZC A;  2K9I A;  2BA3 A;  2RBF A;  2AY0 A;  1MYL A;  3FT7 A;  2K29 A;  3QOQ A;  4ME7 E;  3BKU A;  3BKT A;  3PHT A;  2H1O E; 
#chains in the Genus database with same CATH topology
 4DPU A;  2OEK A;  3WX4 A;  2B4V A;  2AJ4 A;  3QFW A;  2KHC A;  5D0E A;  3AHP A;  2V0N A;  3BGR A;  1KFD A;  5KOW A;  3M05 A;  1X4G A;  1A7G E;  2W9B B;  4RNH A;  1VQ9 S;  4ENO A;  2X3G A;  2Q79 A;  1YZ7 A;  1HD1 A;  3NS5 A;  3Q0A A;  3TQ1 A;  2MJU A;  1FFS B;  4WF9 Q;  3LWL A;  2KO1 A;  5HMZ A;  4B17 A;  4LFA F;  1X5P A;  3CD0 A;  2ZOF A;  2A6O A;  2ZVI A;  2ZNZ A;  4KHM A;  2YKO A;  3KWM A;  3QAU A;  2BV3 A;  4W90 B;  4Y34 A;  3IP0 A;  4DU7 A;  1IKY A;  1RWV B;  5IM0 A;  2VQE F;  1DQ9 A;  1LW0 A;  5T41 A;  4ZIW A;  2LXF A;  1ZZF A;  1HLW A;  4B9M A;  4P71 A;  5DRK A;  4M5N A;  4PQA A;  2UVV A;  3ZZT A;  1ZA2 B;  2Y1J A;  4USV A;  2CQD A;  1NK0 A;  1KD1 T;  1WG1 A;  5DLG A;  4QPT A;  5DDQ C;  4Y28 C;  4DOZ A;  3PHE A;  1X4B A;  3Q2T C;  1M0S A;  1TKZ A;  3TOQ A;  4HL9 A;  4KYZ A;  3GTY X;  1YGY A;  5E0O A;  3N4W A;  1V3Z A;  2KFY A;  2G2Y A;  4PWD A;  4WZQ A;  3KK1 A;  3N6L A;  2QV6 A;  2XZW A;  2BUN A;  1BAZ A;  3FQL A;  1EAR A;  3KLE A;  4FXW A;  3MD3 A;  1KTQ A;  4YME A;  2HFV A;  2CDQ A;  2I6W A;  1H74 A;  2UU9 J;  1OPI A;  4JV2 A;  2AJ2 A;  4DR3 J;  2W4P A;  2K3K A;  1OWX A;  2LVW A;  4ZVS B;  4ECY A;  5HJY A;  2BX6 A;  3AD7 C;  3OV7 A;  3OTO J;  2AJQ A;  2ERR A;  1T03 B;  2P6S A;  1H2U X;  3THT A;  2YKA A;  5HO4 A;  2E1C A;  2FPH X;  1W26 A;  2CQG A;  3BBC A;  2M0G B;  2FZK B;  3FFI A;  2N7Y A;  4ETX A;  2FJX A;  1KON A;  2BE2 B;  1RAC B;  1HR0 F;  1REV A;  2GV1 A;  2RU3 A;  1WKL A;  4A8F A;  3L7O A;  5F3T A;  4P74 A;  3FC9 A;  4ID5 A;  2V2V A;  1RBO B;  4OYA A;  4EO8 A;  3E01 B;  1N34 J;  4IDK A;  1TFW A;  4DG1 B;  2VFR A;  2K6L A;  1D9F A;  4JYA J;  4Y6I A;  5KFI A;  1PAE X;  2KYZ A;  2E7V A;  4PKD B;  5CH7 B;  3V5R A;  2B51 A;  4OLO A;  2QL5 B;  5B0G A;  3GPA A;  3PG9 A;  3W8P A;  2E9T A;  1VQ4 S;  4C11 A;  1S1V B;  4ZJL A;  3PM9 A;  4DQP A;  1YWX A;  5BXI A;  1L3T A;  1Y5I B;  1SL2 A;  1KQK A;  3GV5 B;  2CQ1 A;  1HNW J;  2X3D A;  4DPT A;  2PSZ A;  4GVB B;  2XNR A;  4LR7 A;  4USK A;  4ZVR B;  1XR6 A;  2CPX A;  1IVZ A;  3FBE A;  5E2Q A;  1HAR A;  3M8Y A;  3N79 A;  2FHO B;  5KFZ A;  2VOD A;  1YG0 A;  1H38 A;  2MZT A;  5L9N A;  2KN4 A;  3FBB A;  2CQP A;  3R7N B;  4X84 A;  2EI5 A;  1VOM A;  3QWU A;  4EWT A;  3NS6 A;  5IWA J;  1G1X A;  1RCX B;  3NEK A;  2VG6 B;  1K0T A;  3RAQ A;  3T1Y F;  1X4D A;  4QW9 A;  3UD3 P;  2P8I A;  4I6A A;  4CZC A;  1RTH B;  4LF2 A;  1GX6 A;  3I0S B;  1VQ7 S;  1OY6 A;  1EP4 A;  3D54 A;  1U7L A;  3QO9 B;  3R1H A;  4DU8 A;  2ALY B;  3FQK A;  4Q7A A;  3TX8 A;  2BJ3 A;  3HVT A;  1TKX A;  3G6E S;  1TV6 A;  4QBU A;  1X5T A;  1FCA A;  4HT7 A;  3MOJ B;  1ZBT A;  5JVH Q;  1JK9 B;  3HHK A;  2BOP A;  3BM7 A;  4U8V A;  2KJW A;  4DV6 F;  3DM2 B;  1DTT A;  1YKW A;  1O6X A;  3FSI A;  3K5N A;  4KHP J;  2AGO A;  4N8O A;  5C2C A;  2W2P P;  2W4C A;  2XSJ B;  1FNX H;  4EYH B;  3RAM A;  2Z2Y B;  3OQ2 A;  3HI9 A;  4B9N A;  4QWA A;  3L9Z A;  1HMV A;  1QSL A;  3GXQ A;  4N8N A;  5KG5 A;  2BSQ E;  5KFP A;  4UUX A;  1GQE A;  2XYP B;  4OQJ A;  3DRS A;  4YR0 A;  1U4B A;  4WXW A;  5I4M A;  4WKY A;  4WYL A;  4CLP A;  1WI6 A;  4WP3 A;  4ELV A;  4NLP A;  4FS2 A;  1AB8 A;  4DZD A;  4DR2 F;  2DHS A;  5K14 A;  3DRY A;  2QLJ B;  1NB2 A;  1WF0 A;  2W2N P;  2CQH A;  2YNF A;  3R97 A;  1YJV A;  3SSQ A;  4L3K A;  3B4D A;  1PAR A;  2QFI A;  3CMA S;  2XI2 A;  2WVE A;  3BS9 A;  5H9E J;  4FNH A;  2MZQ A;  1BLU A;  1F9F A;  3SZ2 A;  3SCK E;  4DL4 A;  2W1B A;  4YP3 A;  2E29 A;  2Z4P A;  1REG X;  2EC2 A;  5B0A A;  4LF7 F;  2JEJ A;  5HLF A;  2LXU A;  4JI0 J;  2K1O A;  3UR0 A;  4TVA B;  2OEL A;  3QYY A;  1WEY A;  2V9K A;  1TL4 A;  1XMQ F;  4B3R J;  4X4T A;  1I5O B;  4CYU B;  3EM1 A;  2F4F A;  2YNH B;  4JUZ A;  2ZE2 B;  3BV8 A;  2AQ4 A;  3M8P B;  2R8I A;  4DV7 J;  1U1R A;  3I5C A;  4USU A;  3JSY A;  1G2E A;  4WFX A;  1NEE A;  4PG8 A;  2HKE A;  2BM1 A;  1KOO A;  3HFK A;  2XBP A;  4WPA A;  3NGU A;  2E44 A;  1CS4 A;  4LF4 F;  1ITP A;  5J2N A;  2JNJ A;  2C22 A;  2BJ1 A;  3Q86 A;  4NI2 A;  3CSK A;  2FJE B;  3MMJ A;  4HAC B;  2CPH A;  1AZS A;  2CIM A;  2AJ1 A;  1RWP B;  3M6V A;  1FKP A;  2UUA J;  4NAS A;  3TUZ C;  3OR2 B;  3IM8 A;  2DNP A;  3DXB A;  3ET6 B;  1KLM A;  1RA6 A;  5J1E B;  6FD1 A;  2VH7 A;  2IA6 A;  2QE5 A;  4WKR A;  4FPI A;  2GHV C;  3MM9 A;  4WWS A;  3UR3 C;  3L7U A;  3PZP A;  3HFZ B;  2YQ0 A;  1FER A;  4PG6 A;  1YTY A;  1BQN B;  4J9R A;  3K89 A;  3KDO A;  1O8B A;  1UJ4 A;  3FCW A;  4FNI A;  1S4E A;  2E1A A;  4ANE A;  4C8K A;  1GAO A;  1RT1 A;  2J9C A;  5KFT A;  2DHA A;  5LMN F;  1CC7 A;  2WOM A;  2IM2 A;  4ZPC A;  3A4T A;  3KG4 A;  1SKS A;  4B3M F;  1X4E A;  5D6G A;  3G8S A;  3WBZ A;  4BLG A;  1IKW A;  2YWF A;  3EXC X;  3W9I A;  4ZN3 A;  1MN7 A;  2UZA A;  3CE8 A;  1TEL A;  2HYI B;  3GJR B;  1QE1 B;  1VQY A;  3BQ0 A;  1DRZ A;  4LF8 J;  2DR5 A;  1HNI A;  3MUV P;  2CNO B;  4WFB Q;  3M9M B;  4JI2 F;  3PFE A;  3E3X A;  2WCX A;  1IBM J;  3HXM A;  2LYV A;  2BRK A;  1HIY A;  1IR2 A;  3OL9 A;  1S1T B;  3UVJ A;  4YB1 P;  1F5C A;  1QJH A;  3ZNU A;  4LFC J;  1RTJ B;  1RWK B;  2GNK A;  1WC5 A;  3EE3 A;  3TI0 A;  4QR2 A;  3MD1 A;  3GIK A;  3J81 j;  3RBE A;  1HW8 A;  1RWU A;  3SBM A;  4LIW A;  3M1V A;  3LGN A;  2ZD1 A;  4ED6 A;  2EC0 A;  2D3U A;  3U02 A;  1T9Y A;  3BB5 A;  1FRK A;  2XS2 A;  3J7Z 5;  2XZT B;  1H2T Z;  3Q89 A;  4CH7 A;  3ITH A;  3IFE A;  4ZIV A;  1AA1 B;  5BYS A;  5KT5 A;  1XTZ A;  4GC6 A;  4MKA A;  4YB7 A;  1XBW A;  4WE1 B;  4NYO A;  5GAG I;  4WFA Q;  5AT1 B;  3UDC A;  3LP2 B;  2DNQ A;  2NZ4 A;  1HNV A;  4RWW A;  3I0R B;  1AUS L;  2V2Q A;  2IRY A;  4ZP8 A;  3JSB A;  4B9U A;  1RJJ A;  2XMV A;  3GLJ A;  4F4A A;  3EZ5 A;  2LA4 A;  2QC3 A;  4OYM A;  3KG0 A;  2PFD A;  4NZ7 A;  2EFO A;  3QAT A;  2XY5 A;  2KKH A;  2WBR A;  2OPS A;  1LWX A;  1MRO B;  2IYI A;  1RYS A;  3TZW A;  5ETT A;  2BAC A;  2L9W A;  