2BJCA

Nmr structure of a protein-dna complex of an altered specificity mutant of the lac repressor headpiece that mimics the gal repressor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
62
structure length
62
Chain Sequence
MKPVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAMAELNYIPNRCAQQLAGKQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Altered Specificity in DNA Binding by the Lac Repressor: A Mutant Lac Headpiece that Mimics the Gal Repressor
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords LACTOSE OPERON REPRESSOR
total genus 20
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2bjcA00
2XJ3A 1QQBA 1UTXA 2AXUA 1LQCA 2IVQA 4FBIA 1HF0A 1BDHA 2PUCA 4YBAA 4IVZA 1NEQA 2LYQA 1WETA 2BNOA 2XCJA 1R69A 2AUWA 3FYMA 4JCXA 3G7DA 2L8NA 1JFTA 1LCDA 4Z59A 4I6RA 4MCXA 2KEKA 4JQDA 5A7LA 1RZSA 4Z5HA 2PUDA 2PIJA 3LFPA 4X4CA 2JVLA 2GRMA 2AXVA 3GN5A 2D5VA 2OFYA 1GT0C 3OQMA 1XWRA 1DWKA 3MLFA 3QWGA 3O9XA 2MQKA 3FMYA 3OP9A 2R63A 3SCGA 1LCCA 1E3OC 3F51A 2HSGA 3QYXA 2BNNA 1B0NA 1WIZA 2ICTA 4X4GA 2FJRA 1YSEA 1X57A 4PU4C 3CECA 4I6UA 4J1XA 3JXDL 1PERL 2GRLA 4PU3C 1R63A 1QPZA 2PUEA 3BD1A 3CROL 2JCGA 4O8BA 1ZZ8A 3OQNA 1JFSA 2EBYA 1RPEL 1ZZ7A 4I6TA 4X4DA 2BNMA 2PE5A 4X4BA 2OR1L 3TRBA 1PRVA 2H8RA 3CLCA 1UXDA 1VPWA 3F6WA 2A6CA 2B5AA 2CSFA 2WUSR 3SCHA 1RZRD 3F52A 4NDWA 2MEZA 1ZUGA 2LCVA 1ZS4A 4X4EA 4X4HA 4J1WA 3RZZA 2L49A 4JCYA 2KPJA 4YARA 2IVGA 1ZPQA 3JXBC 1QQAA 2AWIA 1ZZ9A 4GQMA 4FN3A 3ZKCA 1OSLA 1IC8A 1PNRA 1ZZ6A 3H5TA 1L1MA 1WH8A 2IVBA 3PXPA 2PUGA 2AXZA 1PRAA 1QP0A 2R1JL 2IUOA 1JWLA 3ZHMA 2PPXA 1ZZCA 2PUBA 3G5GA 2HINA 2IU7A 3HZIB 1LLIA 3VK0A 1O4XA 1NERA 2PUAA 3KXAA 4OB4A 4X4FA 3U3WA 3OQOA 2O4AA 2CROA 2PUFA 1DW9A 4Z58A 1EFAA 2BJCA 2KEJA 1JH9A 2WIUB 1QP7A 4Y42A 4YG7B 2AW6A 3KJXA 3UFDA 1PRUA 3L1PA 1BDIA 4Z5CA 1CQTA 2LYPA 2LYJA 4Z5DA 3D1NI 3DNVB 4IWRA 1POUA 2EF8A 4PU8A 2XIUA 3B7HA 3R1FA 3IVPA 3QQ6A 4IA8A 1RIOA 1ZVVA 1Y7YA 2GZUA 4MCTA 1RZRA 2IV1A 3GBFA 2EWTA 2XI8A 3FYAA 1Y9QA 3GN5B 4YG1A 2O38A 4PU7A 1SQ8A 3BDNA 1AU7A 1CJGA 4I8TA 2LYKA 4X4IA 3ZHIA 5K98B 2XSDC 1QP4A 4F8DA 3QF3A 3JXCL 3S8QA 3LISA 4GHJA 1UXCA 3OMTA 1ADRA 2LYSA 1OCTC 1ZAYA 1ZZBA 1LMB3 2O49A 2ICPA 3SCFA 2LYRA 3EUSA 1X2LA 1S7EA 3KZ3A 2KZ8A 2LYLA 3BS3A 2KEIA 1WH6A 4YG4A
