2BJCA

Nmr structure of a protein-dna complex of an altered specificity mutant of the lac repressor headpiece that mimics the gal repressor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
62
structure length
62
Chain Sequence
MKPVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAMAELNYIPNRCAQQLAGKQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Altered Specificity in DNA Binding by the Lac Repressor: A Mutant Lac Headpiece that Mimics the Gal Repressor
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords LACTOSE OPERON REPRESSOR
total genus 20
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2bjcA00
1X2LA 1E3OC 1R69A 2AXVA 2GZUA 2LYRA 2AWIA 3QYXA 1JFTA 1UXCA 3OQMA 2KEKA 3SCHA 2EF8A 1QQBA 2AUWA 2ICTA 2PUGA 4IA8A 1WH6A 2L8NA 1WIZA 1X57A 2MQKA 1SQ8A 1Y9QA 2A6CA 3KXAA 2AW6A 4MCXA 4F8DA 3F51A 2LYSA 3BDNA 1LCCA 2XI8A 3JXCL 2XSDC 1ZZ7A 2LCVA 2R1JL 1YSEA 2PUDA 1GT0C 4I6UA 3QF3A 3DNVB 2PUCA 1CQTA 2IV1A 3B7HA 1PRUA 4Y42A 2CSFA 2OFYA 1ZS4A 2XJ3A 1AU7A 4I8TA 4PU4C 4X4GA 1ZZ6A 2PUFA 1RIOA 4Z59A 2KEJA 2L49A 3KZ3A 2OR1L 4X4DA 4YG4A 1UXDA 2LYLA 1NEQA 3OP9A 3SCGA 1O4XA 4YBAA 1BDIA 3FYAA 2XIUA 1R63A 3GN5A 2PUAA 2GRLA 3KJXA 1ZPQA 3F6WA 2H8RA 2WUSR 3FMYA 4PU3C 3OQOA 1ZVVA 4FBIA 1RZRD 4JCXA 1S7EA 1WETA 4Z58A 1PRAA 1UTXA 3UFDA 2PUBA 3CROL 1ADRA 1JWLA 2HINA 2XCJA 1NERA 3O9XA 3U3WA 1VPWA 3RZZA 3S8QA 4JQDA 3EUSA 3VK0A 4X4IA 3CLCA 2BJCA 2JVLA 1RZSA 3QWGA 2MEZA 4J1WA 1ZZBA 4PU7A 2AXZA 1ZZ8A 2O38A 4IVZA 3G5GA 1QP0A 3H5TA 3D1NI 3L1PA 1JFSA 2EBYA 2EWTA 2KEIA 1XWRA 2CROA 2LYPA 1QPZA 1Y7YA 4Z5DA 4IWRA 1LQCA 5K98B 1BDHA 2IUOA 3LFPA 2B5AA 1PERL 1ZAYA 1LMB3 4X4HA 1L1MA 1RZRA 4Z5HA 3ZHIA 3GBFA 4I6TA 1ZZ9A 2ICPA 3R1FA 3JXBC 4X4FA 3MLFA 3TRBA 1ZUGA 2PPXA 5A7LA 2IVQA 1JH9A 4GQMA 4X4EA 2PUEA 2LYKA 3QQ6A 4YG1A 1B0NA 2AXUA 3OQNA 3ZHMA 1PRVA 2BNNA 2O4AA 2LYJA 1CJGA 2JCGA 3BD1A 1OSLA 2HSGA 3PXPA 1OCTC 2KPJA 1HF0A 3G7DA 4NDWA 3ZKCA 4I6RA 1DWKA 3LISA 2WIUB 4GHJA 1RPEL 4FN3A 2R63A 1QQAA 3OMTA 2O49A 2PE5A 3F52A 1PNRA 1WH8A 2BNMA 4MCTA 2KZ8A 1LLIA 1QP7A 1IC8A 3HZIB 2D5VA 4X4CA 1ZZCA 2IVGA 4OB4A 4YARA 4O8BA 4PU8A 3BS3A 2GRMA 4JCYA 4Z5CA 3GN5B 3JXDL 2BNOA 4YG7B 2LYQA 3FYMA 1QP4A 3CECA 3SCFA 3IVPA 1POUA 2IVBA 4X4BA 4J1XA 2PIJA 1EFAA 1LCDA 2IU7A 2FJRA 1DW9A