3SYZ A;  2Z2L A;  2V69 A;  4J37 A;  2B56 A;  4ED4 A;  2QL7 B;  2GVZ B;  5AXM A;  1FDB A;  1HNX F;  4C0H A;  1EQ0 A;  2KH9 A;  4KTQ A;  3BGR B;  1SKW A;  3V2U C;  3KJQ B;  4OYO A;  2L3M A;  1P1L A;  2FHM A;  2ZH5 A;  2K5J A;  3C8Y A;  1JIH A;  1SXL A;  2N4C A;  2E9Z A;  3HT0 A;  1CEZ A;  1TUV A;  4NRT A;  2CDR B;  2DXE A;  1FJG J;  1V3R A;  3N6M A;  1FJE B;  4B3T J;  4J90 A;  2HQD A;  2B6A A;  4JI7 F;  1XMO F;  1V3S A;  2BJ8 A;  4OL8 A;  3SDE A;  2ASY A;  3M9N B;  2ZZN A;  1YBU A;  2DY9 A;  4NLO A;  1B64 A;  1FRM A;  2ILY A;  3DNC A;  3IRX A;  3RR7 A;  3MDF A;  4DN9 A;  1IKY B;  2BJD A;  3KKF A;  1LW0 B;  1Q95 G;  4DCJ B;  4EU0 A;  3NGS A;  3MCS A;  4TY9 A;  5F3Z A;  1UPP A;  2HRU A;  1OSC A;  2ZZT A;  3PRB A;  3PJ9 A;  4NLW A;  3ZC4 A;  1KHV A;  1C1C A;  4QWB A;  4TLQ A;  3OTE A;  1GEH A;  1RBL A;  5LL6 d;  3EVO A;  1TKZ B;  4A48 A;  4DUZ J;  1R6V A;  1NSP A;  2IDL A;  3R9L A;  1UEV A;  1UL3 A;  3R5A A;  2MPU A;  3VQT A;  3UNY A;  5H9E K;  1LEO A;  1FKA F;  5LMU J;  1HA1 A;  1XNQ J;  4KE5 A;  4U7U D;  2W9C A;  2PII A;  1QAY A;  2DIT A;  4NEY A;  2Q6B A;  4PWD B;  3KK1 B;  4FVM A;  3TA0 A;  5KFA A;  5L38 A;  2IM1 A;  2DPJ A;  3PIP Q;  3T5J A;  1PIE A;  3FSX A;  2BM0 A;  2KVI A;  4NLX A;  1CJV A;  3KLE B;  4IKA A;  4DX5 A;  4X4U A;  3UPF A;  1RAA B;  1RAF B;  2QRR A;  4NOH A;  5M2R A;  4IRD A;  1Q8L A;  2CPF A;  2JXH A;  3W5Y A;  1HBN A;  1YJ9 S;  2NS1 B;  3M4X A;  3IXQ A;  4J9P A;  2VAS A;  1YRU A;  2CYY A;  4ZLN A;  1JLA A;  4IR9 A;  4USM A;  3JXO A;  3IR5 B;  4PUO A;  2KZZ A;  4LFB F;  4EBC A;  3HCX A;  2V6A A;  3IO1 A;  1HBO A;  1NJY A;  3FFI B;  4F2R A;  4XAK A;  2I9S A;  2M5Y A;  3BO4 A;  1F9H A;  1REV B;  1SB6 A;  4NEZ A;  2ACM A;  5IT9 Y;  5B0E A;  4ID5 B;  2R7Q A;  3HVA A;  4CI0 B;  1K73 T;  4IDK B;  2VIC A;  1MG7 A;  3SMZ A;  1GT8 A;  1VBX A;  2HVE A;  2BYC A;  2A3J A;  5A2Q Y;  4J9M A;  3G96 A;  2HHH F;  1XJW B;  1UMJ A;  5ETV A;  2H9Z A;  1EB0 A;  2O66 A;  2YTC A;  4C11 B;  2VHG A;  1NK8 A;  3HVR A;  2PT0 A;  2YKP A;  2G0J A;  3D1Q A;  2XYG B;  4ITS A;  5HAT A;  3UD4 P;  5LXY A;  4DI6 A;  1R8P A;  1B99 A;  2JL9 A;  3N6N A;  4MK8 A;  3QGH A;  2DR7 A;  4RW8 A;  3R27 A;  4JI8 J;  3EMT A;  2J76 E;  3JTN A;  4ZJO A;  4MT1 A;  1UVK A;  5IT4 A;  1HW9 A;  4TYB A;  1JLG A;  2XCA A;  4RLE A;  2AEF A;  1UW9 A;  2BQR A;  2G13 A;  2HS3 A;  3UCU P;  3DOK A;  3CF5 Q;  1FXD A;  4M1K A;  4Y2C A;  3BDP A;  1VJW A;  2R7W A;  3QOQ A;  1JJC B;  3VF0 B;  4GC7 A;  1VQO S;  3BKT A;  3DDK A;  4ZPV R;  2WB1 D;  5I3P A;  3NP5 A;  3LOU A;  2XC9 A;  1UFK A;  5KFS A;  1J5O A;  3AQP A;  2KU7 A;  5EGY A;  2IHR 1;  2OO4 A;  3IMQ J;  1TR0 A;  5L9X A;  2IRX A;  2WSE C;  3C3L A;  1SH3 A;  3J80 Y;  1EP4 B;  2XI3 A;  1VK3 A;  2ZHB A;  1P9Q C;  3Q2S C;  3LAL A;  3F56 A;  4ZP6 A;  4XTT A;  5GAE I;  1ZAX A;  1TK8 A;  2W24 A;  4EZ6 A;  1AFI A;  1FRH A;  4I7F A;  3R5G A;  3HVT B;  1TQL A;  1TKX B;  1TV6 B;  2GIR A;  1VBY A;  4RW7 A;  3IWX A;  3T1H J;  2DGV A;  2N7C A;  2B4P A;  1UKU A;  3HUL A;  4J91 A;  3EPG A;  1BXN A;  4OYB A;  2NXN A;  2ZH2 A;  3S1T A;  9RUB A;  4YQW A;  1DTT B;  4F36 A;  3MMA A;  3CTR A;  3ILJ A;  4J9S A;  3ZTS A;  1L3U A;  1ACM B;  2DT9 A;  2OPP A;  1AT1 B;  3U7J A;  2K9I A;  1N0V C;  4BS2 A;  1WC6 A;  1HMV B;  1M1K T;  5E3R A;  2VOO A;  4DQQ A;  5KT2 A;  4LQ9 A;  1M5H A;  4ILL A;  5T7L A;  5KT4 A;  3OVA A;  1FVS A;  4IH5 A;  1VQ8 S;  3AQO A;  3DRS B;  2COL A;  2MLX A;  3DGP A;  1YIJ S;  1TL7 A;  3TNV A;  1ZAV A;  4DR6 J;  4RW6 A;  3EJM A;  4GKK F;  2RJZ A;  2ILZ A;  4TKT A;  3WHI A;  4LRD A;  5K14 B;  2R7O A;  4OHW A;  2YNF B;  4WJB A;  3U1L A;  2HWI A;  2MQL A;  3Q24 A;  1NJZ A;  3GCX P;  1AW0 A;  4YR2 A;  2QYC A;  4ELU A;  4QU6 A;  5HJX A;  3VR1 A;  4KKO A;  3TUP A;  2JC1 A;  5K8M A;  1S6Q A;  3RG6 A;  3FEZ A;  2GS8 A;  1NZA A;  1EIY B;  1R31 A;  2EVZ A;  2MLZ A;  2LU1 A;  5SZT A;  2OP5 A;  2C2E A;  5HLF B;  3CXC R;  2BE7 D;  2X7I A;  4V1A k;  3ENA A;  5CZV A;  4XO0 A;  4NRU A;  4QR1 A;  3CCS S;  1VC0 A;  3MCO A;  4X4P A;  2MKS A;  4Z37 A;  3PYE A;  4K7Q A;  1L3S A;  2VB6 A;  4LFA J;  3OJU A;  1TL1 A;  2UVU A;  3PX6 A;  2HQC A;  4ZMM A;  2V67 A;  3WZ0 A;  2C2M B;  1RSC A;  4TLR A;  4QWD A;  2JLG A;  5J2N B;  4MJK A;  4JI4 F;  5EWE A;  2VQE J;  2GQQ A;  5CXT A;  4NI2 B;  4I1T A;  5LJ3 Y;  1RAO A;  1IRQ A;  3DLL Q;  1AZS B;  3EXY A;  1NPR A;  2F5G A;  1G7C B;  1FKP B;  4XDD A;  2EFQ A;  4NLQ A;  2YH0 A;  1RDR A;  1LWF A;  1NLK L;  5B0F A;  3PDN A;  4C6A A;  1KLM B;  1V6H A;  3GFH A;  1ZH5 A;  3NAH A;  4GRS A;  1YBT A;  2BOA A;  1MLA A;  3IRW P;  2OKQ A;  3MM9 B;  4A47 A;  2M8H A;  4FP9 A;  3A8K A;  3SV4 A;  3I4P A;  1IM6 A;  3AOC A;  3GV7 B;  3CDE A;  4C8O A;  1QSS A;  2PC6 A;  3D6T B;  4RU9 A;  2HHU A;  2OTL S;  2FDN A;  1RT1 B;  1DY3 A;  3PJX A;  2DNK A;  3KUH A;  2Q66 A;  2WOM B;  2F4V F;  4X62 F;  2CWK A;  3C14 A;  1GH8 A;  3BGL A;  3N01 A;  5AXL A;  5D8H B;  4EBD A;  4JP8 A;  4IOA Q;  1IN0 A;  4V19 X;  1IKW B;  2ZBC A;  1TUW A;  4C97 A;  2ZJQ Q;  2XO6 A;  2DYA A;  2XNQ A;  5U47 A;  2V50 A;  1SH0 A;  5AE1 A;  3TQE A;  1HWJ A;  1S59 A;  1WF1 A;  1HNI B;  3A3P B;  3HF5 A;  1VC5 A;  2ZHO A;  5KFW A;  5HVH A;  1FE0 A;  3F0N A;  1XN9 A;  5ETL A;  3OXL A;  3UVJ B;  1URN A;  3OR1 A;  1PCA A;  3CC4 S;  3MM6 A;  4B3O A;  3KXD A;  2KJV A;  4UT4 A;  1BQM A;  1V5V A;  3M1V B;  4YB5 A;  3AJ2 A;  1RT4 A;  1UZH A;  2ZD1 B;  4LRF A;  2X1B A;  4Q2L A;  3LGM A;  1JXV A;  2H3E B;  1VHI A;  4FYX B;  2DNO A;  5E3P A;  1U0H A;  4LRA A;  2OD6 A;  4O0I A;  1VK8 A;  3ITH B;  5KFC A;  3MOZ A;  3KK2 A;  2ZIT A;  5A8R A;  2AX0 A;  4ANC A;  4OYW A;  1PG5 B;  1T9W A;  2EK6 A;  4RX6 A;  5I3U A;  1LWE B;  1HNV B;  3I55 S;  2FVQ A;  5KAK A;  5CYQ A;  5KG6 A;  5JMN A;  1U48 A;  4USI A;  4LF5 J;  2JZ5 A;  2RML A;  1B0T A;  1WD6 A;  1EQM A;  3J81 U;  2D41 A;  2H65 B;  4BC9 A;  2CQC A;  2DKO B;  3W64 A;  3VGV A;  2OPS B;  1NKE A;  2F8E X;  2OML A;  2EFG A;  3CB4 A;  4MIB A;  4RKU C;  4GO7 X;  1HI0 P;  4HT5 