chains in the Genus database with same CATH superfamily
1QQBA 2IVQA 4FBIA 1HF0A 1MFQC 2PUCA 4YBAA 1NEQA 4HRAA 2FFHA 3LQXA 3A9XA 1LCDA 2JQEA 2GRMA 3GN5A 1GT0C 3QWGA 3O9XA 3SCGA 2HSGA 4X4GA 1YSEA 1PERL 3JXDL 4PU3C 1R63A 1QPZA 2J7WA 2PUEA 2JCGA 1ZZ8A 2VEOA 1RPEL 2EBYA 4X4BA 2OR1L 5DTMA 2A6CA 4NDWA 4ER6A 2LLVA 1ZS4A 4X4HA 4J1WA 2PXLA 2L49A 4JCYA 4YARA 2IVGA 2AWIA 1ZZ9A 3UWPA 1L1MA 2PXPA 2R1JL 1ZZCA 2PUBA 3TEPA 5GAGi 1LLIA 2O4AA 1NERA 2YBDA 3KXAA 4OB4A 4X4FA 2CROA 1DW9A 4Z58A 1EFAA 1JH9A 2HCSA 2WIUB 5GAHi 1QP7A 2HCNA 1PRUA 4EQZA 1BDIA 4Z5CA 3QQ6A 2GZUA 4YG1A 2O38A 4X4IA 5DSXA 3QF3A 3S8QA 3BS3A 1LMB3 3SCFA 3A9YA 2XJ3A 1LQCA 1WETA 2XCJA 4Z59A 4MCXA 4ER7A 5A7LA 4Z5HA 2PUDA 2PIJA 2XXAA 2JVLA 1QZXA 1DULA 2OFYA 1XWRA 1DWKA 3FMYA 3OP9A 2R63A 3ME5A 1LCCA 3F51A 3VWSA 3QYXA 4Q2JA 4PU4C 4J1XA 5DTQA 4ER5A 3BD1A 3CROL 3SX0A 1JFSA 2PXEA 4I6TA 3OKZA 2BNMA 5DRYA 2V3CC 3GZCA 3F6WA 3SCHA 2WUSR 1RZRD 2MEZA 4OBMA 3GZDC 3RZZA 5DRTA 2ODRD 2KPJA 3JXBC 3MEJA 4FN3A 3H5TA 1WH8A 3ZHMA 1U2ZA 1HQ1A 1O4XA 2PUAA 4WVLA 2KEJA 3DM5A 2AW6A 3KJXA 3UFDA 3NXHA 2LYPA 1POUA 2EF8A 4PU8A 2XIUA 1ZVVA 4MCTA 3GBFA 2EWTA 3GN5B 3QOWA 1QB2A 5K98B 2XSDC 1QP4A 3QFIA 1UXCA 3OMTA 2PXQA 1ADRA 2LYLA 2KEIA 1WH6A 2L1PA 1UTXA 1BDHA 4DE9A 2LYQA 2BNOA 1R69A 4JCXA 3G7DA 1JFTA 2MXDA 4I6RA 2KEKA 4EK9A 4X4CA 2D5VA 3MLFA 2MQKA 4EKGA 1E3OC 2BNNA 2LLWA 2XXPA 2LNMA 2PXBA 3OQNA 1ZZ7A 4X4DA 4DE8A 3TRBA 3CLCA 1UXDA 3TFLA 2CSFA 3ZPXA 2LCVA 4X4EA 1ZPQA 3GUUA 3ZKCA 1OSLA 1IC8A 1PNRA 2PUGA 2AXZA 1QP0A 2IUOA 5JUWA 3G5GA 2HINA 3HZIB 3VK0A 3U3WA 3OQOA 2PXVA 4Y42A 4YG7B 3NDBB 4EKIA 3L1PA 2HFZA 1CQTA 4Z5DA 5DT2A 3DNVB 4IWRA 3G0TA 2PXTA 3A9ZA 3R1FA 3IVPA 1RIOA 1Y7YA 1RZRA 3FYAA 1Y9QA 3R09A 3BDNA 3PE5A 1AU7A 1CJGA 2LYKA 3ZHIA 3GZDA 3JXCL 1OCTC 1ZZBA 2O49A 2ICPA 2M4HA 1X2LA 2XXQA 2AXUA 4IVZA 3NZLA 2AUWA 3FYMA 2L8NA 4ER3A 4JQDA 1RZSA 3LFPA 2AXVA 3OQMA 2PXUA 1B0NA 1WIZA 