chains in the Genus database with same CATH superfamily
3SCHA 1QQBA 2ICTA 4IA8A 1WIZA 1X57A 4MCXA 3KXAA 3F51A 2LYSA 2XSDC 2R1JL 3TFLA 4I6UA 3QF3A 1CQTA 2VEOA 4Y42A 2OFYA 2J7WA 4X4GA 1ZZ6A 4ER7A 2PUFA 4X4DA 1NEQA 3OP9A 1O4XA 1BDIA 2LLVA 3FMYA 4JCXA 1S7EA 1WETA 3QOXA 3U3WA 3GZCA 4ER5A 4JQDA 4X4IA 3CLCA 2BJCA 2JVLA 1RZSA 2AXZA 3H5TA 3D1NI 1JFSA 2EWTA 3G0TA 1Y7YA 4IWRA 3LFPA 3NZLA 3GZDA 4Z5HA 3ZHIA 4I6TA 1ZZ9A 2ICPA 2HFZA 1JH9A 2IVQA 3DM5A 4X4EA 3QQ6A 2AXUA 3OQNA 2YBDA 4NDWA 3ZKCA 4ER0A 4ER3A 1PNRA 1QP7A 1U2ZA 4O8BA 3BS3A 4JCYA 4Z5CA 3JXDL 4YG7B 2MXDA 3SCFA 3IVPA 2IVBA 1EFAA 3B7HA 3ZPXA 3QOWA 2AXVA 2GZUA 4Q2JA 3QYXA 1JFTA 2KEKA 2PXEA 2PUGA 1WH6A 1SQ8A 1Y9QA 2A6CA 2AW6A 3SX0A 2HCSA 1LCCA 3JXCL 3TELA 1ZZ7A 4EK9A 2PUDA 3DNVB 2PUCA 4I8TA 1ZS4A 2LLWA 4EKIA 2OR1L 5DRYA 2PXPA 1QB2A 3FYAA 2XIUA 2GRLA 3KJXA 2WUSR 3OQOA 1RZRD 4Z58A 1PRAA 2PUBA 1NERA 3O9XA 1DULA 3VK0A 4EZIA 4J1WA 2M4HA 1QP0A 3L1PA 2XXQA 1XWRA 2CROA 2LYPA 3KL4A 4ER6A 2XXAA 1RZRA 3R1FA 3MLFA 1ZUGA 2LYKA 1B0NA 3ZHMA 1PRVA 2LYJA 1OSLA 2HSGA 3PXPA 1HF0A 3LISA 4GHJA 2BNMA 1IC8A 3HZIB 2D5VA 1MFQC 2BNOA 2LYQA 3CECA 1POUA 2PIJA 3UWPA 1LCDA 4HRAA 2GRMA 1E3OC 1R69A 2PXVA 3LQXA 4EQZA 5DRTA 3OQMA 5DTRA 2HCNA 1HQ1A 2JQEA 2XI8A 2PXLA 1YSEA 3A9YA 1GT0C 4DE8A 2XXPA 1QZXA 4OBMA 1RIOA 4Z59A 2KEJA 2L49A 4YG4A 2LYLA 2V3CC 3OKZA 3QFIA 1R63A 3GN5A 3PE5A 2H8RA 4EKGA 2PUAA 3ME5A 2PXQA 4FBIA 3UFDA 2XCJA 3A9XA 1VPWA 2PXUA 3EUSA 5DTQA 2MEZA 4PU7A 3G5GA 2PXFA 2L1PA 1LQCA 2B5AA 1LMB3 2PXBA 3JXBC 4X4FA 2PUEA 3SR4A 4YG1A 2BNNA 2O4AA 5GAHi 3MEJA 3BD1A 2KPJA 1DWKA 2R63A 1QQAA 3GZDC 2O49A 2PE5A 3F52A 3R09A 4MCTA 3NROA 1ZZCA 4DE9A 3FYMA 1QP4A 3GUUA 2IU7A 2FJRA 1QPZA 3NDBB 4WVLA 1X2LA 2LYRA 2AWIA 2LNMA 1UXCA 2EF8A 2AUWA 2L8NA 4F8DA 2MQKA 5JUWA 3BDNA 2PXTA 2LCVA 2IV1A 1PRUA 3VWSA 2CSFA 1AU7A 2XJ3A 4PU4C 3KZ3A 5DTMA 1UXDA 3A9ZA 3SCGA 4YBAA 1ZPQA 2J7UA 4PU3C 1ZVVA 1UTXA 