A;  4HTJ A;  2ROG A;  4DL2 A;  1GMW A;  3MAA A;  4NMX A;  3T1Y J;  4ES1 A;  1J5E F;  2Y1R I;  4DMZ A;  5ETM A;  2BEF A;  4F8R A;  2RD5 C;  4QOT A;  4DS4 A;  2MQP A;  1RT6 A;  1UEU A;  1VJQ A;  3CMQ A;  3T6B A;  3CC2 S;  2HZA A;  2GHW A;  4C2M A;  1NPK A;  4WU2 A;  5KFB A;  1NDC A;  3ILL A;  1YK9 A;  3R5D A;  3CJ2 A;  3QMQ A;  1EKS A;  3PXG a;  2B6A B;  2FY1 A;  3LAN A;  4DV6 J;  3ZZR A;  3VAI A;  3SDE B;  5BJR A;  5E41 A;  2GJI A;  3BN4 A;  1EHW A;  3IRX B;  2YKQ A;  2XQC A;  2F8H A;  3UN3 A;  1GTH A;  3VVT A;  5EHH A;  3W5Z A;  1X4A A;  4EO6 A;  2APO A;  1UET A;  2YPY A;  3KNG A;  1KQS R;  1FJC A;  1C1C B;  1Q82 T;  1GXT A;  4DV1 F;  2R7S A;  1X4H A;  1JKH A;  1OMS A;  1QD1 A;  5IC4 B;  4L6V 3;  3ZZP A;  2LEP A;  4YDX A;  3SSS A;  3TAP A;  3I9V 9;  1E6V A;  5GMK a;  4ECU A;  4Q43 A;  4CO4 A;  4DR2 J;  2W9C B;  2VFV A;  4L3N A;  1LFP A;  3HHL C;  2QIF A;  1FT8 A;  3SSR A;  3Q8Q B;  2AJ0 A;  1KRP A;  4USW A;  3UDE A;  1WDT A;  2EFN A;  1FK9 A;  4KJI A;  1NK9 A;  1D1U A;  1S7I A;  3FMB A;  1CJV B;  2KXN B;  3KLG A;  3D1O A;  4AT1 B;  2VG5 A;  2RQ4 A;  4LF7 J;  3MED A;  5F8I A;  1HBN B;  4P72 A;  2FY8 A;  4E98 A;  2VJU A;  5KFD A;  3BF4 A;  3PYF A;  3OL6 A;  1JLA B;  3DLB A;  1XMQ J;  3FKB A;  2R3V A;  4PUO B;  2KRB A;  2IBO A;  1LW2 A;  4B9L A;  1FTR A;  4PYA A;  5DZ6 A;  2XY6 A;  3D4J A;  2D3Z A;  4CNZ A;  1HBO B;  5LJ5 Y;  5B7W A;  4ZPT R;  4PG5 A;  3FRZ A;  3THP A;  4Y2M A;  2AW0 A;  2RKI A;  2H1Y A;  4NLV A;  2EG2 A;  3TUI C;  1HWK A;  1NKB A;  2VG7 A;  4YDD B;  4PPZ A;  3OFE A;  4LF4 J;  1U49 A;  2FC8 A;  1H0H B;  2ZDP A;  2XGP A;  4DL7 A;  2OI2 A;  2NCK L;  1RUS A;  2QLB B;  4X4O A;  3TJ8 A;  3OFG A;  2J0X A;  1KVK A;  4LQ3 A;  2RRN A;  4QIG A;  1AXQ A;  3I6P A;  4FYV B;  4OZ2 A;  3POT A;  3PTW A;  4F4W A;  4K0K F;  1BD6 A;  2VC0 A;  2RAQ A;  4WTY A;  4IFY A;  4G1Q A;  1M5V C;  3ZZ0 A;  3PRD A;  1YVF A;  2I38 A;  4W4M A;  1X8D A;  3D28 A;  2VPW B;  3H87 C;  1I6J A;  3J7Y U;  4CLL A;  1I3O B;  1FXR A;  1VCT A;  1ZTT A;  2JBV A;  1BDT A;  1ZTW A;  4RW8 B;  2CPD A;  4LRC A;  2V8V A;  2G2Z A;  1SQE A;  4CLU A;  4ECV A;  3MUR P;  5HN0 A;  1SQF A;  3DRP A;  1SCJ B;  5KG2 A;  4TNO A;  4PAA A;  3LPE A;  1JLG B;  3ETO A;  2LFV A;  1AFJ A;  1APS A;  5A76 A;  5LMN J;  3W62 A;  3SFG A;  2ZWO A;  3DOK B;  2XHC A;  1WOS A;  4EFA C;  1RU1 A;  4B3M J;  1F60 B;  4YB6 A;  5CAA A;  3S6E A;  3L09 A;  2AWZ A;  4NX9 A;  4ECR A;  1GNK A;  4JI6 J;  3GSD A;  4NE9 C;  3W66 A;  1J5O B;  3R2C J;  3GJS B;  4ZVU B;  3NO7 A;  4ZPD A;  3M32 A;  5F9N A;  4JI2 J;  3MM7 A;  3A12 A;  1YI2 S;  1RQ0 A;  2POK A;  3I4H X;  1FEH A;  3RUB L;  3IAS 9;  4I7F B;  4R25 A;  4RW7 B;  4HHU A;  4F4K A;  4I0W A;  2ZKU A;  1D9D A;  2Q6C A;  2KB2 A;  3CJ0 A;  3V6D A;  5EWG A;  1ZOT A;  4P2X A;  4RUH A;  5HQL A;  2CJB A;  5F0W A;  3LTO A;  3VGS A;  5C2G A;  1BC6 A;  3R5J B;  3MMA B;  4DV2 F;  5B09 A;  1KP6 A;  5F8L A;  2WK4 A;  2LQ9 A;  4FF2 A;  5GME A;  1SIZ A;  3BEG B;  3DXS X;  4A8S A;  1WDD A;  2DCL A;  1RT5 A;  5LXR A;  2Z2Z A;  1SC4 B;  2VIH A;  2OPP B;  4WP9 A;  5KG0 A;  1PYT A;  3LF0 A;  4AXJ A;  1O5J A;  4DSK A;  3W60 A;  2R9L A;  3I87 A;  1X0P A;  1S4F A;  1VR6 A;  5T7L B;  1MYL A;  2DNL A;  5J2M A;  4M94 A;  4UOH A;  1VMB A;  1U9P A;  3DGP B;  1TL7 B;  3KTQ A;  4RW6 B;  2AYM A;  4ED1 A;  4LUB A;  2QT7 A;  1S0N A;  5EX3 A;  1KC8 T;  4NA3 A;  1FD2 A;  3LW5 C;  4FPR A;  3RRK A;  4ECX A;  2W9A A;  1WKJ A;  3VAJ A;  2MZ1 A;  1RWO B;  2RF2 A;  2M70 A;  2OIH A;  3DI6 A;  5J2P A;  2XS5 A;  4CWB A;  3VCD A;  2CPI A;  5L1J A;  2P9G A;  2V4R A;  4KKO B;  1S6Q B;  1HNX J;  1Y4Z B;  2DK2 A;  2W01 A;  1QUP A;  3OVS A;  3K2Y A;  4DV5 F;  3SEO A;  3VAF A;  1YQH A;  4PWW A;  4DFJ A;  3PKM A;  2K8G A;  3BGF A;  3OJS A;  5B0D A;  3VAH A;  1N54 B;  2R42 A;  1PO6 A;  1N5V A;  5KFJ A;  3R3T A;  3EGN A;  4JI7 J;  1XMO J;  4F0K A;  1Q5Y A;  1ZM9 A;  4I2P A;  3HHL D;  1TL1 B;  4FF3 A;  1NJI T;  2YX4 A;  4LFC F;  4DPY A;  4ED2 A;  2UUC F;  1RKI A;  1TMM A;  4HDH A;  2M52 A;  1UTA A;  3UI3 A;  3QFH A;  1N5Q A;  2HHW A;  4KH1 B;  2DO4 A;  2HNZ A;  2PI5 A;  2HSE B;  2MQQ A;  2PA8 D;  4U96 A;  1GMW D;  4KR0 B;  2ZJP Q;  5L1K A;  4JV5 F;  1LWF B;  1Q78 A;  3IR6 B;  1YHQ S;  2IAJ A;  1RP5 A;  1NO8 A;  1QAX A;  4KSE B;  3QJP A;  2CZV C;  1NB7 A;  2H4Y B;  1U2R A;  1SC1 B;  2M2B A;  3GYX B;  3ZFV A;  3C15 A;  2YQ3 A;  4U7C A;  1X9S A;  3DRX A;  2KZM A;  2B9Y A;  2BAN A;  3I82 A;  4UY8 T;  2JSX A;  3LJP A;  2B0G A;  3ICL A;  1W2B R;  2FHJ A;  4TQS A;  5DJB A;  1JB0 C;  3C14 B;  2B8P A;  4LF6 F;  1MMN A;  2KT2 A;  3IGV A;  1KHW A;  2D9O A;  1KOH A;  4O4R A;  5KG3 A;  2IVM A;  2DGS A;  1S9E A;  3Q8V A;  3CPW R;  5LM7 E;  2VKR A;  4LFB J;  5ETN A;  2V94 A;  4DSJ A;  4R0E A;  4WU3 A;  1JJ4 A;  7FD1 A;  2I8E A;  3CJQ A;  1QTG A;  1SC6 A;  3ILO A;  2HPU A;  2HQF A;  3FZB A;  1B3T A;  4MK7 A;  3VW4 A;  2YWW A;  3K59 A;  3BQ1 A;  1UEK A;  3H7H B;  2V5H G;  2R7V A;  3DOL A;  3MPU B;  4I4B A;  3Q8U A;  3OR1 B;  3CCV S;  1BWV A;  1U02 A;  3MM6 B;  4B3O B;  4O3O A;  5F8J A;  1ZA1 B;  2CPE A;  2HLT A;  5MLC V;  1F9E B;  3NKY A;  1BQM B;  4R5P A;  2E5L F;  2GW8 A;  3HT3 A;  1RT4 B;  2HHH J;  2VON A;  3B6B A;  3HO1 A;  5C7P A;  3K7R A;  1L3K A;  3A8J A;  1U0H B;  5I42 A;  4FKY A;  2R2R A;  3UN5 A;  1S77 D;  3KK2 B;  4OI4 A;  3QJL A;  5A8R B;  2IVY A;  5EN1 A;  1C4A A;  4HH0 A;  4KV8 A;  2JJ4 D;  1IUJ A;  3O6Q A;  5I3U B;  2CPZ A;  1VQM S;  3R5C A;  5CYQ B;  3A3O B;  4ZVP B;  1U25 A;  2ZC4 A;  1Y11 A;  1ULR A;  1SJQ A;  2XLJ A;  2F65 A;  3GJT B;  5LMU F;  1XNQ F;  2HFS A;  2KEL A;  1SVD A;  1RHM B;  3NGR A;  3BGO P;  2Y9H A;  4ECW A;  2FZC B;  5DQH A;  2OGU A;  4DX8 H;  4ED3 A;  4KIA A;  1CJU A;  4AND A;  5GAD U;  3DU6 A;  4YN3 B;  3NCQ A;  2HAI A;  3OL7 A;  3MAA B;  1ARR A;  4B3S F;  1DLO A;  2X1F A;  3L4B C;  4DFP A;  2DIV A;  5AXN A;  1RT6 B;  4JI5 J;  2OPQ A;  3QSY B;  4OI0 A;  1MWZ A;  4HYK A;  4MYT A;  3HDS A;  2FVS A;  2KL8 A;  5CCL A;  4ZN1 