2ICTA 2FJRA 1X57A 3CECA 4I6UA 3SR4A 2GRLA 4EZIA 4O8BA 2PE5A 1PRVA 2H8RA 1VPWA 1NW3A 2B5AA 3F52A 1ZUGA 3NROA 1QQAA 4GQMA 2PXDA 3QOXA 1ZZ6A 2IVBA 3TELA 3PXPA 1PRAA 1JWLA 2PPXA 2J7UA 2PXKA 2IU7A 2PUFA 2BJCA 5DTRA 2LYJA 3D1NI 3B7HA 4IA8A 2IV1A 3OWQA 2PXFA 2XI8A 4PU7A 1SQ8A 3M9LA 4I8TA 3KL4A 4F8DA 3LISA 4GHJA 2LYSA 1ZAYA 2LYRA 3EUSA 3KZ3A 1S7EA 2KZ8A 4ER0A 4YG4A
chains in the Genus database with same CATH topology
2XJ3A 1QQBA 1UTXA 2AXUA 1LQCA 2IVQA 4FBIA 1HF0A 1BDHA 2PUCA 4YBAA 4IVZA 1NEQA 2LYQA 1WETA 2BNOA 2XCJA 1R69A 2AUWA 3FYMA 4JCXA 3G7DA 2L8NA 1JFTA 1LCDA 4Z59A 4I6RA 4MCXA 2KEKA 4JQDA 5A7LA 1RZSA 4Z5HA 2PUDA 2PIJA 3LFPA 4X4CA 2JVLA 2GRMA 2AXVA 3GN5A 2D5VA 2OFYA 1GT0C 3OQMA 1XWRA 1DWKA 3MLFA 3QWGA 3O9XA 2MQKA 3FMYA 3OP9A 2R63A 3SCGA 1LCCA 1E3OC 3F51A 2HSGA 3QYXA 2BNNA 1B0NA 1WIZA 2ICTA 4X4GA 2FJRA 1YSEA 1X57A 4PU4C 3CECA 4I6UA 4J1XA 3JXDL 1PERL 2GRLA 4PU3C 1R63A 1QPZA 2PUEA 3BD1A 3CROL 2JCGA 4O8BA 1ZZ8A 3OQNA 1JFSA 2EBYA 1RPEL 1ZZ7A 4I6TA 4X4DA 2BNMA 2PE5A 4X4BA 2OR1L 3TRBA 1PRVA 2H8RA 3CLCA 1UXDA 1VPWA 3F6WA 2A6CA 2B5AA 2CSFA 2WUSR 3SCHA 1RZRD 3F52A 4NDWA 2MEZA 1ZUGA 2LCVA 1ZS4A 4X4EA 4X4HA 4J1WA 3RZZA 2L49A 4JCYA 2KPJA 4YARA 2IVGA 1ZPQA 3JXBC 1QQAA 2AWIA 1ZZ9A 4GQMA 4FN3A 3ZKCA 1OSLA 1IC8A 1PNRA 1ZZ6A 3H5TA 1L1MA 1WH8A 2IVBA 3PXPA 2PUGA 2AXZA 1PRAA 1QP0A 2R1JL 2IUOA 1JWLA 3ZHMA 2PPXA 1ZZCA 2PUBA 3G5GA 2HINA 2IU7A 3HZIB 1LLIA 3VK0A 1O4XA 1NERA 2PUAA 3KXAA 4OB4A 4X4FA 3U3WA 3OQOA 2O4AA 2CROA 2PUFA 1DW9A 4Z58A 1EFAA 2BJCA 2KEJA 1JH9A 2WIUB 1QP7A 4Y42A 4YG7B 2AW6A 3KJXA 3UFDA 1PRUA 3L1PA 1BDIA 4Z5CA 1CQTA 2LYPA 2LYJA 4Z5DA 3D1NI 3DNVB 4IWRA 1POUA 2EF8A 4PU8A 2XIUA 3B7HA 3R1FA 3IVPA 3QQ6A 4IA8A 1RIOA 1ZVVA 1Y7YA 2GZUA 4MCTA 1RZRA 2IV1A 3GBFA 2EWTA 2XI8A 3FYAA 1Y9QA 3GN5B 4YG1A 2O38A 4PU7A 1SQ8A 3BDNA 1AU7A 1CJGA 4I8TA 2LYKA 4X4IA 3ZHIA 5K98B 2XSDC 1QP4A 4F8DA 3QF3A 3JXCL 3S8QA 3LISA 4GHJA 1UXCA 3OMTA 1ADRA 2LYSA 1OCTC 1ZAYA 1ZZBA 1LMB3 2O49A 2ICPA 3SCFA 2LYRA 3EUSA 1X2LA 1S7EA 3KZ3A 2KZ8A 2LYLA 3BS3A 2KEIA 1WH6A 4YG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XJ3 