3CROL 1ADRA 1JWLA 2HINA 2FFHA 3OWQA 3RZZA 3S8QA 3QWGA 1NW3A 1ZZBA 3NXHA 1ZZ8A 2O38A 4IVZA 3TEPA 2PXDA 2EBYA 2KEIA 4Z5DA 5K98B 2IUOA 1PERL 1ZAYA 4X4HA 1L1MA 3GBFA 5DSXA 3TRBA 2PPXA 2PXKA 5A7LA 2ODRD 4GQMA 1CJGA 2JCGA 1OCTC 3G7DA 4I6RA 2WIUB 1RPEL 4FN3A 3OMTA 1WH8A 1DW9A 2KZ8A 1LLIA 4X4CA 2IVGA 3M9LA 4OB4A 4PU8A 4YARA 3GN5B 5DT2A 4X4BA 4J1XA 5GAGi 1BDHA 3F6WA
chains in the Genus database with same CATH topology
1X2LA 1E3OC 1R69A 2AXVA 2GZUA 2LYRA 2AWIA 3QYXA 1JFTA 1UXCA 3OQMA 2KEKA 3SCHA 2EF8A 1QQBA 2AUWA 2ICTA 2PUGA 4IA8A 1WH6A 2L8NA 1WIZA 1X57A 2MQKA 1SQ8A 1Y9QA 2A6CA 3KXAA 2AW6A 4MCXA 4F8DA 3F51A 2LYSA 3BDNA 1LCCA 2XI8A 3JXCL 2XSDC 1ZZ7A 2LCVA 2R1JL 1YSEA 2PUDA 1GT0C 4I6UA 3QF3A 3DNVB 2PUCA 1CQTA 2IV1A 3B7HA 1PRUA 4Y42A 2CSFA 2OFYA 1ZS4A 2XJ3A 1AU7A 4I8TA 4PU4C 4X4GA 1ZZ6A 2PUFA 1RIOA 4Z59A 2KEJA 2L49A 3KZ3A 2OR1L 4X4DA 4YG4A 1UXDA 2LYLA 1NEQA 3OP9A 3SCGA 1O4XA 4YBAA 1BDIA 3FYAA 2XIUA 1R63A 3GN5A 2PUAA 2GRLA 3KJXA 1ZPQA 3F6WA 2H8RA 2WUSR 3FMYA 4PU3C 3OQOA 1ZVVA 4FBIA 1RZRD 4JCXA 1S7EA 1WETA 4Z58A 1PRAA 1UTXA 3UFDA 2PUBA 3CROL 1ADRA 1JWLA 2HINA 2XCJA 1NERA 3O9XA 3U3WA 1VPWA 3RZZA 3S8QA 4JQDA 3EUSA 3VK0A 4X4IA 3CLCA 2BJCA 2JVLA 1RZSA 3QWGA 2MEZA 4J1WA 1ZZBA 4PU7A 2AXZA 1ZZ8A 2O38A 4IVZA 3G5GA 1QP0A 3H5TA 3D1NI 3L1PA 1JFSA 2EBYA 2EWTA 2KEIA 1XWRA 2CROA 2LYPA 1QPZA 1Y7YA 4Z5DA 4IWRA 1LQCA 5K98B 1BDHA 2IUOA 3LFPA 2B5AA 1PERL 1ZAYA 1LMB3 4X4HA 1L1MA 1RZRA 4Z5HA 3ZHIA 3GBFA 4I6TA 1ZZ9A 2ICPA 3R1FA 3JXBC 4X4FA 3MLFA 3TRBA 1ZUGA 2PPXA 5A7LA 2IVQA 1JH9A 4GQMA 4X4EA 2PUEA 2LYKA 3QQ6A 4YG1A 1B0NA 2AXUA 3OQNA 3ZHMA 1PRVA 2BNNA 2O4AA 2LYJA 1CJGA 2JCGA 3BD1A 1OSLA 2HSGA 3PXPA 1OCTC 2KPJA 1HF0A 3G7DA 4NDWA 3ZKCA 4I6RA 1DWKA 3LISA 2WIUB 4GHJA 1RPEL 4FN3A 2R63A 1QQAA 3OMTA 2O49A 2PE5A 3F52A 1PNRA 1WH8A 2BNMA 4MCTA 2KZ8A 1LLIA 1QP7A 1IC8A 3HZIB 2D5VA 4X4CA 1ZZCA 2IVGA 4OB4A 4YARA 4O8BA 4PU8A 3BS3A 2GRMA 4JCYA 4Z5CA 3GN5B 3JXDL 2BNOA 4YG7B 2LYQA 3FYMA 1QP4A 3CECA 3SCFA 3IVPA 1POUA 2IVBA 4X4BA 4J1XA 2PIJA 1EFAA 1LCDA 2IU7A 2FJRA 1DW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2L