A;  4FXV A;  3MR2 A;  3KHL A;  4IQX A;  2MZR A;  3LA0 A;  4NA2 A;  5AE2 A;  2CNN B;  3EGV A;  1TKT A;  4J9N A;  3AFG A;  3IWN C;  1XNR F;  2C2K B;  3U1M A;  5KT3 A;  1S10 A;  4OYX A;  2DEI A;  2ZH6 A;  4J9V A;  5KFV A;  1LV5 A;  2A10 A;  1FEE A;  1N0U A;  3TVK A;  3M8Q A;  1JKH B;  3ENW A;  3M6U A;  2NR0 A;  5DQG A;  4GKK J;  1E6V B;  3CD5 A;  5C42 A;  4K5R A;  1S6U A;  2CQ0 A;  3NOG A;  3FT7 A;  3MUT P;  3DLG A;  2AEJ A;  1FK9 B;  4Q5V A;  4A8W A;  1Z4U A;  3RBZ A;  4OZL A;  1SIW A;  3PW2 A;  2LQJ A;  1ZYQ A;  1RAD B;  4ZHR A;  3LWM A;  4X65 F;  3KLG B;  4B9T A;  1H98 A;  1RKJ A;  3C46 A;  2VG5 B;  1F2H A;  1RHQ B;  3MED B;  2IDE A;  2MKC A;  3FEX B;  3ISN C;  2CJ9 A;  3PW5 A;  4KH0 B;  2VZ9 A;  4F02 A;  5K9F A;  3CJ5 A;  1SL1 A;  1BGX T;  3QJJ A;  1LW2 B;  3PKY A;  2ZM6 J;  4KT0 C;  5HL7 Q;  5T14 A;  2I1R A;  3W9H A;  4JI3 F;  5HSP A;  1U24 A;  4MMO A;  1WTB A;  2CPG A;  4ER8 A;  2RKI B;  2BAB A;  3NGK A;  5IZH A;  2EFP A;  1GMV A;  3G5O A;  4RPF A;  2VG7 B;  4DCO B;  1D8Z A;  4OV1 A;  1KDN A;  4HTI A;  2QMW A;  3T1H F;  2IM0 A;  1XIQ A;  2LEC A;  3GCW P;  2OAU A;  4WCE Q;  3P3D A;  2ZHA A;  1R8C A;  4Q44 A;  2N4D A;  2X1G A;  4I64 A;  2GMJ A;  1WC4 A;  3DGV A;  2VKZ G;  2JWN A;  3CCM S;  3POT B;  2LXI A;  1IR0 A;  1TU0 B;  1KVJ A;  3TJ9 A;  4IFY B;  1KS2 A;  4N5S A;  4G1Q B;  3NNC A;  2AX1 A;  2N82 B;  3RRG A;  1VLY A;  1Q81 T;  3HK2 A;  3KUE A;  4TU9 A;  1X93 A;  5D78 A;  5IOL A;  1GK8 A;  4K4X A;  1OSD A;  4L72 B;  4AL5 A;  4ZVF A;  3QRQ A;  3LUY A;  2Y8Y A;  2ATC B;  2U1A A;  2WRM A;  3DRP B;  1M5S A;  2OD4 A;  4UQG A;  4R8U A;  4PRF A;  3CJR A;  2AKW B;  1U8W A;  1WSR A;  2FZG B;  1X4C A;  2RQC A;  2E7W A;  2C3O A;  2F4V J;  3I5B A;  4YEA A;  4C4W A;  2FQQ B;  2DH8 A;  2UUB F;  2ZZM A;  1KNZ A;  1RZM A;  4NCA A;  2ASD A;  2EFV A;  2HBR B;  4HKQ A;  2HNY A;  2MJN A;  2HRY A;  1OQ3 A;  1P94 A;  4CLK A;  3NNA A;  1MW7 A;  3TR5 A;  3W2W A;  1N48 A;  2XUL A;  4TQR A;  3CO0 P;  3RBD A;  4HHJ A;  4KFB A;  3JS9 A;  3S01 A;  3M32 B;  2RIJ A;  2V4J A;  3MM7 B;  3GB0 A;  2GQC A;  4O3R A;  1VI7 A;  5LOQ A;  2L48 A;  4ED5 A;  1RAB B;  3IGN A;  4RNF A;  2HVH A;  4K4T A;  2IVF B;  4ZLL A;  4HDG A;  3O2I A;  4CO2 A;  1VLO A;  3KLH A;  3W2V A;  2HIQ A;  2VQF F;  4HVZ A;  4TY8 A;  1RE1 B;  3MEG A;  3WX8 A;  5FDL A;  2PD1 A;  2FHJ D;  4NPO A;  3RBX A;  2HGN A;  3V6D B;  2J6T A;  2VFS A;  3NCR A;  1YJN S;  1RYR A;  1RT3 A;  4NXN F;  1UA0 A;  2XO7 A;  3GII A;  2LCW A;  1RHK B;  4JBC A;  4A8Y A;  2MQO A;  3PJW A;  1LFW A;  2RS2 A;  2J8A A;  2BRL A;  1OO0 B;  2HS0 A;  4PXD A;  1RT5 B;  2I2Y A;  2HGL A;  3A3N B;  2MKK A;  2HBZ B;  4ED7 A;  2YNI A;  3EDQ B;  3GMG A;  4C8M A;  3BQ2 A;  1NDP A;  2EWH A;  1WUU A;  2SXL A;  1W7W A;  3RZA A;  1I94 F;  3TYT A;  1GX5 A;  1ZS6 A;  2PMW A;  5J2M B;  5HI7 A;  4PAB A;  2G9O A;  4FBU A;  5HMW A;  4E8U A;  2CPJ A;  3MR6 A;  3H2L A;  2QSF A;  4AXI A;  4RR5 A;  2DNM A;  3BH6 B;  2AGQ A;  4LRV A;  4UF4 A;  2BQU A;  2H48 B;  1S97 A;  2RF2 B;  1OY8 A;  5A0Y A;  4U9R A;  2QG9 B;  3DI6 B;  5J2P B;  1RBA A;  1S1W A;  4JV1 A;  1R6Y A;  3L3C A;  4KRW A;  3OSP A;  1J5E J;  3WQP A;  2XMW A;  4PXE A;  2HZV A;  5KFQ A;  3K5M A;  1TKD A;  3CVK A;  4C3K A;  3CED A;  2FJW A;  2KM8 C;  1VQN S;  2C2Z B;  1DHM A;  3D3B J;  2IFX A;  3O5T B;  1AUD A;  1IKV A;  1UFL A;  3JQJ A;  3H4B A;  3ZTR A;  4ZOS A;  2HUR A;  4MFB A;  1U09 A;  2I0X A;  1UVI A;  3MAQ A;  2NUU G;  2OJ3 A;  2OTJ S;  1FVQ A;  2ZC3 A;  1Z2Z A;  3W3S A;  4OI1 A;  2QA4 G;  1FWL A;  4FF1 A;  3HSD A;  3CDB A;  4I2P B;  1WJ9 A;  3H5X A;  3OL8 A;  2F1F A;  4N47 A;  5C25 A;  4NYZ A;  2GA7 A;  3HHN B;  3MCN A;  2BE9 B;  1PC4 A;  3DN9 A;  3G6X A;  3VGT A;  2WON A;  5GAH U;  4B9V A;  1CBK A;  1HD0 A;  3RB6 A;  1CUL A;  2D3O 1;  2RHS B;  2HNZ B;  2FGO A;  2XMM A;  3ZNJ 1;  3OD2 A;  3ISN D;  3HHE A;  1H3D A;  4QQB A;  3EZU A;  4DV1 J;  4K4S A;  1WAC A;  3GG1 A;  4DSE A;  2IAJ B;  2AMC B;  2VPX B;  4UZB A;  3PW7 A;  2BNW A;  2R2S A;  2IJR A;  3HMJ G;  2DBB A;  4Y3C A;  2XHW A;  3P4U B;  3P45 B;  2JH3 A;  5CYM A;  2VA2 A;  1NRK A;  3C15 B;  2W8K A;  4LF5 F;  1S99 A;  4CIO A;  4IO9 Q;  2BAN B;  1Z2L A;  3Q83 A;  3UWT A;  2JEF A;  4YS2 A;  3DHW C;  1P9Y A;  4DQS A;  3SV3 A;  3D6H B;  1AYE A;  5KFF A;  4AAI A;  4RJV A;  2VU5 A;  4KAI A;  2CG8 A;  1N36 F;  2P5V A;  1IBL F;  4NYP A;  1ZPW X;  3MM5 A;  3EVW A;  1R8A A;  3CJT A;  2D9P A;  1LKZ A;  2FIU A;  2YY3 A;  4PEO A;  4OIX A;  2ZDO A;  3UD5 A;  1S9E B;  2NXE A;  1VBZ A;  2WSC C;  2RHQ B;  5CHC B;  2A2D A;  1S0M A;  1F2G A;  4GMK A;  1ARQ A;  4FDF A;  3HP6 A;  4M5K A;  3PX4 A;  2JXI A;  2JXG A;  2CJA A;  1K44 A;  3DOL B;  3FDS A;  4XPC A;  3PVX A;  4DSF A;  1U1Q A;  5HP1 B;  4IFV A;  2BA9 A;  4F04 B;  3QGG A;  2DHH A;  4CT8 A;  3G71 S;  3TAR A;  2AHO B;  4I67 A;  3H40 A;  1E6Y A;  4R5P B;  2XWX A;  4S0M A;  1P27 B;  4HEA 9;  4LSN A;  4K0K J;  1L3V A;  4EK2 A;  2OSQ A;  3T6J A;  1FWK A;  5I42 B;  2UV8 G;  3GSI A;  3K58 A;  2GAG C;  5ETQ A;  3QIP A;  4KV8 B;  4OV6 A;  4M5G A;  3Q8R B;  1JLE A;  3R6L B;  4F3Q A;  5JJB A;  2M8D B;  1JJ2 R;  3P49 B;  3ULH A;  4DEZ A;  1S1X A;  5D4O A;  2FLL A;  3GE9 A;  2G1H A;  3V4I A;  3QLH A;  2E9R X;  3JTO A;  3T1A A;  4LSZ B;  2GX8 A;  4U67 Q;  3R5B A;  1B4S A;  4BWM A;  1KVI A;  4DR4 F;  1WTF A;  4BHQ A;  1CJU B;  4NXM F;  2XMJ A;  1S49 A;  4G3I A;  3TZY A;  2E5G A;  3V4M A;  2RVJ A;  4OYP A;  1JLB A;  4M5L A;  1DLO B;  3GIR A;  1HHS A;  3W7B A;  2JLF A;  1RLC L;  2OPQ B;  4BBY A;  2W2Q P;  2JVR A;  2VFT A;  3M8R A;  4RU2 A;  4USH A;  3NL0 A;  1U6F A;  3UCG A;  3T5K A;  3ZZU A;  5F0U A;  4IOB A;  2V8D A;  1GTE A;  1T0T V;  5KFN A;  4C8Y A;  1XR5 A;  3T9Z A;  1TKT B;  5L8R C;  3Q8P B;  2P9C A;  4UOF A;  4OZ1 A;  1FTC A;  3NBP A;  4DV2 J;  3I56 S;  3M30 A;  4Y2K A;  5AE3 A;  3N0V A;  2O67 A;  4BDP A;  1PJ5 A;  4PQU A;  1S9F A;  2XG8 A;  1VYA A;  1RTZ A;  2KG0 A;  2R2T A;  4PCQ A;  2M3D A;  4F26 A;  2YWH A;  5CQG A;  2KVQ E;  5KFX