A;  1QQB A;  1UTX A;  2AXU A;  1LQC A;  2IVQ A;  4FBI A;  1HF0 A;  1BDH A;  2PUC A;  4YBA A;  4IVZ A;  1NEQ A;  2LYQ A;  1WET A;  2BNO A;  2XCJ A;  1R69 A;  2AUW A;  3FYM A;  4JCX A;  3G7D A;  2L8N A;  1JFT A;  1LCD A;  4Z59 A;  4I6R A;  4MCX A;  2KEK A;  4JQD A;  5A7L A;  1RZS A;  4Z5H A;  2PUD A;  2PIJ A;  3LFP A;  4X4C A;  2JVL A;  2GRM A;  2AXV A;  3GN5 A;  2D5V A;  2OFY A;  1GT0 C;  3OQM A;  1XWR A;  1DWK A;  3MLF A;  3QWG A;  3O9X A;  2MQK A;  3FMY A;  3OP9 A;  2R63 A;  3SCG A;  1LCC A;  1E3O C;  3F51 A;  2HSG A;  3QYX A;  2BNN A;  1B0N A;  1WIZ A;  2ICT A;  4X4G A;  2FJR A;  1YSE A;  1X57 A;  4PU4 C;  3CEC A;  4I6U A;  4J1X A;  3JXD L;  1PER L;  2GRL A;  4PU3 C;  1R63 A;  1QPZ A;  2PUE A;  3BD1 A;  3CRO L;  2JCG A;  4O8B A;  1ZZ8 A;  3OQN A;  1JFS A;  2EBY A;  1RPE L;  1ZZ7 A;  4I6T A;  4X4D A;  2BNM A;  2PE5 A;  4X4B A;  2OR1 L;  3TRB A;  1PRV A;  2H8R A;  3CLC A;  1UXD A;  1VPW A;  3F6W A;  2A6C A;  2B5A A;  2CSF A;  2WUS R;  3SCH A;  1RZR D;  3F52 A;  4NDW A;  2MEZ A;  1ZUG A;  2LCV A;  1ZS4 A;  4X4E A;  4X4H A;  4J1W A;  3RZZ A;  2L49 A;  4JCY A;  2KPJ A;  4YAR A;  2IVG A;  1ZPQ A;  3JXB C;  1QQA A;  2AWI A;  1ZZ9 A;  4GQM A;  4FN3 A;  3ZKC A;  1OSL A;  1IC8 A;  1PNR A;  1ZZ6 A;  3H5T A;  1L1M A;  1WH8 A;  2IVB A;  3PXP A;  2PUG A;  2AXZ A;  1PRA A;  1QP0 A;  2R1J L;  2IUO A;  1JWL A;  3ZHM A;  2PPX A;  1ZZC A;  2PUB A;  3G5G A;  2HIN A;  2IU7 A;  3HZI B;  1LLI A;  3VK0 A;  1O4X A;  1NER A;  2PUA A;  3KXA A;  4OB4 A;  4X4F A;  3U3W A;  3OQO A;  2O4A A;  2CRO A;  2PUF A;  1DW9 A;  4Z58 A;  1EFA A;  2BJC A;  2KEJ A;  1JH9 A;  2WIU B;  1QP7 A;  4Y42 A;  4YG7 B;  2AW6 A;  3KJX A;  3UFD A;  1PRU A;  3L1P A;  1BDI A;  4Z5C A;  1CQT A;  2LYP A;  2LYJ A;  4Z5D A;  3D1N I;  3DNV B;  4IWR A;  1POU A;  2EF8 A;  4PU8 A;  2XIU A;  3B7H A;  3R1F A;  3IVP A;  3QQ6 A;  4IA8 A;  1RIO A;  1ZVV A;  1Y7Y A;  2GZU A;  4MCT A;  1RZR A;  2IV1 A;  3GBF A;  2EWT A;  2XI8 A;  3FYA A;  1Y9Q A;  3GN5 B;  4YG1 A;  2O38 A;  4PU7 A;  1SQ8 A;  3BDN A;  1AU7 