A;  1E3O C;  1R69 A;  2AXV A;  2GZU A;  2LYR A;  2AWI A;  3QYX A;  1JFT A;  1UXC A;  3OQM A;  2KEK A;  3SCH A;  2EF8 A;  1QQB A;  2AUW A;  2ICT A;  2PUG A;  4IA8 A;  1WH6 A;  2L8N A;  1WIZ A;  1X57 A;  2MQK A;  1SQ8 A;  1Y9Q A;  2A6C A;  3KXA A;  2AW6 A;  4MCX A;  4F8D A;  3F51 A;  2LYS A;  3BDN A;  1LCC A;  2XI8 A;  3JXC L;  2XSD C;  1ZZ7 A;  2LCV A;  2R1J L;  1YSE A;  2PUD A;  1GT0 C;  4I6U A;  3QF3 A;  3DNV B;  2PUC A;  1CQT A;  2IV1 A;  3B7H A;  1PRU A;  4Y42 A;  2CSF A;  2OFY A;  1ZS4 A;  2XJ3 A;  1AU7 A;  4I8T A;  4PU4 C;  4X4G A;  1ZZ6 A;  2PUF A;  1RIO A;  4Z59 A;  2KEJ A;  2L49 A;  3KZ3 A;  2OR1 L;  4X4D A;  4YG4 A;  1UXD A;  2LYL A;  1NEQ A;  3OP9 A;  3SCG A;  1O4X A;  4YBA A;  1BDI A;  3FYA A;  2XIU A;  1R63 A;  3GN5 A;  2PUA A;  2GRL A;  3KJX A;  1ZPQ A;  3F6W A;  2H8R A;  2WUS R;  3FMY A;  4PU3 C;  3OQO A;  1ZVV A;  4FBI A;  1RZR D;  4JCX A;  1S7E A;  1WET A;  4Z58 A;  1PRA A;  1UTX A;  3UFD A;  2PUB A;  3CRO L;  1ADR A;  1JWL A;  2HIN A;  2XCJ A;  1NER A;  3O9X A;  3U3W A;  1VPW A;  3RZZ A;  3S8Q A;  4JQD A;  3EUS A;  3VK0 A;  4X4I A;  3CLC A;  2BJC A;  2JVL A;  1RZS A;  3QWG A;  2MEZ A;  4J1W A;  1ZZB A;  4PU7 A;  2AXZ A;  1ZZ8 A;  2O38 A;  4IVZ A;  3G5G A;  1QP0 A;  3H5T A;  3D1N I;  3L1P A;  1JFS A;  2EBY A;  2EWT A;  2KEI A;  1XWR A;  2CRO A;  2LYP A;  1QPZ A;  1Y7Y A;  4Z5D A;  4IWR A;  1LQC A;  5K98 B;  1BDH A;  2IUO A;  3LFP A;  2B5A A;  1PER L;  1ZAY A;  1LMB 3;  4X4H A;  1L1M A;  1RZR A;  4Z5H A;  3ZHI A;  3GBF A;  4I6T A;  1ZZ9 A;  2ICP A;  3R1F A;  3JXB C;  4X4F A;  3MLF A;  3TRB A;  1ZUG A;  2PPX A;  5A7L A;  2IVQ A;  1JH9 A;  4GQM A;  4X4E A;  2PUE A;  2LYK A;  3QQ6 A;  4YG1 A;  1B0N A;  2AXU A;  3OQN A;  3ZHM A;  1PRV A;  2BNN A;  2O4A A;  2LYJ A;  1CJG A;  2JCG A;  3BD1 A;  1OSL A;  2HSG A;  3PXP A;  1OCT C;  2KPJ A;  1HF0 A;  3G7D A;  4NDW A;  3ZKC A;  4I6R A;  1DWK A;  3LIS A;  2WIU B;  4GHJ A;  1RPE L;  4FN3 A;  2R63 A;  1QQA A;  3OMT A;  2O49 A;  2PE5 A;  3F52 A;  1PNR A;  1WH8 A;  2BNM A;  4MCT A;  2KZ8 A;  