A;  4ZCK A;  4A8Q A;  4TN2 A;  2NPI A;  3M8Q B;  4RNN A;  2GHP A;  1H72 C;  1WEZ A;  3F44 A;  2QGF B;  1R27 B;  5KT6 A;  1WC3 A;  1DBD A;  5C42 B;  2UV8 A;  3GWC A;  3CDU A;  1MNT A;  2VA3 A;  4WFY A;  3LP0 A;  1C4C A;  4GVL A;  4ID8 A;  1ZET A;  3R7B B;  1ZPV A;  3DC2 A;  1PGZ A;  3NAI A;  3HX9 A;  4EEY A;  3DLG B;  2NYH A;  3K5P A;  4HI1 A;  1Q79 A;  2IYG A;  1SIW B;  4ZHR B;  4DPW A;  2YQ1 A;  1R3N A;  2QL9 B;  1CQM A;  1NJW A;  2ADC A;  4OJG A;  5BYQ A;  4DV5 J;  5HRO A;  4YY3 F;  4ZS6 A;  2XY7 A;  2JEI A;  4JI6 F;  5FLX Y;  4DZ6 A;  2M4M A;  4P73 A;  2DTJ A;  3H20 A;  2R8K A;  4KGV B;  1Y5N B;  3LPY A;  3PX0 A;  2PA3 A;  4O4G A;  3E51 A;  1WHY A;  1RXO B;  3C6T A;  1GXL A;  2EXU A;  4Y00 A;  3VHQ A;  1WC1 A;  4W92 B;  2UUC J;  4A8X A;  4WFZ A;  4KHR A;  2GFF A;  4IG0 A;  1DQ8 A;  1M5K C;  2E1M C;  2DRD A;  1B7Y B;  5B0C A;  5KFM A;  4A8O A;  4KC5 A;  1FKO A;  5HQM A;  1JMT A;  1NND A;  3BJY A;  4G6V B;  4DL5 A;  4JV5 J;  4IRK A;  1T9X A;  1T05 A;  2BA3 A;  2AY0 A;  2H5E A;  1BE4 A;  3OT9 A;  4ZKA A;  3NWG A;  3VEB A;  2UXB F;  1S79 A;  2LLZ A;  1FX2 A;  2VL1 A;  3L7P A;  1YDL A;  3G8T A;  1G4C A;  3GR0 A;  1R7I A;  4OJ1 A;  2AU0 A;  3ZZY A;  4UOG A;  3T5H A;  2JX2 A;  3TVZ A;  4R8U B;  2XTJ P;  3S7R A;  5F41 A;  4MIW A;  5J2Q A;  1PKU A;  3HKW A;  1BUX A;  3BZQ A;  2MHN A;  1B0P A;  4CNY A;  2OH2 A;  1JX4 A;  2PGC A;  1UA1 A;  4P7T A;  2EPI A;  4LF6 J;  1O0P A;  1WC0 A;  2HNY B;  3MXH P;  4CRJ A;  1X9W A;  2L9D A;  4EBE A;  1VHF A;  3GIJ A;  4DBQ A;  4IOC Q;  1TK5 A;  2KM8 B;  1RT7 A;  3W2W B;  1V9O A;  3H25 A;  2CRL A;  1MYK A;  1MN9 A;  1KKH A;  1S76 D;  2AF6 A;  1MNE A;  4A8K A;  4OI6 A;  1O51 A;  2HVI A;  1SV5 A;  2DR9 A;  4DPX A;  4Z2X A;  2W7A A;  4KFB B;  5KG1 A;  2AYG A;  2RT3 A;  3MMC A;  2V4J B;  2B4O A;  2MY7 A;  4X4S A;  1HWU A;  4AL6 A;  3RR8 A;  1S5Z A;  1U1O A;  2KKE A;  2Y0S D;  4NLT A;  1XEZ A;  1QDU B;  4N76 A;  3KLH B;  3W2V B;  3BSO A;  2F9J A;  4TY8 B;  2E5L J;  4AFF A;  4FYW B;  2KOE A;  2WW4 A;  3MEG B;  5FDL B;  1S0V A;  4K4V A;  3IAM 9;  4J9Q A;  2DR8 A;  4IO1 A;  2ZUA A;  1RT3 B;  2QLX A;  5IM0 B;  3NY0 A;  3JSR A;  1HBU A;  2KDO A;  3DKD A;  3BO2 A;  5DM7 Q;  3SI8 A;  5D3G A;  3AY0 A;  3AH6 A;  2FLN A;  2MMY A;  4J9O A;  1B01 A;  1QM9 A;  1QVF R;  1VQ6 S;  2DY1 A;  4B02 A;  2H3A A;  2YNI B;  5KFE A;  5FII A;  4QYZ J;  1CJT A;  3K5O A;  1YBA A;  3ZTP A;  1XER A;  3VGU A;  4CO1 A;  1XWL A;  1HWI A;  1DAR A;  2A2B A;  3W9J A;  3JQM A;  5DG9 A;  1IR1 A;  3HD1 A;  1BWE A;  2W4D A;  3NGD A;  1IQZ A;  3BPD A;  3TAN A;  2F3J A;  1QSY A;  5LSR A;  3QQC D;  2QO3 A;  1F6T A;  4DX7 A;  2QN6 B;  2M9K A;  3CW2 C;  5A0Y B;  3W8G A;  4CLW A;  1MWY A;  3MTK A;  2NXJ A;  4URS A;  2AP6 A;  1S1W B;  5BR8 F;  1Q8I A;  2GO8 A;  1VIO A;  4B3S J;  4A46 A;  4OX6 A;  2P6T A;  4OHX A;  4CH1 A;  1RB0 A;  1IKV B;  3ZZO A;  5JUM A;  1SBR A;  3QT5 A;  3M2V A;  4BWJ A;  1MSW D;  2B8Q A;  2ZOG A;  3MGJ A;  4UQT A;  4MFB B;  3FEY B;  4M5J A;  3VZH A;  2JOQ A;  2PMH A;  3OSN A;  4AL7 A;  3AD8 C;  3CD7 A;  1F3F A;  4CLZ A;  1WHW A;  4LRE A;  1HQU A;  3UNG C;  4DL0 C;  2KTQ A;  3Q23 A;  2HVZ A;  1TL3 A;  2NPF A;  1U2F A;  2AT1 B;  5C25 B;  3HD2 A;  4WIQ A;  5F9L A;  1XNR J;  1S1U A;  2WON B;  4KPY A;  4IG3 A;  4BC7 A;  4AQY F;  2RBF A;  2JVO A;  1CUL B;  3QGI A;  1DUR A;  1JWW A;  4ZP9 A;  3QWP A;  4QIW D;  2CFX A;  2Y1L B;  4Y65 A;  5KFG A;  2DGT A;  4LR8 A;  1FDD A;  4HV0 A;  4UUW A;  2XMK A;  1EJ7 L;  1TAU A;  1W25 A;  3D7S B;  3EUN A;  2F40 A;  1U1K A;  2FTR A;  1Y00 A;  2HGM A;  3THV A;  1IJF B;  4ICL A;  5GMD A;  2L08 A;  5IQ6 A;  2HHP A;  5CYM B;  1VC6 A;  3BH7 B;  3CGI A;  4K5S A;  2D1C A;  4OZ5 A;  1HQ2 A;  1KEK A;  5D0R A;  1WNE A;  1C1B A;  1UAW A;  5D4P A;  4ZCM A;  1Q5V A;  3D6F B;  3GJQ B;  1IBK F;  3CCR S;  1TZ0 A;  4DX6 A;  2DNR A;  4LR9 A;  3J7A 1;  2Y1I A;  4X65 J;  3CCQ S;  2B43 A;  5D15 A;  3I9Z A;  1YJT A;  3VV2 B;  3HZG A;  2DH9 A;  3MM5 B;  1H7X A;  2RB7 A;  3MMB A;  2EW9 A;  3IS9 A;  3OXG A;  2HS4 A;  2K06 A;  2NZC A;  2K7K A;  4XDC A;  4WII A;  3OHA A;  1SJR A;  4HLB A;  4X64 F;  4ZVE A;  4GO5 X;  2G4B A;  4JI3 J;  1X31 C;  4EUV A;  1WWH A;  4JI5 F;  4NLU A;  5IFM A;  2R2U A;  1XMB A;  1GXU A;  3HZE A;  4MTP A;  1YZ6 A;  1X7V A;  4V19 J;  3ETM A;  3JAM U;  4IFV B;  3ZZZ A;  5I3Q A;  2JFD A;  4RO0 A;  3MPY A;  2IBK A;  4GKJ F;  4UOC A;  1NCL A;  2H5J B;  1Y5L B;  1E6Y B;  2DGO A;  4H4O A;  4DL3 A;  2J9D E;  4P52 A;  2V2K A;  4DL6 A;  3O1L A;  4LSN B;  1U26 A;  4URG A;  5KOX A;  2CWX A;  1R43 A;  1TK0 A;  4OMF G;  2B3T B;  1MWQ A;  4ED8 A;  1FRJ A;  1LQ9 A;  2ATL A;  4ETZ A;  3TX0 A;  2F9D A;  3W5X A;  4CLT A;  3TJA A;  2V34 A;  1UJ6 A;  3QIP B;  4WZM A;  3HFV A;  2MEW A;  1Q8B A;  3PFO A;  2OEJ A;  1JLE B;  2GVD A;  5E33 A;  2CNK B;  1Q16 A;  1IWA A;  2QFJ A;  3ZXW A;  3M6W A;  5HVF A;  2XB2 D;  1SJF A;  5C24 A;  3OPK A;  4U95 A;  1S1X B;  3TRG A;  1QLN A;  4RUC A;  2R8J A;  3NXZ A;  2UUB J;  3SQO P;  3V4I B;  2J6S A;  3QLH B;  5DM6 Q;  1T3O A;  3T3F A;  4WTO B;  2CAX A;  3GON A;  3KHG A;  1EKR A;  2OLW A;  1FRI A;  3T19 A;  2FJD B;  4DR1 J;  5KT7 A;  1VIX A;  3NGT A;  2PFF B;  2FLO A;  4QR0 A;  1ZAW A;  3FBF A;  2B5J A;  3MR5 A;  4C8Z A;  2R8G A;  3OFF A;  1T9V A;  1JLB B;  2LEA A;  4RBT A;  1RAH B;  2AIR B;  5D77 A;  1IBC B;  2ADL A;  1HNZ F;  3RW6 A;  4URQ U;  4NLY A;  2ZM6 F;  3AJ1 A;  3T5L A;  4DSI A;  3KMS A;  1OYE A;  2EEY A;  4CDI A;  5DS7 A;  2DB1 A;  2FJB B;  2DHG A;  3RAX A;  2B9X A;  2J9D A;  4B9S A;  2BKO A;  3PCO B;  3MHY A;  4HH1 A;  2VQF J;  2HWH A;  4O3S A;  4N77 A;  4N41 A;  1M1H A;  1KLN A;  3PV8 A;  1CS4 B;  1U47 A;  4NXN J;  2V68 A;  4QYZ K;  3NBP B;  3B8H A;  3PHT A;  2G0C A;  3M30 B;  2JLE A;  4JV0 A;  4P2M A;  3BBF A;  5A6W A;  4ZPB A;  4L74 A;  3EYZ A;  2FVC A;  4PQU B;  4DLG A;  1N5T A;  1EET A;  3NOC A;  4KY3 A;  1KWM A;  1A9N B;  2MDA A;  8AT1 B;  4LF9 F;  2C2D A;  2VF3 A;  1BMQ B;  2VD3 A;  1Q7L B;  2XSF A;  3LP1 