A;  1CJG A;  4I8T A;  2LYK A;  4X4I A;  3ZHI A;  5K98 B;  2XSD C;  1QP4 A;  4F8D A;  3QF3 A;  3JXC L;  3S8Q A;  3LIS A;  4GHJ A;  1UXC A;  3OMT A;  1ADR A;  2LYS A;  1OCT C;  1ZAY A;  1ZZB A;  1LMB 3;  2O49 A;  2ICP A;  3SCF A;  2LYR A;  3EUS A;  1X2L A;  1S7E A;  3KZ3 A;  2KZ8 A;  2LYL A;  3BS3 A;  2KEI A;  1WH6 A;  4YG4 A; 
#chains in the Genus database with same CATH topology
 1QQB A;  2IVQ A;  4FBI A;  1HF0 A;  1MFQ C;  2PUC A;  4YBA A;  1NEQ A;  4HRA A;  2FFH A;  3LQX A;  3A9X A;  1LCD A;  2JQE A;  2GRM A;  3GN5 A;  1GT0 C;  3QWG A;  3O9X A;  3SCG A;  2HSG A;  4X4G A;  1YSE A;  1PER L;  3JXD L;  4PU3 C;  1R63 A;  1QPZ A;  2J7W A;  2PUE A;  2JCG A;  1ZZ8 A;  2VEO A;  1RPE L;  2EBY A;  4X4B A;  2OR1 L;  5DTM A;  2A6C A;  4NDW A;  4ER6 A;  2LLV A;  1ZS4 A;  4X4H A;  4J1W A;  2PXL A;  2L49 A;  4JCY A;  4YAR A;  2IVG A;  2AWI A;  1ZZ9 A;  3UWP A;  1L1M A;  2PXP A;  2R1J L;  1ZZC A;  2PUB A;  3TEP A;  5GAG i;  1LLI A;  2O4A A;  1NER A;  2YBD A;  3KXA A;  4OB4 A;  4X4F A;  2CRO A;  1DW9 A;  4Z58 A;  1EFA A;  1JH9 A;  2HCS A;  2WIU B;  5GAH i;  1QP7 A;  2HCN A;  1PRU A;  4EQZ A;  1BDI A;  4Z5C A;  3QQ6 A;  2GZU A;  4YG1 A;  2O38 A;  4X4I A;  5DSX A;  3QF3 A;  3S8Q A;  3BS3 A;  1LMB 3;  3SCF A;  3A9Y A;  2XJ3 A;  1LQC A;  1WET A;  2XCJ A;  4Z59 A;  4MCX A;  4ER7 A;  5A7L A;  4Z5H A;  2PUD A;  2PIJ A;  2XXA A;  2JVL A;  1QZX A;  1DUL A;  2OFY A;  1XWR A;  1DWK A;  3FMY A;  3OP9 A;  2R63 A;  3ME5 A;  1LCC A;  3F51 A;  3VWS A;  3QYX A;  4Q2J A;  4PU4 C;  4J1X A;  5DTQ A;  4ER5 A;  3BD1 A;  3CRO L;  3SX0 A;  1JFS A;  2PXE A;  4I6T A;  3OKZ A;  2BNM A;  5DRY A;  2V3C C;  3GZC A;  3F6W A;  3SCH A;  2WUS R;  1RZR D;  2MEZ A;  4OBM A;  3GZD C;  3RZZ A;  5DRT A;  2ODR D;  2KPJ A;  3JXB C;  3MEJ A;  4FN3 A;  3H5T A;  1WH8 A;  3ZHM A;  1U2Z A;  1HQ1 A;  1O4X A;  2PUA A;  4WVL A;  2KEJ A;  3DM5 A;  2AW6 A;  3KJX A;  3UFD A;  3NXH A;  2LYP A;  1POU A;  2EF8 A;  4PU8 A;  2XIU A;  1ZVV A;  4MCT A;  3GBF A;  2EWT A;  3GN5 B;  3QOW A;  1QB2 A;  5K98 B;  2XSD C;  1QP4 A;  3QFI