1LLI A;  1QP7 A;  1IC8 A;  3HZI B;  2D5V A;  4X4C A;  1ZZC A;  2IVG A;  4OB4 A;  4YAR A;  4O8B A;  4PU8 A;  3BS3 A;  2GRM A;  4JCY A;  4Z5C A;  3GN5 B;  3JXD L;  2BNO A;  4YG7 B;  2LYQ A;  3FYM A;  1QP4 A;  3CEC A;  3SCF A;  3IVP A;  1POU A;  2IVB A;  4X4B A;  4J1X A;  2PIJ A;  1EFA A;  1LCD A;  2IU7 A;  2FJR A;  1DW9 A; 
#chains in the Genus database with same CATH topology
 3SCH A;  1QQB A;  2ICT A;  4IA8 A;  1WIZ A;  1X57 A;  4MCX A;  3KXA A;  3F51 A;  2LYS A;  2XSD C;  2R1J L;  3TFL A;  4I6U A;  3QF3 A;  1CQT A;  2VEO A;  4Y42 A;  2OFY A;  2J7W A;  4X4G A;  1ZZ6 A;  4ER7 A;  2PUF A;  4X4D A;  1NEQ A;  3OP9 A;  1O4X A;  1BDI A;  2LLV A;  3FMY A;  4JCX A;  1S7E A;  1WET A;  3QOX A;  3U3W A;  3GZC A;  4ER5 A;  4JQD A;  4X4I A;  3CLC A;  2BJC A;  2JVL A;  1RZS A;  2AXZ A;  3H5T A;  3D1N I;  1JFS A;  2EWT A;  3G0T A;  1Y7Y A;  4IWR A;  3LFP A;  3NZL A;  3GZD A;  4Z5H A;  3ZHI A;  4I6T A;  1ZZ9 A;  2ICP A;  2HFZ A;  1JH9 A;  2IVQ A;  3DM5 A;  4X4E A;  3QQ6 A;  2AXU A;  3OQN A;  2YBD A;  4NDW A;  3ZKC A;  4ER0 A;  4ER3 A;  1PNR A;  1QP7 A;  1U2Z A;  4O8B A;  3BS3 A;  4JCY A;  4Z5C A;  3JXD L;  4YG7 B;  2MXD A;  3SCF A;  3IVP A;  2IVB A;  1EFA A;  3B7H A;  3ZPX A;  3QOW A;  2AXV A;  2GZU A;  4Q2J A;  3QYX A;  1JFT A;  2KEK A;  2PXE A;  2PUG A;  1WH6 A;  1SQ8 A;  1Y9Q A;  2A6C A;  2AW6 A;  3SX0 A;  2HCS A;  1LCC A;  3JXC L;  3TEL A;  1ZZ7 A;  4EK9 A;  2PUD A;  3DNV B;  2PUC A;  4I8T A;  1ZS4 A;  2LLW A;  4EKI A;  2OR1 L;  5DRY A;  2PXP A;  1QB2 A;  3FYA A;  2XIU A;  2GRL A;  3KJX A;  2WUS R;  3OQO A;  1RZR D;  4Z58 A;  1PRA A;  2PUB A;  1NER A;  3O9X A;  1DUL A;  3VK0 A;  4EZI A;  4J1W A;  2M4H A;  1QP0 A;  3L1P A;  2XXQ A;  1XWR A;  2CRO A;  2LYP A;  3KL4 A;  4ER6 A;  2XXA A;  1RZR A;  3R1F A;  3MLF A;  1ZUG A;  2LYK A;  1B0N A;  3ZHM A;  1PRV A;  2LYJ A;  1OSL A;  2HSG A;  3PXP A;  1HF0 A;  3LIS A;  4GHJ A;  2BNM A;  1IC8 A;  3HZI B;  2D5V A;  1MFQ C;  2BNO A;  2LYQ A;  3CEC A;  1POU A;  2PIJ A;  3UWP A;  1LCD A;  4HRA A;  2GRM A;  1E3O C;  1R69 A;  2PXV