A;  1I94 J;  2HQI A;  4MH8 A;  3V6J A;  1VFJ A;  4JOU A;  1JLQ A;  3VQS A;  2WTF A;  3FUY A;  4ED0 A;  2OMO A;  2ZH7 A;  4CQ1 A;  3GV8 B;  1NU4 A;  2WHO A;  3IBF B;  1SJ3 P;  2NQP A;  1FDA A;  4H4K A;  3BSA A;  3RW7 A;  4N56 A;  2UXC F;  3LP0 B;  2GAH C;  3CCL S;  1B70 B;  3H2V E;  4U6P A;  2W8L A;  4DUT A;  4AE5 A;  3R1L A;  2RNE A;  3TZZ A;  2QMU B;  3C16 A;  3EDR B;  1TL5 A;  1OJ4 A;  1N33 F;  1VRQ C;  3VAK A;  5HRO B;  3SCL E;  4ALZ A;  3W1Y C;  3UE2 A;  4C3L A;  1Q4R A;  2RQM A;  4U8Y A;  1K8A T;  3KK3 A;  3CNQ P;  2J7W A;  5JVG Q;  5HAN A;  4DV4 F;  3J7Y I;  1Z1Z A;  3TO8 A;  4C8N A;  1SJ4 P;  1WI8 A;  1NKC A;  4O4G B;  4FKX A;  4W98 A;  3C6T B;  1SC3 B;  3H5S A;  4CO0 A;  3UN2 A;  3TAM A;  1N5S A;  4IG0 B;  3R8Y A;  2YPZ A;  1D8Y A;  1N32 F;  2GQ2 A;  3QZ8 A;  5DZ7 A;  1RAI B;  2EK1 A;  1VGY A;  2ASJ A;  1FKO B;  3DHX A;  5IT0 A;  4ZP7 A;  3PW4 A;  2N3L A;  1OS5 A;  2CJQ A;  3GG0 A;  2H4W B;  3HPO A;  4DFK A;  1WKK A;  3U27 A;  1T05 B;  6FDR A;  2K3I A;  4XK8 C;  3RRH A;  3UCZ P;  2MQ8 A;  2DCU B;  5D4N A;  1K47 A;  3CC7 S;  1NK7 A;  1LXJ A;  4QZV B;  3LO3 A;  4L76 A;  4WP8 A;  5IV3 A;  5F8N A;  4KB7 A;  5ETR A;  1MMD A;  4O44 A;  3OXF A;  1GFW B;  5KFU A;  4F7V A;  2CJX B;  4DLE A;  4ES3 A;  3HHL A;  2MXY A;  3Q8S B;  3TZX A;  2E1P A;  4C48 A;  4H4K C;  4F0H A;  1L5U A;  5J2Q B;  3CD6 S;  2H54 B;  1EA4 A;  4OZ0 A;  4C3M A;  3D0H E;  1X4F A;  4M95 A;  5H9F J;  5F8G A;  1N36 J;  2QX0 A;  3QBC A;  4CM2 A;  5C5J A;  1HI1 A;  5DDP C;  1PJ7 A;  1IBL J;  3OLA A;  4TXS A;  1S0O A;  2ZEJ A;  3N5F A;  2J0Q D;  2C2O B;  4DV3 J;  2RDJ A;  1D09 B;  2YWE A;  1RT7 B;  1DAX A;  7AT1 B;  2DRB A;  2ADB A;  1S6O A;  3ADA C;  2DO0 A;  3D1H A;  2YH1 A;  1BHN A;  2JFK A;  1SV5 B;  5IC6 B;  3MMC B;  2Z8Q A;  2HFO A;  2YVS A;  2HND A;  4OFZ A;  1F5B A;  3I32 A;  2A2C A;  4DR5 F;  4P6Q A;  1QUV A;  4J9L A;  4X4R A;  2HBQ B;  5FD1 A;  1Y3J A;  1T9U A;  1NK6 A;  3VAG A;  3CO9 A;  1PYS B;  3FZ2 A;  1PBA A;  3K8V A;  2B7C B;  2VBY A;  4OZ3 A;  2RUG A;  2CXE A;  2BJ7 A;  2ZFH A;  4RBU A;  4NL5 A;  1VDH A;  3CT9 A;  4QYR A;  1NJX A;  2QMX A;  4AUK A;  1EZZ B;  1UVL A;  1HBU B;  5HAO A;  2HK3 A;  3MR3 A;  4FXD A;  3US5 A;  5D3G B;  1C2P A;  1F0X A;  4MIA A;  3ISZ A;  2KRR A;  1RAE B;  4QIE A;  3X3U A;  1CJT B;  3GU0 A;  4NML A;  2Z0G A;  2V4Q A;  3RB0 A;  4M5H A;  3UDV A;  2RIL A;  4KO0 A;  4C7Q A;  1HBM A;  3QRR A;  1M1G A;  3G4S S;  3ELH A;  2UXD J;  3KFW X;  1FNO A;  1P6T A;  2DGX A;  3MI7 X;  3Q22 A;  3P5B P;  2KG1 A;  1X0F A;  2W2M P;  3NS7 B;  2J0S D;  3SQG A;  1RAJ A;  3MEC A;  4CM0 A;  2OPR A;  2D3O R;  1N56 A;  5EX0 A;  3WC2 A;  4DR4 J;  1RHJ B;  4LBP A;  1C0U A;  4QIV A;  5GVQ A;  2F63 A;  4NXM J;  2MB0 B;  2O1P A;  2X51 A;  4TU7 A;  1R0A A;  1UVN A;  2YX7 A;  2JDJ A;  4X66 F;  4CLS A;  2ZUG A;  1RTI A;  2HFZ A;  1YRT A;  3KMQ A;  2CKW A;  3CJK A;  3M2V B;  4RNO A;  4M5M A;  3P6Y C;  2CQI A;  1IXK A;  3IBW A;  3HSJ A;  4PYD A;  3K8W A;  4ZLP A;  4CH0 S;  1U1N A;  3BBB A;  1HQU B;  2UVR A;  4YHH F;  2DD8 S;  3P8B B;  3MEK A;  1LWE A;  1TL3 B;  5CCM A;  3JB9 k;  2RRA A;  2IJF A;  3BYP A;  4R0J A;  4U7U K;  3TA1 A;  5ETK A;  3C19 A;  1R89 A;  4OX9 F;  1S1U B;  2QYG A;  3KJN B;  4IG3 B;  3N28 A;  4O3P A;  4DFM A;  3MF5 A;  3N5B A;  3BGU A;  2YNG A;  3D3C J;  2M7S A;  1GMU A;  3P5T L;  3AXM A;  4CCH A;  1HQE A;  1QVG R;  4DQI A;  2IM3 A;  4P10 A;  3VWS A;  3FNN A;  1U6Z A;  5DG8 A;  4WXO A;  1UPM B;  1JXL A;  2ACY A;  1T8E A;  7FDR A;  3QPI A;  3FVY A;  1UCN A;  2DIU A;  1S48 A;  4FVC A;  1FFW B;  4K2X A;  2XMA A;  4ICL B;  2R7T A;  4NZ0 A;  2G2O A;  4A4J A;  3MWB A;  1URR A;  2WAQ D;  4X2B A;  1U8S A;  1YSJ A;  1C1B B;  3AXK A;  3LAM A;  3W63 A;  4KQZ A;  4KGK A;  1OYD A;  4O23 A;  2VV5 A;  3QT8 A;  4DQR A;  3OBI A;  3S8S A;  3Q8Y A;  2ZH8 A;  4K2J A;  2LQB A;  1RWM B;  3KJF B;  1TVR A;  3L95 X;  3DLJ A;  4IRC A;  4YY3 J;  3MMB B;  3IS9 B;  2VPY B;  3QRP A;  3K17 A;  1UVJ A;  2IIH A;  2UVW A;  1S6P A;  3C6U A;  4CO3 A;  1M5O C;  4ZVG A;  3IG1 A;  3EGZ A;  1OPZ A;  1WF2 A;  5CD4 A;  1KN6 A;  2CUY A;  4C9D A;  3UO0 A;  2ZH3 A;  2IMW P;  4EMD A;  1LNQ A;  5HK4 A;  4MKY A;  2PO4 A;  4NWB A;  4LMZ A;  5B0B A;  5CAB A;  2FJA B;  2XZD B;  1SUQ A;  3BKF A;  4H4M A;  4Y2I A;  3AT1 B;  5IXU A;  2KYX A;  2QZ8 A;  1M90 T;  4I6W A;  3WC0 A;  1FJ7 A;  1X9M A;  2YKN A;  2C28 A;  3C2P A;  4H4O B;  2CPY A;  4J9K A;  5ADZ A;  3TAQ A;  1FNM A;  2F8M A;  5GAD I;  2HHS A;  1WHX A;  1YLX A;  2O01 C;  1DFD A;  4QPX A;  5KFY A;  2VUG A;  2HHT A;  3D67 A;  3BN7 A;  2UUW A;  3D2W A;  2UXB J;  3AD9 C;  4MKV A;  2HFU A;  1NK4 A;  4CLY A;  2NRE A;  1T3N A;  3TP2 A;  4JI1 F;  3QT6 A;  4IH7 A;  2BMB A;  2O3D A;  5H9F K;  4YR3 A;  4K4W A;  2E66 A;  2AYB A;  2GVD B;  1Q16 B;  3JSM A;  3AB2 B;  1UJ5 A;  4ZPW R;  4UTG A;  4L73 A;  5E3A A;  2BDP A;  3DLK A;  3M8W A;  3OHB A;  5C24 B;  1NSA A;  1NAQ A;  3CJ3 A;  1JLC A;  3BSC A;  3EIC A;  5AJ3 F;  5KFL A;  3T41 A;  2CZ4 A;  4FYY B;  1VQL S;  3DYA A;  3GFX A;  3MR7 A;  4EYI B;  3KLI A;  1N88 A;  4DR7 F;  3IWL A;  3ENQ A;  2HFN A;  4FN5 A;  3KHH A;  2R8H A;  4OYZ A;  1FX4 A;  2E5H A;  2C3M A;  2B5J B;  1CQN A;  4F4Y A;  2ALZ A;  3GIM A;  1T9T A;  1NHU A;  2HQ3 A;  2KXF A;  5D0G A;  4ZIT A;  2CZ9 A;  2OEM A;  3NLC A;  1OHN A;  3CIM A;  1RWW B;  2LEB A;  1LK7 A;  4ZK7 M;  5A6P A;  2BNZ A;  4OLP A;  2DXF A;  1VQP S;  2VJV A;  5E3C A;  4WBF A;  2DJW A;  2LP4 A;  4Z7C A;  4PR6 A;  3TW0 A;  1CLF A;  3HSG A;  3O3L A;  2RDD A;  1PC5 A;  2IC3 A;  1JXE A;  3I31 A;  3PIO Q;  2MY8 A;  2CA9 A;  5KFK A;  4IR1 A;  1UW4 A;  5EDW A;  3HSZ A;  1KTV A;  1EET B;  2Z57 B;  3MPW A;  3PAC A;  5DO2 A;  4WK3 A;  2BQ3 A;  2KFN A;  4J9U E;  1JLF A;  3O44 A;  2VBZ A;  2YKM A;  4DUY F;  2PN6 A;  3LP1 B;  4RW4 A;  1RGV A;  2KHD A;  1JLQ B;  1FF2 A;  1QAJ A;  1NHK L;  4CTA A;  2G1D A;  1CJK A;  2RH3 A;  1SH2 A;  1U6B A;  3D66 A;  2DPI A;  2MKH A;  5GAG U;  5D0H A;  3DCA A;  3OTB A;  4LRB A;  4X4V