A;  1UXC A;  3OMT A;  2PXQ A;  1ADR A;  2LYL A;  2KEI A;  1WH6 A;  2L1P A;  1UTX A;  1BDH A;  4DE9 A;  2LYQ A;  2BNO A;  1R69 A;  4JCX A;  3G7D A;  1JFT A;  2MXD A;  4I6R A;  2KEK A;  4EK9 A;  4X4C A;  2D5V A;  3MLF A;  2MQK A;  4EKG A;  1E3O C;  2BNN A;  2LLW A;  2XXP A;  2LNM A;  2PXB A;  3OQN A;  1ZZ7 A;  4X4D A;  4DE8 A;  3TRB A;  3CLC A;  1UXD A;  3TFL A;  2CSF A;  3ZPX A;  2LCV A;  4X4E A;  1ZPQ A;  3GUU A;  3ZKC A;  1OSL A;  1IC8 A;  1PNR A;  2PUG A;  2AXZ A;  1QP0 A;  2IUO A;  5JUW A;  3G5G A;  2HIN A;  3HZI B;  3VK0 A;  3U3W A;  3OQO A;  2PXV A;  4Y42 A;  4YG7 B;  3NDB B;  4EKI A;  3L1P A;  2HFZ A;  1CQT A;  4Z5D A;  5DT2 A;  3DNV B;  4IWR A;  3G0T A;  2PXT A;  3A9Z A;  3R1F A;  3IVP A;  1RIO A;  1Y7Y A;  1RZR A;  3FYA A;  1Y9Q A;  3R09 A;  3BDN A;  3PE5 A;  1AU7 A;  1CJG A;  2LYK A;  3ZHI A;  3GZD A;  3JXC L;  1OCT C;  1ZZB A;  2O49 A;  2ICP A;  2M4H A;  1X2L A;  2XXQ A;  2AXU A;  4IVZ A;  3NZL A;  2AUW A;  3FYM A;  2L8N A;  4ER3 A;  4JQD A;  1RZS A;  3LFP A;  2AXV A;  3OQM A;  2PXU A;  1B0N A;  1WIZ A;  2ICT A;  2FJR A;  1X57 A;  3CEC A;  4I6U A;  3SR4 A;  2GRL A;  4EZI A;  4O8B A;  2PE5 A;  1PRV A;  2H8R A;  1VPW A;  1NW3 A;  2B5A A;  3F52 A;  1ZUG A;  3NRO A;  1QQA A;  4GQM A;  2PXD A;  3QOX A;  1ZZ6 A;  2IVB A;  3TEL A;  3PXP A;  1PRA A;  1JWL A;  2PPX A;  2J7U A;  2PXK A;  2IU7 A;  2PUF A;  2BJC A;  5DTR A;  2LYJ A;  3D1N I;  3B7H A;  4IA8 A;  2IV1 A;  3OWQ A;  2PXF A;  2XI8 A;  4PU7 A;  1SQ8 A;  3M9L A;  4I8T A;  3KL4 A;  4F8D A;  3LIS A;  4GHJ A;  2LYS A;  1ZAY A;  2LYR A;  3EUS A;  3KZ3 A;  1S7E A;  2KZ8 A;  4ER0 A;  4YG4 A; 
#chains in the Genus database with same CATH homology
 2XJ3 A;  1QQB A;  1UTX A;  2AXU A;  1LQC A;  2IVQ A;  4FBI A;  1HF0 A;  1BDH A;  2PUC A;  4YBA A;  4IVZ A;  1NEQ A;  2LYQ A;  1WET A;  2BNO A;  2XCJ A;  1R69 A;  2AUW A;  3FYM A;  4JCX A;  3G7D A;  2L8N A;  1JFT A;  1LCD A;  4Z59 A;  4I6R A;  4MCX A;  2KEK A;  4JQD A;  5A7L A;  1RZS A;  4Z5H A;  2PUD A;  2PIJ A;  3LFP A;  4X4C A;  2JVL A;  2GRM A;  2AXV A;  3GN5 