A;  3LQX A;  4EQZ A;  5DRT A;  3OQM A;  5DTR A;  2HCN A;  1HQ1 A;  2JQE A;  2XI8 A;  2PXL A;  1YSE A;  3A9Y A;  1GT0 C;  4DE8 A;  2XXP A;  1QZX A;  4OBM A;  1RIO A;  4Z59 A;  2KEJ A;  2L49 A;  4YG4 A;  2LYL A;  2V3C C;  3OKZ A;  3QFI A;  1R63 A;  3GN5 A;  3PE5 A;  2H8R A;  4EKG A;  2PUA A;  3ME5 A;  2PXQ A;  4FBI A;  3UFD A;  2XCJ A;  3A9X A;  1VPW A;  2PXU A;  3EUS A;  5DTQ A;  2MEZ A;  4PU7 A;  3G5G A;  2PXF A;  2L1P A;  1LQC A;  2B5A A;  1LMB 3;  2PXB A;  3JXB C;  4X4F A;  2PUE A;  3SR4 A;  4YG1 A;  2BNN A;  2O4A A;  5GAH i;  3MEJ A;  3BD1 A;  2KPJ A;  1DWK A;  2R63 A;  1QQA A;  3GZD C;  2O49 A;  2PE5 A;  3F52 A;  3R09 A;  4MCT A;  3NRO A;  1ZZC A;  4DE9 A;  3FYM A;  1QP4 A;  3GUU A;  2IU7 A;  2FJR A;  1QPZ A;  3NDB B;  4WVL A;  1X2L A;  2LYR A;  2AWI A;  2LNM A;  1UXC A;  2EF8 A;  2AUW A;  2L8N A;  4F8D A;  2MQK A;  5JUW A;  3BDN A;  2PXT A;  2LCV A;  2IV1 A;  1PRU A;  3VWS A;  2CSF A;  1AU7 A;  2XJ3 A;  4PU4 C;  3KZ3 A;  5DTM A;  1UXD A;  3A9Z A;  3SCG A;  4YBA A;  1ZPQ A;  2J7U A;  4PU3 C;  1ZVV A;  1UTX A;  3CRO L;  1ADR A;  1JWL A;  2HIN A;  2FFH A;  3OWQ A;  3RZZ A;  3S8Q A;  3QWG A;  1NW3 A;  1ZZB A;  3NXH A;  1ZZ8 A;  2O38 A;  4IVZ A;  3TEP A;  2PXD A;  2EBY A;  2KEI A;  4Z5D A;  5K98 B;  2IUO A;  1PER L;  1ZAY A;  4X4H A;  1L1M A;  3GBF A;  5DSX A;  3TRB A;  2PPX A;  2PXK A;  5A7L A;  2ODR D;  4GQM A;  1CJG A;  2JCG A;  1OCT C;  3G7D A;  4I6R A;  2WIU B;  1RPE L;  4FN3 A;  3OMT A;  1WH8 A;  1DW9 A;  2KZ8 A;  1LLI A;  4X4C A;  2IVG A;  3M9L A;  4OB4 A;  4PU8 A;  4YAR A;  3GN5 B;  5DT2 A;  4X4B A;  4J1X A;  5GAG i;  1BDH A;  3F6W A; 
#chains in the Genus database with same CATH homology
 1X2L A;  1E3O C;  1R69 A;  2AXV A;  2GZU A;  2LYR A;  2AWI A;  3QYX A;  1JFT A;  1UXC A;  3OQM A;  2KEK A;  3SCH A;  2EF8 A;  1QQB A;  2AUW A;  2ICT A;  2PUG A;  4IA8 A;  1WH6 A;  2L8N A;  1WIZ A;  1X57 A;  2MQK A;  1SQ8 A;  1Y9Q A;  2A6C A;  3KXA A;  2AW6 A;  4MCX A;  4F8D A;  3F51 A;  2LYS A;  3BDN A;  1LCC A;  2XI8 A;  3JXC L;  2XSD C;  1ZZ7 A;  2LCV A;  2R1J