A;  3PYD A;  3IN5 A;  3OVB A;  2DXD A;  3ENV A;  3G8Q A;  1RHR B;  2CVI A;  3IR7 A;  5BR8 J;  1ZM3 A;  2DNZ A;  4OJ3 A;  3C16 B;  1NM2 A;  3WIU A;  4ECS A;  4C0O C;  1NME B;  5HMX A;  1HPZ A;  2ZNY A;  2YBV A;  3MM8 A;  4DCP B;  2FJV A;  1Q86 T;  2C3Y A;  4O3N A;  2E1R A;  4F67 A;  5FJ4 A;  4ME7 E;  3EVM A;  2MZJ A;  4NA1 A;  2BJE A;  2LKZ A;  2WSF C;  4ZVO B;  3KK3 B;  3VZI A;  3HJV A;  1RT2 A;  4H54 A;  1WHV A;  2D74 B;  4G1I A;  4RNM A;  1WG5 A;  2W25 A;  3D68 A;  2R4F A;  2BBE A;  2GC8 A;  4G65 A;  3PW0 A;  3OUY A;  4K8R A;  3TAM B;  1FRL A;  4DV0 J;  4LF1 A;  4AQY J;  2MZS A;  2U2F A;  2YXL A;  4DF4 A;  1WEX A;  4DPO A;  4FF4 A;  1DTQ A;  1LWC A;  4DF8 A;  3M8S A;  1IKX A;  1VRT A;  1ZM4 A;  2N3O A;  3UQS A;  2HEK A;  2XWY A;  1RAG B;  4Q45 A;  3NCP A;  2FLP A;  3MAH A;  4KGX B;  2FB0 A;  2AD9 A;  4NZ6 A;  2EKN A;  1VRU A;  3I96 A;  4O44 B;  4QU7 A;  3RJM B;  4P75 A;  3FSY A;  3HHL B;  2PE8 A;  3QAE A;  4PZV A;  1IBK J;  3ZO7 A;  3CCT A;  2HRT A;  4ELT A;  2KI2 A;  1B0V A;  2OUG A;  2V63 A;  3JAM Y;  1NZ8 A;  3CIZ A;  4NCG A;  2IMO A;  3CCW A;  3G87 A;  2J6U A;  3ZTO A;  3UW1 A;  2DNY A;  2JRS A;  3CJ8 A;  4CP5 A;  1DQA A;  4JB8 B;  3DDI A;  3H0P A;  5M2P A;  5IS2 A;  4PWU A;  2CAJ A;  1ZM2 A;  3NG8 A;  2GJF A;  3G86 A;  4X64 J;  1N8R T;  5AXK A;  2ZH9 A;  3MTJ A;  1XR7 A;  2A18 A;  1K0V A;  5E3Q A;  1DJ0 A;  3PRV A;  1TP7 A;  2AYE A;  3KUG A;  3CWJ A;  1Q0N A;  1UWB A;  5DDR C;  2HND B;  4NLG A;  4MJW A;  2NSB A;  1G3O A;  3I5A A;  3R7S B;  4ZCI A;  1R0C B;  1X60 A;  1OIA A;  4TYA A;  4GKJ J;  1T95 A;  2K1R A;  5F8M A;  3D0G E;  3FGV A;  2GIQ A;  2MGZ A;  2CNL B;  3KLF A;  3TEG A;  4RZR A;  2KT5 A;  4LSL A;  2ZJR Q;  2GML A;  3CUL A;  1NDL A;  3MEE A;  3AJD A;  2WVB A;  5L39 A;  4O3Q A;  2XMT A;  2LDI A;  3DRR A;  3SIP B;  2A1B A;  1QY7 A;  4F25 A;  4QWC A;  4ZCL A;  3FRY A;  2VDH A;  1WG4 A;  4WYW A;  1SQG A;  4DXL A;  2M88 A;  3DDN A;  3JYT A;  1HWL A;  1PAU B;  1KSP A;  4KO0 B;  3M9O B;  4PG7 A;  1JNR B;  1HBM B;  3FCV A;  3DOM A;  3LQV A;  4ECT A;  4LT6 A;  4P2F A;  4QIF A;  2MST A;  4ZVQ B;  3MPD A;  5CYJ A;  1NH8 A;  3G2X A;  5ETO A;  1TTH B;  3TEH B;  5L1L A;  4FBT A;  4UZC A;  1CG2 A;  3MUM P;  1HR0 J;  3SQG B;  2XLI A;  3MEC B;  3V81 A;  2OPR B;  1LOU A;  5GAH I;  1OY9 A;  1C0U B;  1KBR A;  3NWR A;  4YOE A;  2WB4 A;  1K1S A;  2LDY A;  1Y0H A;  1R0A B;  1Y10 A;  1SI9 A;  2B9E A;  3DU5 A;  2CQ3 A;  2QA2 A;  2IY5 B;  1RTI B;  4DN0 A;  2GO9 A;  4Z7Y A;  3VVU A;  1HNZ J;  2KFZ A;  3CJK B;  3TA2 A;  2DGU A;  1UZD A;  4MK9 A;  1JNZ B;  3IBC B;  3PEH A;  4EZ9 A;  1F3V A;  1WOR A;  2XYH B;  5CZX A;  1NLA A;  4NLD A;  1UVM A;  3HM9 A;  2ROE A;  2Z2M A;  4ECZ A;  1U0S A;  3D0I E;  3DFE A;  5LSL A;  2UUT A;  4WFN Q;  2O5D A;  4L75 A;  5GAE U;  3GFY A;  2PDA A;  5EWF A;  4Q8E A;  2B9W A;  2DR6 A;  1IJE B;  3OFH A;  5L1I A;  3D5M A;  3FMW A;  2YNG B;  4IYQ A;  3PEJ A;  4LF9 J;  4E0D A;  2BZ2 A;  3M2U A;  5JXS A;  1A0O B;  4OI2 A;  1HQE B;  3PYG A;  4OHY A;  2ZH1 A;  3CJS A;  1WSV A;  4P7V A;  3AAW B;  2Q3P A;  2EBE A;  4F4X A;  4M8L A;  3SCI E;  2AV5 A;  3AOB A;  1NDK A;  4I2Q A;  1ARO P;  2B4U A;  1NHV A;  4RL1 A;  2UU9 F;  4DR3 F;  2NLW A;  4K50 A;  2VBX A;  2UXC J;  4P2S A;  3EZO A;  3OTO F;  3NMA A;  3TWZ A;  2HVD A;  2RE1 A;  2QSW A;  2A6M A;  3DLE A;  1HL6 A;  2RU9 A;  3MCM A;  2OFH X;  2HW3 A;  3H90 A;  2ZWP A;  3T9N A;  3DMJ A;  2JEG A;  4K4Y A;  1NXI A;  4F3O A;  3NNE A;  1I51 B;  1N33 J;  3MPV A;  4DR1 F;  4F3M A;  1TVR B;  4ZLJ A;  4ZVT B;  1N34 F;  2W7P A;  1VQ5 S;  2WBM A;  4JYA F;  3H5U A;  3C66 A;  3HVW A;  3RB4 A;  4DV4 J;  1S6P B;  3C6U B;  2J9E A;  5HBM A;  3IG1 B;  2R7U A;  1QTM A;  4N7T A;  4FS1 A;  3H98 A;  5CA5 A;  4OHV A;  3H4D A;  4PPD A;  2MQM A;  2V8H A;  3M7V A;  5K8O A;  3D9B A;  3M2R A;  4ERD A;  3HJF A;  1C0T A;  2GZO A;  1SUQ B;  3K57 A;  1N5Y A;  4H4M B;  3J81 Y;  1QTN B;  1FXL A;  1HNW F;  4C98 A;  1FI4 A;  1N32 J;  4M5D A;  4QWE A;  4ZJQ A;  2YKN B;  4OYI A;  4XIU A;  2Y0B B;  2ASL A;  1SPB P;  1ICE B;  2Y8W A;  1UP1 A;  4KGZ B;  1H7W A;  1T11 A;  4D3G A;  1D9A A;  2GMH A;  2YX1 A;  2IRU A;  3V6H A;  4HR2 A;  2IJN A;  1RLD A;  5G0R A;  2PEH A;  3H8Y A;  1W2I A;  3FBC A;  2AGP A;  4Q2M A;  1DZ5 A;  3CDW A;  4OHZ A;  2YWG A;  5IWA F;  3G82 A;  2CVE A;  4ZA1 A;  3CJ4 A;  2MQN A;  3JSM B;  3CCJ S;  3UFC X;  1S57 A;  5KFO A;  1NK5 A;  4IQM A;  1S72 S;  3U1N A;  2OHD A;  3DLK B;  3VTI A;  2CQ2 A;  2MKI A;  4Q0B A;  4Q8F A;  1JLC B;  2DIS A;  3RTV A;  4NLS A;  2DRA A;  2CJY B;  2PI4 A;  2FC9 A;  3DYA B;  2P2C B;  1YIT S;  3KLI B;  2DVI A;  1N6Q A;  1H2V Z;  3BDE A;  2GPE A;  4IH6 A;  3NRB A;  1VQS A;  4FZV A;  5CD4 H;  1FES A;  2I5J A;  2V8G A;  2WVF A;  1IQT A;  3J7A N;  3BSN A;  2WVD A;  1MML A;  4KHP F;  2V9W A;  2R7R A;  4DR5 J;  3BPS P;  5K8P A;  1YJR A;  2EG1 A;  1PIL A;  2QTW A;  3A8E A;  5B08 A;  2J7U A;  3DLH A;  2FUG 9;  4BCA A;  4LVN P;  2HBY B;  1R8B A;  2AEM A;  1ELO A;  1S9G A;  3GZ7 A;  1Q53 A;  3B82 A;  1U2C A;  3GR1 A;  1T7P A;  4CO5 A;  3KJV A;  2IC3 B;  2VOP A;  3AB4 B;  2HMI A;  1HFE L;  4EGL A;  2QA1 A;  2GGP A;  2J7K A;  1KR4 A;  1NSQ A;  1HKA A;  3H5Y A;  5A8K A;  3OLB A;  2JHE A;  1HYS A;  2MYF A;  4RW9 A;  4ECQ A;  5DET A;  3G9C A;  1R0B G;  2WVC A;  1MU2 A;  1OQ6 A;  4DSL A;  5E7O B;  4HHH A;  5RUB A;  2PMZ D;  1JLF B;  3BKU A;  1FO1 A;  3BO3 A;  2YKM B;  4FYD A;  3EGW B;  5A8W A;  3E8O A;  1RTD A;  1P1T A;  4I69 A;  4RW4 B;  5KTQ A;  2LQ5 A;  3JTP A;  4CTA B;  2FD2 A;  5K8N A;  4DDF A;  1CJK B;  4P9S A;  1WOO A;  4JI0 F;  2W9B A;  4Y2A A;  1YX2 A;  3W61 A;  3QSI A;  1NSK L;  1RHU B;  1HHT P;  3IC1 A;  3H42 A;  4B3R F;  3FK4 A;  1HI8 A;  2QLF B;  3KLV A;  1JJH A;  1CPZ A;  4RUB A;  1LK5 A;  2RS8 A;  4ILR A;  3KDN A;  5KFR A;  2Z56 B;  4DS5 A;  3FCH A;  4D8J A;  3IR7 B;  3R2D J;  2Z58 B;  2E5I A;  4DV7 F;  2MLY A;  2QJ3 A;  2ROP A;  4X66 J;  1EX8 A;  4DV3 F;  1HPZ B;  5DGA A;  3MM8 B;  2HZC A;  1NPP A;  1G6B A;  