A;  2D5V A;  2OFY A;  1GT0 C;  3OQM A;  1XWR A;  1DWK A;  3MLF A;  3QWG A;  3O9X A;  2MQK A;  3FMY A;  3OP9 A;  2R63 A;  3SCG A;  1LCC A;  1E3O C;  3F51 A;  2HSG A;  3QYX A;  2BNN A;  1B0N A;  1WIZ A;  2ICT A;  4X4G A;  2FJR A;  1YSE A;  1X57 A;  4PU4 C;  3CEC A;  4I6U A;  4J1X A;  3JXD L;  1PER L;  2GRL A;  4PU3 C;  1R63 A;  1QPZ A;  2PUE A;  3BD1 A;  3CRO L;  2JCG A;  4O8B A;  1ZZ8 A;  3OQN A;  1JFS A;  2EBY A;  1RPE L;  1ZZ7 A;  4I6T A;  4X4D A;  2BNM A;  2PE5 A;  4X4B A;  2OR1 L;  3TRB A;  1PRV A;  2H8R A;  3CLC A;  1UXD A;  1VPW A;  3F6W A;  2A6C A;  2B5A A;  2CSF A;  2WUS R;  3SCH A;  1RZR D;  3F52 A;  4NDW A;  2MEZ A;  1ZUG A;  2LCV A;  1ZS4 A;  4X4E A;  4X4H A;  4J1W A;  3RZZ A;  2L49 A;  4JCY A;  2KPJ A;  4YAR A;  2IVG A;  1ZPQ A;  3JXB C;  1QQA A;  2AWI A;  1ZZ9 A;  4GQM A;  4FN3 A;  3ZKC A;  1OSL A;  1IC8 A;  1PNR A;  1ZZ6 A;  3H5T A;  1L1M A;  1WH8 A;  2IVB A;  3PXP A;  2PUG A;  2AXZ A;  1PRA A;  1QP0 A;  2R1J L;  2IUO A;  1JWL A;  3ZHM A;  2PPX A;  1ZZC A;  2PUB A;  3G5G A;  2HIN A;  2IU7 A;  3HZI B;  1LLI A;  3VK0 A;  1O4X A;  1NER A;  2PUA A;  3KXA A;  4OB4 A;  4X4F A;  3U3W A;  3OQO A;  2O4A A;  2CRO A;  2PUF A;  1DW9 A;  4Z58 A;  1EFA A;  2BJC A;  2KEJ A;  1JH9 A;  2WIU B;  1QP7 A;  4Y42 A;  4YG7 B;  2AW6 A;  3KJX A;  3UFD A;  1PRU A;  3L1P A;  1BDI A;  4Z5C A;  1CQT A;  2LYP A;  2LYJ A;  4Z5D A;  3D1N I;  3DNV B;  4IWR A;  1POU A;  2EF8 A;  4PU8 A;  2XIU A;  3B7H A;  3R1F A;  3IVP A;  3QQ6 A;  4IA8 A;  1RIO A;  1ZVV A;  1Y7Y A;  2GZU A;  4MCT A;  1RZR A;  2IV1 A;  3GBF A;  2EWT A;  2XI8 A;  3FYA A;  1Y9Q A;  3GN5 B;  4YG1 A;  2O38 A;  4PU7 A;  1SQ8 A;  3BDN A;  1AU7 A;  1CJG A;  4I8T A;  2LYK A;  4X4I A;  3ZHI A;  5K98 B;  2XSD C;  1QP4 A;  4F8D A;  3QF3 A;  3JXC L;  3S8Q A;  3LIS A;  4GHJ A;  1UXC A;  3OMT A;  1ADR A;  2LYS A;  1OCT C;  1ZAY A;  1ZZB A;  1LMB 3;  2O49 A;  2ICP A;  3SCF A;  2LYR A;  3EUS A;  1X2L A;  1S7E A;  3KZ3 A;  2KZ8 A;  2LYL A;  3BS3 A;  2KEI A;  1WH6 A;  4YG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...