L;  1YSE A;  2PUD A;  1GT0 C;  4I6U A;  3QF3 A;  3DNV B;  2PUC A;  1CQT A;  2IV1 A;  3B7H A;  1PRU A;  4Y42 A;  2CSF A;  2OFY A;  1ZS4 A;  2XJ3 A;  1AU7 A;  4I8T A;  4PU4 C;  4X4G A;  1ZZ6 A;  2PUF A;  1RIO A;  4Z59 A;  2KEJ A;  2L49 A;  3KZ3 A;  2OR1 L;  4X4D A;  4YG4 A;  1UXD A;  2LYL A;  1NEQ A;  3OP9 A;  3SCG A;  1O4X A;  4YBA A;  1BDI A;  3FYA A;  2XIU A;  1R63 A;  3GN5 A;  2PUA A;  2GRL A;  3KJX A;  1ZPQ A;  3F6W A;  2H8R A;  2WUS R;  3FMY A;  4PU3 C;  3OQO A;  1ZVV A;  4FBI A;  1RZR D;  4JCX A;  1S7E A;  1WET A;  4Z58 A;  1PRA A;  1UTX A;  3UFD A;  2PUB A;  3CRO L;  1ADR A;  1JWL A;  2HIN A;  2XCJ A;  1NER A;  3O9X A;  3U3W A;  1VPW A;  3RZZ A;  3S8Q A;  4JQD A;  3EUS A;  3VK0 A;  4X4I A;  3CLC A;  2BJC A;  2JVL A;  1RZS A;  3QWG A;  2MEZ A;  4J1W A;  1ZZB A;  4PU7 A;  2AXZ A;  1ZZ8 A;  2O38 A;  4IVZ A;  3G5G A;  1QP0 A;  3H5T A;  3D1N I;  3L1P A;  1JFS A;  2EBY A;  2EWT A;  2KEI A;  1XWR A;  2CRO A;  2LYP A;  1QPZ A;  1Y7Y A;  4Z5D A;  4IWR A;  1LQC A;  5K98 B;  1BDH A;  2IUO A;  3LFP A;  2B5A A;  1PER L;  1ZAY A;  1LMB 3;  4X4H A;  1L1M A;  1RZR A;  4Z5H A;  3ZHI A;  3GBF A;  4I6T A;  1ZZ9 A;  2ICP A;  3R1F A;  3JXB C;  4X4F A;  3MLF A;  3TRB A;  1ZUG A;  2PPX A;  5A7L A;  2IVQ A;  1JH9 A;  4GQM A;  4X4E A;  2PUE A;  2LYK A;  3QQ6 A;  4YG1 A;  1B0N A;  2AXU A;  3OQN A;  3ZHM A;  1PRV A;  2BNN A;  2O4A A;  2LYJ A;  1CJG A;  2JCG A;  3BD1 A;  1OSL A;  2HSG A;  3PXP A;  1OCT C;  2KPJ A;  1HF0 A;  3G7D A;  4NDW A;  3ZKC A;  4I6R A;  1DWK A;  3LIS A;  2WIU B;  4GHJ A;  1RPE L;  4FN3 A;  2R63 A;  1QQA A;  3OMT A;  2O49 A;  2PE5 A;  3F52 A;  1PNR A;  1WH8 A;  2BNM A;  4MCT A;  2KZ8 A;  1LLI A;  1QP7 A;  1IC8 A;  3HZI B;  2D5V A;  4X4C A;  1ZZC A;  2IVG A;  4OB4 A;  4YAR A;  4O8B A;  4PU8 A;  3BS3 A;  2GRM A;  4JCY A;  4Z5C A;  3GN5 B;  3JXD L;  2BNO A;  4YG7 B;  2LYQ A;  3FYM A;  1QP4 A;  3CEC A;  3SCF A;  3IVP A;  1POU A;  2IVB A;  4X4B A;  4J1X A;  2PIJ A;  1EFA A;  1LCD A;  2IU7 A;  2FJR A;  1DW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...