2CQ4 A;  1YJW S;  2CG4 A;  2XMU A;  3GFZ A;  4O0N A;  1RIS A;  5KG4 A;  4YFU A;  3R6G B;  1U1P A;  1FE4 A;  2FVR A;  4LVO P;  4QCL A;  3FMT A;  2RUS A;  2HQG A;  1RT2 B;  1PBU A;  1XC9 A;  3KNA A;  1I1G A;  2UUA F;  2Q1L A;  1Q7Y T;  4YHH J;  1NBE B;  4LBH A;  1RK8 A;  3PR4 A;  1TUG B;  2K2P A;  2WW8 A;  1YRX A;  3AA9 A;  4OX9 J;  3OUY B;  3KG1 A;  2Z30 B;  2D7S A;  4I56 A;  4CLF A;  3VEA A;  1DTQ B;  4B08 A;  1LWC B;  1B28 A;  1U1M A;  1H6K X;  1Y3K A;  3TVY A;  1IKX B;  1VRT B;  5K5M A;  1FDN A;  1D3W A;  1QAI A;  4UY8 5;  2VFU A;  3IA0 A;  3PNI A;  2B7B B;  1ROF A;  3WIV A;  3RYL A;  2BKN A;  5ETS A;  4USJ C;  2H51 B;  4QJV A;  2DHX A;  1VRU B;  3QID A;  1FHT A;  1T03 A;  2UXD F;  4J7C A;  2XLK A;  5THW A;  1Q1K A;  1J2V A;  2L9N A;  2H5I B;  1RA7 A;  3WDO A;  4ES2 A;  2QA4 S;  3CME S;  4LF8 F;  3H59 A;  4DWI A;  2BE2 A;  2RSQ A;  4NCG B;  9ATC B;  4LIR A;  1K1Q A;  1IBM F;  1FWP A;  1KQF B;  3GP9 A;  2D69 A;  2HHV A;  3GYN A;  2LQ8 A;  2KT3 A;  4F2S A;  5ETP A;  3E01 A;  4DG1 A;  4OZJ A;  1P8G A;  2ZH4 A;  3QGP A;  4KGM A;  2IPO B;  3KHR A;  1F5A A;  4XPE A;  2K7J A;  3AOA A;  3K5L A;  3RB3 A;  1CSJ A;  1RCO B;  4A8M P;  4UW2 A;  2A0F B;  1S1V A;  1SKR A;  1H73 A;  4LJM A;  1UWB B;  5H1S V;  5FLX U;  2XEX A;  1R8H A;  4OX7 A;  3HLU A;  3B54 A;  2X1A A;  2HLU A;  2K1R B;  2J5A A;  2GCF A;  1Y9O A;  4GVB A;  2MGZ B;  2MSS A;  4UST A;  3KOA A;  3KLF B;  1SJ1 A;  4ZVH A;  4LSL B;  4MYU A;  2BR0 A;  3MEE B;  1BQX A;  5DDO C;  1VBK A;  4C8L A;  2ZBR A;  3DRR B;  2CJK A;  5HQ8 A;  2E7X A;  4EI2 A;  4G1P A;  3HHD A;  1T94 A;  5IV4 A;  5DQI A;  4X4Q A;  2HHX A;  2QEX S;  4JI1 J;  3JYT B;  8RUC A;  3M8Z A;  3PO5 A;  3OTC A;  2VBW A;  2VG6 A;  2ZKT A;  3E2E A;  3LGH A;  3DOM B;  3OTD A;  2OSR A;  2HK2 A;  4CT9 A;  4HI2 A;  2BXJ A;  4I6Y A;  1RTH A;  1S7H A;  3I0S A;  5K20 B;  1FA0 A;  3QNW B;  4D3H A;  3B78 A;  1KQG B;  5F8H A;  1F1B B;  2LMI A;  3QO9 A;  3GIL A;  2J8S A;  5AJ3 J;  2RDI A;  3FJ2 A;  2HIY A;  2MKY A;  3V81 B;  4Y0F A;  1FJG F;  4RBV A;  2IA0 A;  4DR7 J;  1U45 A;  4RUA A;  4B3T F;  5HP1 A;  2GIF A;  1T02 A;  5J1P A;  2ABY A;  1PYO B;  5J1N A;  4ATN A;  3F73 A;  3DM2 A;  3BRE A;  4FXE A;  1WEL A;  2VDI A;  2C42 A;  2NXC A;  1K9M T;  2HHQ A;  3H2U B;  2BVZ A;  3B4M A;  2XSJ A;  2Q2K A;  1BDV A;  2AZ1 A;  1PSD A;  2KXH A;  3NMR A;  3ILI A;  4PXC A;  1KFS A;  2CQB A;  2G0I A;  4DJB A;  1NH7 A;  1ZZN A;  1FRX A;  3O8W A;  3A1Y G;  4F0M A;  4DUZ F;  1SL0 A;  3A8I A;  4LBI A;  1NUE A;  2RRB A;  2XM3 A;  3M2U B;  5SUH A;  2ZBQ A;  2DNG A;  2MTL A;  1SKU B;  2DH7 A;  2J0W A;  4DUY J;  1Q8K A;  2VC1 A;  4I2Q B;  3KYL A;  5D4L A;  4X4N A;  3BR9 A;  3QT7 A;  3F41 A;  5G4D A;  2WZ1 A;  5KFH A;  2FHK A;  3PY8 A;  4ZDN A;  5MAO A;  2LU2 A;  1N4L A;  4F4Z A;  3DLE B;  2DGQ A;  2C3P A;  4OX8 A;  4K4Z A;  4CYU A;  2DGW A;  2Q43 A;  3RGI A;  4WK1 A;  3DMJ B;  2YNH A;  2BJ9 A;  2ZE2 A;  3G6V A;  3M8P A;  3LAK A;  1TFY A;  1FD8 A;  2C1E B;  3MFH A;  1IWG A;  5HVG A;  3EWG A;  1D0E A;  3M6X A;  3PR5 B;  3A13 A;  1XK8 A;  3OW2 R;  5LSO A;  2JC0 A;  4QW8 A;  2CAD A;  4HAC A;  2UP1 A;  4K59 A;  5HBM B;  1HHQ A;  1Y7P A;  4NCB A;  2DEJ A;  4TU8 A;  5HMY A;  3OR2 A;  2C3U A;  5LT5 A;  3GQC A;  1RU2 A;  3ET6 A;  3M2R B;  4I68 A;  5J1E A;  4OJH A;  1CC8 A;  3ONQ A;  1C0T B;  4KPC A;  4OZN A;  2NSC A;  4KBI A;  3EX7 B;  1N5Y B;  1YJ7 A;  2HWT A;  5IT9 U;  2K29 A;  3NNH A;  1OG7 A;  4M5D B;  1CVJ A;  3J7Z T;  4JI8 F;  1BQN A;  2NYI A;  2EBG A;  2DNH A;  2HG4 A;  1VS3 A;  1PJ6 A;  2FVP A;  5DG7 A;  1N52 B;  2BW7 A;  3JQK A;  2AN7 A;  2PEB A;  5A2Q U;  5DLF A;  1J27 A;  1WOP A;  2C2N A;  5G0R B;  2XCP A;  1LXN A;  4K4U A;  1XQI A;  2BW2 A;  5E5N A;  2LA6 A;  8ATC B;  3X1L B;  3QZ7 A;  1UWA A;  3G82 B;  1RI7 A;  2EKY A;  1X5O A;  2RQK A;  1IM4 A;  5ITH A;  1QE1 A;  1TMJ A;  2V2Z A;  4MAK A;  1BY9 A;  2Y3Y A;  4Q0B B;  2NUH A;  3D6M B;  3ZTQ A;  5M2U A;  4F50 A;  1YJU A;  3SXL A;  4PXB A;  1RWN B;  4M5I A;  1JQG A;  3V6K A;  2MKJ A;  1EAY C;  3CCU S;  1S1T A;  1VIS A;  2F7V A;  2XS7 A;  1RTJ A;  2HAF A;  5EUH A;  2OFG X;  4AYB D;  3VAL A;  1N6Q B;  2GJ2 A;  3P96 A;  4JI4 J;  4J5O A;  6AT1 B;  2H1O E;  3VAM A;  4DHV A;  4AD6 A;  3CDA A;  1V5I B;  2C2R A;  3UDL A;  2I5J B;  3N9U C;  2VPZ B;  2FGC A;  2XGQ A;  2P9E A;  3BYR A;  2AJF E;  4E2F B;  3MZI A;  3RU0 A;  2W7O A;  3BR8 A;  5L46 A;  4C0B A;  2R7X A;  1U1L A;  1X5S A;  1FFG B;  1M5P C;  4RWX A;  3PO4 A;  3LH2 S;  2QLW A;  3J80 U;  3SFU A;  1UFW A;  2AZ3 A;  3AOD A;  3CUN A;  4WE1 A;  3IM9 A;  4MKB A;  3CCE S;  1TAQ A;  4ZPA A;  2V8P A;  3LP2 A;  1S9G B;  2DNN A;  3I0R A;  2W2O P;  2ZBP A;  3AA8 A;  3K0J A;  2NXU A;  4PG4 A;  3W65 A;  3KJV B;  3SCJ E;  4DV0 F;  2HMI B;  3TUJ C;  2BKP A;  2GGP B;  4IUF A;  3MFI A;  1VQK S;  4DR6 F;  2ZVS A;  2E5J A;  4M63 A;  5A8K B;  2YWK A;  1HYS B;  3EPI A;  4RW9 B;  5IQQ A;  1MRO A;  1B7F A;  1MU2 B;  4X62 J;  3GYG A;  5DGB A;  2L41 A;  2MHE A;  4OI3 A;  1S12 A;  1A6L A;  2ZOM A;  3G6Y A;  1RWX B;  5KG7 A;  3CCZ A;  5A8W B;  1RTD B;  3HKZ D;  4ILM A;  4NLR A;  4YUD A;  2FYX A;  2ZBI A;  5BYR A;  2GVZ A; 
#chains in the Genus database with same CATH homology
 4HV0 A;  2HZA A;  1U9P A;  3VEB A;  3GXQ A;  2K5J A;  2WVB A;  2FGC A;  2BSQ E;  1BDV A;  2GPE A;  3BKF A;  1ARQ A;  1X93 A;  3OD2 A;  2CAX A;  2K6L A;  2BJ9 A;  1EA4 A;  2WVF A;  2JXI A;  2JXG A;  1QTG A;  2WVD A;  1NLA A;  2KEL A;  3VEA A;  3H87 C;  1IRQ A;  2HZV A;  1BAZ A;  1B28 A;  3QSI A;  3LGH A;  2BJ7 A;  3VW4 A;  2BJ1 A;  2BNW A;  2BJ8 A;  2CAJ A;  1BDT A;  2JXH A;  1B01 A;  2BNZ A;  1Q5V A;  2CPG A;  1PAR A;  2CAD A;  2BJ3 A;  4D8J A;  2WVE A;  1ARR A;  2Y3Y A;  1MYK A;  1P94 A;  1MNT A;  2F1F A;  3FMT A;  2K1O A;  1Q5Y A;  2PC6 A;  2WVC A;  2CA9 A;  4FXE A;  2NZC A;  2K9I A;  2BA3 A;  2RBF A;  2AY0 A;  1MYL A;  3FT7 A;  2K29 A;  3QOQ A;  4ME7 E;  3BKU A;  3BKT A;  3PHT A;  2H1O E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...